3P19A

Improved nadph-dependent blue fluorescent protein
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
239
structure length
239
Chain Sequence
MKKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFDTAITRAEKIYGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVMTIAPSAVKTELLSHTTSQQIKDGYDAWRVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative blue fluorescent protein
publication title Structure of a NADPH-dependent blue fluorescent protein revealed the unique role of Gly176 on the fluorescence enhancement.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Oxidoreductase
total genus 91
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3p19A00
2DQ4A 1I2CA 2PD6A 4RF3A 3ABIA 2RBEA 1BHSA 2J3HA 4AJ1A 1FXSA 4YEDA 3E03A 4BO4A 1DEHA 4ZQEA 3R0IA 3ROMA 1YXMA 1BW9A 1CF2O 1J5PA 4UVEA 2EW8A 3MJSA 5JFOA 3PXXA 5CP8A 3EK2A 5U9CA 3JSAA 4TQGA 3WDSA 4D3DA 4XDZA 4E31A 2W98A 3VOSA 4GMFA 1ZUD1 3O26A 2Y1FA 4YRAA 5G2OA 2EGHA 4TKLA 4XR9A 4YT5A 2EP7A 5BSEA 5HM8A 3ZWMA 2VHWA 3IDSA 4IGEA 3GAZA 1HSZA 1FDWA 4ALIA 1I3NA 4Z0TA 4MVJD 2PR2A 3WSVA 3ZH2A 3BXXA 3DMTA 3L4BA 3NYWA 3IS3A 1IYZA 2H5LA 4OAQA 3PWZA 4WEOA 3EZLA 5DULA 1PGNA 1EK5A 5T8KA 4ZD6A 2EXXA 1SZJG 3VVBA 1X1EA 4DLAA 3I9OA 4PVDA 3RASA 3BMOA 1E3SA 2GZ1A 3NGLA 3M2TA 4PCVA 4UUMA 2NQ8A 3RKUA 2F00A 1GUYA 3D4NA 2IZ1A 4IMRA 4S1VA 4C7KA 3UF0A 4EZBA 4W82A 1OBFO 1P44A 3KYDA 3WMWA 1EVZA 1EQ2A 2Y1DA 5C37A 2NU7A 4RPHA 2G1UA 4OYRA 4IXWA 1E7RA 2A4KA 4YYZA 1JVSA 1DLJA 1P1HA 4YACA 2X22A 3WS7A 5C5IA 2ZK7A 2I99A 2G76A 2FOIA 4E30A 1CERA 2RH8A 3F9IA 4BKRA 2PKQP 1HSOA 5KJCA 1GAEO 1HDGO 1GEGA 3H4VA 1ZH8A 4L4RA 3F4LA 4RV9A 1NQAO 1R0KA 3PTZA 4CMGA 1ZJYA 5TS3A 1HF3A 3K9QO 1LLQA 2YFQA 4QSMA 5AYVA 3M6IA 1BSVA 2OUIA 2CVZA 4KDFA 1Q0HA 4LCJA 3G3EA 5JAQA 2EV9A 3LT1A 1M6HA 3PHLA 1IULA 4N7RA 1A71A 5I8ZA 5I7EA 3ICCA 3BMCA 3NDRA 1DOHA 1KYQA 2FMUA 1U2GA 3RC9A 3HN7A 1YL6A 1ZK3A 2NTVA 3C7CB 3LC7O 1R16A 2OP1A 3DC2A 4Q39A 1RM3A 3QRWA 3IMFA 1GPDG 3RUHA 4DVJA 1Y81A 1GADO 2CF6A 4LK3A 4OJNA 1JAXA 1ID1A 4HP8A 3AM4A 5JAIA 3RFXA 4B4UA 4DIOA 1N5DA 1WVGA 1SOVA 4AJ2A 3U5TA 3JYOA 5G0UA 1SO8A 5GY7A 4WK6A 1FDTA 3QVXA 2JD2A 2NU8A 5KKAA 4ALJA 4NMHA 4YA6A 5COAA 1PZGA 3H9GA 5MGBA 1EUCA 1OOEA 4JBGA 4CMKA 3ZDFA 1U1IA 5K6AC 2VRCA 3GVXA 2UYYA 5BNTA 4BGIA 1AXGA 3AU9A 1H6AA 3QVSA 3H5RA 4D7AA 1NVMB 2GGSA 4FD3A 4PLVA 4MIEA 2V6GA 1PR3A 4S3MA 1S7CA 2HMVA 3EZYA 3GHHA 4BV8A 5G0SA 1ZIDA 2X7HA 2Y1OA 5CG1A 5AOVA 5DBIA 4GWGA 4TVBA 3TF5A 4XYBA 1WWKA 1EDZA 3WNQA 3ZW9A 4MVJG 3DBVO 5F21A 3GUCA 1PZEA 2Q2VA 3WYEA 1FDVA 1XEAA 4CR6A 1BTOA 1H9BA 1DLIA 4E0BA 3I9LA 4HFJA 4UEJA 1ZEMA 4XGNA 2BI8A 1K6JA 2XXJA 4ALNA 4WECA 3AUAA 1NASA 1T2CA 1B14A 1WMBA 2LDBA 2PZKA 4PZDA 1EUZA 1QYCA 5DOVA 1WW8A 3W4IA 2C5EA 3DZKA 1HTBA 3CUKA 3KEQA 1DFIA 2PZLA 3GRPA 3H5NA 3MOIA 3TL3A 1IHYA 4FB5A 3ZU5A 5JC8A 1Y7TA 5KVVA 2Q99A 4XQGA 4OM8A 1I2BA 2Q49A 1ZKMA 2J5RA 1LLDA 2DTDA 3EW7A 2EIHA 3DDNA 3JQAA 4CJXA 3OM9A 5KWEA 2Q4EA 2QRLA 4FR5A 3VPGA 5AXBA 2CMDA 4WEQA 3WYBA 1O5IA 1I2ZA 3KZVA 4MIYA 4AFNA 3UCFA 4Y6PA 1SEVA 1FF9A 1O8CA 4PFJA 3MTGA 2UDPA 2VNAA 2C2XA 1ZXLA 4EITA 3AI3A 1C3VA 1E5LA 1Z74A 3PP8A 4NI5A 5KTKA 1JTVA 3OEYA 5CAEA 5BQFA 1RWBA 2PD3A 4J1NA 4CV1A 1DB3A 2DTEA 3IQDB 5EIOA 1F8GA 1HDXA 2Z1NA 2D2IA 2VYVD 4WLVA 3D64A 2EKPA 4E6PA 3IKTA 5IXSA 2AEFA 1VKOA 1ISHA 1VI2A 3KYCA 1BWSA 2C2YA 4U0JA 2FSSA 2PKQO 1NR7A 3AUUA 4Q3EA 2PWZA 4PLPA 1QMGA 3MWDB 4FDAA 3F4BA 2WJPA 4XA8A 1F8FA 3H2SA 4TRJA 3HN2A 3W1VA 4IJVA 4EJ0A 4BUCA 1BVRA 1YBVA 4GKBA 1UZMA 4PIVA 5JCJA 4AG3A 4IXTA 2CZCA 4XKJA 4YPOA 4K6FA 2OBNA 2PKRA 5B12A 4OIMA 2PY6A 3AY7A 5A4DA 3JQ7B 1EVIA 4RORA 1KEVA 3O38A 4LMRA 4KP7A 3R3JA 2I3GA 5COBA 4MPDA 3JQBA 2DUWA 4M54A 4BO9A 2JL1A 5EPOA 3PGXA 4J0FA 3TZCA 3INGA 3BZUA 5JBIA 3GZNA 4MIOA 1G6KA 3PJDA 4R41A 2PH3A 2E49A 1WZIA 5I8WA 3IKVA 1D3AA 5ER9A 1NQ5A 2BHLA 3A9WA 4J90A 1YE3A 4ALLA 2HK8A 1YL5A 3AUSA 3ZHXA 1X13A 5DDIP 4X54A 1ZO8A 4DIBA 3PDJA 4FFRA 1LQUA 3RC7A 3G1TA 2W2LA 3BHIA 4P38A 5DBGA 3QVTA 2HK9A 3KEOA 4D41A 4HV4A 3CTMA 3WR5A 2FHSA 2UUPA 4E5YA 1I01A 3GNSA 4M86A 4BB5A 2VUTA 1UXKA 4BKPA 4OSPA 1J0XO 3U4DA 4XYLA 3B70A 1PZFA 7ADHA 1X7GA 3AOEA 5JYDA 3JD2A 4XQ9A 4BGVA 2AXQA 1MA0A 2CD9A 5IG2A 2I5PO 1IPFA 2AE1A 2D1YA 1DFGA 2X5KO 3U62A 5FFFA 4UUPA 1NWHA 3MJTA 4LGVA 1R0SA 1B2LA 1LA2A 3JQ8B 4HNGA 1YQXA 4N18A 3DAPA 1D1TA 1E77A 1LSOA 2Y66A 4HKTA 4CUZA 1MG0A 2DKNA 2YQ5A 3CZRA 5KNLA 4J9VA 1P1KA 4GWKA 4NBWA 1LRLA 2GDZA 4B8WA 5U1PA 2WD7B 1UP4A 3I9MA 3LQFA 1GQQA 1GR0A 4FJ0A 2OORA 3P2YA 3CPSA 4W9NC 1UXIA 4OXNA 4E2WA 5DCWA 1OC2A 5JE8A 2HMUA 1N1GA 3IUPA 4QO7A 1QYXA 4EBFA 3GEDA 4DLLA 2E6UX 3HDQA 3U4HA 4GH5A 3ZHBA 1Y8QB 5JXWA 3W4KA 1KEPA 1T1RA 4R1NA 4R3NA 5FI5A 3GQVA 1D1SA 4JP2A 1VJ1A 1OFGA 3QVOA 5ICSA 1LSUA 3AY6A 4A03A 4XIYA 1NAHA 2FR0A 3H9QA 5LCXA 4PG5A 2BLLA 2IEBA 3CSDA 2O50A 1GFSA 4RDHA 1DIGA 3H3JA 1RYDA 3Q9NA 4XGIA 4EEXA 1U4OA 4EDFA 1Q7BA 4XCVA 4EJMA 2NUAA 1MV8A 3QIVA 4D3FA 3PK0A 1UZLA 3M1AA 1MLDA 1ML3A 5CHEA 3QY9A 4PLCA 3Q9UA 4FS3A 3F1KA 4HUJA 3ZV6A 2HKIA 2FY8A 4CLOA 1E7SA 3GNQA 5TNXA 4NPCA 4PLWA 4IIUA 1XR3A 1R37A 5AVOA 4L4XA 4E5KA 3RFTA 3BMNA 5KKCA 1E3EA 1KS9A 3ANLA 4R1SA 2CUKA 4KUEA 4PVCA 1E6EA 4RDIA 4Q3CA 1LC0A 4ZQGA 4CLHA 3RSHA 3ZNQA 1PJQA 5CFZA 4NR0A 2QYSA 1MXFA 1A7KA 4YJDA 1BRMA 3H5AA 5IDYA 4R3WA 3L9XA 3U4CA 1VKNA 3MTJA 4BNZA 2X58A 4E5NA 4YRDA 3NX4A 4CLEA 2PTGA 3LC1O 4DYDA 2CY0A 3IP1A 3ENNA 4BNUA 4DBVO 4BO3A 2YY7A 3H7AA 3RC2A 2WTBA 3DZIA 3WGIA 2JFHA 3ICPA 4J0EA 3PEFA 2W4QA 2ET6A 2P5UA 1E1NA 5L7YA 4CLRA 1UP6A 3VH1A 1RJWA 1MC4A 1JU9A 3BYZA 3UVEA 1A7AA 4JCOA 5EERA 2X1HA 3K2BA 1XSEA 3PWKA 1TA4A 5G4KB 4NQZA 2J5KA 4CMEA 4MVJH 5EESA 2Q1WA 2VHXA 4XEHA 1WMAA 1EFLA 2EJWA 3JQFA 2FRDA 4EJ6A 4YWJA 4TVOA 4AJIA 2FWMX 1K6IA 5TT0A 3X2FA 1XDWA 5A9TA 1LC3A 2R00A 3A14A 4ND3A 2RCYA 4Z3DA 2GERA 5JLAA 2JD1A 1PGOA 1ADBA 3KSUA 3RU9A 3QWBA 4AJ4A 2I67A 5G0TA 4BMNA 1Q7GA 3E5RA 1TT7A 5L40A 3LVFO 2HMSA 2BFMA 3UCEA 3DBHA 4ID9A 5GZ6A 4XYMA 4M55A 1PL6A 1KIFA 1I8TA 1RM5A 3RBZA 4J4BA 3ZWCA 3VPHA 3EY4A 1LRJA 5B37A 3DL2A 3EAGA 2AQ8A 4KUHA 4PG8A 3I9JA 3OBBA 4ZU3A 1DO8A 3WBBA 3QA9A 4CMAA 3E82A 3GEMA 1DDOA 1EBFA 3FTNA 2NVUA 1AUPA 3WQSB 4WNCA 4QXMA 3VHRA 5TIIA 1GQ2A 2O3RA 1XU7A 3NGXA 3UH1A 4MVJE 5DNAA 1FK8A 1B7GO 1NXQA 2G5CA 5HA5A 3RKRA 4I5GA 3DBLB 3C1OA 4QFDA 2ZCUA 1LXCA 1V35A 1PJBA 4N54A 4TRMA 1GZ3A 3KB6A 2NTJA 3E18A 1Z45A 1ZNQO 1EEHA 2E82A 5CEFA 5CPFA 1NPTO 5IXYA 1VLLA 1V3UA 3TWOA 5BSGA 3DQPA 1WDLA 1BXGA 4GGOA 3U4IA 5L53A 2AE2A 2R6JA 3GDGA 2H63A 2O3JA 2VZ9A 1KEUA 2DT5A 2ZQZA 4KTVE 1T4DA 4OKIA 1VJ0A 2C59A 3JQAD 5JO9A 1O89A 2X0RA 2Z1MA 3NDIA 3D3WB 4NBUA 3JCZA 4WPGA 5L4SA 3V8BA 1KVRA 4O59O 3E9NA 1HL3A 4YXFA 3VAZA 5CDGA 1PGJA 1E1MA 1PS0A 2YV1A 2NV6A 3C8MA 4IDBA 4CM4B 4BNTA 2DLDA 1T2EA 2NU6A 4BNGA 3FN4A 4YDRA 1ONOA 4D45A 5EJ2A 2PGDA 3ENKA 4OQYA 2Y1EA 3PLNA 1BGVA 4IUYA 4MKRA 3HSKA 3WJ7A 3DBRB 1PS8A 4MP3A 3ZNPA 1D7OA 4TMFA 4WOKA 1R6DA 4YQYA 1PL8A 4HWKA 4BNIA 3HFGA 4CLDA 2P4QA 2VZ8A 4CPDA 3GPDG 2ZIZA 1CYDA 4YTEA 1SNYA 2SCUA 1EVYA 2VT3A 2VWHA 4RLHA 3M1LA 3TJRA 3ADOA 3ZZNA 2G17A 5KJ1A 4I5DA 5A9SB 2Q3EA 2BKAA 2QW8A 4NU5A 4NK5A 4MVJP 2P91A 1LEHA 4DMLA 1NP3A 1HE4A 4D0SA 4J7CA 1CIVA 3D4OA 2V6FA 5JCJD 4RVSA 3WGQA 4DC0A 5DT9A 2X6TA 1DC3A 1U28A 1PS9A 3TOXA 1YWGO 4FFNA 3LT2A 4DQXA 1U2DA 2X23A 2O4CA 3FBGA 4NHEA 4QX6A 5C7LO 4Q3BA 4C4OA 1R4NB 4Z9YA 2FP4A 3IAHA 4R4JA 1NHWA 2Y67A 4BKQA 5BR7A 1PJ4A 3FR7A 4ZRMA 5L4NA 3WXBA 3CMMA 1B26A 1UUFA 4H16A 3N74A 3RVDA 3DB2A 4AJPA 3WLFA 2O23A 3VTFA 3WBFA 1YGYA 3GF4A 2QYTA 3I23A 3NEPX 4B7UA 1V3TA 1HEUA 4BMVA 3ZWOA 1JKJA 1VPDA 1PJLA 3N7UA 3VDRA 1Z73A 4OKNA 3AM3A 3AUTA 4OHUA 3KXDA 3CZMA 1YKFA 4CODB 3OQ6A 2IZ0A 3PZBA 5AXDA 3WGTA 1VRWA 3C85A 4GGPA 1MP0A 2C5AA 1MFZA 2EGGA 3ZCXA 2DTXA 2FPPA 1C0PA 3OFSA 3IUSA 1AXEA 1PGQA 4Q3DA 4GQAA 3K73O 5L7WA 2J3KA 1QV6A 1X1TA 3JQ9C 4J6FA 5ER6A 4BNNA 3TDKA 1YDEA 5FF9A 4YJGA 3ASUA 4BQRA 2O3QA 2VHZA 2PD4A 3HZZA 3R1IA 3OECA 2QRJA 2VT2A 3VPSA 1NBOA 1AN9A 3D1LA 3GY0A 5T6BA 1F14A 4FFPA 3I9KA 1JAYA 2ZYDA 1N9GB 1Y8RA 4ALMA 4CQMA 5FWNA 5ICMA 3RI3A 4Z3KA 1K2WA 2GNAA 2EWMA 4I5EA 1XG5A 3DHNA 3GZ4A 1H93A 3GMDA 4MINA 3BIOA 4DQVA 2QHXA 4PZEA 3CKYA 1WLYA 5B4UA 1GZ6A 4K28A 4R69A 3GLQA 4CMIA 5B4TA 2O7QA 3JYLA 3BHJA 4OXYA 1LJ8A 3GPIA 4NJMB 3VPFA 1ISJA 1C0IA 1ADGA 1AHHA 5TT1A 3GEGA 1UDBA 3HG7A 4FIZA 4E2YA 3AJRA 1XHLA 3GOHA 2V6BA 3OIGA 3VC7A 1LSJA 3FNHA 2EERA 5DN9A 1ZZEA 1X0VA 2F1KA 1UXJA 3W6ZA 3U09A 1EZ4A 4BV9A 1M2WA 2JAPA 5EN4A 4F6LA 2EKLA 4IJKA 2YFHA 5JY6A 1E3JA 3ROPA 2Z95A 3DMTC 3L4BC 1NVGA 1I24A 2EG9A 3U3XA 4E4YA 4MVJF 4AJKA 4DPMA 4E21A 2DU8A 4FSHA 4WUVA 1ZMOA 4TZTA 3W4JA 4LVUA 4BKOA 3JD3A 4DIFA 3FCOA 1QRRA 4AJHA 5JDIA 1HLPA 3ZWWA 5JCXA 1PU2A 1ZW1A 2A92A 1ZK2A 3ANNA 3MJEA 4U7WA 4E5PA 4WOJA 1NTOA 2GYYA 4MOWA 3JYQA 4UEOA 2Q1TA 4CL8A 4RVFA 4MP6A 2VRBA 3HJAA 4QUKA 4U8GA 1EE9A 4R51A 3GVPA 2O3UA 2PV7A 3DZFA 1C0LA 4JBIA 1ONPA 1SAYA 2AA3A 1PEDA 4BKUA 5KCZA 1X15A 2OHXA 4FOSA 2GD1O 4BO2A 3EHEA 4LRTB 3FNFA 4I9UA 4ALKA 3ONFA 3V2GA 2CSUA 5K6AA 1NNUA 4IQGA 3ZI0A 2QZ9A 2IRWA 3OJOA 3BTUA 4UEKA 4W7HA 1ISMA 2JHGA 1MFPA 4DQUA 4E2ZA 1FJHA 2AG8A 1YOVA 2RIRA 2RHCA 3M2PA 2OBYA 1R4MB 3H6KA 1GY8A 5T5QA 1KOLA 3WYCA 1SOWA 3P19A 2PFGA 1D8AA 4A26A 2P4HX 9LDTA 4KQWA 4E32A 5C3MA 4E5MA 3KOUA 3Q0EA 3NT2A 5EQFA 4TWRA 1I33A 2X9VA 4YBZA 4FQ8A 1I0ZA 2FR8A 1ZVMA 3C1TA 4TZKA 4LN1A 4YJHA 4N5LA 1Q0QA 3L6OO 5F5NA 5JO0A 4YAGA 3PLRA 1T25A 4RZHA 3DO5A 2HQ1A 1O94A 4NNJA 2YQ4A 5LDGA 3KV3O 1P33A 4WCFC 5IFLA 3LZ6A 4CMBA 4ROSA 1WXDA 1WDMA 3JQ7A 1LU9A 3LSYA 3G0OA 4R54A 5IZ4A 1HDCA 2H9IA 1U7HA 1HE3A 1HXHA 1ULSA 1YL7A 4OH1A 5KVCA 3MJCA 3DONA 3ZU3A 3RJ5A 3BTOA 3VTZA 1E1KA 3GG9A 2B83A 4R1UA 2VHYA 2AG5A 1RPNA 1CJCA 4BO1A 3RUEA 2AEMA 1TB4A 2C20A 2J8ZA 3GK3A 3JTMA 3JYPA 3ZWXA 2B4QA 2P9CA 3FNGA 2IYPA 3S2FA 1UDAA 5JC1A 2I66A 2YDYA 4AJOA 3E6AA 2DBRA 5J23A 3ITKA 4IQ8A 3FI9A 2IDZA 4Z6KA 1PQWA 4I9NA 2DBVO 4CR8A 2YW9A 1K0UA 4GL4A 3ANMA 3C3XA 4LSMA 2B5VA 3UW3A 3HQ4O 2ZJ1A 4GVLA 3NT4A 4I08A 1K6XA 4DC1A 3WNVA 2VOEA 2GSDA 1LTHR 1R0LA 1VL0A 1Y6JA 2CFCA 4P8RA 5A03A 5B4VA 1E0DA 5F1KA 3JD0A 4IPTA 4OO3A 2GZ3A 3FPLA 3PI7A 4CM8A 1YQGA 3LF2A 1LDBA 5K9ZA 4R01A 3NAQA 4A0SA 4RL6A 1CDOA 1X7HA 5KOIA 2P2SA 1Y9EA 2ZB4A 1A9ZA 4CV0A 4MVJI 3PFFA 1GEEA 1NPDA 1PJTA 4ND5A 3OA2A 1DBVO 4PLFA 1Z6ZA 2WD7A 2YHIA 3TNLA 2X0IA 4IQ0A 1UH5A 3SXPA 2ZTUA 4D44A 4Z9FA 1DJQA 5CDYA 1HYGA 3KBOA 5F5LA 3HWRA 3LDHA 4YT4A 1Z75A 5IZCA 1NYTA 5JMWA 3WGGA 3QHAA 3F6YA 3GC6A 4WCFB 2C54A 2RHRA 3Q2KA 4G65A 5L51A 4GX1A 4FJ2A 4RF5A 5JPIA 4BNVA 1T4BA 2O2YA 4IDFA 2ZKLA 2PLAA 1OI7A 1O95A 1OMOA 3WQRA 3FTPA 1A72A 1N7GA 5BT9A 5L3ZA 4CQLB 2BGKA 2DBZA 2P68A 2D0IA 1U9JA 1C1DB 2AQIA 4LSWA 4PG7A 4M49A 1TLTA 2VHVA 1QSGA 4AVYA 2QX7A 1NM5A 4J4TA 2NADA 3ROKA 2Y0DA 4IJUA 4J7UA 1XELA 3KETA 2AQKA 2YUTA 4GI2A 1O9BA 1E7YA 1IE3A 3JQ6A 2C07A 2XAAA 1OAAA 1MUUA 3NTRA 4PGFA 2JHFA 1T2FA 2X8LA 1EBUA 2VNSA 1LRKA 1LNQA 4BVAA 1YJQA 2VCYA 1SCUA 2EP5A 3WTCA 4IGFA 2Q1UA 3GAFA 3HB4X 3MWEB 4J9UE 5H81A 4DPKA 2YZ7A 4Z0HO 2HUNA 2R2GA 4ZGWA 1GL3A 1EE2A 4B79A 4UVGA 4YJFA 2AW5A 3OF2A 3TN7A 1V9LA 4EW6A 4RZIA 2FN7A 1HKUA 1ENZA 1K89A 1KERA 4WJZA 2B35A 2HDHA 3A28A 2IE0A 1Q2XA 4NFSA 3ETDA 5L95A 1ADFA 2DUUA 3O4RA 1ZK0A 3V5NA 5BSHA 3UHAA 1PR9A 3JQGA 4LW8A 4QEDA 3T7CA 4XZ3A 5L4LA 2DVMA 1NX6A 1OZAA 4J3FA 4D0RA 4FJ1A 2B36A 2YDXA 4BB6A 1P0FA 2V7PA 3LLVA 1YB1A 4CL3A 3WMXA 4EGFA 5GMOA 4E13A 4GLLA 1MXHA 1UXHA 3QSGA 3RBXA 3WG9A 1A5ZA 2DAPA 5C7OO 4CQMD 5A06A 1G0NA 3IOYA 2VWGA 5F3RA 2HK7A 5THKA 1Q1NA 1G0OA 3VZRA 1C1XA 3JQCA 3QP9A 3TPCA 1XQ1A 1H0KA 4YQZA 1H9AA 5ENVA 4XJSA 1B16A 3ITDA 2YV3A 1E3WB 4IDAA 4W4TA 1EDOA 3GR6A 3TZHA 3KYCB 5JY1A 1V8BA 2D3TA 4JNKA 3ZNNA 1KEWA 4IDDA 3ST7A 3ZHYA 3PPIA 4K26A 3VZPA 1HE2A 2HMTA 1J49A 2O2SA 2W2KB 3SEFA 1NFRA 4RGBA 1JW9B 1GV0A 3Q2IA 2D4AA 2QRKA 1PWZA 2IEDA 4PG4A 5FEUA 5COQA 1BXKA 5DOZA 4PZCA 3ZWAA 1ZFNA 1VL8A 4OMUA 3TZQA 4RPLA 5I7SA 3L6DA 5JYEA 4BO6A 4YR9A 3EYWA 5DP1A 5TF4A 1GCOA 5JDCC 5HS4A 2NACA 3VKUA 4BNXA 4I9HA 3BA1A 2IODA 2B0JA 2FPGA 2X9GA 3FF4A 4DL9A 3GZNB 4TROA 4Q3AA 3LK7A 2DBQA 4B8ZA 3DHYA 3AI2A 4D79A 2JAHA 4IS3A 3O8QA 2GN4A 3EMKA 3PYLA 1Z82A 3PQEA 2CDCA 1ORRA 4II2A 3ONEA 1DRVA 3TZKA 4J1QA 4YCAA 4QQRA 3GHYA 3PRJA 1DC4A 5KJEA 5JS6A 3F1LA 3E48A 1HYEA 4KUGA 1ZK4A 2PZMA 3GGOA 3RIHA 5CEJA 5DBFA 1U3UA 1CQIA 3C7DB 1MG5A 5KJ6A 4IZHA 3GVHA 1HE5A 1IUKA 2EJVA 1U7TA 1P1JA 1H2HA 1BG6A 4Z9XA 2NVWA 4HXYA 4BL5A 1MX3A 3I6IA 4PLHA 1MC5A 1UJMA 3ULKA 2HO5A 3AWDA 5TC4A 2X86A 3PVZA 4JK3A 3AFMA 4N5MA 3OQ1A 1S6YA 2Y05A 4IDCA 2B4RO 3DZGA 1X7DA 2WD8A 3E9QA 1IL0A 4BOYA 3SBOA 4OSOA 1SB9A 4WE3A 4AICA 1KVQA 3DBRA 2QIOA 3EDMA 3WJAA 2V6MA 1T26A 2NQTA 2VOJA 1EVJA 4M1QA 3B1FA 4RJTA 1QXSA 1P3DA 2IXAA 4XX0A 5DCYA 3U49A 4EUEA 1JDJA 4HFNA 2DPGA 3RWBA 4PLTA 5IDXA 4G5HA 3B20A 1N92A 2GN6A 5KVQA 1ENOA 3SLKA 4F46A 2QZZA 4FFLA 2BD0A 2NM0A 2NNLD 3WB9A 1A27A 5L9AA 4WNIA 4CMEC 1IPEA 4RVUA 4WLOA 1IY8A 3GFBA 3V2UA 1NFFA 1LLCA 2XF8A 4PLGA 3SJUA 1PSDA 2J3JA 3QQPA 3A06A 3CXRA 6LDHA 4GSKA 4BMSA 5KJFA 1HDOA 1XIVA 4R16A 1VJTA 2ZTLA 3I5MA 1GYPA 3OSUA 1DJNA 1EK6A 4GKVA 1H2BA 3K31A 4MO2A 4B3JA 4J2OA 4F3YA 4NH4A 3OETA 5G0VA 3DOOA 3RD5A 2Z5LA 5HS6A 3D7LA 2AMFA 4YRBA 3DXFA 1CQJA 4XGKA 3RC1A 5CEEA 3NDJA 3INTA 1U8FO 1Z7EA 3AI1A 3CMCO 2YYYA 3L4SO 3FSRA 5A9RA 2FSVA 4RPJA 3WTBA 1E1LA 2I76A 2VZ0A 4O63O 5T57A 4CLOB 3KLPX 4J7XA 3DTYA 3ZN2A 3AU8A 3WQQA 1E6WA 4JQCA 3ZGYA 1MGOA 1ISFA 2Y68A 4YAKA 1U4SA 2NLOA 4RPGA 3RU7A 3UN1A 3BMNB 4DRYA 4P4GA 1U8XX 4PLYA 3QJ5A 3BMQB 1ZCJA 3U0BA 3UOGA 1ADCA 1A4UA 2JCVA 2OFPA 1ZSVA 2ZB3A 3S55A 3JQDA 4UVIA 4ZQHA 2D59A 1QV7A 1F06A 4BGEA 3ZU4A 3S1LA 5G4LA 1SEPA 1NPYA 3ZNOA 2Y0EA 1L7DA 1WNTA 4LRSB 3WGZA 1KY5A 1PQPA 1DC6A 4BNWA 1TI7A 2Y99A 1U3WA 3OJ0A 1Q0LA 3HDYA 3V1YA 4YB8A 4WASA 1A4IA 4C7JA 3HDHA 1PL7A 2OO5A 4GAEA 1GU7A 1SBYA 4XYGA 3WGYA 4CLRB 1XYGA 2WE8A 2J3IA 1H5QA 1GYRA 5HWSA 4P22A 4NJMA 4YT8A 1WAMA 3DTTA 5JW6A 4R9SA 3UFXA 4BHTA 5ILGA 3WFIA 3SC6A 3VH4A 5IN5A 5TGDA 1P1RA 3GNTA 2D5AA 1XLTA 2DFDA 3DMYA 2WSBA 3AOGA 3GVCA 1Y9AA 4GX0A 3SLGA 3L77A 4I5FA 5EL0A 3NKLA 4R5HA 1I36A 1A9YA 2FZWA 2ZJ0A 3LC2O 2RH4A 4E12A 1I3KA 1EQUA 4B3IA 3SJ7A 4KOAA 2BELA 3N58A 3VH3A 4O5OA 4KMSA 2A94A 4FGWA 4R1TA 4ZQFA 3DBHB 2I9PA 1KC1A 3IJRA 4ZA2A 3U9LA 4H15A 4XQCA 4XRGA 3OICA 4OOFA 3RCBA 1C14A 2FPIA 2QQ5A 1LDEA 1AHIA 4URFA 1J4AA 1P9LA 3D3EA 5EMHA 4YAIA 2X5OA 3PIDA 4LISA 4B4VA 4YAJA 3H9EO 2DC1A 2VN8A 3GT0A 3GUYA 4L73A 3LT0A 3ZWVA 5TQVA 4BO5A 2NVUB 1T1SA 3PYXA 5I7VA 3FPCA 1KC3A 3OIFA 1WP4A 2NU9A 5TLSA 3AM5A 4KQXA 3G1UA 4JX8A 4FGSA 1JWAB 4Z0PA 2XPCA 2EHDA 4GX5A 1LLUA 5GZ1A 1DXYA 3PHHA 2ZQYA 3NT5A 4XQEA 3F3SA 1QG6A 3L07A 1PTJA 3D5TA 1T2DA 1VC2A 4R5MA 4P4NA 4UVHA 2ZTMA 3NV9A 3H9JA 4AL4A 4JJFA 3NUGA 3HDJA 2B5WA 3PZRA 4M8SA 2O3SA 3DZBA 4IDGA 3DHEA 4DWVA 2ZYGA 2VQ3A 1B3BA 1DHRA 4LVCA 2PNFA 1M76A 1ZSNA 1B8UA 5JMPA 2HJSA 3FBTA 3GG2A 2BFOA 1G1AA 3GDFA 4FPXA 1JVBA 2NWQA 4M87A 3W6UA 1PWXA 3HNPA 1R4MA 1Q7CA 3WLEA 4WCDA 1SPXA 3QV1A 4WLFA 2VYNA 3K96A 5ES3A 1F17A 2OMEA 2PZJA 1PJ2A 4RLSA 2VWPA 2GR9A 2WEKA 2C29D 3HHPA 5FI3A 1KY4A 3AFNA 5IDQA 1TT5B 2JCXA 4GBJA 3TZ6A 3FR8A 4NJOA 3W8EA 4JIGA 4WLEA 1GZ4A 1W6UA 4A10A 5B1YA 1DIBA 4NZ9A 3FRJA 4GPD1 1VM6A 3RUAA 4O6VA 4L75A 4F6CA 3EGOA 3OIDA 2CVQA 2DM6A 1V3VA 3K2EA 3GFGA 5CDUA 3IL2A 1TXGA 4FN4A 3ZV5A 4TSKA 2X5JO 2OP0A 3GGGA 3KSZO 3B1JA 4CMJA 4FBGA 3O9ZA 1DRWA 1R12A 2GF2A 2HJRA 1HWYA 2CVOA 4K6CA 4U6SA 5DZSA 4ZVVA 1IB6A 4IMPA 3K6JA 4KWHA 1BMDA 2ZCVA 3Q3CA 4ZRNA 5T8KC 1L1FA 3RUIA 4CLXA 4M89A 4XYEA 3SX2A 5I9MA 1DHTA 2GLXA 2Y0CA 1B0AA 5KVSA 5K0ZA 1CRWG 2C0CA 1UP7A 2NTNA 3JD4A 3UUWA 2Q2QA 1KVTA 3CEAA 2FZEA 2GRAA 5KIAA 1XQ6A 3KYBA 4BNFA 4DGSA 2JCYA 5AXCA 3E5MA 2HAEA 3PDUA 2DPHA 3MZ0A 3MOGA 3I3OA 2YJZA 4LCEA 4B7XA 3B1KA 5DCUA 3ADPA 5CG2A 4GLOA 4YAEA 2WDZA 3LT4A 4ZJUA 4Y98A 3JQEA 4B7CA 4BQPA 1SB8A 2GASA 4QFCA 4XDYA 1FDSA 4A5OA 1TEHA 1NFQA 3EC7A 1YJ8A 4CMCA 5JDIC 1YO6A 2CF5A 2Q4BA 5IJZA 3EVNA 4CUJA 2D5CA 2WYVA 4ILKA 3DOJA 1JA9A 1NQTA 4FOOA 3E9MA 3K5PA 3W8DA 3FD8A 4K9DA 2VUSA 4MJLA 3QVWA 1B8VA 4DLBA 3WOHA 4QO8A 1M75A 1X0XA 2AEJA 3UKOA 4ZICA 4IM7A 4DXHA 1AE1A 5T64A 3F5QA 4AJNA 5MDHA 1N2SA 4NFYA 1YBMA 3VVCA 5F1OA 3STHA 4ND2A 2IZZA 3W8FA 4J16A 1F0YA 4CM7A 2POQX 4JBHA 3H9UA 4YJGB 3RAJA 4AJJA 5A3JA 1BW9B 1N7HA 3QW2A 4KWIA 4QECA 1RYEA 3IIEA 2HU2A 1GCUA 3KO8A 1WPQA 3PYMA 5F1PA 1CETA 5ITVA 4KDEA 3K92A 4WCFA 5CPBA 3JYNA 1YDWA 4B4OA 1Y8RB 4CQMB 4FC6A 5T67A 3OQBA 3WIDA 2NSDA 4TRNA 4GX2A 4JJIA 2HMWA 3UGKA 3WWZA 1GDHA 4UAGA 3DZHA 2IXBA 2ILTA 3WWYA 1CWUA 4CMIB 4R68A 4Y67A 3I1JA 1KETA 3H65A 4CQLA 4NBRA 3RFVA 5ADHA 1XU9A 2Q46A 3D5QA 2AQHA 4QT0A 1C1DA 5L45A 4FFMA 3WIEA 1LI4A 3BMOB 3PHGA 3WGHA 1QYWA 3L0DA 1V0JA 2W8ZA 3DWFA 2JD0A 3CIFA 4IINA 1FMCA 4FFOA 5JSFA 3RROA 3ASVA 1DSSG 3KYDB 5HBRA 1U3VA 3EUWA 3P7MA 1N8KA 4DTIA 1HLDA 4J2HA 1NAIA 1L7EA 4I1IA 4DREA 2WYUA 5LDHA 1GYQA 1O0SA 4KZPA 2C82A 4EYEA 3HFSA 4NU6A 5JAMA 2P9EA 1QYDA 1RM4A 2C7VA 2HRBA 3DFZA 3OEWA 3SVTA 3LF1A 2UVDA 3HADA 3G17A 2GO1A 3RJ9A 3RUFA 1Y5MA 4CM9A 2Q2WA 3KTDA 4HFRA 3ZV4A 1NWCA 3IP3A 5I9LA 7MDHA 4BNMA 1UXGA 1GD1O 3AK4A 4JGBA 3ZHZA 1XKQA 2ZTVA 5AQ1A 2VTDA 5LC1A 4GMGA 3BMCB 3ZU2A 3ON5A 4DUPA 4A27A 1SC6A 4RQTA 1HDYA 3GN2A 3JQ8A 1E3LA 2G82A 2TMDA 4KTTE 3S2GA 4J91A 3VPXA 1YS4A 1GPJA 3DAFA 3UXYA 5BNIA 4JN6B 3I9NA 2I3AA 1ISIA 1DAPA 3INRA 4OXKA 1Z7BA 2IYOA 4BO7A 1AGNA 4W7IA 2A9FA 2PA3A 2BF7A 1GUZA 3DOCA 4UUOA 4BNLA 3I52A 4PG6A 1R15A 4D3SA 2Q50A 4J1TA 3A4VA 4UUNA 3G49A 4L4SA 2Y1CA 3ORFA 3E8XA 4NDNE 2EKQA 3GVIA 3R3SA 2V65A 1Y8QA 1I5RA 1ONNA 3QWIA 3Q11A 3DR3A 4O0LA 2RAFA 2PH5A 4BNHA 4LMPA 4U6QA 5IAAA 1RM0A 1YOVB 2J5QA 4WKGA 4JP3A 4MDHA 4ONEA 4RF4A 1E3WA 2O4UX 1P0CA 4E3ZA 4FC7A 1H6DA 2BGMA 1ZBQA 2HSDA 4I8XA 3ZWNA 3MEQA 1EUDA 3CINA 4A73A 4PN3A 1NHGA 3ZWBA 3WGOA 2EW2A 1V6AA 2VWQA 2W2KA 4QTZA 1N1EA 4L0QA 1DC5A 4YJHB 2Q1SA 2GN9A 4CV3A 2WYWA 5IZCC 3Q6IA 3BHMA 4BS9A 4HBGA 3LLSA 1B8PA 1XWFA 1YVEI 3FHLA 3PQDA 2O48X 3OHSX 3OJLA 1QR6A 2X4GA 3A1NA 2HCTA 3KVOA 4Q9NA 1YB5A 4OGWA 1E92A 2O7SA 4RQUA 3OA0A 4ND1A 4L74A 1T24A 4ZN6A 5H83A 3MJVA 1QORA 4CM6A 3JQBC 3ZV3A 1ENPA 3R6DA 5ENDA 5A02A 5A05A 3KM0A 4BNJA 4EEZA 2GZ2A 1GUFA 5A5EA 4HY3A 3OMLA 4AJLA 3BTVA 2B69A 2OOSA 1HZJA 5EINA 4JROA 4JJGA 4RCVA 5TX7A 2XXBA 4INAA 3PHIA 3DFUA 3MCVA 1YQDA 1BVUA 1LDMA 2OXIA 3AW9A 4XRRA 4L9RA 3JQAB 5ILOA 4A2CA 5BSFA 4UULA 2XOXA 1M6WA 4W9NA 4L76A 4BIIA 4CR7A 2ZB8A 3TL2A 2TMGA 1E3IA 4BNYA 1HT0A 1KVSA 3FNEA 5G4KA 4CM8B 5I9NA 3TQHA 4CV2A 4XR4A 3UCXA 1LDGA 3QE3A 5A1TA 1DRUA 3ETEA 3PFWO 3AOEC 1E6UA 5A3VA 3TFOA 3V1TC 1XGKA 1O6ZA 1E7QA 2JFFA 4CUKA 2DFVA 2B37A 3IC5A 5CDTA 3IJPA 3FWZA 3QWFA 3QWAA 2YHUA 1UR5A 1ULUA 1B3RA 2VYND 5A04A 4MVJA 4BGUA 2H1SA 3B6ZA 1ISGA 5TSDA 4GVXA 2YHIB 2UAGA 2PGJA 4G81A 2PGLA 4IY1A 4BO0A 4EI2A 5JAZA 4HADA 3K8ZA 2O3TA 1R66A 2WMDA 3NJ4A 4GSLA 4R9RA 3UICA 1YRLA 3C7AA 2LDXA 4RVHA 4CM5A 2JJYA 4NBVA 2C7GA 1W0CA 3L9WA 5TJ9A 2QG4A 2BGLA 1NR1A 2B4TO 5CDSA 1LDYA 3S2IA 3RUDA 5JDCA 1LBEA 2I65A 4IZIA 4BO8A 5H82A 4XWYA 1QLHA 3K30A 5GZ3A 2JKVA 2AHRA 1QLJA 3VDQA 3DBLA 4W6ZA 1DFHA 2FR1A 5AXAA 3ZW8A 4YT2A 4JXKA 1CEQA 4HFMA 1IHXA 4MVJM 5IN4A 2X0JA 4J43A 1T2AA 1IZ0A 1JN0A 1PJCA 2ZATA 4MKXA 1W8DA 1WZEA 4RVGA 1PZHA 1K3TA 2VTEA 4MKZA 4L8VA 4WLNA 4IIVA 4J4HA 1DIHA 3ONDA 1DPGA 4UREA 4PLZA 2PK3A 1GV1A 2X9NA 1I10A 1J6UA 3PIIA 3Q1LA 3D3WA 1OC4A 3PGJA 5JNLA 3DEYX 3DZJA 3E1KA 3BMQA 3GRKA 3PJFA 3JV7A 3UAGA 1PGPA 3C1AA 4H7PA 1I3LA 4PRKA 3H3FA 1UZNA 1I30A 2X0NA 3D4PA 4F45A 4YJFB 4TKMA 5C7IO 1Y1PA 1JQBA 3F47A 4CM4A 5I7FA 1UDCA 1ZSYA 1K5HA 1JKIA 3LU1A 3WX0A 5ITWA 5IDWA 3QLJA 2EF1A 4AJEA 2JFGA 3OJFA 2I6TA 8ADHA 3S2EA 4RVDA 1ZMTA 2P9GA 4ITUA 1EMDA 3BAZA 4DPLA 4DYVA 4DMMA 1QYVA 3JQGB 1ARZA 4NBTA 3KLMX 1GTMA 1YONA 1BXZA 1BDBA 1W4ZA 4YVFA 3GMSA 1XCBA 3ETGA 4A7PA 4H3VA 4DBZA 1GQYA 3I4FA 1U5CA 5DF1A 5A9SA 3JD1A 1ZK1A 4Y6SA 1P45A 4ZHSA 2BRUA 2ZYAA 2VRCD 2BMAA 3T4XA 1XA0A 1HDRA 1FDUA 4Y6RA 3I83A 1DAOA 1I32A 4EUHA 2Y1GA 1C1XB 1E5QA 3KRTA 4IS2A 5DP2A 3JQFC 4TRRA 1LQTA 4HX5A 4XB1A 4D42A 5IF3A 3NRCA 5FYDA 4J49A 1C0KA 1P31A 1R4NA 2R00C 4ND4A 3PJEA 3P5SA 1P74A 1SMKA 2E4AA 4K1LA 3T4EA 2BI7A 1D4FA 1YBAA 1P1IA 1ZEJA 1P77A 2VUUA 4UVDA 1H6BA 4IBOA 1RKXA 4P4LA 5BNFA 3WFJA 1PJSA 3ZWYA 4B3HA 3S8MA 1HRDA 3KSDO 3MJ4A 1ZJZA 3DAGA 5TRTA 1BDMA 4XIJA 5L7TA 1P1FA 4XB2A 3X2EA 1ENYA 3H2ZA 1F12A 2CNBA 2Y93A 3PWSA 1VL6A 1YB4A 3COSA 4N5NA 4JLWA 1VE9A 4D46A 1KVUA 2UUOA 2G0TA 3P2OA 4Q3NA 4J1SA 4WGGA 1TVEA 2GCGA 1NVTA 1HZZA 1EFKA 4IJWA 3HB5X 3QWHA 5U4QA 4O1MA 1IZ9A 2OZPA 3O8QB 4FW8A 3ROQA 4CM9D 1Y5RA 3SC4A 1LDNA 1LX6A 8LDHA 3NJ8A 3TOZA 1H6CA 3PJGA 4IDEA 1YH3A 1M66A 1NQOA 3PQFA 2OL4A 1N9GA 2P5YA 3GH3A 4OOEA 1IOLA 3KHUA 2VYVA 1QKIA 1KBZA 4Y8VA 1VSUA 2Q45A 3H8VA 2D8AA 3CE6A 4MP8A 4NIMA 3NTOA 1X14A 4HNHA 3VH2A 2WWRA 4OQZA 1WDKA 3NTQA 5THQA 2UV8A 3C24A 1JWBB 3WSWA 1DIAA 2GN8A 1TT5A 2BH9A 3TRIA 4XJTA 2J6IA 3AY3A 5A5FA 4CM3A 1M67A 1UAGA 1E7MA 3LYLA 1I3MA 4RPKA 3TFQA 3HE3A 4BNKA 5G0WA 2A35A 4NG5A 3EVTA 1B15A 1QP8A 1PIWA 3GN1A 4DA9A 3GA0A 3KUXA 2HRZA 3TSCA 2HLPA 3WICA 3T7EA 2ZB7A 4RO0A 4W99A 3ZWPA 1E7WA 2WE7A 1LUAA 3I6QA 2H6EA 3O03A 3I4CA 3CH6A 1H94A 1LSSA 4EUFA 1JLLA 4OL9A 3GDOA 4E33A 4D43A 3L6EA 3OH8A 4NFHA 2OGUA 3VZQA 1U5AA 2WM3A 3G79A 1MB4A 1HETA 5HRUA 3PHJA 5TJHA 1HDZA 2E37A 3RQSA 3F5SA 2CDAA 2GPTA 1VSVA 4NK4A 4U0KA 3OJEA 2E48A 2W90A 3RUCA 3VZSA 4CM1A 4FCCA 3BTSA 1PJ3A 2YV2A 2CDBA 4CMHA 1W73A 2NVBA 5HTOA 3V1UA 1ZXBA 3V2HA 4E2XA 3F46A 4PRLA 9LDBA 3HUDA 3JQ9A 2GUGA 2BFPA 3FWNA 1PQUA 4II3A 4B4WA 1JKFA 3VKVA 1HYHA 1DIRA 3D0OA 3GGPA 4G2NA 1UAYA 4WLUA 3OP4A 5EQDA 6ADHA 3RBVA 4ZQBA 1BXGB 4U5QA 4ESOA 4XD2A 4RF2A 4Y9DA 2BFAA 1U3TA 2W2LD 2EEZA 1PX0A
chains in the Genus database with same CATH superfamily
3RFCA 3GNLA 1I2CA 2PD6A 3BIFA 1MR3F 4C3ZA 3F4KA 4LYAA 1FQKA 4DDKA 2ZJAA 4NE2A 4Q34A 1G21E 1XN4A 1FXSA 4BKMA 3GEHA 1YIAA 2A9QA 3UV6A 4LXXA 3CLVA 4HZGA 2WF7A 4V38A 3ROMA 1KMHA 1YXMA 1QV9A 4UVEA 1T1IA 1VL5A 1ZW6A 3MJSA 4YCJA 5BN4B 4EFMA 3C5CA 3S2YA 2XCRB 4TQGA 4D3DA 1PTJC 2AJTA 4KX5A 4URYR 1U7XA 5IEBA 1Y3FE 3LBAA 3C6KA 1NQUA 4GMFA 3T41A 3SHFA 4YRAA 2RHBA 5G2OA 5JS7A 1BXRB 3VU8A 1M5TA 2ZQ5A 2VJCA 4XR9A 1JR4A 2EP7A 3FSJX 3SLRA 5HM8A 1FFYA 1G5HA 3IDSA 3GAZA 2FWPA 3R40A 4Y7CA 5BMVA 721PA 1X70A 2ZE7A 2RBGA 4MVJD 1KYYA 1SELA 2PR2A 4XIIA 4PYKA 4WZAB 5BWMA 3DMTA 5DGIA 3CPHA 4WEOA 4QFMA 4IHJB 4NH0A 1T29A 2WYHA 3EZLA 4TS9A 4U9IS 3Q7QA 5MHTA 3EAQA 4Z54A 4KXLA 2F48A 3JPYA 5ELLA 1P18A 3PFNA 4DEVA 3DMGA 1KO8A 3K0CC 1E3SA 5EOVA 2C4KA 4UUMA 3RASA 2C8KA 4CZ2A 3NOXA 1W8IA 3L8GA 3RS3A 1CEEA 3D4NA 5JS2A 4S1VA 5KMGA 2YYAA 4RYLA 1KWKA 5EHNA 4AKGA 5I5EA 1K9VF 2A0WA 1C3OA 1P44A 1U5BB 2IEGA 2VYFA 3DEZA 3FW1A 3L0BA 2C94A 2Y1DA 4GWLA 5DI9A 2O19A 5A6SA 3IBTA 5DHSA 3AKCA 2FEWB 2WJVA 1PUJA 5EE0A 2JI7A 5TQ0B 5D5HA 1P73A 3SJCA 3U7HB 3HXOA 2P3QA 1QQ7A 5C5IA 1UOEA 2DWUA 1OX4B 3O6VA 2REBA 3TIIA 4R9VA 2FOIA 1P4AA 4GBED 1FS5A 4M9ZA 4E30A 4YCSA 1WUHS 4GPEA 2PCLA 2E0IA 3F9IA 3LY8A 3SMQA 4I1RA 2VSYA 1IBRA 1WVMA 1WW2A 4XFKA 1GAEO 5HCNA 5KJCA 4RMGA 1ONSA 3LRPA 5JSKA 2F90A 4CMGA 2ZZMA 2OGZA 3K6KA 5JCPA 4IXMA 1CUAA 2XMZA 5HJ5A 2G36A 4EFKA 2GZDA 2YFQA 3FIUA 4QSMA 4JP1A 5AYVA 1J00A 4IJ6A 3RSQA 1U3FA 1Y80A 1JDUA 2CVZA 1MCZA 2JI8A 1C0EA 3LUFA 3E7PA 4GI1A 4LCJA 3WWCA 1HH4A 3PHLA 2H4WA 3WB0A 1IULA 4N7RA 1A71A 4L78A 4HGPA 3ICCA 5I8ZA 4D8YA 2GVZC 1J39A 3HNOA 1KYQA 5DM1A 5JAUA 2W11A 3HN7A 3A31A 2NTVA 4YDHB 1EESA 2W5UA 1KQGA 4Y1FA 4CFSA 1CJSA 1SIUA 1U7ZA 3D7MA 4FS8A 3RUHA 4DVJA 1Y81A 2CF6A 4FNGA 2OYCA 1D2HA 2FPPB 4BDSA 2HI0A 3OZGA 3W4JA 3WZLA 1Q5PA 3P2EA 1UBLS 3DHVA 4P54A 5JAIA 1RWWA 3DKIA 1SOVA 3ODGA 2REQB 1FYFA 2PKWA 2J5XA 4EZIA 4KO4S 2ODAA 3E70C 2FW9A 5TR9A 4QGGA 1HTWA 1U9ZA 5J5AA 1O4WA 2JHCA 1VE5A 4YRMA 2XYQA 1D5WA 4BFSA 1P9NA 2HW8A 5CVUA 4GRAA 1ND5A 1QUEA 3INYA 2HQBA 5MGBA 1Y5NA 1LTKA 4KBFA 5T4FA 1U9YA 2EU8A 5LD2C 1F4LA 1WMEA 1Q21A 2RG1A 2UYYA 2GEVA 5EXEA 5HDQA 3U81A 1DKNA 4TLCA 1NA5A 4F96A 3FXAA 5FPQA 2ZIAA 1NVMB 3KC2A 1G8FA 2WA2A 4MIEA 4NICA 1K5DA 1J8VA 4PAQA 5EZQA 5IWAB 3AHGA 3BH6A 5DHQA 4EF6A 3P0HA 3EFOB 2LW7A 4UMFA 3AXTA 3EZYA 4OQNA 4TXLA 1V3QE 5IJAA 2ZAGA 4EW2A 1ZIDA 2BMWA 1OGIA 1RW4A 4HEA1 1GILA 5CB0A 4J16C 3FCSB 5DBIA 4TVBA 1E2KA 3LCMA 1AIPA 3D8TA 1EDZA 5EWJB 3ILXA 4Y9RA 4CCSA 1YB7A 5F21A 3ZEIA 3DLHA 1BE6A 4KO1S 3ITNA 1PR5A 3TR0A 1RXSA 2C2HA 1FDVA 2RGUA 2ZYTX 2H4YA 5AICA 4DM3A 4WOBA 1OXKB 1NKVA 2KBFA 4DR2B 1J2UA 2VDQB 3ESZA 4HDCA 5CB4F 4XGQA 2ONCA 1ZD2P 4HFJA 3ZCRA 2GJ8A 1TTPB 2II6A 4HAUA 1K6JA 1GSOA 1HQYE 1QX4A 2Z0MA 3REOA 4EG5A 1T10A 4F60A 2CB9A 2WTEA 5CW1A 4TT8A 4JDUA 1UK9A 3SAJA 4DA7A 2HYIC 2GPJA 3BFXA 4OQQA 4X1KA 5DOVA 1XZFA 3MG9A 3W4IA 3MWEA 1YB2A 4L8GA 2Q07A 5KYYA 2HR1A 3KQSA 2WUDA 2C5EA 2X7XA 3EB9A 5AKLA 1HTBA 4MV9A 2P5TB 3RIGA 1FLAA 4Q7KA 3MHTA 3OKCA 4E08A 4EABA 1XAJA 2BEUA 2PZLA 2OXTA 4F06A 3P32A 2FQWA 1EWYA 3H2KA 2IZOA 3MGKA 3H5NA 2W70A 3A36A 2PL3A 3N8HA 3GELA 3F96A 3ZU5A 4CEHB 3IOMA 4BVLA 5IX8A 4OM8A 2Q49A 2DR0A 4D0GA 1ZKMA 2J5RA 2FQYA 1X7XB 4CGZA 2VJMA 2VLBA 3DDNA 4A0RA 3DB1A 3CRVA 5TPWA 1OJLA 3QJGA 4M1OA 2Q4EA 4CJXA 5BWNA 5KWEA 3TX6A 4Q9JA 3HO1A 2W6MA 1SA0B 4PSUA 5EUQB 4UCWA 3UK0A 2FMTA 2CMDA 4Z99A 4YP9A 4C5AA 1T3LA 2EVWX 3LFUA 4EY6A 4PZUA 4AFNA 1F5SA 1KK1A 3UCFA 2ODEA 4F7DA 1SEVA 2FU5C 1KQNA 3GWGA 3LWDA 4P5DA 3R7NA 1L5FA 3AI3A 4C4PA 4NI5A 1JTVA 3WWEA 5K0EA 2OAQ1 1M34B 2PD3A 2V45A 1VXRA 1I4WA 4DA6A 3IQDB 3WO1A 1HDXA 2CYCA 1NN0A 2ZANA 2WWIA 3H5VA 4EEKA 1Q0PA 4UKDA 5EUBA 4ZCTA 2D2IA 3QLUA 3JALA 5J2UA 1BIFA 3WP0A 4E6PA 3D43A 4W7SA 1N32B 1TADA 1Q16A 1S0UA 5LZ4A 3NASA 3TQSA 1OI2A 2PIAA 1I2MA 4UFOA 3M6MD 4IIGA 2Z2IA 3KYCA 1U1FA 1E59A 4MDYA 1DAFA 4E7PA 1Q0ZA 4JB8A 4KITB 4ZIRA 3AUUA 4DHEA 2AH5A 1GM5A 2PWZA 3MWDB 4EFLA 4FDAA 1NUHA 2TMYA 4C89A 1H2FA 1RQGA 2WJPA 3V1KA 2CLMB 4DV5B 3U6KA 2WU1A 4AZSA 13PKA 4BUCA 3G2JA 3HPQA 1UZMA 4INOA 5IDVA 3UK1A 1NVUQ 4IXTA 3WLKX 1VKRA 4XKJA 3OPYB 4K6FA 1ZOSA 4URVR 3CVOA 3HRKA 5A4DA 1KEVA 2HT6A 3O38A 4HWSA 3ABSB 3ZBTA 3R3JA 2I3GA 4PPYA 1EM8B 3IIJA 5J4LA 1JQ3A 2RGYA 4BO9A 2JL1A 4XWTA 5EPOA 1K3FA 3EEBA 3K9CA 3PGXA 3QZUA 4J0FA 2O54A 3QVKA 5EMMA 2Z5FA 2EBHX 3HA5A 4MIOA 1IQUA 4TTJA 1AK2A 2P79A 3S1SA 1G6KA 4R41A 3Q7RA 3DWGA 4KNYA 2I8CA 1QNFA 4IP0A 4LMBA 2E49A 4N6NA 2GK4A 4OEHA 4B46A 4D4HA 5AW4A 2KB0A 2WHPA 3L7DA 3S70A 1OZ0A 1IJFA 2C9YA 4C4RA 4ARZA 2QIPA 1E0KA 4J90A 3C97A 5TQJA 3RVSA 3JQRA 5JMOA 4F2GA 4MRMB 1LPSA 1O4VA 1RC0A 2IDJA 3OPVA 4PR0A 2I2CA 3ZHXA 3AUSA 5TPZA 1OBVA 4WN9B 2GKSA 1KKMA 2POCA 2WOJA 3O1LA 1H9CA 4C5BA 1IDN1 5M3BA 3BHIA 3D7SA 4K9MA 4QLAA 1Q14A 2BFEA 1U7DA 3DR5A 2XJ9A 2UXBB 2D5IA 2QRZA 5CTAA 2I71A 2JHAA 1ECBA 3FKSD 3HU1A 3GNSA 4E5YA 4BB5A 1Z2NX 1UKCA 3C3WA 2QMYA 2ZRBA 2RGCA 4HH4A 1K63A 4RL4A 1PR4A 1IZYA 1NP7A 2W2QA 3NRBA 5AVJA 5GJVC 4KXUA 2V3WA 1W2HA 1ZUNA 2A1UA 3SZLA 3GW8A 2Q5LA 3CKKA 2P1DA 1QKJA 4K8RB 2AOWA 4MYDA 1DFGA 5JJIA 5BV1A 2K2QB 3WHLA 1FOEB 2XCLA 3LBNA 1I3OA 4FXPA 2CJXA 4QICA 4LXYA 1NWHA 2ZIVB 3FSGA 3MJTA 1ZIXA 4YJ3F 2WWTA 4HGOA 4HNGA 1PF7E 4JX9A 4N18A 5IARA 1CXZA 3DAPA 1E77A 2ZRAA 2Y66A 2O5VA 3EA0A 3M5WA 1CKEA 4WBNF 1JU4A 1QANA 4DSZA 1QVRA 4DB4A 1UADA 5GJWC 3UMMA 4X66B 4XWWA 2EZ9A 1P1KA 4GWKA 4NBWA 4ED9A 2D6FA 3HO8A 3LGSA 3KKMA 2PXCA 3EPPA 4YP7A 1YS2X 1GR0A 4FJ0A 1M2FA 4W9NC 1XCJA 3OQPA 4Q7EA 4HNVA 5E9AA 1EP3B 3ORYA 2H08A 4I0WB 4M60A 5DCWA 4N76A 5G3ZA 1V5IA 3CN9A 4NEQA 3GEDA 1IDOA 3NWEA 1FSZA 2E6UX 4LYDA 2DFNA 3U4HA 3B48A 3V7NA 1P62B 1AQUA 4D3ZA 2UZ0A 3TQRA 3BICA 3W4KA 3ISTA 3LBHA 4RTLA 1B42A 2ZSIA 4R3NA 1MO3A 5FI5A 4YP0A 3ZIAD 3FCAA 2HWWA 1QJ4A 3QVOA 4EQZA 3WAKA 4EKNB 4IOJA 4RY2A 2Q5IA 1RWXA 4QHTA 2L19A 3EGDB 3D0QA 3Q2OA 4MXDA 4NU8X 2ONJA 2WWGA 2Q3MA 2IVZA 4PG5A 5AJTA 1GFSA 4NULA 4MRRA 1Z63A 1JSCA 2PU7A 4ZK6A 2OY0A 1JG2A 2J30A 3A6HA 3FPHA 4M1MA 4LQDA 4RTMA 1U4OA 2E4VA 2F1HA 1E2DA 4EJMA 3TGPA 4G01B 4D3FA 3QIVA 4FFBA 4M9UA 1MLDA 2RHMA 2H16A 3D1JA 3DGEC 4ISBA 5CHEA 1TAQA 1VE1A 3FZYA 4TL9A 3LLUA 3TNDA 2C1EA 5SYNA 3NWJA 2PT9A 2O6LA 2J9XB 2J5BA 1QHYA 1TJ3A 1E1YA 4IIUA 4XM1A 4EHAA 5FP0A 5DKFA 3LAWA 1U7OA 1EFRD 1R37A 1YMQA 3CONA 3OX2A 4S12A 4TTRA 2B4AA 1RQPA 4E5KA 3GPCA 3RFTA 5KKCA 1E3EA 1UODA 2ZAIA 1UMCB 1YRBA 2BM8A 1DT3A 1EVKA 4DZZA 4ZTBA 2FB9A 3C6YA 1NLMA 3AIKA 4PNHA 3USES 3GT4A 2GJSA 1LC0A 1SY7A 3AF5A 2ODTX 4L9AA 4Q3CA 2AB0A 2YWDA 3FH0A 1FNCA 3KAKA 2R44A 3KEGA 3QNMA 2C78A 4D3XA 1ZYUA 4PQRA 4ARBA 2V7GA 2IIPA 3BWBA 3H5AA 4YJDA 5IDYA 4CF6A 1U2SA 3UZUA 4R3WA 3MTJA 3NIGB 2VT6A 5A4MS 4NL4H 4GQIA 1X38A 5EVJA 4IKPA 2XKKA 4RTKA 4OYYA 4IKOA 3VNUA 1UWVA 5FR1A 2YY7A 3SU8A 4LZLA 3P9SA 3DZIA 1EINA 5DGTA 1Z4IA 4C7XA 2H31A 4G4GA 4F4DA 2GKOA 2JAWA 3ICPA 3KKPA 3KTAA 1KDOA 1CUCA 3AR9A 3PEFA 4MQLA 1UPUA 4X6YA 5DW3A 1QFJA 4JLJA 3A4YA 4CLRA 1N6OA 3BD9A 1RJWA 1MC4A 2ZSFA 4EHLA 4WCVA 2CV0A 4BWVA 2FEXA 2HU5A 4JCOA 4W6QA 4RNCA 3M70A 2FPWA 2O2JA 2C42A 3VKFA 5GTDA 2W6PA 2OV3A 3OCJA 5G4KB 3L7KA 3E84A 4FB4A 2HQRA 3MT0A 4D9BA 4MVJH 1Z56C 2Q1WA 3B1YA 3MRTA 2XT9A 2VHXA 4LOJA 3T3IA 3CVWA 4FN5A 4XEHA 1QU2A 1WMAA 4U7GA 5IUKC 5LDDC 4I4TA 5JEEA 2ZJZA 3JQFA 4X6UA 4YRJA 3VO2A 1SIOA 4TVOA 5CBPA 1E3QA 2AG0A 8OHMA 2C7PA 4I3FA 1U81A 5SZKB 1TJPB 2BFBB 1JHOA 1NU6A 3RT9A 2D3WA 4L6CA 2GERA 3D8UA 1P2FA 2QYHA 4D9MA 4K0KB 3MRVA 1Q7GA 4WTOA 3W2FA 2AFIE 1KJQA 4EX7A 1MT3A 4Q3OA 2GHTA 4I1OA 3E7FA 4GBGA 4TV9F 1CIPA 2QD3A 2YR0A 3CVXA 2LCFA 1FP4A 3JPWA 2FWIA 5CW2A 1IONA 3K94A 1R00A 3BJZA 1MA3A 2XNDD 1LRJA 3FOFC 3ETJA 2P6NA 1R0RE 3MTIA 3BCHA 4A0QA 3T1NA 4OQPA 2QZJA 2OB1A 2QPOA 5T4HA 3HPRA 2VBFA 4CMAA 3E82A 3M3HA 1EWVA 2HADA 3C3PA 4N12A 1DDOA 1EBFA 3M89A 3O91A 2NVUA 1AUPA 3H5OA 4WNCA 1UBHS 4ZGBA 2V4UA 4M88A 3NWOA 4QXMA 2ZZNA 2ZTSA 1XU7A 2G1JA 3KT8A 3OCWA 3UH1A 5LNK1 1EWRA 1FK8A 3G8CA 1B7GO 3X0DA 2L2QA 4Y6OA 2IOYA 3L0PA 3KXKA 1TJYA 1CR6A 4N54A 4TRMA 3E18A 1JG1A 1OILA 2RGNA 5BYJA 3LTNC 2GEDA 3QLEA 4E46A 3BG5A 4B74A 5JYDA 1BCSA 1KEEA 1VBNA 4TL7A 5BSGA 4G07A 4AO6A 2TRSB 1WDLA 3DQPA 1MHTA 5G02A 3PQ3A 5E6RB 4BBAA 2MSKA 2AOVA 3UANA 5D84A 5CNIA 2AE2A 2R6JA 3T06B 2J3DA 5CXSA 2PUBA 5DIZA 4QPPA 2DT5A 1DINA 1T1EA 4TTQA 1AKNA 4OKIA 5I6DA 1VJ0A 1JB9A 2G04A 4KR3A 2PGOA 3G7NA 2H5IA 3TXYA 2OGWA 1LK7A 4JGIA 1W0JA 4OIFA 1W5TA 3SNHA 5F9MA 3IQGX 2LIPA 4WPGA 3HLYA 1L9KA 1KVRA 2V7BA 3KK0A 3WL7A 2YXNA 4YXFA 5ENZA 3EMDA 2QGNA 1YZ3A 3TZEA 1YASA 1LWNA 2VF5X 2Q62A 3CE9A 3SJZA 4CDGA 1Y98A 2DQSA 3HU5A 1VDMA 1W4LA 4BE4A 3GRYA 2AYYA 5DX1A 4IDBA 5FOWA 4IIJF 4BNTA 2DLDA 2NU6A 2NSYA 4EVQA 1NUSA 4YCCA 5C8DA 1NXOA 5DBHX 4YDRA 4ZC1A 4D45A 5K8VA 2GM4A 2Q5OA 2PGDA 3W2GA 2C2KA 3BIJA 2Y1EA 3R23A 5ALUA 3TE6A 4C0AC 3HKCA 2DHRA 1G2PA 5A7GA 3HSKA 5IBCA 3DBRB 2CJFA 3VU9B 1PS8A 2QTGA 2F4VB 4ZT4A 3S99A 1D7OA 3ZNPA 3H9CA 1USVA 2XJ4A 3OMXA 1CV2A 4X6XA 1PL8A 4BNIA 3VO9A 3DZDA 3T4PA 1T6ZA 1ZGBA 2ZIGA 1Z7GA 3ETCA 3KHSA 2P4QA 2VZ8A 5DASA 2O2GA 4LNHA 4RA9B 3F6BX 2ZGVA 2CMGA 2VBCA 3GROA 4IF4A 4PAGA 3GCGA 3FRIA 3GMIA 1SNYA 1MT0A 2SCUA 3DYVA 2X15A 1JJVA 3F71A 3HU3A 4RLHA 2H3EA 1MEOA 3ADOA 1JMVA 3RRFA 2G17A 3ZZNA 4MYTA 5A9SB 4QOSA 2OKCA 4BFVA 1KZ9A 2BKAA 1C1HA 4Y2PA 4BMYA 4F92B 2P91A 1LEHA 3HKBA 1B73A 2PMFA 4D0SA 4LC0A 1SUPA 4S1NA 2PWPA 2GBPA 3OTIA 4MQFB 1AU9A 4NCKA 5DT9A 1JE0A 5AO9A 3TLZA 1PS9A 3P0IA 3LSTA 4QBHA 4FFNA 4QULA 3LT2A 3TOXA 2V5AA 4CTJA 1OROA 1KIMA 4ZO8A 4G0QA 4MROA 3UKDA 1NJ6A 4Q3BA 4C4OA 4KR9A 2VDRB 3QKRA 1R4NB 2DQYA 4W5JA 4Z9YA 3IAHA 4Q21A 3ZYCA 1Z62A 4ZO6A 2O14A 1NHWA 2Y67A 3N8NA 2NPOA 1G21B 1UKYA 4I4CA 2EZ8A 1XC7A 1AKMA 2YRFA 5L4NA 1E5VA 3WXBA 5K6TA 5AW2A 1X8KA 3CMMA 1DUVG 1HX7A 3PPVA 1RWVA 1NJ1A 4H16A 4P83A 3RVDA 4ZI7A 3NBXX 4P36A 3WLFA 4EA6A 2O23A 3WBFA 3C14C 3I23A 4J75A 3LOUA 2LZ0A 5K0GA 2FJUA 1PJLA 2I0FA 4P0PB 3TOVA 1Z73A 3AUTA 2X3YA 3PFIA 2GJ9A 2WJZB 4EZEA 3CZAA 1RPAA 3KXDA 3CZMA 1UPTA 1R74A 1GPWB 3LX4A 2CJPA 3F3KA 2ORIA 2J4FA 3PZBA 3VNQA 1SH7A 2EDAA 2BMVA 3WGTA 5IAOA 1ABBA 1S2IA 2C5AA 1MFZA 2PMWB 4BVBA 4E07A 1LB1B 1AXEA 1PGQA 4Q3DA 1UFVA 4DCVA 1P2GA 4KREA 2J3KA 1RKVA 4BNNA 1NUAA 2ZI7A 4DCUA 1RXEA 2JAQA 1JG3A 4YJGA 5FF9A 3TMAA 2GRJA 3ASUA 1UWLA 4JT9A 2O59A 1QG0A 4BQRA 3UW3A 4X7BA 3OECA 2J9ZB 4BCCA 1NBOA 4QYWA 1IN7A 2FN3A 4QD3A 3GOQA 3GY0A 1U0LA 3C8UA 4HTFA 4O4JA 4EX6A 1P81A 4GE3A 1L7AA 3RI3A 4Y2HA 1K2WA 2DHDA 2EWMA 4MMYB 1XG5A 3NBQA 1GGEA 4DA0A 3HEAA 3RAEC 4U1RA 2I2XB 2VF8A 5DTMA 1ATIA 4MKFA 4Q1FA 4PZEA 1WLYA 4H59A 4K28A 4TMKA 4LGYA 2UZ1B 5D3MA 3SQMA 2A1TR 2O7QA 4E4RA 5B4TA 1NBME 3BGIA 3E7XA 4R8MA 3EXHB 2WK1A 5A7FA 1LJ8A 3GPIA 2HF7A 1G8JA 5SYMA 5INTA 1XDUA 2HA0A 1JPJA 2X41A 3VPFA 4N5IX 3I12A 5EHIA 2J0SA 1KJJA 3UGQA 3GEGA 4HDRA 4CGYA 3ZZ1A 4E2YA 2X8BA 5FJIA 3GBPA 2W0MA 1WEHA 4ZK2A 2B3TA 2P67A 3L1IA 3N3AC 4KYIB 2BHTA 5LBUA 5H3CA 4XLZA 4DCTA 2I2AA 2VK1A 3VC7A 4Z4FA 3IEKA 3NXSA 4I55A 1UXJA 2NO1A 3W6ZA 4KQ9A 3U09A 1M2WA 5I47A 1UKAA 4UTNA 4B3RB 4Y0AA 5MGNA 2DQZA 4LF7B 1PW7A 1L5HA 4QBKA 1UIRA 2MSCB 1Z6AA 5B58T 3ROPA 3BSSA 3L4BC 5CLLA 3OG9A 5EE3A 3AX6A 3LBFA 1JDSA 3MSXA 2EG9A 1JLKA 4MVJF 4AT1A 2BM0A 1I2AA 1BA2A 5EJ8A 1VCOA 2FGKA 1EXNA 4P4SA 3ZLBA 1LK0A 4ZVRA 3VR0A 5IFKA 4CYMA 2ENWA 4WZ6A 5EIWA 4Q15A 4HAXA 4WY2A 3EGIA 1N4AA 2QZSA 1PU2A 4JR2A 5DMXA 5TVKA 1ZW1A 2BR3A 3LE8A 4J03A 4E5PA 4U7WA 3T7AA 4HWPA 2HHJA 2GYYA 3W8NA 4NOLA 4KQ6A 3ED1A 5HZMA 3HJNA 4KODA 1H42A 2AJBA 2RK4A 3S4YA 2FLVA 9ABPA 3TNJA 5GVSA 5CGQB 3R5KA 5B3AA 1U0HC 4MV3A 3TIXB 4BVHA 1QOQB 3ESCA 1QGZA 5DT2A 1IBMB 5CJJA 1DKUA 1RI5A 2B25A 2Y6UA 3OTWA 3RK1A 4DLXA 3W7BA 3DZFA 5ULLA 1T1GA 5JEDA 2WFZA 2JLVA 3GRFA 2P1RA 2VAMA 2W37A 3IMKA 4HB0A 4I50F 3X1JA 1YI8A 4JT8A 3MGBA 1D6NA 3MVEA 3WLAA 1NXSA 5I48A 2EX0A 1THZA 3HJHA 3OUZA 4I9UA 4PFQA 1S89A 1P5JA 3PFKA 5E7IA 4ES6A 2CSUA 3PQCA 4AMBA 4IQGA 1P7ZA 5EKXA 2QZ9A 2IRWA 3MRXA 4UHCA 2FEOA 4KQHA 4A8TA 4W7HA 1QVAA 3W79A 2XBMA 3M6WA 2Y4NA 2PUFA 5EJ9A 3LG2A 4E2ZA 2PRZA 4GKAA 5AKZA 5L3QA 5LL6P 1Z4KA 2RIRA 1AGPA 3M2PA 3NAZA 2OBYA 3H6KA 5T5QA 3WYCA 2EZTA 1YMVA 2P7HA 4BNUA 2XB2A 3CJQA 5AMXA 1LBTA 3QPDA 2G4LA 2BEJA 2XAUA 1ZGZA 2CFOA 5C3MA 3OF5A 1TZBA 4KE7A 3KOUA 2I4IA 4I9GA 1JP7A 2ATXA 1I33A 5E8JA 4A8JC 1DCKA 2X9VA 1I7QB 2N47A 3N6XA 4N1AA 4YBZA 2BEWB 3M6VA 1K8XB 3BXGA 1QP7A 1JHXA 2WU4A 1H3NA 1I0ZA 3C1TA 4I3HA 4R2HA 1AKVA 2O8FB 2FAXA 3SZMA 1Q0QA 3R9KA 3DPUA 5F5NA 4C4AA 1OF1A 3PLRA 3WB1A 1GUBA 1G8AA 2R2AA 1FFEA 4KLRA 4BEJA 2JJ2A 1UQTA 4WK4B 3GUZA 5CVDA 1P33A 1XCGB 2BGJA 1FFSA 2LVBA 2CFRA 3M34A 4GYKA 5SZIA 4A0HA 2MT9A 4R54A 3WYAA 3H11B 3BJMA 4ZPJA 1JRLA 5IZ4A 2Y4OA 3GXBA 1D0VA 1U7HA 4EGAA 2O2ZA 4DV7B 4NNOA 5KTNA 3Q3VA 4CG0A 1TTTA 5J40A 1CS0B 3OE7A 3RJ5A 3VTZA 5DXAA 4REQB 3REGA 1V7PC 5CCXA 4BVEA 4N4AA 3O4JA 2VTBB 1T4MA 2AEMA 4GNKA 5F23A 2Q0XA 4S2UA 3ZWXA 4A6PA 1ZVVA 3WMEA 2M6KA 2P9CA 3FNGA 1E64A 3PRHA 4ENUA 3N3BC 1VLMA 3V55A 1Q0SA 1TKBA 1J99A 5D8DA 1HI9A 2AVNA 2O2HA 2I66A 4UE3S 5CCEA 1A9XB 2YWJA 1OWOA 1P5HA 1XPRA 3NC4A 5K3FA 4DG9A 2DBRA 2Z9BA 1X1SA 1BMFD 3KU4A 1WV0A 5CA1A 1EX9A 4I36A 1PQWA 3R3XA 3SK0A 1DKQA 3ANMA 3C3XA 2FVXA 1PK9A 4MAMA 2B5VA 1NF2A 1NL3A 3QHPA 4QZVA 3ECSA 3NT4A 1CFZA 2Z5GA 4I08A 4QPCA 1QMPA 5E6UA 1D2RA 5F7JA 5CFNA 1DG9A 4QXRA 1UBKS 1BKSB 3EZ7A 1OQAA 3OFJA 3WNVA 1R0LA 5A03A 5B4VA 2BM9A 1J09A 4H3SA 3VR6D 4X91A 3CVJA 3JZAA 2BKLA 4IPTA 2GVNA 1HG0A 1NVAA 2QQFA 3ADBA 2YICA 4TPKA 3EH1A 3M33A 3ZH9B 1AGRA 1LDBA 4BX3A 1JJ7A 4R01A 3K16A 1X7ZB 3G59A 4RL6A 2CKMA 2V4MA 5TMEA 1CDOA 1WUYA 2GBIA 2WIDA 3E58A 3L8YA 1PR0A 3R20A 4FONA 4BJ5A 5JH7B 1OLUB 1RPTA 5C53B 1NI5A 4PONA 4J0KA 5JJLA 5EVCA 1JS1X 5EQTA 1R8XA 4Y2RA 4CV0A 3PFFA 1ORTA 2YMQA 1VPLA 3IYLW 4HWTA 4OTZA 2IHJA 1PJTA 1L3CA 4ND5A 4RM3A 3TGWA 2WM8A 1Z5GA 3HR8A 4GXTA 3B9PA 1C8BA 4FCVA 3I6ZA 1ECLA 1Z6ZA 2WD7A 2XB8A 1D9XA 2ZWAA 4JLMA 4LZZA 1T2VA 3SKVA 5ICCA 2Q3BA 3BIXA 1VG0B 1ESDA 2QNIA 4L3WA 3WGKA 2F1IA 2JLXA 2HD4A 2DUMA 4POAA 4Q48A 4V0SA 2EKZA 4O5AA 4D44A 4RD1A 1ZH2A 2ZRLA 3AEXA 3K5WA 4Q00A 1G5IA 2Z04A 5D6NA 1YHNA 2AF4C 1K8YB 3UB2A 3LDHA 3ENQA 5IZCA 1KR5A 4RSGA 4J1TC 4EF4A 5JMWA 1AKEA 4ROTA 1JXAA 1NKSA 3R0VA 1TZMA 3SQNA 5L51A 3U7JA 4ND8A 2KHZA 3H86A 1Z0SA 4D4LA 4L3VA 1QR2A 4RF5A 5CK5A 5LOVB 2Q6TA 1U0RA 3IR7A 4G85A 1TX4B 5AI9A 1N1DA 3VR2D 3ETNA 3KQVA 2PR7A 2YIMA 2ZXFA 1KI8A 1KDVA 3ORQA 1QF7A 2OZVA 2OGSA 4KN5A 3ABRB 5L3ZA 2VQFB 1Q12A 3IRUA 2D0IA 1DP4A 4PG7A 3WSTA 1C7QA 1TLTA 4OQXA 4L51A 2IZ6A 2QX7A 3RM3A 4AVYA 2IHNA 2NADA 2VEDA 4BP1A 1KARA 2Y0DA 5A4AA 3BUSA 3FVRA 1Q1GA 3Q3IA 3N2YA 3RSOA 3AP2A 2MSDB 5K8IA 4W9MC 2DPLA 2BUAA 1O9BA 1IE3A 3D4LA 1G3RA 4DILA 1OAAA 4PGFA 1VYUA 5M5BA 3DDWA 1JQKA 4X8OA 4UTZA 2XXAA 1EBUA 2FZCA 1LRKA 4BVAA 4XDGA 1YJQA 3DVAA 4S05A 2Y77A 1BQEA 2D7DA 1T43A 2PMEA 3GAFA 4KXFB 3ZTTA 5BV0A 3OLXA 2YZ7A 1HDIA 2HMAA 5AM2A 1O2DA 2Q6LA 4C3OB 2HUNA 2EBFX 2CHFA 1GL3A 1XKLA 5ICFA 4OJMX 2QRVA 4DANA 1G41A 2AW5A 3P2MA 4OHVA 1G5TA 4OB7A 3TN7A 2IYRA 5HTKA 1OUMA 4XVCA 1HK7A 2Q5FA 5GONB 1VZ3A 2G8LA 2BF4A 1DDIA 3AESB 2OHIA 2HPHA 4ZDIA 4NMLA 2GEBA 3G8DA 3ZVNA 1OB2A 1O0BA 3MJHA 4KGDA 1ZWKA 1VHWA 2LR0A 3DOFA 4RYDA 2XZOA 3OHMA 2F8SA 2X5XA 2IE0A 3CNHA 3A3YA 5E7MA 1C8KA 2JLSA 4HX2A 3TM4A 1JQLB 1A8QA 2SKDA 4TMXA 3ACDA 3B5JA 1ADFA 1OKKD 5D3QA 5L95A 5JSHA 3IQIX 3V5NA 1ZK0A 1K92A 1G8HA 4PS0A 4RBNA 5BSHA 4NARA 4O3MA 2YWXA 1XZQA 1NOKA 4WH0A 2DVMA 3Q7SA 1JHZA 2B36A 3LUDA 1I1OA 4KCGA 3U7QB 2V7PA 3R6GA 4IVRA 3LKDA 3WMXA 4QVKA 4EGFA 1TYBE 1EAMA 2QUHA 1MXHA 3QUTA 3A1SA 3WWOA 6REQA 1GIAA 5HSGA 3ZGVA 5FBVB 4ZZIA 2P2NA 4HHEA 1NOIA 4CQMD 1G0NA 2VWGA 2GVDC 2P8SA 3GEBA 3JS5A 4K3UA 5FLEX 2H7CA 4CF7A 3E8SA 1WLSA 2X14A 2NO9A 1C1XA 4DLSA 4RJKA 2FFJA 3TPCA 5HKLA 5LP6C 2JZOA 3LXUX 1L2TA 1AKTA 3UHFA 1FZTA 1ODLA 2ID8A 2CNNA 3RBAA 1B16A 4QYXA 3ITDA 1SVIA 2RH9B 4IDAA 2HXGA 4W4TA 2GAFA 4RK0A 3TZHA 2GQ0A 2I7VA 3EVGA 3BJIC 2D3TA 3KJNA 1VE6A 1LZLA 1EUDB 5T4EA 4QM6A 4KWCA 3TTTA 4E3WA 1F4PA 1WOYA 2X1LA 4HNSA 4ZRDA 3ST7A 2WWWA 3WZ2A 1GGKA 2VK8A 4JSRA 2Y71A 1HE2A 1PO7A 1J49A 2HMTA 2O2SA 2PUTA 4JHXA 3WDLA 3SEFA 1PK8A 1T0PA 3FGPA 3HBLA 2FKAA 1ID8A 1JW9B 2FF5A 3D02A 1VKHA 4PG4A 5FEUA 4ABYA 2ZJFA 2HLDD 2ZR0A 4KR2A 1VL8A 4OMUA 2WNHA 3TZQA 3B1VA 4EL5A 5HJ7A 4O4IA 2XCSB 2QW0X 3V46A 4OBEA 4ITRC 3CNEA 2AZMA 1X6VA 3L6DA 4B40A 2VPXA 3TLEA 4AKHA 3EYWA 4FHZA 4IL5A 1J0AA 2FX5A 4L5CA 5DP1A 4YECA 5FNVA 3TZBA 3BSYA 4EI9A 1XZCA 5FQNA 3CNQS 3VKUA 4IEIA 4ASUD 4FWTA 1GUDA 4I9HA 1M2VB 3RRNA 2DULA 5LMNB 2BDEA 1U3CA 2X9GA 4KZKA 3GZNB 4DL9A 2VP5A 2DBQA 4B8ZA 1P4GA 2N1BA 3AI2A 4ENSA 2JAHA 4IS3A 3O8QA 4M8NE 2REOA 4ZDWA 3S2ZA 3GP3A 2GN4A 3PYLA 5EA2A 1B6RA 1OTYA 1Y33E 1Z82A 2F9FA 3ZD8A 2JLWA 3U3OA 1EVQA 2WIGA 1TAUA 2IYAA 4HDQB 4QQRA 4DMRA 2F1RA 1M1YB 2CLFB 4N65A 3KV1A 4P9NA 3NALA 1J0EA 3E48A 3R9XA 5JS8A 4KUGA 4YNBA 2BIFA 3KQLA 3LBYA 3G82C 1ZK4A 1US8B 2EC5A 2PZMA 5CEJA 3WB2A 3DO8A 2PS1A 1U3UA 4MWDA 3MERA 1N8SA 3E8MA 3AUJB 1JR3A 1MG5A 3N2IA 4IZHA 1CULC 3AR7A 4XVHA 3JQQA 3PC4A 1IUKA 3FLAA 1XP5A 1EFUA 3TAXA 1T91A 5DN6D 5BW6B 2AFIB 5EWLA 3UWKA 3RT1A 2NVWA 4ARIA 4AP9A 1TKCA 5TC4A 4KQ2A 2AKAB 4JK3A 1JDNA 3AFMA 4N5MA 3OFVA 2I7TA 1TUEA 4LXTA 1IL0A 3NM5A 2IA5A 4BOYA 2JBAB 3IOBA 4DBLC 1SB9A 2B21A 2OCPA 3LRTA 5DTRA 1IBKB 3A10A 4FDLA 3TOCA 1PWYE 1KVQA 4AICA 1WVIA 4DV3B 2VOJA 3D7NA 1WPGA 4RJTA 1P3DA 2G72A 3KALA 2IXAA 2WSSD 4XX0A 4HMQA 1UC5B 3U4QA 1GLNA 1NYLA 1Z2PX 4XD7D 2CJWA 3AQ4A 1IHOA 4PLTA 4G8DA 2F3SA 3O1IC 1DQSA 1XZLA 3B20A 4TYMA 3S0JA 1EX7A 2GN6A 3SLKA 1ENOA 3NHYA 1L4YA 1AB6A 3ICEA 2QZZA 4FFLA 2B98A 3H8WA 2SNIE 3V2IA 1G4UR 3FMPB 2QTLA 1A27A 4RIIA 1QNLA 5L9AA 3QVGA 4MVWA 3TMYA 1RABA 3OAAD 2GT1A 4WLOA 1O57A 2BCJQ 5F3DA 3RUPA 4OLBA 1O94D 2YHBA 1YTUA 3GFBA 4QGFA 1P3Y1 3C6ZA 4ARAA 5KUTA 1LPNA 1E5TA 2AFRA 2NPIA 3Q98A 5CYFA 1QGOA 1KHTA 4BMSA 5LQUA 3RIMA 5DO9A 4JLPA 2EWVA 2ZTLA 3CV3A 3DF7A 3DCJA 4L22A 4IQ4A 1DJNA 1EK6A 2C5LA 2MMGA 2OQIA 3FDIA 3K6SB 4PHHA 2C2OA 1H2BA 4B3JA 3F6CA 2FFHA 2ILVA 4J2OA 4CNBA 4ABTA 4JFAA 4FEEA 3CLTC 2IKSA 5ICEA 1FSGA 2OQ2A 3DOOA 4MRPA 1OYVA 5BVHA 3PQ2A 4FBMA 4ZVLA 1JAHA 2BE7A 2O9JA 1H2RS 1XF9A 1OHHA 2KJQA 3HB9A 4XGKA 3LUHA 3RC1A 1H3EA 3DKPA 3NDJA 4NCNA 3NNNA 4UHJA 3EVAA 2YVAA 4C4ZA 4EL0A 2H8KA 2XUAA 3WTBA 2OO7A 5DVZA 2P75A 4UTVA 4TL6A 2EFCB 3KLPX 3DTYA 4J7XA 1NXTA 4R0NA 3F6PA 1NMYA 3CWQA 4B3XA 2PAAA 3AU8A 5IBPA 3RVBA 2O7VA 4JQCA 1CUZA 5HXAA 2Y68A 3F6EX 4YAKA 3WAJA 1FYXA 1G20B 2GCPA 2XQKA 3IPCA 2P35A 4N03A 4RPGA 1JKXA 3RU7A 4G25A 1XTUA 4DTCA 1YA6A 1KDTA 1E9BA 4TLEA 4ZVKA 3BMQB 2A5LA 4O2BA 1RCTE 4CHGA 1E9DA 4N0DA 3KQWA 5CNKA 5HZKA 1VE7A 3S1AB 2JCVA 2Z6VA 2ZBPA 1NGSA 4RHCA 2ZB3A 1P7PA 3A05A 1VIAA 2SICE 3GJQA 3PPWA 3HWWA 2L42A 4M8KA 4R9NA 4UVIA 4ZQHA 3MIIA 3NCHA 1L4HA 3EH2A 1YK1A 4BGEA 3ZU4A 5G4LA 3FFBA 4REMA 1WO8A 4S35A 3OT4A 2Y0EA 3IV6A 1L7DA 3ZGNA 2IBSA 1GXSB 1SXIA 2HMYB 1TI7A 3H17A 3F98A 3PNQA 3SOZA 2WOOA 1QB8A 3DGFC 3AEKB 1JSXA 1KSFX 3UPDA 3AUKA 3HDHA 4G9GA 4C7JA 2BEVA 1TE2A 2BFFB 4B17A 1APBA 1M8FA 3V00A 3HMQA 2PUVA 2J3IA 1H5QA 1VMEA 3HYLA 4HDMA 5EJMA 1VP3A 4KJXA 2CXTA 5HWSA 4V1CB 1Y9DA 1NMXA 3BAFA 4X93A 1Z5NA 3MJRA 4X1OA 3B36A 1GFWA 1KI6A 3TSYA 3UC9A 4AMVA 4D4MA 1T4CB 4EELA 3FNQA 3G2MA 3Q6NA 4BHTA 2HZBA 4ZKEA 3AHJA 5EGNA 4Y2SA 2C9ZA 4JWKA 2XWQA 1NJ8A 1P1RA 3GNTA 1BAPA 3NPMA 4MR7B 4P6VF 4QE3A 3R3HA 3DMYA 2IZ7A 2WSBA 1S2MA 3BB3A 3HP4A 1NSYA 4EJSC 5K6RA 2PX2A 3OFND 4FXOA 1JYSA 3BWCA 1KEKA 2JVIA 2ZBEA 2HCJB 4TTAA </