3P19A

Improved nadph-dependent blue fluorescent protein
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
239
structure length
239
Chain Sequence
MKKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFDTAITRAEKIYGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVMTIAPSAVKTELLSHTTSQQIKDGYDAWRVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative blue fluorescent protein
publication title Structure of a NADPH-dependent blue fluorescent protein revealed the unique role of Gly176 on the fluorescence enhancement.
pubmed doi rcsb
source organism Vibrio vulnificus
total genus 91
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3p19A00
2P4HX 1N5DA 4XYBA 4Z0TA 1XA0A 1P1KA 4WEQA 4TVOA 4CODB 2ZYGA 5HRUA 5F1OA 3RUCA 3ZH2A 3WSVA 4MKZA 4RZHA 1KY5A 3OM9A 5I7EA 2X23A 5C7IO 3FD8A 4XDZA 5L9AA 1BXZA 2CVOA 1VM6A 3DZFA 2PGDA 2X58A 1Q7CA 3LC7O 5L3ZA 2J3HA 4R54A 3S2IA 4Q3CA 3ICCA 3L6OO 1PTJA 4L74A 4ALKA 5L7WA 5A02A 2QW8A 4IDBA 1VC2A 3LC2O 4BNVA 5A4DA 4WCFB 4AJNA 1YO6A 2XXBA 3RUHA 4QO7A 4PLWA 2BKAA 3I9JA 3ROMA 4UUPA 4KUEA 3O4RA 4GPD1 4X54A 4CUKA 2YDXA 3TZ6A 2GF2A 1GZ4A 1DIRA 2GN4A 3GGPA 1RKXA 3SJUA 3WR5A 7ADHA 2EW2A 4L73A 1LDYA 1HSZA 3CXRA 4YJGA 5G4LA 4CMHA 1HDGO 2Q50A 2JD0A 3CZRA 2NV6A 2VN8A 3DXFA 1E1LA 3TFQA 1YQGA 3JTMA 4MVJE 1VL6A 4O63O 2V6FA 1LLCA 5CDSA 4WK6A 1N7GA 4HNGA 1MX3A 2YV2A 1IZ9A 3EMKA 1JN0A 2JHFA 4JBHA 1ZK1A 3L9XA 3JYQA 5C7OO 1YBVA 3GT0A 1R0LA 3GVXA 2GN6A 5T64A 2HUNA 2A92A 2FHSA 1IB6A 1PWZA 3GGOA 1U4SA 3OEYA 3T7EA 3PYLA 3DHEA 2DKNA 2HK9A 4A2CA 3RBZA 2JHGA 1TLTA 4EEXA 2BFMA 1JA9A 3WNVA 3KV3O 3NJ8A 1C3VA 1XG5A 3FBTA 1W6UA 2VWQA 3Q9UA 4UUMA 4KQWA 3S55A 3AJRA 2WDZA 3AUAA 2X5JO 3IKVA 1AHIA 3MJ4A 2JD1A 4NDNE 3ZHBA 3JQGB 1KC3A 4H7PA 4XYLA 4HWKA 1L7EA 1R4NA 2OP1A 3AI3A 3KLMX 3BMNA 1BG6A 2J3KA 1EE9A 2PD4A 2PV7A 3PJEA 5FYDA 4E6PA 4BGIA 4DIOA 1T4DA 2PY6A 3OMLA 4WE3A 1ZUD1 3DZGA 3D5QA 5A3VA 2EEZA 4B4WA 2HMSA 2JCYA 2OMEA 1E3JA 3BYZA 4FJ2A 5A05A 2IEDA 1I5RA 1LRKA 3AU9A 2O23A 4B8ZA 2XF8A 4XA8A 2LDBA 4Z0PA 5BR7A 3JQ9C 1WZEA 3QHAA 1S6YA 3W8EA 2P9GA 1DOHA 2D4AA 3UCFA 4DQXA 4IDDA 2OP0A 1GZ3A 1HKUA 2W2KA 2C29D 1Z74A 3OJEA 1EVZA 4CMBA 4D46A 4LSMA 1J0XO 4ESOA 4Y6PA 5A9SA 1CIVA 4CL3A 2V6MA 3H65A 3D1LA 4RF5A 2QG4A 4B7CA 1H0KA 1L7DA 4A27A 1K5HA 1PZHA 3BMCA 3UH1A 4ND3A 4YAIA 3E5MA 1H94A 2NM0A 2DBRA 3DAPA 1CWUA 4YRDA 4IUYA 4W82A 1N9GA 4TZKA 3W1VA 3RUIA 4CMKA 2PKQP 3HNPA 1YL7A 3D0OA 3LYLA 3CINA 1PS8A 3WMXA 2OOSA 5TC4A 1GUFA 1GEEA 1V35A 2GSDA 4L75A 3H9GA 4GSLA 3OJ0A 4PLCA 3WGTA 4UEJA 3NTRA 4UEKA 4BV8A 3WICA 3W8DA 5JCJD 1U9JA 4HX5A 3ZWYA 1SO8A 5LDHA 1JDJA 3CMMA 1Y5RA 4HFJA 1QV6A 1ML3A 3JCZA 4YJGB 3ST7A 4DQVA 1F8GA 1TT7A 1P0FA 1XEAA 3KZVA 5LC1A 3AI1A 2AE2A 2XPCA 2VRCA 3PGJA 4PN3A 2VRBA 1AUPA 2GZ2A 3EGOA 2AQ8A 1K6IA 3RFVA 1NHGA 4PZEA 5ENVA 4J91A 3Q9NA 4CLRA 3DQPA 1PJTA 3O38A 4B4VA 1HDOA 1BDMA 1UXJA 4UUOA 4E5YA 2EIHA 1IYZA 3QWHA 4AJPA 4UVIA 4CMEA 3UOGA 1B7GO 2RIRA 3U62A 3DBLB 2X5KO 2D2IA 5F21A 2D3TA 3ANLA 4XYGA 4E4YA 4BV9A 2CDCA 2NADA 2OFPA 1QYCA 5IN4A 1EUZA 4IDAA 4URFA 1ADCA 2C07A 2PD3A 1H6AA 3F46A 2YHIB 5L95A 4PFJA 4OIMA 1XKQA 3F9IA 2Y68A 3FNEA 5DZSA 3JQBC 1VPDA 5ES3A 4CMJA 3N58A 2GRAA 1QR6A 2G5CA 5F1KA 1ID1A 1BVRA 2NTVA 3ADPA 3C1OA 4ZD6A 5JPIA 1ZSYA 4I5FA 2CY0A 3R1IA 3KYDB 3RD5A 3BMOA 2DAPA 1C0IA 1PGOA 2ZCVA 4N54A 3IOYA 3EDMA 4RPGA 1HF3A 3GA0A 3HZZA 4K28A 1MFPA 1TEHA 4Q3BA 4U0KA 1I32A 2FWMX 1C1XB 2Z95A 4J1TA 1DIHA 2ZTUA 1BXKA 2ZB4A 1T24A 4OYRA 5ENDA 3CTMA 4CUJA 2VUUA 4WOJA 2BHLA 3TQHA 2PNFA 3AFMA 3NV9A 3I4FA 1ZSNA 1P1JA 3L6EA 1GPDG 1NNUA 2O3TA 2W2KB 2ZK7A 3COSA 5B4UA 3BTSA 3SC6A 1OC2A 3RUAA 1D1SA 2NSDA 4EI2A 2AQIA 4ILKA 1XDWA 1W4ZA 3OEWA 1T1RA 3TOXA 1I3KA 3MWDB 2ZTMA 5A3JA 2X86A 5G2OA 1TA4A 2EGGA 2O2SA 4BNMA 3DBHB 4CR7A 1Q1NA 1OBFO 3U3XA 4IDEA 3PRJA 4J43A 1BHSA 1X7GA 3LT0A 3DZIA 3UCXA 2R00A 5AQ1A 2NVUB 1X14A 4ZQEA 3JQ8A 4BHTA 1GV1A 1JAXA 2O3JA 2AEJA 2PTGA 2W2LA 1YL5A 4YWJA 1B8PA 3JV7A 4R68A 3Q2KA 4FOSA 5ILGA 1PGJA 1DPGA 3PIDA 3GR6A 4YPOA 3A14A 2QRJA 2C7GA 5DDIP 2RH4A 2YZ7A 2HK8A 4D43A 3WDSA 4YVFA 4LRTB 3RIHA 4KDEA 2EW8A 4M1QA 1QYWA 3F4LA 1FDSA 2DQ4A 3O03A 2WMDA 4GWGA 4IJVA 4FQ8A 4I9NA 2P9CA 1A5ZA 2B69A 2CD9A 3DTYA 5KVSA 4CQLA 1RPNA 3I9NA 3OIFA 3GDFA 4L0QA 1AXGA 1O6ZA 1SZJG 4EDFA 1WAMA 1C1DA 3C1AA 3RI3A 1NVGA 5IDXA 2CSUA 4NU5A 3G1TA 4MO2A 4IZIA 4YTEA 5F3RA 4JBIA 1MV8A 4GGPA 1XLTA 1VRWA 3G79A 3H9EO 5ER9A 2NU7A 2BRUA 2PA3A 2VOEA 1Q0LA 3GC6A 4JXKA 4LW8A 2H6EA 4U6QA 1E6EA 1WDLA 1DIAA 4IJUA 4A26A 4HUJA 4ND4A 5FFFA 1H93A 1H5QA 3HB4X 3ZWBA 1U2DA 3WG9A 1A71A 4CUZA 4CR8A 2X1HA 5JMPA 1H6BA 1K3TA 4AJ4A 5ICMA 3F1LA 4BO7A 2ZTLA 2CFCA 2PZLA 4OXKA 1DO8A 1MA0A 3UFXA 1SAYA 2FSVA 4JK3A 3AM4A 3C7CB 3DC2A 1FK8A 4NBRA 3DR3A 4ID9A 3EW7A 3OICA 2AW5A 3RUEA 6ADHA 4HBGA 1VLLA 1E3SA 1A7KA 3ONDA 4GVXA 4LN1A 4P4NA 1ZNQO 4I1IA 1LSUA 1QLJA 3CE6A 1NPYA 4R4JA 4WLEA 1GYRA 4CMCA 5JDCA 1I10A 1NQAO 5I8ZA 5HS4A 4PLZA 3QSGA 5JBIA 1H6CA 1I24A 5IJZA 4GX5A 1LA2A 3FTPA 2NQ8A 5CP8A 1Z6ZA 4IIUA 3DBVO 2Q1WA 1N7HA 3GNSA 4Z3KA 3PWKA 3LSYA 1HZJA 1Y9EA 3AI2A 1HWYA 1WDMA 5CHEA 4HV4A 2F1KA 2E37A 4K6FA 2IODA 4BIIA 3DO5A 1M66A 2EWMA 1GUZA 2ILTA 5A1TA 4N5NA 2P4QA 2JFGA 1HLDA 2JFHA 1G6KA 4TMFA 1IULA 2DPGA 1SBYA 2OGUA 1LX6A 5JLAA 2EJVA 3JQAB 1FDWA 2B0JA 3OF2A 1EMDA 3V2HA 3IDSA 1P1FA 1ZKMA 4MVJG 2HSDA 3U5TA 2OHXA 2CMDA 2TMGA 3WB9A 2JKVA 4BGEA 2Q4EA 3NT2A 3OIGA 4ALIA 4D0SA 3R0IA 4PLVA 2P5YA 1E6UA 4FFNA 2WTBA 2NNLD 3KLPX 3JYPA 5AOVA 1PU2A 4JCOA 1CETA 1OI7A 2YY7A 1P45A 2PH5A 5FEUA 3M6IA 3DAGA 4JJGA 4MVJP 3ZN2A 3V8BA 3IJRA 1I33A 1ZMOA 4ZQGA 4MPDA 3LQFA 1Y1PA 2X9NA 3GDOA 4LGVA 2NWQA 1IOLA 3QA9A 1SOVA 1WPQA 3GVPA 1I2CA 3NKLA 4E33A 3ZW8A 1Z7BA 3KYBA 1ZJYA 1DFGA 1X1EA 2VHWA 4YJHB 2GLXA 3GVIA 2D59A 4HY3A 4MINA 3EUWA 1KEWA 2GNAA 2G82A 5GZ3A 2VHVA 1MC5A 4QSMA 4WKGA 1VJ1A 1MC4A 4MJLA 4TZTA 1HDRA 1NVTA 1ZK2A 2C82A 3ICPA 3OHSX 3NGLA 3E48A 3OQBA 5KNLA 3TL3A 1C0KA 3GRKA 1IE3A 1MLDA 1I2BA 3C3XA 4L76A 2O4CA 4JLWA 1ZJZA 3HDYA 3K92A 3VC7A 5T8KA 3WGZA 5CEFA 2PR2A 3LZ6A 2FZWA 3KSUA 4GLOA 3WGOA 4LK3A 1T2AA 2C2YA 3MTJA 5L53A 4PLFA 4NJOA 4G5HA 1F8FA 1LU9A 4YDRA 4AJLA 3MZ0A 4CM4A 1ADBA 3ZV6A 1N1EA 1T2DA 3HDJA 2AG5A 2WM3A 4IXWA 1EFKA 4C7KA 4TRMA 4Z3DA 4KMSA 3WGQA 4PVDA 1ZH8A 3PHLA 3M2PA 2VYVA 2YUTA 1ADGA 1GV0A 4EBFA 1IPFA 1D4FA 1G1AA 1XSEA 3AOGA 1B16A 3KB6A 4YAJA 4FFOA 1GD1O 4L8VA 2GPTA 2GCGA 3DEYX 1PR9A 3L4BC 3G1UA 1RM0A 3GZ4A 1HYEA 3RBVA 1ZEJA 4WLFA 3Q3CA 4RVUA 3F4BA 1ISMA 4YRAA 2O7QA 1KEUA 2AEFA 1M67A 2C0CA 3RJ9A 5IZ4A 5BSGA 5KCZA 3GUYA 2EV9A 1Y9AA 3D3WA 3LDHA 1DRVA 3CEAA 5GMOA 2F00A 1DJNA 5F1PA 2J5RA 3O9ZA 3JQ6A 4GMGA 4O1MA 1MG0A 5TF4A 3SLKA 3ENNA 1DLJA 1WZIA 3MOIA 1LTHR 2Y93A 4GI2A 5COQA 5JCXA 3GPIA 3CZMA 3I23A 4H3VA 5I7FA 3E8XA 3IC5A 2VWHA 4NBWA 2YDYA 3UW3A 1Y6JA 4MP3A 5DOZA 3WQQA 5GZ6A 3KETA 3SBOA 4R9RA 4GX1A 1X13A 4JQCA 3B70A 4ZQBA 3V1UA 4BL5A 3PGXA 4RCVA 1FJHA 5HS6A 1ULSA 1PGNA 1PZGA 3K73O 4YT4A 1I3LA 1F12A 4D44A 4ZHSA 1CQJA 2HK7A 5DP1A 2YV1A 3B1FA 4CM1A 3NTQA 2CF5A 2I65A 4E5PA 4FC6A 1QG6A 5TIIA 2VNSA 3AM3A 4D0RA 1J5PA 2X0RA 3GN2A 1UDAA 3GFGA 1WLYA 3WTCA 4RLSA 4L4SA 2WD8A 3HN7A 5A06A 4PZDA 2QRLA 3NGXA 4XQCA 3OQ1A 4PLYA 3ZDFA 2ZJ1A 3FNHA 4RDIA 4DXHA 4CM7A 4BKUA 1UH5A 4UVDA 1NWHA 5EN4A 3H6KA 4FS3A 4JROA 3RCBA 2E48A 2PGJA 1HDZA 4YYZA 4PLGA 4FN4A 4RVFA 4BNFA 4YA6A 3F5SA 3I6IA 2PZJA 1JWAB 3JYOA 4AG3A 4J16A 2ZQZA 1XYGA 3W4IA 1L1FA 4IQ0A 4KDFA 1HE3A 1O5IA 3ULKA 4EJ6A 5EESA 2RAFA 5JS6A 2V7PA 4R16A 5COBA 3INTA 2LDXA 3ZU3A 1HETA 1IUKA 3VAZA 2VT2A 4R3NA 4ZQFA 2D8AA 4KWHA 2GR9A 3I9KA 1I01A 4CV0A 2O48X 1VL8A 5T5QA 1YOVB 1OZAA 4CMAA 5CEEA 3PFFA 4RORA 2BH9A 3KTDA 1SEVA 2I9PA 4XB1A 2X8LA 4M54A 3C85A 2GYYA 5JFOA 4GX2A 2DT5A 2X0IA 3W4JA 3H7AA 4AJKA 2B4TO 1P0CA 4FGWA 3X2EA 2FPPA 2J8ZA 4H15A 3RAJA 3ROKA 3W6ZA 3E6AA 3I9MA 1CQIA 3HUDA 1E7WA 5FI3A 2QYSA 3FN4A 1GFSA 5JO9A 2VWGA 5COAA 2GUGA 1KERA 1DIGA 4J1SA 3LK7A 1AGNA 3OJLA 1NYTA 1MG5A 1UZLA 1WW8A 1XQ6A 4YJFA 3QVWA 2X0JA 3H3FA 4MVJF 1T25A 1YH3A 3S2GA 3I9LA 4DYVA 3ROQA 1UP6A 3H2SA 3TDKA 4UVHA 1YB5A 2FMUA 3GY0A 3GDGA 2GGSA 2PLAA 1TB4A 1E3WA 2BFOA 4F46A 1HXHA 3D3WB 1U28A 3PZRA 3LU1A 3DAFA 2O3QA 3ZWOA 1V3VA 1LXCA 3ADOA 5AXAA 4BGVA 3QVOA 2AXQA 1ISHA 4GWKA 2I99A 4KZPA 3RUDA 2FR0A 4CM9A 2GN9A 5TLSA 1QYDA 1ISJA 3WIDA 3NTOA 4DPMA 3D4NA 1X0XA 4IGEA 1JQBA 3DZJA 3IAHA 3SEFA 3FSRA 3GEGA 5G4KA 4GH5A 3TL2A 4F6CA 2G0TA 2O3RA 1O0SA 3PXXA 3GOHA 1VSUA 5CPFA 5THQA 3CUKA 2IYOA 3F1KA 1LSSA 1FDUA 1KIFA 1Z45A 2BLLA 3WQSB 1ONNA 5AXCA 1KEVA 2GDZA 3LC1O 5FWNA 1M6WA 3GMSA 1NAHA 1LQUA 5DCWA 4DQUA 5IDQA 3E03A 3WXBA 5IAAA 3ETDA 4JJIA 1PZFA 1PQUA 1DB3A 2IEBA 2W8ZA 4RGBA 1SOWA 1EVJA 1R4MB 3VPFA 4FW8A 2ZB7A 2V6GA 3VZSA 2UYYA 3I1JA 4J3FA 3OSUA 1FDTA 2I67A 4PLPA 5BT9A 3ZHYA 5EERA 4J4BA 1Z75A 1UJMA 4XIJA 5AVOA 1B3RA 2H63A 3OETA 3KOUA 3QLJA 1DC5A 1XU9A 3GGGA 4OSOA 3RWBA 1DAOA 5I9LA 4J0EA 4RJTA 1YVEI 3NX4A 4LSWA 3LVFO 9LDTA 1NR1A 1Y7TA 1HZZA 4HKTA 4O59O 1KVRA 1HDYA 3NDRA 3IMFA 4AJ2A 3BTOA 4XDYA 3WFJA 4MIOA 4YQZA 1W73A 3B1JA 4CM3A 2GZ1A 3HDHA 3VKUA 4CJXA 4OL9A 3UKOA 4J4TA 3A9WA 4EUHA 1JW9B 1PEDA 1U2GA 4DMLA 5L45A 3WTBA 9LDBA 1JU9A 3ASUA 1E77A 3HE3A 2VYNA 4CMEC 3P19A 3F47A 5AXDA 2ZYAA 4FR5A 2B5VA 1EFLA 2VNAA 3NJ4A 3JQAD 3H5AA 3ZGYA 4II3A 4YJFB 1CDOA 5B1YA 5TJ9A 1A9ZA 2W4QA 1DC4A 1LRLA 1U4OA 3AOEA 3PLNA 4TWRA 4R01A 2VCYA 1U3VA 4D79A 1VJ0A 4AFNA 5TRTA 1P44A 4ALMA 4DC1A 2WE8A 4CLDA 1D3AA 3BA1A 3PVZA 3KBOA 1B2LA 1EVYA 2DFDA 3ZV5A 4LMPA 4J4HA 3SJ7A 3PPIA 4BNXA 5DULA 5KIAA 2HO5A 4TRNA 2D0IA 1U8XX 5B12A 4KQXA 4Y6SA 1LSJA 1A27A 1GQ2A 3GF4A 1U8FO 4AJEA 4GSKA 5KJFA 3OH8A 3H2ZA 3JD1A 5DF1A 4IBOA 5A5FA 1BVUA 4B7XA 3L9WA 3KVOA 3UF0A 4PRKA 1YS4A 5AXBA 3WGGA 1NHWA 2E82A 3EYWA 2Y0DA 4NK5A 3VZRA 3U4DA 2OL4A 1KVUA 4OQYA 2JL1A 1TT5A 4F3YA 2V6BA 1QRRA 4P38A 5IXYA 4XQEA 5IN5A 4CR6A 3TZKA 1PS0A 3P2OA 5BSFA 3HADA 3FWNA 4CLOA 1XIVA 3PYXA 5F5LA 2BGLA 3MJTA 3IS3A 3QV1A 4QFDA 2AEMA 4CV1A 4WEOA 1UZMA 4MVJM 2C20A 3IJPA 1PS9A 3DZBA 3HHPA 1EDOA 3WIEA 2NTNA 3FNGA 1YWGO 2R00C 4J7UA 2X6TA 3RUFA 1QSGA 3Q11A 2NVBA 1JKJA 3KRTA 2WD7A 3P2YA 3ZU2A 4QO8A 4Z6KA 4EZBA 1R4NB 1I0ZA 5EJ2A 4BMNA 5IXSA 5DCUA 3BMNB 1VSVA 5ER6A 2RHCA 4TQGA 3DZHA 2GZ3A 5B37A 1R12A 1HDXA 4ALNA 4HFRA 3RU7A 3IL2A 5IF3A 4MKXA 4BO8A 1SCUA 5L7YA 3ZI0A 3C1TA 1Y8QA 3K2EA 5EPOA 3PHJA 1DRUA 4NK4A 5KTKA 2RHRA 2UAGA 5T67A 4KUHA 1AXEA 1U5AA 2I66A 2CUKA 1R6DA 3OFSA 1JWBB 2Z1MA 5G0TA 1GQYA 4E5KA 5C37A 3JQEA 2R2GA 2O50A 4NNJA 5A9SB 1VKOA 1ARZA 5L51A 2EKLA 4QEDA 1E1MA 2CDBA 1YJ8A 3A1NA 2I76A 4I9UA 1UDCA 3VH2A 3BMCB 5K9ZA 4CV2A 1Q0HA 4U6SA 4B4OA 1ZMTA 3AY3A 4S3MA 2UV8A 1N9GB 2VTDA 2DTXA 1UXHA 4J0FA 1DXYA 4PG6A 4XR9A 5H83A 4YT2A 4WCDA 3W4KA 3LT1A 4BO4A 3KSZO 1VE9A 2YFHA 4MIYA 3BMQA 1PGQA 2P91A 4ZRNA 5CAEA 1X7HA 3EVTA 3F3SA 5A9TA 3GEMA 2IZZA 4C4OA 4W6ZA 2B36A 1PGPA 2J5QA 5A5EA 1W8DA 4Y9DA 1O89A 1R66A 4J7XA 3A4VA 4XQ9A 1UUFA 3DMTA 4HXYA 1ZO8A 1A4IA 4TRJA 4E2YA 4KWIA 3E82A 4A5OA 2FSSA 2QYTA 5G0UA 4TRRA 3ZWVA 2XXJA 1E5LA 1GDHA 1H2HA 3DFUA 3WGYA 1YBAA 1IPEA 4CLRB 3FWZA 1VI2A 1U3UA 3FPLA 4L4XA 5IZCA 2RBEA 3ZNQA 3L07A 4XIYA 3AW9A 4J1NA 5L7TA 4N18A 5GZ1A 4Y67A 1EK6A 4NPCA 5IDWA 1XU7A 1KOLA 1V6AA 2HU2A 1KVSA 1PL6A 5HM8A 2I3AA 3ANNA 5JCJA 1UP7A 2HAEA 3M1LA 4RVSA 1X1TA 2AHRA 1RJWA 2AG8A 4Z0HO 4OOFA 2CZCA 1J49A 4HP8A 4YBZA 2NU8A 3ITKA 3GNQA 3KUXA 4XRGA 2HJSA 1ZEMA 4DUPA 1ADFA 3WLFA 5JXWA 3RFTA 1HE2A 4GX0A 3VPSA 1YDEA 4OXYA 2DVMA 1HLPA 3M1AA 2DU8A 4G2NA 3B1KA 4IDFA 4R3WA 4FJ1A 4PZCA 5TQVA 1B0AA 3GMDA 3D7LA 3KHUA 3K9QO 4D3FA 4MDHA 1T1SA 2ZQYA 3JD3A 3N7UA 1E3LA 1SC6A 3PJDA 3BMOB 4OHUA 3LF1A 5KVVA 4ALJA 5KKCA 2WEKA 1MXHA 3GZNA 2QZ9A 5JO0A 3WNQA 1I2ZA 1E6WA 1C14A 1GCUA 2Y0CA 1E3IA 3QWBA 2PWZA 3RQSA 3OP4A 1LDEA 2VZ0A 2EKQA 3OIDA 4JX8A 2UVDA 1YDWA 3R3JA 4NFYA 3OA0A 1VKNA 4B79A 1XHLA 3O8QA 2X4GA 3W8FA 3FPCA 1LEHA 4U8GA 1EUCA 4NJMA 4D45A 3EVNA 4AL4A 1DRWA 1PJCA 3G17A 1P1IA 4OGWA 4KOAA 3QRWA 2UUOA 3H9QA 4MIEA 4ZQHA 2VOJA 4MVJA 1H6DA 5I7VA 4YAEA 4MP8A 1KVTA 1ISFA 1SMKA 3C8MA 4JGBA 4CMGA 3ITDA 5J23A 4XEHA 4YB8A 3DBRA 3WFIA 1GTMA 1Y81A 3JQ8B 3EZYA 5JAQA 3I6QA 1HYGA 4IZHA 1HL3A 4WJZA 2H9IA 4JBGA 1BXGA 4F6LA 1DC6A 2O3SA 2Q3EA 1DEHA 2AQHA 1K6JA 1U1IA 4CM5A 3PYMA 4E3ZA 2W98A 2Y1FA 3ZNPA 1KVQA 1PJQA 5HA5A 3ZWAA 4BNIA 2NU9A 4BO6A 5JDIA 5T8KC 1ENYA 5IFLA 1HSOA 3Q6IA 2JAHA 3CKYA 4DMMA 1XQ1A 3U0BA 1PIWA 2NTJA 3OBBA 2A35A 3NRCA 4J9UE 1EEHA 4JNKA 3GQVA 3I83A 5LCXA 4CQLB 2OO5A 2O3UA 3VPGA 3S8MA 3QWFA 2FR1A 3FRJA 1CJCA 2QX7A 1C1DB 4LVCA 5GY7A 3C7DB 1FDVA 3PP8A 1LC0A 3QJ5A 4YT8A 2DLDA 4LVUA 3N74A 3HFGA 4WGGA 3IIEA 3WYBA 4E13A 4BO1A 4U7WA 4ITUA 1LDMA 1QP8A 4II2A 2B83A 4RF4A 3AY6A 5ITWA 4DLLA 3DOCA 4O5OA 3DHNA 4XJTA 4FBGA 1Q0QA 4PLHA 4BNUA 3GVCA 2WJPA 1U3WA 1ZXLA 2EF1A 1MUUA 1YJQA 2J5KA 1B14A 3K30A 2CVZA 3VDRA 3KYCA 4Q3EA 4W99A 1YRLA 1XELA 4ONEA 3H3JA 1XWFA 2O4UX 3VZPA 4BOYA 5B4TA 3QIVA 4R1NA 3WBBA 3JQFA 5K0ZA 4GVLA 4Y8VA 4ZGWA 2HMVA 1MXFA 2OZPA 1HTBA 4FB5A 1IL0A 3C7AA 1C0LA 3L77A 1U7TA 2FN7A 3WSWA 4BO9A 4DVJA 3FNFA 4TROA 4E2XA 2QIOA 1ISGA 3EHEA 4YXFA 1JAYA 4H16A 2VZ9A 4W9NA 4XGIA 2EP7A 1YL6A 3PDUA 3PHGA 1ZCJA 4R1UA 1LC3A 3I3OA 4CMIA 1LNQA 3PFWO 3S2FA 5IG2A 1K6XA 3TSCA 1QV7A 4M89A 1CERA 3MEQA 3TF5A 5DN9A 1X15A 5CFZA 5KOIA 3WBFA 4IY1A 5AYVA 4IGFA 3TN7A 4XWYA 3SX2A 1GQQA 2EJWA 4WNCA 4GQAA 5EL0A 4DC0A 3U49A 1P33A 1PJ4A 1DDOA 1YE3A 3VVCA 5JY1A 1CYDA 3G49A 4NFSA 2POQX 3VHRA 4BQRA 4CM9D 3UCEA 4RVDA 3WJ7A 2EG9A 4BS9A 4LRSB 2TMDA 3H4VA 3WGIA 1XCBA 3U9LA 1GY8A 3EZLA 2JD2A 2EXXA 1B3BA 2Q46A 3MTGA 1ISIA 1M6HA 1P1HA 4WCFA 3UICA 3PWZA 3UN1A 3INGA 3AM5A 4XZ3A 5JY6A 3RU9A 1PZEA 4A0SA 1RWBA 5FI5A 4QX6A 3FR7A 2I5PO 3KO8A 2NUAA 2E49A 4RPJA 4R41A 3VOSA 4YRBA 2EERA 4YR9A 1LBEA 5BNFA 4EW6A 4OOEA 2VHYA 5TS3A 4BKRA 1FXSA 3UUWA 3AK4A 4KUGA 5TNXA 3PI7A 2DBQA 3QE3A 1EQ2A 1RM4A 3IUPA 3WGHA 1U5CA 5K6AA 3GG2A 3MOGA 5DNAA 1VJTA 4XRRA 1CEQA 1LLDA 1Y8RA 2X22A 4QECA 1BWSA 2B4QA 4WNIA 4U0JA 3V5NA 1QYXA 5ICSA 3NT4A 4BUCA 4RQTA 5G0WA 1LLQA 3GHHA 4QT0A 1PX0A 2YFQA 4EJ0A 4CL8A 1NTOA 3KYCB 1UAYA 4ZU3A 2B35A 2IXBA 4GKVA 3T4XA 3I52A 3VDQA 1ZK4A 4XYEA 1YKFA 2DBZA 1Y5MA 3DHYA 3VH1A 4EUFA 1GL3A 5U9CA 1B8VA 2VT3A 3BIOA 1NBOA 3E9NA 3VZQA 5JW6A 4DGSA 2EGHA 2HQ1A 4MP6A 1NQTA 4J7CA 3RC2A 4G81A 1EDZA 4CM4B 4Y98A 1UP4A 1NQ5A 3PHHA 4ZICA 1YB1A 1GPJA 1N2SA 3WYEA 3RASA 4I08A 2VYND 4KP7A 2DUWA 3HSKA 3CH6A 1DJQA 3HG7A 4E32A 4O0LA 3OA2A 1EK5A 1GUYA 3BHMA 3HN2A 3WOHA 4YAKA 4PLTA 4EUEA 4CMIB 1DBVO 1I8TA 2D5AA 3E9QA 4TSKA 5JC1A 2I3GA 3UGKA 1ZXBA 1NP3A 3D5TA 4IXTA 1HYHA 1EBFA 1ZK3A 3GH3A 1QORA 1N92A 3BXXA 1EBUA 2BI8A 1ZW1A 2BD0A 2PKRA 3GAZA 3MJEA 1ZFNA 4J9VA 4P4GA 3ENKA 4WLUA 4OJNA 2Y67A 3K96A 1UZNA 3ZWPA 1NVMB 1OC4A 2NACA 2YQ5A 3ZHXA 1YB4A 4TKLA 2NLOA 3AU8A 3F6YA 2ZKLA 4RV9A 1E7YA 5LDGA 3ZHZA 5CPBA 4E12A 4GMFA 5EIOA 3OJOA 1A7AA 1K0UA 2VUTA 1LDNA 3SXPA 1BW9A 1LUAA 4BNNA 5CDUA 1EVIA 4XKJA 2AA3A 3EAGA 3UAGA 4ZJUA 1KC1A 1K89A 2VRCD 2ZB3A 2Q99A 4BKQA 1VL0A 1YQDA 4RDHA 4K9DA 1MP0A 3STHA 4QTZA 3ZWMA 5CG1A 5JMWA 4OSPA 2CF6A 2YJZA 4JN6B 4Q3DA 4EGFA 4HNHA 3A28A 1WXDA 1E7RA 3JD0A 4MKRA 4E31A 3ONFA 1NWCA 4LCEA 2H1SA 2ZIZA 3QWIA 1B15A 1FMCA 3HJAA 3UXYA 3D4PA 3RVDA 3LLVA 1PQPA 2GD1O 1GAEO 5A9RA 3GLQA 3PWSA 4LISA 5G0VA 3ZU4A 1SNYA 4B8WA 3C24A 4Z9YA 2Q2QA 4AJIA 3TFOA 4G65A 4P4LA 2C5EA 1PSDA 2B4RO 3ABIA 3TRIA 4XQGA 4ZVVA 3TZQA 2FPIA 1Y8RB 3F5QA 4XR4A 4B3IA 1D7OA 2PGLA 3AOEC 4AVYA 4BNKA 4IDGA 2WYUA 2BFPA 5KJ6A 3DBLA 3K8ZA 4GKBA 4W7HA 1IHXA 1YQXA 1ENZA 1KYQA 1A4UA 3GPDG 3IP3A 2C2XA 1DFIA 1NM5A 1V3UA 3B20A 3DONA 4DBVO 4OKNA 2DFVA 2AE1A 1G0NA 4XYMA 4P22A 1QXSA 1PJLA 3LF2A 4FDAA 1RYEA 2YHIA 3R6DA 1R0SA 2I6TA 2YQ4A 4PCVA 2Y0EA 2VQ3A 4W7IA 1E7QA 3HB5X 4AJOA 4IJKA 2G76A 4Z9FA 3QWAA 2FR8A 2G17A 3PQEA 2P2SA 5JE8A 2O7SA 3AUSA 2Y66A 1S7CA 3KYDA 1Z82A 3ZV3A 4W4TA 4E2WA 2HDHA 4IJWA 2X7HA 1MB4A 1Z7EA 2QZZA 3RSHA 4I8XA 3NYWA 1C1XA 2YHUA 3KEOA 1I36A 4XD2A 4BNZA 1V3TA 4CQMA 4PG4A 3JYNA 2VHXA 4A73A 2HRBA 1C0PA 1MFZA 2NQTA 1JTVA 4QFCA 1UXKA 3EY4A 3RFXA 2GASA 1ONPA 2CDAA 3KXDA 2PKQO 4UVGA 2W2LD 4B7UA 4E5MA 3QW2A 5HBRA 4BNWA 3RC9A 2Y1GA 3CSDA 2FPGA 4RZIA 3DDNA 1J4AA 5HWSA 1E3WB 3P5SA 4N5LA 2YYYA 1O95A 3PJGA 4BQPA 4GL4A 1BGVA 4GLLA 1ONOA 3DBHA 3DTTA 3VPHA 1HEUA 1Q7GA 1QKIA 3CMCO 1F0YA 3DWFA 4L4RA 4B4UA 3KEQA 1P3DA 3GK3A 3VH3A 1YONA 1BW9B 2NVUA 4M49A 2VHZA 1TI7A 5ILOA 2ZB8A 3HDQA 4NH4A 2BFAA 4R5MA 5A04A 1PWXA 2C54A 3WYCA 3K6JA 3LT2A 3ETEA 4XCVA 3VTFA 1GYQA 3DMYA 4FD3A 4DWVA 5G4KB 4NG5A 1PJ3A 5JYDA 2R6JA 4CPDA 4WLOA 2OORA 4EJMA 4WLVA 3D64A 2IZ1A 3GVHA 3TWOA 3GN1A 1O8CA 1I3NA 2Z1NA 3JQ9A 3WLEA 4JIGA 2OUIA 3X2FA 1ZIDA 5TT1A 2DPHA 4XJSA 2ZJ0A 3EK2A 4K1LA 4YT5A 1PL8A 1SB8A 2YW9A 1OFGA 1M76A 4MOWA 3TNLA 3WJAA 4OH1A 2J6IA 4TKMA 1BTOA 3QP9A 3ZCXA 4D7AA 2GERA 1LI4A 1J6UA 1NXQA 1DFHA 1UAGA 3RBXA 3GEDA 3CPSA 1P1RA 3K2BA 4I9HA 4PG5A 4QQRA 5ITVA 2BF7A 4J2OA 3O26A 4XX0A 4DTIA 5JYEA 4YJDA 1YGYA 4M86A 4YCAA 1LDBA 5B4VA 1QLHA 1KY4A 2EP5A 3UHAA 1G0OA 4FC7A 3FBGA 3WS7A 5DOVA 4IMPA 4UAGA 3FF4A 3T4EA 3FR8A 1UXIA 3LLSA 4WASA 4CM8A 4PG7A 4FIZA 4DLAA 1ZVMA 3WMWA 4YACA 3DMTC 1F17A 3PLRA 3E5RA 4B3HA 4IS2A 5TJHA 3QVXA 1IZ0A 1GCOA 4D41A 3BZUA 1P9LA 1O94A 5TSDA 1WDKA 2JCXA 4DREA 3QQPA 1RM5A 3GG9A 4J1QA 1NASA 1HDCA 2FZEA 2OBNA 1YBMA 3DOOA 4NZ9A 4YAGA 5JNLA 2FP4A 5C3MA 2PH3A 3QY9A 3PDJA 3ZWCA 4DRYA 2VWPA 4AICA 1AN9A 4MVJD 1N8KA 5IZCC 4I5DA 2VZ8A 2FY8A 4TVBA 4CQMB 3WQRA 1P74A 4FSHA 4QXMA 4A03A 3W6UA 1JVBA 1X7DA 3L4SO 4ND1A 1F14A 1ZSVA 4JP3A 7MDHA 2PK3A 5BSHA 3TPCA 1PR3A 2SCUA 3FTNA 4WOKA 5A03A 4I5GA 3NT5A 2P68A 3K5PA 2B5WA 5HTOA 1R15A 1HT0A 1A72A 1RM3A 4BNLA 8LDHA 5L4SA 3U4HA 2AQKA 4Q3NA 1Q7BA 4NIMA 1E1KA 4IINA 3JQAA 2Z5LA 1T4BA 2HMTA 3D3EA 4BVAA 3JQBA 1F06A 3DOJA 2HMWA 4FPXA 1CF2O 4IS3A 4EEZA 3KM0A 2UDPA 4K26A 4PIVA 2RH8A 4L9RA 5JDCC 2Q1UA 1OAAA 2DM6A 3JD4A 3E18A 4FFPA 3GFBA 4DIBA 3FI9A 1DAPA 4NI5A 3ZU5A 5KKAA 3SLGA 1BSVA 5BNTA 3QVTA 4FOOA 2OBYA 1TT5B 2H5LA 2ZCUA 3H8VA 2OXIA 4M55A 3V2UA 5EMHA 4DYDA 1JKFA 2JFFA 5G0SA 3RKRA 4NBTA 4CLOB 2W90A 3ZV4A 2PFGA 4O6VA 2DBVO 3GRPA 3NEPX 5KJ1A 1O9BA 4IMRA 3MJVA 1ENOA 3I4CA 3IP1A 5KVQA 1GEGA 1KS9A 2QRKA 4PVCA 2A4KA 4PG8A 3D4OA 3Q1LA 1ULUA 2P5UA 4IM7A 3MJSA 1D8AA 4N7RA 4YJHA 4Q39A 1GR0A 1UDBA 4INAA 2WD7B 5KJEA 3H5NA 1M75A 4RO0A 3RKUA 1AE1A 4R69A 4EITA 1NAIA 4NHEA 3H9UA 4GBJA 4OM8A 1JVSA 3ETGA 3FCOA 4HFMA 5F5NA 1RYDA 4Z9XA 5THKA 2QHXA 3TZCA 3JQCA 4BGUA 1N1GA 2BMAA 1LSOA 1NPTO 4FGSA 5H81A 1X0VA 5JSFA 3L0DA 4CM8B 5JDIC 5H82A 5I9MA 1BDBA 1Y8QB 2VYVD 2BELA 1HE4A 3RROA 5CG2A 2WYWA 2QQ5A 3ANMA 3I9OA 4LCJA 4Q3AA 4XB2A 4WECA 1WVGA 2Y1EA 4CLEA 4CLXA 1R0KA 1ORRA 1WNTA 3ZNOA 2GN8A 4BNHA 2GO1A 4CM6A 3P7MA 3PJFA 4RLHA 4RVHA 3RC7A 2HKIA 4QUKA 4UREA 3VTZA 3DFZA 3RJ5A 4JP2A 2ET6A 4FJ0A 1P77A 3BTVA 3PIIA 4WPGA 3H9JA 1BRMA 2Y1CA 4NBVA 5DP2A 4AJ1A 3Q2IA 1HE5A 2P9EA 1B26A 4J49A 2JJYA 1JKIA 1H9BA 2BI7A 2DTDA 3R3SA 4ROSA 4B3JA 2Q49A 3CIFA 3BMQB 1CRWG 3NUGA 4K6CA 6LDHA 3LT4A 1LJ8A 5CDTA 4NMHA 2DTEA 5CDYA 3ZZNA 4NBUA 2DUUA 4BKOA 4UULA 4KTTE 5DT9A 2HJRA 4S1VA 3INRA 1NFRA 5U4QA 2HCTA 3NDIA 3JQFC 1EE2A 3DZKA 3HQ4O 3JSAA 2J3JA 5CDGA 3FHLA 4DPKA 4HFNA 5KJCA 3BHIA 4RPLA 2PZKA 2D5CA 2WE7A 4FFMA 4IDCA 2Q2WA 5CEJA 4HADA 5L40A 1OMOA 3NAQA 5EQFA 2D1YA 4BO2A 1WMAA 2IE0A 1YXMA 5TGDA 1K2WA 3GAFA 5C5IA 4ND5A 4LMRA 2ZATA 4W9NC 3V1TC 4D3DA 4BNGA 4D3SA 1NFFA 1NQOA 3MJCA 4IQ8A 1V8BA 1LRJA 5C7LO 1KETA 5T6BA 3ZWNA 2Q1SA 3E9MA 2VTEA 3EC7A 1E92A 5I9NA 3SC4A 5JAMA 1DHTA 2X9VA 2Q4BA 3OJFA 4DLBA 3ONEA 3AUTA 4AJJA 2VUSA 1DC3A 3JQDA 3HFSA 3G0OA 4U5QA 2UUPA 1KBZA 3VKVA 3TJRA 4A10A 1ZK0A 1GZ6A 3M2TA 1I30A 5BSEA 3TOZA 3IKTA 4E2ZA 1EUDA 3UVEA 3HWRA 2EHDA 3DL2A 1B8UA 4C7JA 3BHJA 2Y99A 3S1LA 4IPTA 1A9YA 3MCVA 1WP4A 2ZYDA 2BGMA 3ZNNA 4GAEA 5JAIA 4OO3A 1ENPA 3GNTA 4D42A 3AFNA 4YQYA 2E4AA 3GZNB 3V2GA 1T26A 1M2WA 2ZTVA 2YV3A 4OAQA 4RVGA 1LQTA 2NVWA 4WCFC 4BMSA 1P31A 4CV3A 4BNYA 2X9GA 4BMVA 1PQWA 4BKPA 4J90A 4EYEA 1T2FA 1DSSG 5DBGA 1E7SA 1OOEA 3IUSA 4YEDA 4OXNA 4ALLA 2E6UX 1YOVA 1QYVA 3Q0EA 5DBFA 1PJSA 3ORFA 1U7HA 4PRLA 3O8QB 4M87A 3VVBA 4DBZA 1V0JA 3JQ7A 3BAZA 4NJMB 1T2CA 1IHYA 2IDZA 4R1SA 2Q1TA 4P8RA 2IYPA 4E0BA 3A06A 3AUUA 4R51A 2C7VA 1XR3A 5BNIA 5ADHA 1V9LA 3IQDB 1QMGA 5I7SA 1NR7A 4BO5A 4OMUA 2Q2VA 5K6AC 4MVJH 4RL6A 2C59A 3PK0A 2HRZA 2X0NA 3BTUA 4OKIA 1PL7A 3DBRB 4I5EA 2JCVA 2PZMA 1U3TA 1R16A 3PTZA 2JAPA 4Q9NA 1LDGA 1E5QA 2IZ0A 1DLIA 3ASVA 5EINA 4OQZA 4J2HA 5KVCA 3G3EA 1BXGB 1EQUA 2Y05A 4FFLA 3ZWXA 4RPHA 3TZHA 2NU6A 5TX7A 3VH4A 1XGKA 4IIVA 1E0DA 2HMUA 4JJFA 4RF3A 1H9AA 3U4CA 2BGKA 3K31A 1IY8A 1TVEA 5DBIA 2V65A 2XOXA 4RPKA 4UVEA 1ZBQA 3WWZA 3NDJA 2XAAA 2O2YA 1WMBA 3PZBA 1DHRA 3ROPA 1BMDA 3WX0A 3VPXA 2Q45A 5KWEA 4NQZA 2IRWA 4ZA2A 3U09A 1GU7A 4BNJA 3OQ6A 3JD2A 4WUVA 4CLHA 1R37A 8ADHA 4DPLA 2EKPA 3QVSA 1GADO 2Y1OA 4DIFA 1E1NA 4GGOA 5L4LA 2C5AA 4MVJI 4FCCA 1NFQA 4F45A 4BO3A 4ZN6A 1PJBA 1ZZEA 4N5MA 4NFHA 1FF9A 5MGBA 1E3EA 4BB6A 3SVTA 2IXAA 1Q2XA 3PHIA 5T57A 5JC8A 1JLLA 3PEFA 4RQUA 3DB2A 4Y6RA 1UXGA 5FF9A 5TT0A 4DL9A 2RCYA 1NX6A 2G1UA 2WSBA 3GHYA 3MWEB 3ON5A 4PGFA 3JYLA 1EZ4A 3L4BA 3GUCA 4XGNA 3U4IA 4AJHA 4E21A 2A9FA 4NU6A 4DA9A 1H2BA 1LLUA 1W0CA 5U1PA 4ND2A 3RC1A 3PQDA 1I3MA 2HLPA 4BNTA 4R9SA 4NR0A 2X5OA 3AWDA 4UEOA 4IQGA 3I5MA 3OECA 2WWRA 4RF2A 1R4MA 1SB9A 2PD6A 5MDHA 1KEPA 1Z73A 3PQFA 1D1TA 2CNBA 1UR5A 1T2EA 3JQGA 4J6FA 4ZRMA 3WWYA 1E7MA 4BB5A 5DCYA 4E5NA 3L6DA 3S2EA 4BO0A 2CVQA 1WWKA 2Y1DA 5EQDA 3KSDO 3ZWWA 1GYPA 2FOIA 4M8SA 1MGOA 2B37A 3T7CA 3ZW9A 1PJ2A 4CQMD 4KTVE 5I8WA 5JAZA 4E30A 1NPDA 4R1TA 2FRDA 3E1KA 3B6ZA 2DC1A 3AY7A 5BQFA 3H5RA 5IDYA 4XGKA 2WYVA 1SEPA 1TXGA 4A7PA 2A94A 5L4NA 3JQ7B 2AMFA 1AHHA 3V1YA 4FFRA 4UUNA 4WLNA 1DIBA 1SPXA 4R5HA 2J3IA 1HRDA
chains in the Genus database with same CATH superfamily
1QTIA 1KHHA 4Q21A 4Z0TA 3ZX4A 4CODB 1JHRA 3MGKA 3LQKA 2PT7A 3OCWA 4RZHA 5DK6A 3T7DA 4ENPA 1KBQA 2GI4A 3DF7A 3CLRD 4LOAA 4G41A 4LRYA 4ZVKA 3WGVA 5JVDB 3FD8A 4YUYA 4XCXA 3EGXB 4RESA 5L9AA 1AZTA 1S96A 2C77A 5HTKA 2WSYB 3A1EA 2MR6A 2RHGB 3I45A 4X71A 3ROFA 3LDFA 3OZUA 1KK0A 2XITA 1Q19A 5CLIA 4F4FA 5LQAA 4L74A 4UBLA 4ZMBA 4F56A 2YBDA 5L7WA 2XOKD 2H85A 1NUHA 1WTAA 4LWPA 5I9BA 2QYOA 2XH8A 5LDDC 4BNVA 4Q1BA 4AJNA 5KYUB 4CIYA 4YMHA 1M73E 1OLXB 4O2RA 1XRNA 1LNSA 2HA6A 3NP7A 3WQHA 3ROMA 2DX7A 1F48A 1MTOA 1DWPA 3LTNC 5JSKA 2V54A 4EHAA 4BQOA 2D1FA 3O4RA 3G9TA 3W0LB 5CFPA 2UUBB 3TZ6A 1GZ4A 3DL7A 4QVGA 3GGPA 2ZWVA 5ESDA 2D5BA 3MCAA 4QU9A 2VEDA 4AF7A 4L73A 4N7JA 4ZZ1A 2EAUA 1VDZA 4BRSA 1QMPA 1HDGO 1H4TA 1SA0A 2JD0A 2Q50A 3CZRA 1TQ6A 2QJOA 4Q19A 5KDDA 4G0VA 3C8DA 4YRNA 3P0HA 4EDHA 3SIRA 4URWR 4O63O 4L4UA 4FKBA 4UHDA 1BCSB 2Z04A 2OHHA 4KSCA 4U7JA 2I29A 2QNRA 1BRTA 4HEHA 2JIPA 5CDSA 5DFAA 3ZDZB 1V9SA 2CLLB 1J7JA 3S0JA 3K6SA 3I92A 1ZK1A 3NC4A 1NSTA 5AKYA 5KYWA 5JQWA 4LOHA 4LYJA 2K6GA 3BF8A 4H7EA 2HUNA 2HDWA 2FHSA 3FKJA 2OE2A 4B33A 2WUEA 3TX6A 4J0CA 2XMRA 1PWZA 1TC2A 1DT3A 5HE9A 4EKNB 1FX0B 3TLJA 3TZBA 4A2CA 4PO1A 1CQPA 1G8KA 3I2FA 2RAPA 4HZGA 4HX2A 3U9TA 4XOIA 3AVPA 5DH9A 4MMYB 5L3SA 3HA7A 4UDYX 1QH0A 4AQ7A 3CLRC 4ITRC 1NJ5A 2HRCA 1NF2A 2CLKB 2VWQA 1N8TA 3FBTA 1E58A 2GHIA 1BQ3A 3GA5A 3O91A 4WXPA 5EXDA 3T3EA 4BFCA 4YCSA 3IKVA 4CKCA 1WY5A 1KC3A 2DFPA 1R4NA 1MD9A 3F6RA 1T4MA 1D2MA 3OLCX 4Y9UA 4O2BA 1PFYA 4D6YA 1LLFA 2A9OA 4DAEA 3PUZA 5IKXA 4RVCA 1EE9A 3GX1A 1T8UA 2PV7A 1W76A 2XR1A 2YJ6A 2OXFA 3DBOB 3N6XA 4BGIA 2IKQA 4G3XA 3SQMA 4Z7OB 4G0PA 1E4VA 3TW6A 3OMLA 4D0LB 4HQLA 5A3VA 2EEZA 4QHTA 1TMYA 1ESEA 5AICA 4ZKDA 2JCYA 3H16A 4KMOA 1F9AA 3ENWA 2QTVB 2VP3A 1I5RA 3AU9A 3GJ0A 2ZI9A 4XA8A 1C4KA 1CRLA 2Z09A 3OVMA 2R4TA 4Z0PA 2B4YA 1VJRA 3AF2A 3KB1A 1STOA 4GYJA 3WGJA 4C7BA 4ZT2A 1L5LA 2FP3A 3FB4A 4PBRA 1KIMA 1GZ3A 4R3UC 5LB2A 2EYQA 2ASEA 2PUDA 2PMEA 3KOYA 3A36A 2PXCA 2IIVA 2ZVPX 5BN5A 1AH2A 4WAUA 1NMQA 4LSMA 4CMBA 3C4VA 3U26A 2EWVA 3O94A 4Y6PA 1M8JA 4UOQA 1F60A 3NETA 4A3SA 2V6MA 3SZLA 3D1LA 3JRXA 3F8WA 4RF5A 3NHWA 2FEAA 2ZB2A 4GXQA 5IEJA 1TCVA 4W5OA 1L7DA 4RC9A 1FLVA 5FLYA 2WIJA 2XYHA 2J7KA 2R48A 3GUUA 5IUJC 3FTDA 1UBLS 4YAIA 3HKDA 1H94A 3ESDA 4YRDA 3I01M 1FSFA 1N9GA 4LS3A 4Y3UA 5E2AA 1C0EA 3W1VA 4YMIA 2VNIA 3R77A 5EJFA 5EI5A 3E0XA 1YL7A 2HRRA 3W79A 4DLTA 2ZI6A 1JEDA 2MIIA 4HDCA 3KKMA 1T6YA 2RGGA 3AH8A 3NFYA 3PQ7A 4RD4A 1PS8A 3P0FA 2CLCX 2DZDA 3EN0A 5BMVF 3AP1A 4P84A 1M0TA 2PYDA 3WMXA 4MULA 3SE7A 1K63A 1L5HB 1F1BA 1Q0SA 2YL2A 4F1WA 1GKKA 1HTTA 2JASA 3UZUA 5FL3A 1QV9A 1KSJA 1ABEA 2V9CA 4IGAA 1RBMA 4V1CB 4UEJA 4HAVA 2BFCB 2C5LA 2LIPA 5D7BA 3TNDA 4ZTZB 5JCJD 3V8MA 4ER6A 3CMMA 1A8QA 1ML3A 3V8VA 1W5BA 4UNIA 1XEAA 3KZVA 3RJTA 3DKPA 1WETA 4C0HA 2AE2A 5J2UA 1UFOA 2VRBA 1AUPA 4PN3A 3WAJA 2AQ8A 2ZVJA 1A7JA 5B6JA 1MO4A 3I72A 3VO9A 2VO1A 4CLRA 4XIGS 1PJTA 1R0ZA 1N4AA 3DYIA 2Z3ZA 1HDOA 4Y9RA 3RRFA 4JEUA 1I3OA 4NARA 4B6PA 4RJKA 4E5YA 2F1HA 2QU8A 4DCSA 2CUZA 3I6BA 1CRZA 1F2VA 2PGAA 3U62A 1XDGA 3THWB 1BWRA 4B3SB 3NYQA 1H0SA 4LV6A 1AM4D 1TQ2A 1VE7A 3JZDA 5JJLA 3MUEA 3ANLA 4B5KA 2G0NA 3CPEA 4YP9A 2NADA 2VPYA 3GCZA 3AUKA 4FYJA 1OX5A 5AK4A 1GG8A 1N9ZA 1H42A 4IDAA 1W44A 1QHSA 2IPXA 3H9CA 3NQ41 3UMRA 1SKAA 2J5XA 3AX6A 1JXMA 1G20A 2FZVA 4QTXA 2XUQA 4PFJA 4HYTA 3W8FA 1C9YA 3SXJA 2WWFA 5DZSA 3ORSA 3ID6C 4M1YA 3JQBC 1VPDA 4V3CA 1SUEA 2YNMD 5KTKA 1QR6A 2GNOA 3L02A 2NTVA 2WU8A 4ZD6A 5D6OA 1ZSYA 4BQNA 4I5FA 2Z3WA 3IVCA 4V03A 3TYXA 4F0JA 1YFJA 2QKYA 3EGEA 1ZM7A 4RHEA 5KWIA 3KYDB 1AK1A 1GXSA 3DDCA 4C3OB 1F20A 2ZCVA 3ZX5A 1T2VA 3LUPA 5DKFA 1L2TA 2V1XA 2YXEA 4Q66C 4RPGA 2ZUVA 2QM0A 1FP4B 1MFPA 4B48A 3BD7A 3C5HA 3GFVA 3IFSA 1C1XB 1H2ZA 1Y0BA 1XVIA 1QHGA 4Q1FA 3WZ2A 5ENDA 4OYRA 4CUJA 3CTMA 4AY2A 2JG3A 2G83A 5J4LA 3LX6A 2BI4A 1UDRA 2O2HA 1FRNA 1GIAA 4M83A 3T5GA 4L8WB 2V3VA 2DWPA 4C30A 1MGPA 2O3TA 2PFKA 2W2KB 4PC1A 1YU9A 5B4UA 3BTSA 1U65A 3N2YA 1X7WA 3IT1A 1YI1A 2NSDA 3OEED 1FJXA 3B5EA 1W4ZA 3OEWA 1T1RA 3R4VA 3IESA 1ATIA 1PG0A 3D7MA 5L3RA 2I22A 3HFRA 1KNXA 4UMFA 2F43A 3MGAA 5G2OA 5B3JA 1EIWA 2BM0A 4K2AA 2ST1A 1U2ZA 3SVLA 3LWBA 3I1FA 4ZCPA 3U3XA 2PRJA 4P86A 5P21A 1Y9DA 3SYNA 4QYIA 1JYFA 1EWTA 3DZIA 3LDGA 2ZUTA 3T38A 1YIDA 2NVUB 4IZOA 1X14A 3IPXA 2G8NA 1ZD1A 2QN6A 4PGHA 1LBSA 1KSFX 2RGAA 3JQ8A 2KPOA 5CT8A 4CF7A 4G23A 3AETA 2AKEA 2AEJA 1WNFA 3FA2A 2WJVA 3COPA 1JR3A 1K3UB 4YCJA 5D85A 3FVVA 3IVGA 4N3AA 4YWJA 3U7JA 4MVWA 2P8JA 4FOSA 4F60A 4MIKA 1PGJA 3HR7A 4IFEA 5IVIA 4DRZA 1JQLB 3GR6A 4J0QA 1YF3A 4EW1A 2XKBA 2W7TA 2A67A 2O57A 2HK8A 4ZAYA 2C4HA 4P3YA 3CCFA 1GVNB 1SXHA 2OB1A 2YNMC 3KQTA 3OC0A 2P8SA 3KE9A 3OZVA 1QYWA 1Z4LA 3F4LA 4KDEA 4M1QA 5DTEA 3F4KA 4H1UA 4XVRA 1EM8A 4FQ8A 4IJVA 5CA1F 3QXHA 4DDUA 4I9NA 3SQLA 5AH0A 2B69A 2PAAA 1SXIA 3X1MA 1NW8A 1RPNA 4FLFA 1Y9ZA 3D2LA 4J76A 1N6KA 4Y30A 3GDFA 4L0QA 2OG2A 3N9IA 3K9BA 1IIRA 3C1AA 2ZR7A 2IP1A 3A9CA 3Q98A 3V3TA 1NVGA 1Z0FA 5IDXA 5M2QA 2UZ4A 1BE6A 3O93A 4NU5A 1WG8A 4YTEA 2BFDB 4JBIA 3CCBA 4GGPA 4J0DA 1BHO1 1F1JA 3C3YA 2BRUA 3IAUA 2IYNA 2YXPX 1JQ3A 4O3FA 5HIJA 4DV7B 1Q0LA 1N1DA 3KZCA 4XX0B 1J2EA 1W34A 1IM8A 1A8HA 2H6EA 4U6QA 3VOBA 5C8XA 3MPUA 1OYYA 3HGMA 2VXYA 2DR0A 2H1FA 4MVCA 1DDIA 2O6LA 2H7CA 3VSBA 1H93A 5JZBA 2X1HA 5JMPA 3D0KA 3TR5A 5KI6A 5BR4A 3OLZA 3EYAA 3GJZA 2RSLA 3Q40A 4MPPA 2IHKA 3EF0A 4X1IB 3U4GA 521PA 3OLYA 2H2GA 5JD4A 2X7XA 3GLGA 1SAYA 2VAXA 5DNYB 1SR8A 1IN8A 2NZUG 2JRLA 3AM4A 1FK8A 4UNSA 1DOZA 1PR2A 2HHHB 1XCMA 3CZCA 2NXJA 1M1NA 2PGXA 4TVSA 1UT8A 4TV9F 2AJ8A 4HGYA 1FYWA 3FMPB 4MKHA 1E3SA 3AJ9A 2C7OA 4P4NA 2Q6IA 4JITA 1ZNQO 5DHFA 4XIIA 2C2HA 4HH0A 1FDIA 1GYRA 2IS6A 4CMCA 4BYMA 3VR6H 3R5HA 4YV2A 4G4GA 2NQ2C 5HS4A 1WF6A 2C8JA 5AKEA 5JBIA 1H6CA 1IG0A 2AVDA 3EEBA 3CZAA 1XVLA 4GX5A 5CP8A 2IYTA 2GSWA 1L5ZA 3DBVO 2PUHA 1L8XA 4L9AA 2P3QA 1U3CA 1HZJA 2OK8A 3AI2A 3BD9A 3H11A 4OQMA 5DWDA 4FILA 1TYZA 4HV4A 3MUNA 2IODA 3DKRA 4BIIA 4KKVA 3FUUA 1NKSA 1D2HA 3LNTA 3M6VA 1FNNA 1M66A 1RXEA 2EWMA 2ZJYA 1MVLA 3LAWA 3MT8A 3QMMA 5FO0A 1QOZA 4N5NA 2P4QA 4M0CA 3IXLA 4DTCA 1Q0PA 2JFHA 4TMFA 5BNWA 3AVXA 2DPGA 4YR7A 3DNFA 4XEUA 3NEYA 2PPVA 5CX1A 1NY6A 3K1AA 5DW0A 4AC9A 4FINA 3BT7A 4OJTA 3JQAB 1FDWA 2B0JA 3U7RA 3UKJA 2CLOB 5EHXA 5J4YA 3IPLA 1L9XA 3QFCA 3UJ8A 1UANA 1P1FA 1EDBA 3HS3A 2WJJA 1R5BA 1RDFA 2FPXA 1U6JA 2J87A 2XWPA 1FP6A 2OHXA 2REQB 2TMGA 4DF3A 5LLDA 4U7TB 4GC9A 2JKVA 1JEYA 2Q4EA 5T41A 2KYRA 3VTAA 3QKRA 4TKUB 1KEKA 1PEKE 1PZXA 2PANA 3USCS 3KQYA 4OAOA 5I3ZA 3FAZA 1I94B 3KKZA 4D0SA 5AW7A 3W5BA 4N7BA 4FFSA 4MW4A 3KAQA 4Q1DA 2A0YA 2D54A 3PU6A 2WTBA 2NNLD 1JPNA 1M33A 1S8AA 1IY0A 1V45E 3EEFA 4JCOA 5AOVA 4ZVUA 5HQ3A 2UYHA 5FNZA 3R9KA 2PH5A 5FEUA 5JI2E 1TF5A 2V7XA 3A9UA 3ZN2A 5DLDA 2OBXA 3IJRA 2PX4A 3ND8A 1I33A 4KIUA 4A8TA 5B30A 2WNIA 1J1UA 4MPDA 5F33A 1IEVA 2IEAA 3ANXA 3LQFA 1EK0A 3H7IA 2I7TA 3OPYB 3QPAA 1LBIA 2C4VA 2F64A 3GDOA 4BJ5A 3JXEA 3PRHA 3Q7SA 5B7NA 2JDIA 4LC0A 5BQ5A 4C4AA 1ND6A 1SOVA 4I3HA 4L2IB 3QQ5A 3KEGA 3HRKA 1C2TA 4IRUB 4G0NA 4DGQA 3ZW8A 3ESBA 1FFYA 3HC7A 3FPJA 5J2TF 4MHTA 2XUPA 1V7ZA 2R8EA 3VX4A 3GJXC 1VMIA 1SU6A 2FLVA 3Q9SA 2YASA 5FBVB 1SU8A 2AFVA 3ZHVA 3HM9A 1VP9A 1AZLA 2GCPA 2YC2C 3U39A 2CNKA 4K03A 1WQ3A 4MINA 4YX9A 1GPKA 2G82A 3ZKAA 3BF7A 2VHVA 1MC5A 5FHQA 4QSMA 5BSTA 3UYKA 3WBKA 1US8B 1ZYUA 1VJ1A 4IL5A 4AK9A 1KAQA 4D4HA 3L7DA 5I9TA 1P8AA 1CPYA 3GFPA 4BRUA 3TLYA 5BW6B 4LQ4A 2FEMA 1BKDR 1CUVA 1LFDB 3E48A 5GONF 3OQBA 3VDNB 5KNLA 2A0UA 1C0KA 1E2MA 4C7XA 1XTUA 3PTLA 3LKBA 1D04A 4U2EA 1AZSC 2O4CA 3SFVA 1HNNA 2PG3A 4FS8A 1J2UA 4I4TA 5C5EA 4IO0A 4BEWA 2C88A 1ZJZA 2IC5A 1GNSA 3SYLA 3K92A 1WKBA 1KKMA 4GZMA 3UENA 2XLBA 2HA3A 1V5WA 3G9UA 4LK3A 2C2YA 3MM4A 2QLFA 3MTJA 4UEWA 4NDAA 3ZKWB 5EIXA 3LWNA 4DV5B 2QUBA 3U60B 3V48A 2IW1A 1A95A 2RE8A 2NO0A 3T1OA 1DBRA 2CE2X 2FLKA 3EB9A 4OYLA 2BEJA 5LXTA 4KNYA 1T2DA 3EXFB 1JECA 2QN9A 1M6EX 4LF5B 3N76A 4IXWA 3EIEA 1M0SA 4GM4A 4TRMA 2B7CA 3WGQA 3S70A 1ZH8A 3HZHA 3PHLA 3M2PA 2XZOA 1GV0A 2A9RA 1D4AA 1ESCA 1XSEA 3AOGA 2XB9A 1B16A 4Y9TA 4E88A 4F8EA 4YAJA 1EVQA 3G59A 4JVSB 3HRIA 1GD1O 1U1DA 2ZAGA 2IWHA 3CO5A 1PR9A 2YWBA 1QZUA 4Z49A 5GVSA 2JI6A 3FFAA 3RBVA 1KJZA 3ZDDA 1WEKA 5IKEA 3SF8A 4CCYB 1USWA 3FMVA 3PUKA 2CMFA 3L4JA 2XA2A 2B82A 1QDUA 2AEFA 2F9FA 2ZIGA 1M67A 4I7EA 1SWVA 4ZAWA 1WBDA 1YQWA 1R6BX 3FGOA 4QUGA 2WIGA 3FCXA 2EV9A 5HW0A 3IAM1 1CUXA 2YRWA 3TO5A 1QJ4A 1ZP6A 1DRVA 1K6EA 5GMOA 2ZE8A 2QRQA 5F1PA 3ODPA 3VR5H 3JQ6A 4MB6A 5EHZA 3JRWA 1MG0A 3OFKA 1FFSA 5FWYA 1QP7A 1QB7A 1FUYB 4KXUA 1RHKA 3ENNA 1WZIA 2WF6A 1U0FA 3CNBA 1LTHR 3EIHA 3DULA 3HEAA 5CVVA 1TJPB 1C4XA 1W2HA 3RIHA 5EHQA 3S99A 1M2VA 5H9WA 3I23A 3A4YA 3RV4A 4D57A 3WZMA 1EYZA 3EARA 3PC4A 2FPRA 5IARA 5I7FA 3E8XA 1PL0A 1IU9A 4NENA 1GL7A 2FZKA 4UZFA 3UW3A 3ZE2B 4MQFB 2AI2A 1Y6JA 4MP3A 4FNGA 5HGXA 5DOZA 1WB4A 5T4EA 2WW8A 2FRDC 4GX1A 4R9RA 2PE5A 3R5JA 3LTEA 2YMLA 3ZI7A 4JWTA 4ZQBA 3V1UA 3VSDA 3PGXA 4RCVA 4Y1RB 5AVXA 3LLCA 3NEAA 3B3FA 3U3DA 3COWA 1A1VA 4C07A 3FYCA 4AX8A 5IABA 3EHDA 4D44A 1O87A 3HP4A 1E32A 3OUUA 4FGLA 4F2DA 4HNSA 4TTIA 2HK7A 3LW8A 1IQRA 2YV1A 3B1FA 3G8CA 4CM1A 2IT1A 4KXYA 4FC6A 5TIIA 3SFZA 3MYYA 4X20A 4D0RA 1KHTA 2FETA 2Q8NA 1J5PA 3CUSA 1UDAA 3OPVA 4OFWA 2D2VA 4HLDA 4J75A 3I37X 3WTCA 1WCIA 1L5RA 1S3SA 1K6MA 3GIWA 3HN7A 4PZDA 2GFHA 2QRLA 1RI4A 4PHCA 4XQCA 4PLYA 2PUJA 3BA6A 2FGJA 3D6VA 2ZJ1A 3R7BA 3A4MA 5E9JA 5M29A 1MTZA 3CSUA 4JI7B 3B1ZA 4BKUA 3SBEA 4UVDA 5I3CA 1LPAB 2VH5R 4FS3A 4JROA 2OFXA 1FRQA 4YP6A 3LCJA 1LWNA 4ZDIA 3DCYA 1CZHA 3IUJA 4FX5A 3GH1A 1KK3A 4NEQA 4KXNA 3F5SA 2UYQA 4AG3A 1CR4A 1XFAA 4J16A 2ZJOA 2PSFA 3CONA 4KDFA 3MWFA 4M1OA 2V7GA 3AXTA 3VNSA 5HX7A 1VFPA 4KQ1A 4EMBA 2X76A 3CO0S 1MAUA 2RAFA 3EZ9A 2OC4A 4NY1A 1NBAA 1YIOA 1CEXA 4MQUA 2J0SA 1HETA 1IUKA 3KOOA 2VT2A 4QBIA 5E0OA 3VAZA 2CMKA 4KH0A 3D8HA 3G2KA 1Z0ZA 1Z4OA 2O48X 1N7JA 1OI2A 2AF3C 2OXEA 3TAUA 2RGBA 1W8IA 2XUDA 4TKZA 2WLTA 3M8KA 5B3LA 5CEEA 1JYSA 3KTDA 2ETXA 2GEDA 3WMEA 1QVRA 5BR8B 5JQGB 2HIGA 3KS9A 2X0IA 3W4JA 1CB7A 5B4VA 3X2EA 1P0CA 1ZI6A 2M6KA 3RAJA 5MHTA 1UQRA 3LK6A 3G0CA 4H17A 4CI0B 2E1PA 3SD7A 1VDMA 4FU0A 2P9JA 3Q3IA 3DKKA 2WILA 4FKZA 3I1IA 4HDKB 1QIJA 5DLYA 5HUJA 4JV5B 1G8JA 1MHPA 3DD1A 1FMJA 3KB8A 1TMGE 2I1VB 5COAA 3AFHA 3KIPA 4AKGA 5LYYA 1ZD2P 2Z2JA 4PZZA 1AGNA 1TJ5A 4UZEA 1MG5A 1WW8A 1XQ6A 2WBLC 3QVWA 4MV4A 3N8IA 3F2IA 3WLOA 4DA6A 1VJCA 1BEEA 1LJLA 1YH3A 2BP7B 4UOEA 1RRMA 3I9LA 3ROQA 3K9NA 3QKIA 3TDKA 2R8ZA 2GAIA 4IGIA 1YAJA 3B2NA 3E23A 3QHPA 5TARA 2JA1A 2XNCA 3DOEA 3LY8A 1TB4A 1SBQA 2XJ9A 4WQMA 4YRQA 2GF0A 1KZ1A 4Q5IA 3BJMA 3VJLA 1CS4C 3PZRA 4UTNA 5TVKA 3LU1A 2PJRA 2CXXA 2O3QA 2ONCA 3WIVA 4DCUA 5AM2A 4OX9Y 1P7PA 2WIAA 1CZOA 3ZWOA 2H18A 1GN8A 3IEPA 4JBXA 4PW0A 2KHZA 5AXAA 4BGVA 5BMVB 3QVOA 1IK4A 4GVPA 3ZXSA 1Y1RA 3OX3A 2IIBA 2AR0A 3Q0IA 3RUDA 4CM9A 5KQPA 4ZMSA 3T1QA 3OTIA 1BFKA 5FD8A 2FMKA 4DPMA 3D4NA 2QTBA 3DZJA 4AYWA 3NM6B 5BORA 3BXPA 4G5QA 4CCAA 4IIDA 3DE4X 2G0TA 1Z3CA 3K9GA 3NBYC 1BU5A 1E98A 1XRRA 2RGUA 4Q47A 4X41A 3GOHA 1VSUA 3N2ZB 4A92A 4CTKA 1ZD8A 3IP6A 1TW3A 3HJHA 1IM5A 1DKLA 5ERXA 2ZSBA 3WQSB 1BOFA 4GP7A 1CQJB 4MZXA 1IJKA 2IF0A 5FFNA 3R7FA 1QCYA 5F9HA 1KEVA 2A2ZA 2Q4RA 4MR9A 5FWNA 1K08A 1IXZA 2RKBA 1NAHA 4ARUA 4ARBA 1YZQA 1R0WA 3AL0C 1C8BA 1FFEA 4RMHA 4YRFA 1PYDA 4KQKA 2IEBA 4B71A 4UM5A 1Z47A 2W8ZA 3S8EA 1G8MA 3PGKA 2XIQA 2MMGA 3L7MA 1GL9B 3T1YB 1NE2A 3GP3A 2VA8A 4FGJA 1QAMA 2V6GA 4FW8A 5PGMA 2F6RA 4G0XA 3VZSA 2JIMA 3I1JA 1DDGA 2XQVA 4DARA 1FFAA 4PLPA 3WA7A 3GEEA 1YVRA 1CR2A 1E2BA 2ONKA 2PL1A 1B3RA 2H63A 2ZIXB 3OETA 3EXEA 3GGGA 4W8HA 3R0VA 4BN0A 1LBTA 4CF4A 1I4WA 4HGOA 4MDFA 4GPTA 1OASA 3PNPA 2CFTA 4YRJA 5TE9A 3WL6A 4X9XA 3LVFO 4A0RA 1LZLA 4IUDS 1JPJA 1NR1A 2H0QA 1PHPA 1RMQA 1QYIA 3KCNA 3FWYA 2DR3A 2QM8A 1HDYA 2ODAA 3AF1A 3IDZA 4PZUA 3ZGNA 3UK2A 4LF4B 1P7VA 2AJBA 2QXYA 5K51A 4GT1A 4QGHA 3HBFA 1QO9A 3HABA 4MIOA 4YQZA 4UHFA 3TNYA 5GINE 1Z15A 4KRYA 1J8MF 4CM3A 3ETLA 3HDHA 1AB5A 2JGAA 2WTXA 2J4CA 1Y6ZA 1FNSA 1XVAA 3KZMA 4J4TA 4NV0A 5L3QA 4QJIA 1PEDA 2JBAA 3WTBA 3MOSA 5C8YF 4EGCB 2ZBPA 1WSWA 3P2EA 1BS9A 3IUMA 4QZVA 4PONA 1MC8A 3HP1A 2ZRGA 2CFRA 1N5LA 3H5AA 421PA 4TMWA 2XKAA 1CDOA 4JC5A 5TJ9A 1Z37A 1WBJB 2W4QA 3HLKA 1DC4A 1U4OA 4X61A 1DQPA 1OLUA 1R8YA 2K7ZA 1GZDA 1U3VA 4AFNA 1P44A 4D9NA 1V1MB 3L82B 3MQFA 3PWTA 1I9CA 2JB9A 5AW2A 3BA1A 2D0DA 4QOGA 3MELA 3ZS9A 4DUGA 3ZV5A 4HWGA 2ZETA 1WOYA 4LMPA 4MWEA 4RYDA 4WZZA 2HJHA 5B1IA 4BQSA 2GAFA 2IOQA 1ZM3A 4JCCA 4BNXA 2I9KA 5EIEA 5A6VA 2OCGA 3AB3A 1IN1A 1AS3A 1P2VA 1CUZA 1ODIA 4GBED 4MQEA 4NJEB 4D80A 1EB9A 4EHBA 1JJ7A 4B3FX 2CSXA 4H7DA 5GJVC 1SCIA 1GGVA 2W22A 1G4HA 3EH2A 3SU8A 1WXQA 4GSKA 1IOVA 3CVUA 3H2ZA 4DLZA 3JD1A 4N0PA 4IBOA 1A9QA 5EUQB 1KY2A 2OKCA 4AECA 2PS0A 1ZH6A 3C3AA 1IH8A 3GRUA 1U0BB 3ZJTA 4JJEA 3DH0A 1DT5A 4KXLA 4WK0B 4HJRA 4GICA 2WKWA 1EB8A 1L9KA 3A58B 3EYWA 3VZRA 1P4HA 1WULS 3U4DA 4AMYA 3IOCA 4JUFA 4OQYA 1Z8NA 5J5AA 3MMNA 4F3YA 1BDHA 1QRRA 1U8CB 2HV9A 3C5EA 4P38A 3TJZA 1JFTA 5IXYA 1ESNA 1KO8A 1N0UA 4QYXA 1KI4A 5IN5A 1C3JA 1N57A 2VDKB 1C7ZA 3HTXA 3HWSA 2RHBA 3QE2A 3LNCA 5CB4B 3FWNA 5JTTA 5F5LA 2NYVA 2YW2A 2BGLA 3ZHOA 1DCKA 3NHJA 3C3CA 3RRMA 3TLXA 5B3JC 5BV1A 1UPTA 3W5JA 3RU2A 2DG2A 2HCFA 4RZXA 3BXGA 5LBTA 1TRKA 4DNOA 2CW5A 4L07A 4J7UA 1UODA 3RUFA 1RWWA 1QSGA 3Q11A 5LZ7A 2WY2D 3LHDA 3OKFA 2OXCA 3A3KA 3P2YA 3ZU2A 2AXEA 3ZW7A 4Z6KA 4V1CI 4DEVA 4L7VA 5DCUA 4R8LA 3UM9A 3QEAZ 3H5WA 5DU2A 2XUZA 2XRZA 1EJ6A 2VDOB 4TV9B 2GCNA 1HDXA 5KOJB 2I1QA 1XTJA 4P4TA 3M6AA 5DHQA 1DCFA 1SCUA 4GR4A 5L7YA 4ZAXA 3K2EA 2HADA 4AS3A 4BFZA 1MZPA 2BMDA 3L0BA 4QBFA 1WF3A 1WCYA 2P2ZA 2QTGA 2ZYIA 3E84A 3M4JA 1DMRA 4FT4A 2M98A 4IRXA 4CEJB 2UKDA 3RVJA 4DDKA 3EDRA 5E6SB 3LSTA 2CUKA 2CYBA 3GELA 3NAZA 5G3YA 5G0TA 3GDHA 4C6HA 2VQEB 1ZG3A 3THRA 4E5KA 1YS9A 2X7JA 3FSEA 5C37A 2O50A 2JGIA 1Z62A 1TM4E 2ZRAA 1HOTA 1E0KA 4MEBA 1ZC3A 4JYPA 4LC1A 2RBGA 1P9NA 4RZQA 5L51A 5LU8A 3SI7A 2XA9A 2OC9A 4PX2A 1TEVA 4C4RA 4L5IA 1SBIA 1XMPA 2BDEA 2I76A 4I9UA 3EGVA 5K9ZA 2XF2A 1OX4A 3LBHA 1P7ZA 3OBIA 3RWMB 1ONSA 2OWEA 2FWAA 1IJEA 2EBFX 1KMNA 4TTTS 2H1OA 4UW9A 2UV8A 3GFQA 2RGNA 5H83A 1DXYA 4YT2A 2NP6A 2QQFA 3KYJB 3FPFA 2I7XA 4KMMA 5FWXB 4S1NA 5HNKA 2W0SA 4G8JA 1TJ3A 2HIMA 4PPGA 1NNEA 2YOHA 3E81A 3QLEA 2DF8A 4RIEA 1IUPA 1U98A 4DRXA 2G5GX 4ZO6A 4CFZA 4JYMA 1BROA 3CX7A 3CB2A 3P20A 1NJ6A 4C4OA 2QMOA 2ACKA 2B36A 1PGPA 1F4LA 3DLHA 5C81A 2JGRA 4B31A 3F74A 5I4CA 1T9GR 1AC5A 5AWFC 1GUBA 3O84A 4JBNA 2Z43A 5D5HA 3U4MA 5IC6A 2BHNA 1ZO8A 2QYHA 3V2IA 2HWWA 4EEKA 1JMKC 1Z33A 1L8LA 3DGFC 1OCEA 2H7YA 2QYTA 2ODQA 3G0BA 4TRRA 4YBRA 4YQEA 3ZWVA 3U7QB 3T1VA 1E5LA 2JDID 4MHOA 2HBQA 1VBFA 1RQ7A 3DDWA 4M1KA 1TQHA 3V4ZA 3B7GA 4GL2A 1X19A 3WGYA 2QAGB 1OVGA 1JHZA 3IE2A 4KN9S 4AP5A 2P2CA 2YINC 1PLJA 2QN3A 1KH2A 4HTFB 1IY9A 3QU7A 4YCCA 1KS2A 4B8YA 1L5FA 3HWX1 4OBBA 3AW9A 1IB0A 2YR0A 4LUCA 4MUMA 4N18A 2OHJA 5B36A 1EK6A 3AFOA 3LP6A 1RQ2A 2CJFA 1T91A 2HU2A 2J0UB 4QRIA 4DLXA 4ZZ0A 2F4VB 1PL6A 4TMVA 5HM8A 4HDNB 2HAEA 4RK4A 1O97D 1SD1A 4RVSA 3JWHA 2RGRA 2AHRA 5A4IS 2R62A 3G23A 5BQPA 4DLPA 4EY8A 2AG8A 4I19A 3ROZA 1Q0TA 2MT9A 5F9FA 5HF6A 1KJ8A 821PA 4UPVA 2ID8A 5KYXA 1NU8A 1CJUC 4HYEA 4U9HS 3N8KA 3ITKA 3GNQA 2P6OA 4QXQA 5F52A 1QWSA 3KLBA 3SQOA 3WLFA 5A4MS 4RETA 2QENA 2FDXA 3VNRA 3CV3A 3HB9A 3ONVA 2A58A 2YZ2A 3VPSA 1YDEA 2XB6A 4D96A 1A9PA 1G21B 3AP2A 3FIUA 2BPOA 3M1AA 3MRSA 3TKAA 4IDFA 3NCTA 5IC4A 1D2AA 1B0AA 2L69A 3KHUA 3E3LA 4RABA 1W4LA 4OAPA 3JD3A 4B74A 4DY6A 3BMOB 1VMEA 4FYMA 1R10A 2K2QB 1Z6QA 3LF1A 4MJXA 4OHYA 1A97A 1FP1D 4B34A 2B1IA 4D8YA 3IAM6 3HI6A 3ESYA 2MYPA 3MS7A 3NPAA 4K9SA 4G2TA 4K40A 1T10A 2PZAA 4OFBA 2WF8A 2JARA 3PGA1 3LH5A 1GCUA 3OQHA 4RBNA 2BZSA 5FL7A 3UA3A 3FTQA 3SAJA 1L4GA 2EGUA 2OD2A 3I28A 2VZ0A 3KHTA 1VIDA 2B1JA 2YHSA 3PNQA 2C5GA 2G9ZA 3VNBA 4UD6A 2QN1A 3B3QA 5F7XA 1OXTA 3BREA 4MVYA 5DGIA 9MHTA 2NYAA 1CY2A 1DXHA 2P0EA 3P9YA 4WD3A 1IVSA 5F77A 5CLFA 5K4GA 1R9GA 4JBWA 4RTQA 4KFSA 3VU3A 1TAGA 4NJMA 3A05A 2AOUA 2MR5A 4S35A 3G17A 4AL4A 2IUTA 4OGWA 1W7AA 1NOKA 4A0HA 1Q74A 4J0KA 5FNVB 1ZCFA 3B5IA 4ZQHA 4MVJA 1H6DA 1S3IA 5KHLB 3KXLA 3HKEA 2FGKA 1Y98A 4AMZA 2TECE 5I7VA 2YRFA 4G84A 4YAEA 4KV7A 2QN2A 1ISFA 1SMKA 4CG0A 5CLHA 3SCZA 5LQJA 3C8MA 4YXFA 5IZ4A 2QRPA 1JHPA 4XEHA 3H86A 4G67A 3HN6A 4IF6A 4X00A 3FOEC 4H7KA 5AJUA 4HWTA 4GPZA 2O1XA 3A2MA 3I6QA 1O97C 1X7XB 3LA8A 4GR9A 4O4IA 4IZHA 2YZGA 4Q4LA 3KTOA 5H68A 3GV0A 3STVA 3BQNB 2P9YA 1BXGA 2O3SA 2ZR9A 4ZPXA 4E22A 2XQGA 4KB5A 5MF6A 2FCAA 1RADA 1GGEA 3CZ4A 3NBUA 4CM5A 1ZAKA 3PYMA 1DINA 4BATA 1UKCA 5K0BA 1W36D 4Q00A 4IIJA 1PJQA 3JZMA 2CMGA 3VR5A 2QIPA 1P7CA 1W85B 1HSOA 3CUTA 3EXIA 4YCDA 5KTYA 3CKYA 1QH1B 1MX1A 1XQ1A 3LQQA 4MQ5A 1ZCAA 1X80B 1K98A 4DMMA 5HKAA 1DI0A 2FK8A 3A10A 3AHJA 3BZBA 3GJ7A 4J9UE 4TM7A 1I4LD 1EEHA 2IEGA 4U3JB 3WGLA 5AMXA 1Z6GA 2NXNA 3N0VA 3KUUA 3QBJA 1SC9A 2O2DA 2MSDB 4RKRA 2NYRA 4M9QA 2KS6A 1C3LA 1E9AA 2R66A 1CJCA 1RWKA 3GRVA 3K8QA 2QAJA 4LVCA 3O8OB 1JILA 2QS9A 3JATB 4FOLA 5GY7A 2CT8A 2NZ8A 3IAFA 3I0ZA 1VYTA 4M60A 4UMDA 3TSYA 4B47A 4PTZA 3PP8A 1BH2A 2I8AA 3K2IA 4YT8A 3H17A 1T8RA 3SOPA 1JHVA 1LPPA 4Z9BA 1OFIA 4WGGA 3NIBA 3MB8A 5GV8A 1KEEA 5F5XA 1OBOA 3JALB 3QE9Y 3EASA 4C3UA 1SHJA 4TKVA 1J8YF 5HZGA 3VR4H 2JIRA 4ZVRA 1CJTC 3DOCA 2VPQA 1NDUA 2WFLB 2LVBA 1LX7A 5BSVA 1VPVA 3OFNA 4TYPA 4YRLA 4L5JA 4IYJA 4JVNA 4C6RA 2RGEA 2W83A 2NU8B 2WJPA 3T0GA 5B5SA 1CE8A 2CKDA 1U3WA 2P35A 3BN3A 4WACA 2EF1A 1MUUA 1R4ZA 2ZBUA 3CLUD 2F8TA 4TT8A 3OF3A 3FJ1A 3I09A 4Q3EA 1JHXA 4MS3A 4W99A 2RHTA 1E3QA 5CVCA 5CD1A 2NUTB 2PTHA 5EIFA 4N6GA 3HO8A 5JAUA 4IXNA 3LV8A 4OI4A 1GTRA 1DKUA 1CR6A 4BOYA 2PT9A 2A1TS 2Q07A 2QJTA 2YMPA 3LPMA 3WBBA 1V8PA 4X1KB 1RPTA 2Q27A 4ZGWA 1MXFA 1U1EA 2BUBA 3IB3A 5HILA 4MUXA 3CVWA 1D9ZA 1F6WA 3KEMA 4M9XA 4YI3A 5CGZA 1QQ5A 2VAVA 5EE1A 4B0PA 1XD2B 3DHWC 1SELA 4UDXX 3C7AA 3OPYI 4U39A 1C0LA 5CBPA 1U7TA 1W36C 1MOSA 5HZMA 1VPWA 2ZS9A 4U63A 5K99A 3QU9A 1ISGA 5G1OA 4XGIA 2YC4C 2VZ9A 5KDOA 4OVKA 1Z35A 3EZFA 3PDUA 4MWBA 3MGGA 5ARBA 4US2R 3K35A 1ABFA 2DXIA 3HO1A 3LRXA 1Z4JA 1ZJJA 3QX7A 3TS1A 3JX9A 1YC5A 4BX0A 3C6ZA 3VUFA 4O4JB 1SU7A 2X14A 3PFWO 3A1SA 1GFIA 4BP8A 5KC8A 3TSCA 3HKCA 4M89A 5A0VA 3IX7A 3EISA 3I0NA 4MAAA 3TEJA 4KGZA 5IKPA 2ZGVA 3RH0A 5M04A 4PC2A 2QG9A 2IE8A 3KZ1E 4XWYA 4WUTA 4DKJA 3N07A 3BWVA 3CZQA 1YR9A 3A70A 1X77A 1N2ZA 1G20E 4FMDF 4KC0A 1GDTA 3A6FA 3H97A 3OE4A 5KQLA 3VVCA 1CYDA 3G49A 2ZRFA 2HL6A 3DLPX 5JVDA 4NFSA 3EGXA 1JIKA 1HG1A 4CM9D 3E9EA 2EG9A 4LRSB 3EDCA 3H4VA 3WGIA 3PQ8A 1T2NA 4J16C 4EFDA 1ODCA 3CRNA 1M2EA 3NI2A 4FYWA 1NW6A 2ZRHA 5K0JA 2EXXA 2O7RA 2WV7A 2ZYTX 5EY5B 5IJXA 3CLUC 1H0RA 5DYWA 5TEVA 3W04A 2AR9A 1DP4A 1ISIA 1RRPA 2ACEA 3FSGA 1XCLA 2VIIA 2X15A 1D4OA 4FHEA 4MV1A 3WP0A 4AZ3B 1Z4IA 3FGZA 1VA5A 2NU9B 4QOIA 3PWZA 1IVYA 1YB2A 2ZBVA 1OLXA 2BHSA 1O1YA 3INGA 1VGRA 3AIOA 4D5GA 1CBUA 1VKHA 5ECWA 2PNJA 4DIUA 1BQ4A 1EGMB 1PV2A 5BT8A 3UXHA 5CXQA 4QX6A 5C9ZA 1EESA 4P93A 3CWCA 2ZRBA 4KODA 1YZNA 4RPJA 1J23A 4R41A 3SHWA 3VOSA 3F67A 1COWA 1LBEA 3DFKA 2Q3MA 1GGMA 1JHUA 1UDWA 3FCSB 5E9QA 4BKRA 4ZI7B 2ERXA 2KLHA 4FXPA 2DPMA 1XN4A 1HT1E 1DWOA 1U7WA 4U7DA 1BCSA 4JC8A 1DU4A 2O1SA 3MN1A 2DBQA 1G7CA 1C8VB 2VT6A 2J31A 4MH0R 3RTGA 1AMUA 1XCJA 3OF5A 3ZVRA 1VJTA 4G1EB 4XRRA 4AUKA 1Y8RA 2X22A 3K1JA 4FR2A 3KQQA 1C3XA 1M6VA 3E27A 4WNIA 5DXJA 2G67A 3V4SA 2BH2A 3COZA 4I50B 4ZCSA 1T0PA 4R2LA 3EQ9A 1URPA 1TRHA 3VJRA 1WCXA 4C7OA 4BUCA 1JRLA 1O6GA 4MKFA