3P19A

Improved nadph-dependent blue fluorescent protein
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
239
structure length
239
Chain Sequence
MKKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFDTAITRAEKIYGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVMTIAPSAVKTELLSHTTSQQIKDGYDAWRVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative blue fluorescent protein
publication title Structure of a NADPH-dependent blue fluorescent protein revealed the unique role of Gly176 on the fluorescence enhancement.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Oxidoreductase
total genus 91
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3p19A00
4GI2A 4NR0A 2CVZA 5JY1A 4E5YA 3GZNA 4XYLA 4CMHA 3ANMA 1NQOA 4BNKA 1R15A 1HYGA 1N1GA 1XHLA 3AK4A 3HSKA 3LC1O 3IDSA 4NPCA 4AJEA 5JO0A 1Q0QA 2UVDA 4OSOA 5KKCA 4YJFB 3W4JA 1HDZA 2I67A 3JQBA 1LXCA 2C07A 4MVJF 5KJEA 2BHLA 4QQRA 5T67A 1GZ4A 3NTQA 2VHVA 4LSMA 4MIEA 4YAJA 3WLEA 2R2GA 3RWBA 3C1OA 1VLLA 1ID1A 2X22A 1HDXA 1U8FO 4CQLA 1FDUA 5HBRA 5A04A 5L7WA 4YVFA 2WSBA 2W2KB 1YO6A 3LVFO 4OHUA 1PJCA 1HETA 3AU8A 5JNLA 1MC5A 2H6EA 4RZIA 5DCUA 1ONPA 1WDLA 1PS9A 2XXJA 4DC0A 4DPLA 4J4HA 3M2PA 3HJAA 3QP9A 3AWDA 5KIAA 2W98A 3GZNB 3DWFA 1LLUA 2JHFA 3VC7A 4BV8A 3H2SA 5IDYA 3L6EA 3PWZA 4OIMA 1C0KA 4LVUA 1H6BA 3WFIA 5BSEA 2E4AA 4FFLA 1X1TA 2E82A 1GEGA 5I8WA 1J49A 3WX0A 3HN7A 1PJQA 4S1VA 2GLXA 4GGOA 5C37A 1GR0A 1P1IA 1MB4A 2EJVA 4UVHA 4JJFA 5DP2A 5EMHA 4CQLB 2AEMA 3PI7A 3ZU5A 3ZW8A 4B7CA 1QP8A 3NTRA 1KYQA 3B70A 4AFNA 4DIOA 3KLMX 2PKQO 3FWZA 3DQPA 2O48X 3KEOA 4JXKA 1SOWA 2C2XA 1GPDG 1ADGA 1QSGA 2D5AA 4M87A 4N5MA 3GGGA 1DIRA 4FBGA 3DXFA 5JAQA 4CV1A 5MDHA 3S2FA 8ADHA 2VN8A 3K6JA 2X1HA 4E31A 4RQTA 3PJFA 1ZO8A 4FJ0A 1SNYA 3K73O 5CG1A 4CL3A 1QYWA 1UXHA 2AEFA 3LT2A 4JBGA 3G79A 2GN8A 4XD2A 3TZKA 3TRIA 4IDBA 3HDJA 4RPKA 3ZWOA 3VZQA 4RVSA 5A9SA 2AQIA 1UZLA 5T8KC 1LDMA 3K31A 4J7CA 2QW8A 1ZJZA 2JFHA 4HNGA 3C3XA 3PZBA 4NMHA 1NPYA 5B4TA 1TT5A 3SJ7A 3ZNNA 3ETDA 4B79A 4RQUA 2C2YA 1Y81A 2FR1A 5ITVA 1PJ4A 1A27A 1DIGA 2A9FA 3WGYA 4YRBA 2EEZA 2F00A 1B7GO 4J2HA 2DM6A 2Z95A 2WJPA 3RKRA 3TFQA 3I9JA 2VOJA 2WTBA 3HZZA 5GZ3A 3KRTA 2VRCD 3JQEA 3QIVA 3PP8A 4QSMA 1G0OA 4TKMA 4M55A 4OYRA 4ALNA 2H63A 2YHIA 3MTJA 3F46A 4UAGA 2PLAA 5FWNA 5MGBA 1B2LA 4YT5A 4BNFA 3GK3A 3GUCA 4BO0A 5F1PA 2ZTMA 2QRJA 4JCOA 4PG4A 5LDHA 3WJAA 4J49A 5A9SB 4A03A 1I33A 1P1JA 2NU8A 3DAFA 5KKAA 2AE2A 3DHNA 4W9NA 1NQAO 4AJIA 4BNUA 1EUZA 1TT5B 2BFOA 1LLDA 1LTHR 3NYWA 4BO3A 1RM0A 2Q3EA 3M1LA 1CQIA 4GL4A 3ZU2A 1EVYA 2DBRA 3JQAA 4B4WA 1E5QA 2ZTUA 4UEJA 3JV7A 1UJMA 4DLAA 5GY7A 2AE1A 4YB8A 1QV6A 1ZW1A 4RORA 4A73A 2QRLA 4J1TA 3WJ7A 4J1NA 3VPGA 3NTOA 5K6AA 1NBOA 4DWVA 2HK7A 2YHIB 2GF2A 4JJGA 5TGDA 4MVJM 5CPFA 3I9LA 2HLPA 3BAZA 4PLPA 2Q1WA 4DBZA 1LSSA 2Q2QA 3LF1A 4CJXA 2GN6A 4E5MA 4MVJP 3Q0EA 4Z0HO 2QQ5A 3HDQA 2YV2A 3GN1A 1LBEA 3KVOA 5IN4A 1U3WA 4R1SA 1EQUA 2I9PA 2X9VA 3E6AA 1TI7A 4O6VA 1HSZA 3L9XA 3PFWO 4IDFA 1PS0A 1ZZEA 5TC4A 3U4DA 1ZNQO 3ZWAA 4I5EA 5CDYA 1DRWA 4XJTA 3U5TA 1Z6ZA 2PK3A 4P38A 3KXDA 3GF4A 1GU7A 1Q2XA 5IZCC 2V7PA 1I10A 1JAXA 2FSVA 3HDHA 3VH2A 3HG7A 3AJRA 2BH9A 3V1TC 2J3HA 5A5FA 4IGEA 4FB5A 4YYZA 1LRKA 1OFGA 4E2ZA 5C7IO 4AICA 1IULA 2ZK7A 5CDSA 3WYEA 2J5QA 3QVTA 3U0BA 3QVWA 4J0FA 1I30A 4WOKA 3IUPA 1DC5A 4U0JA 3ASUA 4AVYA 3CEAA 2EXXA 4MIYA 1DLJA 4TWRA 2W90A 3ASVA 1GZ3A 1XR3A 3JQ9A 4RVDA 5EESA 1H2BA 3ITKA 4J90A 4O63O 2UAGA 4DIFA 5COQA 5TT1A 3RI3A 4B4UA 5TLSA 2DTEA 3X2FA 1HDGO 1U4SA 3DDNA 4GX1A 2O7QA 2O2SA 3FCOA 2HRZA 2NQTA 4LSWA 1GD1O 3ZV6A 4DQUA 3GH3A 4QT0A 5A4DA 3HDYA 1BMDA 1JAYA 2PWZA 3ONEA 1T2FA 3F4BA 4ZQEA 1EVZA 2DPHA 2Q1UA 3ZCXA 2FWMX 1UDAA 1U2GA 3IOYA 2Q4EA 5JW6A 4Y8VA 4M89A 4YDRA 5L4LA 3GDOA 1I0ZA 5KJFA 2G5CA 3OBBA 4Q3BA 1E3WA 2ZJ1A 4FJ1A 1CWUA 1IOLA 2HDHA 2Q2WA 4HBGA 2BGLA 3S2EA 2W4QA 3NAQA 3OHSX 2HKIA 1NYTA 1VSUA 4PLZA 3C1AA 4QFDA 5JDCA 1H93A 1J4AA 3OSUA 1PJBA 4IDGA 4QEDA 1SEVA 3E9QA 1B8UA 4PN3A 3HFSA 2Y1GA 4MDHA 4R5HA 2V6GA 2ZJ0A 3FF4A 3MOGA 4WLUA 3A4VA 4EEZA 4QO7A 1QYDA 3AOEA 4ND3A 4EJ0A 4YPOA 2FPIA 3BMNA 3C7DB 3ORFA 3GVCA 4YTEA 3TN7A 4DMLA 4H3VA 3TJRA 1I3KA 1HWYA 3ENKA 3TZHA 1DXYA 1NNUA 2DLDA 2OFPA 3G3EA 3KSDO 2VHYA 3ZWPA 4NNJA 4ZVVA 1YB1A 3Q1LA 2C5AA 1CERA 1E3WB 4BGEA 4RF5A 4DYVA 1X0XA 1Q7BA 3TL2A 1E3LA 1FMCA 1N92A 2X86A 5COBA 7ADHA 1Q7CA 2EERA 5EQFA 2YW9A 1I32A 3QVSA 4GVLA 4CV2A 1QV7A 3UAGA 4XZ3A 1F0YA 1JN0A 4AJ2A 1EDZA 2Y1FA 2BFPA 4WGGA 3JQFC 3WGQA 2I6TA 3KSZO 4I5GA 4RLSA 1EE2A 3JQAD 3WGZA 2C54A 2HAEA 4BNZA 1I24A 3BMNB 4P4LA 3PHHA 3ROQA 1YJ8A 2QYSA 2X9GA 2NTVA 3LLVA 1U2DA 2R00C 3QLJA 2B37A 3RU7A 4BHTA 3I6IA 1SBYA 2P9EA 4CPDA 3FTNA 4KWHA 3PYMA 3TPCA 1L7DA 1E7YA 3PDUA 3DC2A 1CIVA 3LSYA 4NZ9A 4YBZA 2GZ3A 4YQZA 1R4NA 4RPLA 4LVCA 1E3EA 2VWHA 3DZGA 3NGXA 4FFMA 1AXGA 3JYLA 1CYDA 4NBVA 5A3VA 4LRSB 4IZHA 4JNKA 1I2BA 4PZEA 5JMPA 2A35A 2WYWA 4RDHA 5JE8A 3S55A 4IPTA 4X54A 1WVGA 3C7AA 1LI4A 2Q49A 4PLTA 3OA2A 1PZGA 4FS3A 4K26A 4PZDA 2PGJA 1O95A 3ZWWA 4RF2A 1L1FA 3ZDFA 2X4GA 3DMTC 3EVNA 4XWYA 4A7PA 5C5IA 3LT4A 3ANLA 4BNNA 1UXIA 2J8ZA 4DLLA 4TRRA 3K92A 4Q3DA 2BFAA 1CQJA 2D59A 4OOFA 1P31A 2VT3A 2FSSA 3R3SA 5L53A 1SB9A 1MFPA 2X0IA 1E6WA 4DTIA 1R4NB 3PQEA 1HDCA 4OQZA 3DFUA 3QWBA 5JXWA 4F45A 3GQVA 3QWFA 2GPTA 2ZB4A 3A1NA 2ZB8A 4KUHA 4LK3A 4D41A 5ADHA 4C4OA 2YDYA 1U3VA 4WK6A 3I83A 4IQ0A 2DU8A 2EV9A 3O4RA 1K89A 4LCJA 4YACA 5B4VA 2WD7A 1C1XA 1O9BA 3OJOA 1ULUA 3BMCA 2PZLA 3QWIA 4H15A 4MVJA 5TQVA 5I7EA 3E9MA 4BGIA 2Q46A 4M8SA 1PJLA 3Q2KA 2NU6A 3GAFA 1FJHA 2NUAA 1JQBA 4IJUA 4XYMA 5AXDA 4DVJA 4XQ9A 4GSLA 3ZNQA 1FXSA 2D2IA 4MOWA 4ALIA 1XCBA 3IP3A 4PLGA 4XB1A 8LDHA 2GNAA 4XB2A 2UV8A 1Z75A 5A9RA 3DZHA 4KDFA 1BVUA 4Z3DA 1YBAA 4R4JA 3H3FA 4GKVA 5FFFA 5T8KA 1W6UA 1KVQA 4IUYA 2QX7A 2W2LA 3KO8A 3OQ6A 1FDTA 1HF3A 1E7MA 3INGA 3ZNOA 2WD7B 4OO3A 1C1XB 3H8VA 2FY8A 3H9QA 4GBJA 3SLGA 3BMCB 3G17A 2HQ1A 3JD4A 2OP1A 1T2CA 3R6DA 4E2WA 3WGOA 2HK9A 1DSSG 5I9MA 4XJSA 4KWIA 1VPDA 1RPNA 3DB2A 2O3UA 2GR9A 4PRLA 2G1UA 4ZJUA 4N7RA 4NJMA 3AUSA 3PHJA 3ROKA 2PKQP 4QXMA 5U9CA 3GRPA 4ROSA 4EYEA 1ZUD1 2B83A 4BUCA 4IQGA 3E03A 1PTJA 3AY3A 3DTTA 1EE9A 3U4CA 5GMOA 3WGGA 1RWBA 4BKRA 3OMLA 1LJ8A 1MLDA 2PY6A 1E92A 3F9IA 2OMEA 5U4QA 4TKLA 4LRTB 5BSGA 5IFLA 4Q9NA 2B0JA 4N54A 1ZBQA 3EC7A 3PIIA 4NJOA 2Z1MA 4D43A 4YEDA 1K6IA 2C20A 5K0ZA 2XXBA 1QYCA 2D3TA 3DBVO 1A7AA 1HTBA 3FTPA 4NJMB 1ENYA 4BKOA 4ZD6A 3MZ0A 4MVJH 2AMFA 5I9NA 1MG5A 5KWEA 1P1FA 4NBUA 5HA5A 5L9AA 3RU9A 2DUUA 4BQPA 3C85A 1A4UA 1UAGA 3PTZA 3DZBA 4DQVA 1D1TA 2DVMA 4GLOA 4R5MA 3UFXA 2DBVO 1GUZA 1W0CA 3DAPA 3ONDA 3SBOA 1X13A 5JAZA 5ILOA 4WASA 4TVBA 4PFJA 3EZYA 1DC6A 2BI7A 4LW8A 5IXSA 3FRJA 4ONEA 1ZMTA 2BGMA 2P9CA 1Y8RA 1ISIA 1Z7EA 5HM8A 1JLLA 1KS9A 5EERA 5FI5A 4XRGA 4IJKA 3GMDA 4DLBA 1TLTA 5I7VA 4FOOA 2PH5A 1P1HA 1Y7TA 2DBQA 5H81A 4BGVA 2NVBA 1R4MA 3I9OA 5IZCA 2VWQA 3JQ7A 3VH3A 4BO7A 1EFLA 5CEJA 2IEDA 3Q11A 4FC6A 4ALKA 4DXHA 5A1TA 3QVXA 4PLYA 3DOJA 3V8BA 3I6QA 2CY0A 4CM4A 4E21A 3Q2IA 4YRDA 1UP4A 4BNIA 5JCJD 5CPBA 1LSJA 5TJHA 1Y8RB 4J3FA 2QZZA 1WLYA 4PGFA 5DCWA 4QFCA 1MC4A 1EVIA 3ROMA 1KBZA 3OQBA 3U09A 2NU7A 4MVJD 2UYYA 1PJ2A 3VKUA 4TZTA 3HE3A 4R41A 1YONA 4PG8A 1RJWA 3F3SA 3T4XA 3B1JA 3UICA 1R4MB 1YWGO 3GY0A 4HV4A 2C29D 4Q3EA 5L4NA 4U6QA 3JQ7B 1UUFA 3DOOA 1IPEA 3F1KA 3V2UA 1HLDA 3VAZA 1PR9A 3FSRA 2BFMA 5DNAA 2ZB7A 1PL6A 3O8QA 4MKXA 4PRKA 1RM3A 2C7VA 2P5YA 2A4KA 1U5AA 1SB8A 3C8MA 1T4DA 4CM4B 4XA8A 1BSVA 1NM5A 1ISFA 2E6UX 3FNFA 3RJ5A 3GHYA 3IIEA 2JCVA 4FIZA 3W8DA 1K2WA 3ROPA 1NAIA 2IXAA 4NBRA 5I7FA 2W2LD 4R1UA 2WM3A 4BO5A 3DEYX 3GZ4A 3VDQA 4EUFA 2DFDA 3WQSB 4CUZA 1SZJG 2IYPA 2PZKA 4G5HA 1T1RA 1R0KA 2B35A 4OJNA 3VZSA 3WNVA 4FGWA 2GSDA 3RBVA 1BWSA 2QYTA 4DC1A 2CDAA 3U49A 4PLHA 4U6SA 1BRMA 1M75A 5AXBA 2Y0CA 2V6MA 4LN1A 2B4TO 4OH1A 4BO1A 2ZIZA 3O8QB 4GLLA 4WPGA 3UCFA 4TROA 1AHHA 3K96A 1KC1A 4BNTA 1PZEA 4CM8A 4E5KA 4BKUA 3D4PA 4BKPA 5CFZA 2AQ8A 4BKQA 3V1YA 4HADA 4YT8A 3VOSA 3W4IA 3JQFA 2EGGA 4NBWA 4O1MA 2I3AA 2GO1A 3U3XA 4DMMA 2VRBA 1ZVMA 2O3JA 3WBFA 1E5LA 3B20A 2OBNA 3AOGA 1U3TA 2P2SA 1N5DA 2PA3A 2C7GA 3ANNA 3GEGA 2HUNA 3PDJA 4II2A 1U28A 2R00A 1DIHA 1GAEO 4NBTA 4NFYA 1R66A 3RROA 4A2CA 4CR8A 5TS3A 4JGBA 4MP8A 4M1QA 4JBHA 3N58A 2QZ9A 4PLFA 4IGFA 1C1DA 4E3ZA 1J5PA 3PHIA 4XIJA 4GVXA 2Q1TA 2EKPA 1DPGA 2WEKA 4URFA 2X5OA 4FFPA 4CM8B 5J23A 5L7YA 3W6UA 5JLAA 4W82A 3ZWXA 4DPMA 4R54A 4WNCA 3GNQA 4EITA 1GZ6A 3DL2A 3D3WA 2GDZA 4RZHA 4FR5A 3GG9A 4BNHA 5AOVA 3WSWA 2Y05A 4J9VA 4D0RA 2DQ4A 3U4HA 1YB5A 2EW8A 4IS3A 4OMUA 4CMAA 4CMEC 3BA1A 3GEMA 4E0BA 3I1JA 3OIGA 1ZCJA 2EIHA 1VSVA 2UUPA 4P4GA 2X58A 1NP3A 1A9YA 3EW7A 2YV3A 4BL5A 1VKOA 4PVDA 4CMJA 3DMTA 1DFGA 1K0UA 4G2NA 5EN4A 4RLHA 1QMGA 3K30A 4IM7A 1O0SA 4Z9YA 4KTTE 2EJWA 1ZXLA 1C1DB 3I9MA 1D3AA 1HL3A 2HSDA 3G49A 4TRJA 4GWKA 3ZU3A 4Y67A 3EUWA 5JFOA 2DPGA 1GDHA 2YV1A 4OXYA 2C82A 4MINA 1XWFA 3FBTA 3GDGA 4IIVA 3D3WB 4NDNE 1FF9A 4JK3A 4MVJE 3ZZNA 3TFOA 2H9IA 3TNLA 3MJ4A 3TL3A 4KUEA 3O26A 1XU9A 4CM9A 2Q99A 1YQDA 5LC1A 5I9LA 4CLEA 3NV9A 5DBIA 4ZU3A 3V1UA 3D5QA 4IXWA 1VL6A 2IDZA 4RL6A 1YBMA 5IDQA 1IZ9A 4WJZA 4CLXA 1SOVA 5KCZA 3ZH2A 3EZLA 2NVUA 2W8ZA 3TOZA 4AG3A 3JYOA 4XYEA 3WNQA 1DO8A 3MWDB 5AXAA 5C7LO 1AE1A 3Q6IA 4AJJA 3O03A 3TQHA 3BTSA 1R0SA 3DMYA 2FPGA 2GERA 1ENPA 3E8XA 4J6FA 4KP7A 4OAQA 1Y1PA 1NFRA 5HTOA 2E37A 2RH8A 1GYQA 3B6ZA 2OOSA 4PLCA 5L95A 4XDZA 3N7UA 3CH6A 4FOSA 2DC1A 3GUYA 1TVEA 3MJSA 1NPTO 2Y1EA 3H5AA 1V9LA 1ULSA 2JD1A 3L4SO 3VPHA 4YAKA 3ZWCA 3JD1A 1GCOA 1AHIA 2CVQA 4J4TA 5A3JA 5IN5A 2EP5A 3FPCA 3GPDG 4IS2A 5TF4A 5FI3A 4MVJG 3OQ1A 3H9JA 4EDFA 4D42A 2EKLA 1OI7A 1YKFA 2AQKA 2OGUA 1QLJA 3E18A 5DP1A 3FN4A 3JQAB 4EBFA 1H9BA 2AA3A 3GC6A 2IEBA 3DTYA 3GFBA 4XYGA 3I9KA 5G0SA 4B3IA 4YXFA 4Z9FA 2RH4A 4FC7A 1DFIA 4K9DA 3WYBA 3LYLA 5T57A 1B26A 1GPJA 4R69A 5ER9A 2I5PO 3ABIA 4BNMA 3L4BC 5G0WA 5C3MA 3OETA 1H94A 1A5ZA 5TJ9A 1ADFA 2FZEA 3UKOA 2YJZA 2Y1CA 3H6KA 2IE0A 1RYEA 3ZHYA 4IJWA 3UF0A 4PIVA 2TMDA 2JKVA 5BSFA 2GD1O 5G0TA 4Q3NA 1P33A 2OHXA 3GGPA 3H2ZA 1DC3A 2UUOA 1FDSA 3PIDA 3EMKA 3WGIA 2G17A 1W8DA 1YS4A 4PVCA 4HUJA 5BSHA 1M6WA 1XQ6A 3RFTA 3ZWBA 5GZ1A 4MJLA 5JC8A 1ZMOA 3PJEA 3GHHA 4IDAA 5JCXA 3SLKA 4R3NA 2YHUA 2PD6A 3AM5A 5GZ6A 2CSUA 4R3WA 1GEEA 2PZMA 1LUAA 3QVOA 3EHEA 3IP1A 4RF4A 3I5MA 2CUKA 1HZJA 1SMKA 1O94A 2YFHA 2J6IA 1TEHA 4Q3CA 3ITDA 3KM0A 5HS4A 4P22A 4YT4A 3NRCA 1TB4A 4DPKA 4CLOA 4DBVO 1TA4A 1GY8A 2HJRA 3UH1A 2ZQZA 4XR9A 5JSFA 2O4UX 2GASA 2LDXA 3GFGA 3IAHA 2RAFA 3JYQA 4ESOA 5A5EA 2IRWA 4ILKA 5CEEA 5JYEA 1DEHA 3LZ6A 2UDPA 1B3RA 4GGPA 4H16A 3OH8A 3AI3A 4WOJA 3WG9A 4BB6A 1F06A 1GYPA 4CM6A 1NVTA 2ZATA 4CL8A 4ZA2A 2AG8A 3GVXA 3BHIA 4U8GA 4Q39A 5EINA 3O9ZA 1M2WA 4WLEA 3D4OA 5JAMA 1N2SA 4YWJA 2RHCA 3GDFA 4INAA 4DA9A 3SVTA 3RUDA 3LK7A 4Y9DA 4YAEA 2PTGA 4PG7A 2VHZA 2YQ4A 4UUPA 3K9QO 2O3QA 1DB3A 3AI1A 4CLOB 1KIFA 3WTBA 1KC3A 2X5JO 2IZ1A 2JHGA 5TSDA 4FD3A 2Q2VA 1YL5A 5IG2A 3TOXA 1PX0A 3ZI0A 1CETA 5L4SA 1NVMB 1NVGA 4QX6A 2RHRA 5T64A 2WMDA 3HB4X 4CM9D 1ZK3A 3I23A 5C7OO 1XEAA 3FWNA 3RUFA 5DBFA 3AY6A 1AXEA 5IXYA 1IE3A 4XGKA 2HO5A 1B0AA 3IKTA 2GRAA 2GN4A 3OEYA 4DRYA 1YL7A 3M1AA 1I5RA 2J3JA 3F5SA 3KZVA 2NWQA 4QECA 1D7OA 4BMNA 1YQXA 4NH4A 4CMGA 1ZEMA 4AJ4A 3HQ4O 3NEPX 3OICA 5DBGA 1Q0LA 3HUDA 4F3YA 3WDSA 2E48A 1ADCA 1PZHA 2OUIA 1HEUA 3LT0A 4DUPA 3AFMA 1M6HA 1PZFA 4DIBA 1PJSA 4MP3A 1QKIA 3LDHA 2FR8A 1JVBA 2QIOA 4E32A 1VJ1A 4FDAA 1QXSA 4TSKA 5ILGA 3C24A 2C59A 2Q1SA 3E48A 3ZV3A 3F4LA 4RPJA 3UCEA 2DBZA 2Y1OA 3DBLA 4AJ1A 1E1LA 3JQ6A 1NPDA 2ZYDA 3RUCA 1E77A 3GA0A 2EP7A 1LRJA 4YAGA 1GCUA 1N9GA 2NLOA 4JP2A 4FJ2A 2GGSA 4WLOA 3VPFA 1R37A 4GX2A 4J9UE 3DZFA 4ZRNA 4AJLA 4BO9A 5JMWA 3VH1A 4TMFA 1E6UA 1KVRA 3T4EA 1PWXA 3QY9A 3W8FA 2IZZA 4CM5A 3MOIA 2X0JA 2D1YA 5HS6A 4KDEA 4OQYA 4G65A 4QUKA 5FF9A 4A27A 2NM0A 1XA0A 2ILTA 3WWZA 4FFRA 4MO2A 1EBUA 3D1LA 4J0EA 3O38A 2WYVA 5IAAA 3MTGA 1BXKA 3ZNPA 5F1KA 1Q0HA 1DOHA 4RVUA 3KSUA 1WPQA 1E3IA 4JLWA 4Y6RA 5JCJA 3WQQA 4F6CA 1QYVA 4WCFC 2ZCVA 3GMSA 3KOUA 3QE3A 4FN4A 4L0QA 1EVJA 1O6ZA 3BHMA 3DBLB 1MXFA 1RM4A 1B15A 4OL9A 3CXRA 1ORRA 5KJCA 3CMCO 1I8TA 2I76A 4XQGA 4EW6A 3I52A 1N9GB 1BXZA 2JJYA 2QHXA 3EK2A 3FNEA 3GVPA 1QR6A 4ZHSA 3GOHA 4XQCA 3T7EA 5CDTA 1VL0A 1CJCA 3K2EA 3AW9A 1BXGA 2EG9A 1WMAA 1HSOA 4CM7A 3JD2A 4LISA 3WQRA 4R16A 5KVSA 3WMWA 4UVEA 4WLNA 3RFVA 2FMUA 2HJSA 1K6JA 4D79A 1ZIDA 1JDJA 1SO8A 1ZK1A 3P2OA 2NACA 4WKGA 3ONFA 1SC6A 1CRWG 1NHGA 3QRWA 1OOEA 2CNBA 3ZHZA 4N18A 4HFRA 1ONNA 5KVVA 4I5DA 4B3HA 4FGSA 4Y6SA 3KLPX 2IODA 1IUKA 3DZJA 2Y0DA 3F1LA 4CMEA 3UXYA 1G0NA 2G0TA 4JBIA 4L73A 1H0KA 1CEQA 1WNTA 2Y99A 4JJIA 5ENDA 1U8XX 1ZXBA 3PYLA 1DBVO 5HRUA 2FPPA 4KQWA 3ZV5A 1GQ2A 1GTMA 3PHGA 4BO4A 4UVDA 4TRMA 2PR2A 2C0CA 4CQMA 1BXGB 3D0OA 3JD3A 1E1MA 4XYBA 3VVBA 4K6FA 4J43A 2AHRA 2BELA 3RC1A 3QWHA 1HLPA 3X2EA 3H65A 3VZPA 5IZ4A 4B7UA 4BNYA 4XKJA 1H6CA 3GEDA 3H9EO 1KOLA 5B37A 1TT7A 2D8AA 5CDUA 5A03A 4L74A 3VPSA 3F5QA 1Y5MA 3GPIA 3S8MA 3HB5X 3DBRA 4ITUA 4R9SA 2P68A 3ZN2A 2R6JA 4H7PA 1KEUA 2WE8A 1RM5A 2X6TA 4IDDA 4EUEA 2PH3A 1X15A 2BKAA 3JQ8A 2NQ8A 3BTUA 4A5OA 1GQQA 2HCTA 1XKQA 2NADA 3KHUA 1KY4A 5EL0A 2QG4A 4N5LA 2O4CA 1ONOA 3BXXA 1EMDA 1LX6A 4P8RA 4CQMB 2Y68A 3OJEA 1HE5A 5TT0A 3KYDA 4D46A 5BQFA 3N74A 1PL7A 3JQGA 3GLQA 2B69A 4XEHA 1E0DA 2CF6A 3QHAA 2O2YA 2HU2A 3UHAA 4U7WA 3LF2A 1BDMA 1YQGA 1PGOA 4WCDA 2X8LA 4U0KA 3BIOA 4CMBA 2Y67A 4PCVA 3IUSA 4ID9A 1PEDA 3G1TA 3DBRB 2YYYA 4LMPA 4MIOA 4CM3A 3DHEA 5AVOA 2BMAA 4CODB 1NQ5A 3JQ8B 4BNVA 1NR7A 2JAPA 4AJPA 2H5LA 1SCUA 4IMPA 3FI9A 1P0CA 1B16A 1N1EA 1R6DA 3SC4A 3WICA 1J6UA 3GNTA 4J2OA 3A14A 2VZ9A 3LQFA 4JROA 1ML3A 1P3DA 3KYDB 5JYDA 1B8VA 1LC3A 3JSAA 3JQGB 1M67A 5DDIP 4JN6B 4L75A 2VOEA 4D7AA 1H2HA 3ENNA 1A7KA 3EYWA 3L4BA 5KJ6A 2DKNA 5BNTA 4L4XA 2JAHA 1WDKA 4XR4A 3ZWVA 1OBFO 1SPXA 1I2CA 4NHEA 4YQYA 4DQXA 5JPIA 4ALLA 1MUUA 4GMGA 5G0UA 3K2BA 3WOHA 3KEQA 3DZKA 5I7SA 2NTJA 1P77A 1X0VA 4AJNA 4WECA 2QRKA 4MPDA 4AJOA 1JKIA 1DLIA 1FK8A 3NT4A 3B1KA 3AM3A 1UP7A 3NJ4A 1U9JA 1EUCA 1FDWA 1JWBB 2B4RO 5ES3A 3AUAA 3UW3A 1U5CA 3ETGA 5B1YA 4YJHA 3MJEA 2CMDA 1H9AA 1U1IA 1JKFA 3GR6A 5IJZA 1M76A 3SXPA 3I3OA 3L6DA 1VM6A 3DR3A 3ON5A 4R1NA 4OXKA 2OBYA 2ZQYA 1ENZA 5EIOA 1W73A 1QYXA 3H5NA 3VH4A 1ZFNA 2HRBA 3JCZA 5FYDA 4DL9A 2NTNA 5BNFA 3ICCA 4F6LA 4TZKA 2VTEA 4CR7A 2FR0A 3ZGYA 2BI8A 4BV9A 2PD3A 1LDBA 3K5PA 1YL6A 5JDIC 1OZAA 3PLNA 3L0DA 3DHYA 1E7QA 1P1KA 1GFSA 1GUFA 2WWRA 4Y6PA 4BMSA 3EAGA 4HP8A 4BNJA 3CTMA 1GV1A 4FPXA 3INTA 3ETEA 2FZWA 4YJHB 4YJDA 2VYVA 3ADPA 3STHA 5L45A 3ZW9A 2Q50A 1L7EA 4BB5A 3K8ZA 1KEVA 1OAAA 4L4RA 1KEPA 5ER6A 1DHTA 3NT2A 1Z45A 5THKA 3IJRA 4GQAA 3BHJA 4A26A 1NFFA 1E7SA 4E2YA 1KY5A 4JQCA 3P5SA 4UEKA 4CQMD 5CG2A 2X23A 2XAAA 2BRUA 2Y1DA 2YFQA 3JYPA 2WDZA 3IS3A 4IINA 2J5KA 4JP3A 1IHYA 3OFSA 4BVAA 1YDEA 4YJGA 3RCBA 4G81A 3OEWA 1SEPA 1Y6JA 2VUSA 4BO8A 1EFKA 1KETA 3TZ6A 1WWKA 1ZSNA 4PLWA 2FRDA 3CE6A 2VHWA 5T6BA 3PHLA 1H6DA 3M2TA 1O89A 2VWPA 3NGLA 4IDEA 3MJTA 2ZCUA 3QV1A 1G1AA 3CPSA 4BMVA 4UUNA 3RC2A 4RF3A 1YH3A 4KOAA 2VHXA 3V2HA 2VUUA 5ICMA 1BDBA 4RPGA 9LDBA 1U7TA 1U7HA 1Y9EA 1MXHA 3VHRA 1LDNA 1YDWA 3GN2A 4NFSA 4Z3KA 1O8CA 3HADA 3ZWNA 4KUGA 5A06A 1C14A 1V8BA 2ET6A 2PGLA 1LC0A 1NQTA 1E1NA 3JTMA 4L4SA 4WEQA 4KTVE 1LSUA 1MX3A 4E33A 4YJGB 3ZHBA 5BNIA 3KYBA 2B36A 1WDMA 1YBVA 4I8XA 2EF1A 1NHWA 1YVEI 4Z0TA 1F8FA 3RUEA 4NK4A 3E9NA 5B4UA 4R01A 2FP4A 1Z82A 1Y9AA 3S2GA 1B8PA 3SC6A 1XSEA 2EKQA 4RV9A 5CAEA 3TZCA 3H4VA 3NT5A 1KERA 5TRTA 4W6ZA 5AQ1A 2XPCA 1UZMA 2PV7A 4I9HA 1AN9A 3FNHA 4J7UA 2J5RA 1DHRA 3OA0A 1MG0A 4ZICA 3OJLA 1NFQA 3VTZA 1G6KA 5BT9A 1B3BA 3IKVA 1X14A 3MCVA 3F6YA 3WIEA 3NKLA 3RJ9A 2YZ7A 1PGJA 3D4NA 5JY6A 2O50A 1DRVA 4PZCA 4HWKA 3ZWYA 1JTVA 3RFXA 2G76A 2HMVA 5KNLA 4GX5A 1AGNA 1IY8A 4GH5A 4B4OA 1UXKA 3IC5A 3PXXA 1ADBA 1A72A 2VZ8A 3I9NA 3AI2A 5B12A 2VZ0A 4NK5A 4B8ZA 3DO5A 2I3GA 1GUYA 4FCCA 2ZTVA 5CEFA 1Z74A 4WCFA 1K3TA 4RVFA 3AFNA 3GG2A 5I8ZA 1HRDA 1P44A 1P74A 3VVCA 1NX6A 2WYUA 4J1QA 4E12A 4OOEA 4Z6KA 3A28A 3RC9A 1K6XA 4NI5A 4XDYA 2RBEA 5EJ2A 1PWZA 3QW2A 1BHSA 3GVIA 4XGNA 4E5NA 1T4BA 1VC2A 2I99A 3BTOA 1JA9A 3KYCA 1P1RA 2JFFA 3LLSA 1MA0A 2VWGA 4HFJA 1E3JA 3SJUA 3V2GA 1XG5A 5L51A 2Y93A 4CR6A 1F12A 4EI2A 5ENVA 1E3SA 3VDRA 4E6PA 1V0JA 3MJCA 4HY3A 4PG5A 3DOCA 2VNSA 4QO8A 1UH5A 1LDEA 1UXJA 3AY7A 3UUWA 2ZYAA 4FFNA 3WXBA 4KZPA 1Z73A 5LCXA 3WWYA 4P4NA 2A94A 1R16A 1WXDA 2P9GA 4HFNA 4RCVA 2GUGA 3UCXA 4UREA 4DYDA 1XYGA 3DZIA 3D7LA 4ZQGA 1ISHA 4WCFB 3NX4A 1F14A 1EUDA 4JIGA 5JBIA 1LRLA 3NDIA 4IQ8A 4WUVA 1J0XO 2LDBA 3WGHA 4EJ6A 1ZKMA 2IZ0A 2Q45A 4ALJA 4OXNA 1QRRA 1YJQA 2VYNA 2IYOA 3BZUA 4ZQBA 3PYXA 3CKYA 3KYCB 3KETA 1A71A 3MJVA 1Q1NA 2VYVD 1IB6A 3AU9A 4XGIA 4BNWA 2D0IA 2C5EA 3AUTA 1E6EA 3FR8A 4IDCA 4O0LA 3A9WA 3R1IA 1UDBA 4NFHA 1P45A 3LC7O 1VKNA 2NVUB 3RIHA 4IXTA 1HXHA 1I36A 4Z9XA 5DF1A 2DTXA 1EQ2A 3MEQA 3WS7A 1ZH8A 4DREA 4IY1A 2GZ1A 4B7XA 2P4HX 5G4KA 4B8WA 1ENOA 4GPD1 4UUOA 4KQXA 2OL4A 2CZCA 3R3JA 2V65A 5CDGA 1HYEA 4E30A 1GQYA 5CHEA 4I9UA 5DN9A 1DJNA 3GT0A 4LGVA 4UUMA 1LU9A 5COAA 3PQFA 4BQRA 5TX7A 5EPOA 1Z7BA 5LDGA 1VRWA 1WW8A 2B4QA 1NAHA 6LDHA 4M54A 4CM1A 3E5RA 4E13A 1PJTA 1V35A 2VNAA 3H7AA 3L9WA 4XIYA 2B5WA 3T7CA 2G82A 3CUKA 4EEXA 2BLLA 4N5NA 1NASA 3PRJA 4R51A 5G4KB 5IF3A 2DFVA 3RUIA 1T25A 4ND5A 4WLFA 4XRRA 1I01A 3DBHA 1IZ0A 2Y66A 4WEOA 5JO9A 1FDVA 2CFCA 4FW8A 2JD2A 1PIWA 1PQPA 3H5RA 1X7GA 3WBBA 3ZV4A 2PD4A 2RIRA 3WGTA 1NTOA 1XQ1A 4FSHA 4XCVA 3OJFA 1IL0A 2DTDA 5G4LA 3V5NA 3NUGA 1UXGA 1LQUA 3FR7A 3PFFA 1HE4A 3JQDA 3OECA 1PQUA 1I3MA 3OP4A 3RKUA 4S3MA 1VE9A 1RYDA 3GGOA 2X0RA 1K5HA 2X7HA 1GADO 1EZ4A 5G2OA 4EGFA 5IDWA 1I3NA 1P9LA 5AYVA 4E2XA 2HMWA 3PWKA 5JC1A 4J91A 3P19A 5CP8A 4CLDA 3CMMA 3C1TA 4MKZA 3VZRA 3L77A 1UDCA 4R1TA 2BF7A 3CSDA 1YRLA 3KBOA 3DBHB 3B1FA 3D64A 1PQWA 4ZQFA 3W8EA 3KB6A 4BOYA 1IYZA 4D3SA 1PJ3A 3SEFA 1LDYA 3FNGA 1UAYA 3U4IA 4QTZA 3WMXA 1V3TA 1MP0A 2Z1NA 1VI2A 3GNSA 1HDYA 1LNQA 3A06A 3H9UA 3JQBC 3Q9UA 1BTOA 3PWSA 1N7HA 3IL2A 3WLFA 2OP0A 2IXBA 3H9GA 2WD8A 1SAYA 1UZNA 3E5MA 5KVCA 2NVWA 5TIIA 1BW9A 3PLRA 1X7DA 5ICSA 4XQEA 1PS8A 2PGDA 4M49A 3PVZA 2GZ2A 3U9LA 2CDBA 1JKJA 3IMFA 3CZRA 2EGHA 4J1SA 1MV8A 3GVHA 3NDRA 1HDRA 5U1PA 3FBGA 1WAMA 1PU2A 5KOIA 3G0OA 5JDIA 3MWEB 3I4CA 2X0NA 4MP6A 2YDXA 1HDOA 5TNXA 3WIDA 4C7JA 3ICPA 2NSDA 1ZK4A 1F8GA 1PL8A 1XIVA 1D8AA 4J7XA 4WE3A 2D5CA 4HNHA 2CF5A 2XF8A 2I65A 4I5FA 3ZHXA 4OSPA 4BGUA 6ADHA 2VQ3A 4W7HA 4IBOA 1A9ZA 5FEUA 1T2DA 3EDMA 4EJMA 2VYND 2V6BA 4ND1A 1BW9B 2TMGA 1UR5A 3QQPA 4B3JA 1YB4A 1I3LA 1NXQA 4K6CA 4NIMA 2A92A 4YAIA 1DAPA 3UN1A 3WSVA 3FD8A 4GKBA 3IQDB 5EQDA 4L9RA 3W6ZA 3EVTA 1HYHA 2O3SA 4CLRA 3OM9A 4BO2A 4OGWA 2OORA 1KEWA 1NWHA 1C3VA 1XGKA 3S1LA 3HHPA 4WLVA 1ZK0A 2AG5A 1C0LA 4NG5A 4A10A 1DRUA 1DDOA 4BS9A 4RJTA 3LT1A 3WR5A 4ZN6A 1S7CA 3ZWMA 5KVQA 3W1VA 2OZPA 1X1EA 1KVSA 2H1SA 4RVHA 5T5QA 2P4QA 1H5QA 2OXIA 1BG6A 1EK5A 2HMUA 2JD0A 3DONA 4K28A 3Q9NA 3JD0A 4ZQHA 3D3EA 2GCGA 2B5VA 3E82A 3LU1A 4I1IA 5DZSA 1VL8A 4HXYA 1P0FA 1E1KA 2J3KA 4LMRA 1V3UA 4CLRB 3KTDA 1V6AA 3D5TA 1D1SA 1GV0A 2RCYA 1PSDA 3PQDA 5G0VA 3TF5A 1HZZA 4OKNA 4EUHA 2HMTA 3JQCA 4UVIA 3RD5A 4GMFA 4E5PA 5F1OA 1WMBA 3VTFA 1T24A 3OIDA 1OMOA 4BNGA 1LLCA 1DIBA 1JW9B 4KMSA 1VJ0A 4NU5A 1V3VA 2AXQA 3INRA 4RGBA 2VCYA 4W9NC 4BO6A 5L40A 4CUJA 1EEHA 1QG6A 2SCUA 4TRNA 4U5QA 4AL4A 2NU9A 4W4TA 1F17A 1Q7GA 3AM4A 3P2YA 1B14A 1R12A 4GAEA 3SX2A 1IPFA 9LDTA 1VJTA 2EWMA 2ZTLA 1W4ZA 1ZK2A 2NNLD 1LSOA 3RBXA 2VT2A 2FHSA 5KTKA 2Y0EA 4Y98A 3ZU4A 2E49A 3RVDA 5K6AC 1ISMA 4BIIA 1U4OA 1PGQA 1WZIA 3BMOA 4IIUA 3QWAA 2DAPA 1LDGA 3RC7A 2YUTA 2AQHA 2FN7A 1ZSYA 1JU9A 3PGJA 4PLVA 1CF2O 1OC2A 1U3UA 1E7WA 1C0PA 3RAJA 4W99A 2CVOA 4PG6A 4GX0A 1KVTA 1HT0A 5KJ1A 3DAGA 4YCAA 1I2ZA 1O5IA 4R68A 2ZB3A 2PNFA 4D0SA 1NWCA 3EY4A 5H82A 4MKRA 2D4AA 1OC4A 4J16A 4E4YA 2Q4BA 2CD9A 5ITWA 2JL1A 1LQTA 4EZBA 4HFMA 3IJPA 4WNIA 4CV0A 1ISJA 3L07A 2EHDA 4IMRA 4YR9A 3F47A 5AXCA 3BMOB 1Y8QA 3W4KA 1XDWA 4CMKA 5HWSA 3ADOA 5DULA 3PK0A 3PGXA 5BR7A 1ZSVA 3M6IA 4D3DA 1XLTA 1PGNA 1YGYA 4L76A 4B4VA 3BYZA 4RVGA 4UEOA 3NDJA 3S2IA 3WTCA 1ARZA 1D4FA 1H6AA 4OM8A 1E7RA 1PR3A 2NV6A 3BMQA 1ZJYA 2PFGA 3Q3CA 1GYRA 1CDOA 3RUHA 4A0SA 2PKRA 4K1LA 4ZRMA 4AJHA 5L7TA 4HX5A 4GWGA 3CIFA 2JFGA 1HE3A 5F21A 4F46A 2O7SA 1ISGA 1C0IA 4O59O 3I4FA 3JQ9C 4C7KA 1WP4A 4ND4A 4DGSA 1X7HA 5THQA 3GAZA 3HNPA 1BVRA 4RO0A 1T26A 4ALMA 2J3IA 3UOGA 2YY7A 1WZEA 4O5OA 4L8VA 4CMIA 1MGOA 1S6YA 4D44A 3PEFA 4RDIA 1Y8QB 1LA2A 5F5LA 5A05A 1QORA 1MFZA 3OF2A 3JYNA 3R0IA 4BNXA 4CMCA 3PJGA 5L3ZA 4CLHA 1DJQA 1HE2A 3H3JA 3PZRA 3ST7A 3KV3O 3E1KA 4FFOA 2DUWA 4NQZA 2WE7A 3NJ8A 3FHLA 2I66A 4HKTA 2O23A 4RPHA 4NU6A 3BMQB 4Z0PA 4TVOA 1HKUA 1T2EA 2AEJA 2POQX 1IHXA 3WYCA 2DT5A 4ZGWA 3FPLA 3COSA 3EGOA 3RASA 4W7IA 4CUKA 3WB9A 1QLHA 2ZYGA 3C7CB 4UVGA 1UP6A 3RSHA 3PPIA 4I9NA 1YOVA 5JS6A 2EW2A 2O3RA 2HMSA 5DCYA 3DFZA 5JDCC 1EDOA 1R0LA 4YA6A 3HWRA 4UULA 1RKXA 1N7GA 2VUTA 2XOXA 4XX0A 3RBZA 4MVJI 3ULKA 3LC2O 2PZJA 3P7MA 4M86A 2GN9A 4IZIA 3AOEC 4CMIB 3OIFA 5DOZA 1YE3A 3RUAA 5A02A 1XU7A 3OJ0A 2VRCA 3QSGA 1DAOA 1PGPA 5H83A 4TQGA 2CDCA 3TSCA 1T2AA 1Y5RA 2FOIA 5JAIA 4ND2A 7MDHA 5F5NA 4CV3A 3HFGA 2BD0A 3UGKA 4LCEA 4FQ8A 1DC4A 5A9TA 3WFJA 1EK6A 4D3FA 2HK8A 1ZEJA 2AW5A 4AJKA 1T1SA 2VTDA 2P91A 1N8KA 2YQ5A 4IJVA 3VKVA 1LEHA 1AUPA 4OKIA 3PJDA 5DOVA 3QA9A 5F3RA 1YOVB 2X9NA 3TDKA 3QJ5A 4II3A 1XELA 3L6OO 3VPXA 4YJFA 1DFHA 2F1KA 2Z5LA 2BGKA 1A4IA 2GYYA 4JX8A 3U62A 4Q3AA 4R9RA 4D45A 3HN2A 1JWAB 1DIAA 1LLQA 2JCXA 3KUXA 5IDXA 2X5KO 4J4BA 2JCYA 1GL3A 3TWOA 1JVSA 1KVUA 3G1UA 2OO5A 1YXMA 3UVEA 2W2KA 1TXGA 1NR1A 4BNLA 4I08A 3BTVA 3CINA 4YRAA 1M66A 2P5UA 4GSKA 3RQSA 3TZQA 4YT2A 5DT9A 3GRKA 2V6FA 3AUUA 1EBFA 2ZKLA 5K9ZA 2O3TA 3CZMA 1BGVA
chains in the Genus database with same CATH superfamily
2H5EA 2W0SA 2PGAA 4NR0A 2AVDA 5JVDA 5JY1A 5JJIA 3GZNA 5EIBC 3RQIA 2DH6A 3KBBA 4V0SA 4Z0NA 4KI0A 4EYKA 2UU9B 2NZVG 4BNKA 1Q5PA 4HPWA 1JXMA 5KKCA 3W4JA 4B7AA 3VUFA 3UGJA 4R2KA 2BP7B 4IIFA 5F3WB 1OX4B 4K9LA 2R0QC 4QQRA 3PUIA 2M2IA 5T67A 4TMKA 4K2AA 1MC8A 4X00A 1BNCA 4WK2B 2R2GA 2CXHA 2PSHA 2ZBFA 3C1OA 5IUKC 3B38A 1U8FO 4CQLA 4IIBA 5HBRA 5A04A 5JS1A 3C87A 3NYQA 3EXAA 2YWDA 1EHIA 2QOEA 4Q4JA 1YO6A 2Z08A 1Z6GA 1RXCA 2H07A 1NRWA 1SU8A 2OZEA 3OT5A 5AVZA 4EB6A 4NVRA 3AHHA 1Z6XA 3AU8A 3E84A 2MWMA 3RLFA 2E4ZA 1MC5A 2ORYA 5DCUA 2IWHA 2WNIA 3G23A 4CDMA 5B6IA 3IAEA 3O73A 4JJZA 3N53A 3W5DA 2E4YA 3LQ1A 4J0QA 2ZAOA 4LJ7A 5HQ3B 4MVYA 1XLUA 3IAS1 1JDNA 3M9WA 2PV0A 3FXAA 5E1OA 5KQSA 4GOJA 1MX5A 3GRVA 1SCNE 3Q3IA 1P60A 4KDCA 4YHHB 1MHTA 1JLRA 2CJYA 3L6EA 4P0QB 4OIMA 3E7FA 1YZNA 3P2MA 5TQ2A 3EBPA 1KPIA 4EBBA 1QZXA 5AM2A 1RHUA 1W1UA 4FHZA 2W6PA 1XLVA 2WWFA 5I8WA 2H1WA 3T3NA 1RLJA 1GPAA 3A6GA 2PWAA 4RABA 4S1VA 1KZYC 5AICA 5BRJA 5C37A 4EMBA 5DP2A 1RI3A 5EMHA 4JJFA 3NHZA 4KN5A 4O1HA 1E20A 2AEMA 4FFBA 4H18A 3ZU5A 4OTZA 5CNMA 4RFSB 4DCMA 3NTRA 4PTYA 1AUXA 3B70A 1ITZA 2PKQO 1UMBA 3CEMA 4GPTA 2LD4A 5TE9A 4U9UA 4BU1A 3O4HA 2ZGVA 4JXKA 1SOWA 2C2XA 2YASA 3EIUA 4QLBA 1QSGA 4MUFA 4CGZA 1HYBA 4FBLA 4LKRA 2P6NA 3RNOA 1B23P 3DXFA 1B0ZA 3JVUA 1K1EA 5JAQA 3U7QB 1PLKA 6REQB 3WHKA 4F06A 5MDHA 1SHUX 4YV0A 4NZYA 1L2TA 2R79A 3RRZA 4EELA 2FE4A 3OFND 3K73O 5I5GA 4WOBA 4GQBA 3QE0A 2HLHA 4JBGA 3C8HA 2P9BA 3BWCA 5U4XA 3A4MA 2XTAA 3TRIA 1NXOA 4QG7A 3HDJA 5K0JA 1ECJA 3DDUA 2CUTA 3KL2A 1QJ4A 1L4EA 3NVDA 3OCVA 1WKBA 2ZU6A 1VSQA 3ZY5A 5A9SA 3S1SA 2AQIA 4LUCA 1JHDA 4PC3A 4Q9JA 2ZVJA 4CHGA 2QY6A 4ARCA 2XLCA 1M1YB 4J7CA 4QUIA 4MI6A 2MINA 4RKQA 4X44A 1IVSA 4ER0A 4DR2B 5IXJA 3ZKWA 1X7ZA 4UZSA 2CFRA 4NMHA 4URUR 2PU7A 2HZBA 4Y9SA 1Z25A 1AQ6A 2H11A 5K5EA 1MO2A 1TJNA 3FOBA 2CL0X 4FCVA 1VMIA 3ESRA 4RHUA 5AJHA 4ER5A 2II6A 1L4LA 3KZXA 2FR1A 5ITVA 3TQIA 4WA7A 5JI2E 3NUZA 4Q21A 1FSFA 4RKFA 1JEOA 4OQ4A 3RKRA 1D2NA 2VOJA 2MIIA 3HZZA 3C7KA 4F12A 2XVZA 3JQEA 5F3DA 3ZDYB 4MR9A 1WOMA 1YTLA 4X1OA 3QVJA 3MTJA 3F46A 4YXWA 4UAGA 5MGBA 4JX9A 2VT7A 1DOAA 1ST3A 3LP5A 5EVJA 1N6LA 5EHQA 3URKA 4DCVA 1YQEA 1M34B 4JUFA 5DNWA 2ZTMA 3T0FA 3A6FA 5IVPA 3FOWA 4J49A 4WV3A 3SE7A 2HYIC 5D00A 2P2LA 3T6KA 5KQLA 4LHEA 4C0JA 3D3QA 3KS9A 5IAOA 1N8SA 2ZS7A 1DBPA 4MUYA 5CH8A 3L8FA 4DR4B 3N2IA 2YMMA 5KKAA 2RGEA 4XSGA 1TM5E 4PSAA 4MUXA 4W8HA 3OY2A 3B12A 4MMXB 3T5BA 1LTHR 2Q3CA 3TLKA 4BO3A 3CQ9A 3HH8A 4MV4A 5CBKA 5FBQB 2EKBA 3MT9A 2FKNA 4QL3A 4XVCA 1Q95A 1E5QA 2EX4A 4URXR 3K0BA 1O5OA 3JV7A 3PGVA 3BD6A 5AMXA 1SKAA 5EUQB 5GY7A 3KWMA 4YB8A 1ZW1A 4IIXA 3WO0A 2QRQA 1SULA 2OHVA 4JNCA 3WJ7A 2DXIA 3L49A 4P2GA 2FWIA 1DQRA 1EH5A 3LUAA 1EA7A 4XVRA 4F4FA 1D8TA 1QHXA 1VL5A 2YHIB 3ND8A 4NYMQ 3EVZA 2XDYA 2P2YA 2WIFA 3HKDB 4JJGA 5HRAA 2HBRA 3CWCA 3FIJA 4H1VA 5FNVA 4A9AA 3L06A 1SD1A 2JG3A 1KRHA 1QFSA 3BAZA 4QDKA 4DBZA 2Q1WA 1CUEA 3UY4A 3EW9A 3CVOA 4HRAA 2GN6A 1QUEA 2AFIE 1A8SA 3M3DA 1ZOOA 3WYFA 4RKYA 1XTBA 2DPMA 5D3KA 1ZUIA 2YV2A 4YP1A 1J0CA 2NU8B 1ZGJA 3U37A 5K8JB 5AHKA 1QRUA 3D8NA 3UJ6A 1RPZA 4S1TA 3FMOB 5GOZA 2JK1A 4HH4A 3VDXA 1TM7E 4R1SA 4XI9A 2EBWA 1TZCA 2A9JA 1VCNA 4YRIA 2I9PA 3E6AA 4DR3B 3BH0A 3RO7A 1NSFA 4D8WA 4ZFNA 1WR8A 3L9XA 1B1AA 3BORA 1PS0A 1ZZEA 5EE1A 2OWEA 3S1AA 3OLZA 1DARA 1PK7A 1ESNA 3Q10A 1RMQA 2QUHA 3U4DA 3ZWAA 4I5EA 2BBOA 3NHLA 4L7VA 2OO3A 4KQKA 1FBNA 2PS3A 3HUUA 3LXUX 2PK3A 3HM2A 4P38A 3TI9A 3GJRA 4WJLA 3SC2B 3FI0A 5H5JA 3BL8A 2TMYA 4UHBA 1Q2XA 1GA6A 3OWHA 5DGCA 5K3FB 3HDHA 2PTHA 2HD4A 1HUQA 2PKEA 3L8CA 5A0TA 5JNSA 1PR2A 3T7SA 2BH9A 4W5WA 3V1TC 5A5FA 4J07A 4IGEA 4FB5A 2W6ZA 2H16A 2QSZA 5H59A 5KOHA 5C7IO 3ORSA 1ZLYA 1THMA 1JRLA 4GE0A 4MUEA 1ODTC 2ODEA 2IY7A 1DC5A 3O9VA 3CEAA 4ME6A 2EXXA 1E5XA 1S8AA 2O52A 1XO1A 3SVLA 4YYEA 4X3CA 1TAGA 1K2VN 5EESA 4UEQA 3WVNA 1H2BA 5FDFA 4J90A 1PZMA 4JSRA 1FYDA 4RMJA 2PS0A 3MBIA 3QBEA 5SYAA 2PG3A 1R8SA 1JX6A 3RI3A 4B4UA 4OKSA 4EMUA 4W63A 3B3FA 1TM2A 4MLCA 1JG7A 4OB8A 5C5CA 2QW0X 3LOPA 3N0RA 4JL6A 1VP9A 2W70A 4QT0A 4MI3A 1AZWA 4XARA 1A96A 4PXSA 2IS2A 5HEKA 2FG7C 4EW2A 3HO1A 2Q1UA 2H48A 3ZCXA 5CJ2A 4RD2A 4M6WB 3BB4A 1KKLA 1U2GA 3RREA 4FMDB 2VPYA 4CFZA 4EOGA 4NCHA 5JW6A 3MOSA 1JDUA 1RCUA 2XBUA 3DCJA 4PX3A 1ZD4A 1I0ZA 4C30A 1FJXA 2V9CA 3OBBA 4Q3BA 3LUFA 3U2QA 1E3WA 4HLNA 3WP1B 3EXFB 2D7JA 2EZUA 3KG2A 1JFSA 4D9KA 2C9ZA 3SOPA 2CMHA 3KJEA 1IOLA 2D4HA 4BLOA 1ODJA 4KN6A 3PVSA 3S2EA 3DV2A 4BYMA 2BKLA 2E4XA 1VFPA 2W2TA 3PENA 4G3XA 4PLZA 2OYCA 1F38A 1N2OA 1PJBA 4IDGA 3LUCA 3RH0A 4YMLA 3E9QA 1J9GA 4CNBA 1DG1G 1C8LA 3EDQA 2O2EA 3HFSA 4N0QA 4PN3A 3H4TA 2ZJ0A 4DLKA 3H75A 3A4VA 4M0UA 1DX6A 1YR6A 4ZYUA 3PEYA 3WXMA 1EZZA 3AOEA 4G8CA 2PAAA 3ZYZA 2AOTA 4EJ0A 3I53A 4DMLA 4B44A 2OCKA 3H04A 3IRUA 2C3YA 1T1JA 4AQ7A 3TZHA 1NNUA 4F93B 2OFPA 2QX8A 1TM1E 4JVNA 4LBYA 3ZVKA 2ZB2A 4C4ZA 1XEFA 4FD2A 4MIKA 1YB1A 3QUAA 1GT91 1CERA 1KAGA 1KO5A 3ZCQA 4BGEA 1GUDA 4RF5A 2GZAA 5K1ZA 5H02A 1Q7BA 2AN5A 4DE5A 4TYNA 4KQ6A 3A6EA 2PMWB 1R88A 3TL2A 5CDFE 1U80A 2QQFA 2X86A 2HWUA 4TPKA 5COBA 2EERA 4DJDC 2P0YA 5HZMA 2QNIA 1GGVA 2YW9A 3QVSA 4CV2A 5A7FA 1QV7A 2F7SA 4XZ3A 1F0YA 1EFTA 3CF4G 5JZMA 1Z4KA 4AJ2A 3DVLA 4QUAA 2WNSA 5KYVA 1EFUA 3IHLA 4QNNA 5ISMA 4MGZR 4YAOA 4QFBA 3JQFC 1MMFB 2I6TA 3BKWA 3HXKA 2UZ0A 2JKYA 2JLUA 1E0JA 1PFKA 4DUGA 4U8HA 3V8RA 3C3AA 4QATA 2HAEA 1X8LA 2ERYA 3CKLA 1A76A 2PUWA 4P4LA 1OIXA 3UT5A 1YJ8A 4L72A 2ATCA 3OQIB 5CFNA 1UT6A 2XECA 2YXBA 3LYAA 5CVDA 5FUWA 1U28C 2R00C 3KOMA 3QLJA 4L9WA 4BNDA 5EJ6A 4BHTA 4TS4A 2HSWA 2P9EA 4CPDA 2N0SA 1I51A 3HGTA 3MXTA 4U2DA 4C5AA 1CHNA 2I7XA 3PYMA 4Q19A 1ABFA 4F3TA 1E7YA 5A6SB 3CX7A 4RHYA 1ZESA 1XTZA 3U81A 3LSYA 4JC8A 4X20A 4NZ9A 1T34A 3S68A 4U2EA 1R8XA 4PQFA 4MPTA 2WINI 5TR9A 1IDOA 1WVIA 3A9TA 3PPXA 2IK8A 3QFSA 4LVCA 2VWHA 4LC1A 1UFOA 2FCAA 4BN0A 3QKSA 4FGJA 4FFMA 2O57A 3JRNA 3I0MA 4IZHA 2FB9A 3WLTA 1ZAYA 2FG5A 3MCAA 3DDHA 3FCEA 1KYWA 4X6UA 5JMPA 4BQFA 5KNCD 1EFDN 5JE8A 2DJIA 4X54A 1N3LA 4PLTA 3C7AA 1LI4A 3DMRA 4DN6A 1XLWA 1F8XA 2W6ID 3OA2A 3RU3A 1OZFA 4E51A 3U13A 4PZDA 1NUUA 2PGJA 4KYUA 4QU8A 5EOVA 1QOZA 5I9TA 2QR3A 1OJLA 1U0GA 3AY0A 1JHUA 3ZDFA 5F51A 1VIMA 3NBZC 4A7PA 3LT4A 2XIJA 1ZM9A 3OY7A 1JJAA 2VZEA 1UXIA 5ICFA 2RG1A 3NG1A 5GQSA 2AJBA 2X6RA 2VP6A 3N2LA 2QXTA 3MPOA 4P3YA 2G4VA 4KACA 4Q48A 5LKRA 3KE8A 2VT3A 1RAFA 2FWJA 2RI1A 4JENA 1OJ7A 2D3WA 2GCOB 3D3KA 2GNOA 3NWJA 3V7WA 2X0IA 3PRKE 5E3IA 9ATCA 3M4XA 3N8NA 3T52A 5KYUB 3PQEA 4OQZA 5AW5A 4DRXB 5JU6A 3MIIA 2XA1A 2XCUA 5JXWA 4F45A 1NF9A 3GQVA 3QWFA 4E11A 2GPTA 2RKOA 2ZB4A 1KI2A 3V4LA 2ZRNA 2XQJA 2ZB8A 4L07A 4LK3A 2YDYA 4WZ6A 4WK6A 2DU8A 4GBGA 1JHRA 3K0FA 4A36A 3BM5A 5LLSA 4DWOA 3OOEA 3O4RA 4LCJA 4RCYA 1P2DA 3WAKA 3DUFB 2OBBA 4J0DA 2P4SA 3BMCA 4H15A 2QJRA 3OQPA 2AUTA 2XMGA 2Q46A 3BWMA 3QKUA 1NI3A 1Z37A 2ZWAA 5K6TA 1XQXA 1Y6GA 4U9IS 4LDZA 1Q6ZA 3M9LA 3H2KA 5ERYA 3Q2KA 5CNKA 3T7AA 1IEWA 4S1OA 2B98A 2FEXA 4C76A 2EJTA 3FKQA 1OI3A 3DKIA 4IJUA 2ZIXB 2FQ1A 1CQJB 1G18A 4FGKA 5LUAA 4GSLA 1GG8A 2J0UB 4HLUA 4M7PA 2D2IA 1DKPA 3A04A 1OLXA 1XCBA 3JAMA 3N8DA 1QPGA 4XB1A 2GNAA 3HCEA 3JAKB 8LDHA 3A05A 5JSZB 2CV2A 3A1CA 3UKJA 1MNAA 4ENUA 2DERA 3DZHA 1XRJA 2BZ1A 3SIXA 4YUYA 1SXQA 5BV8A 2WSSA 1SQ0A 3H3FA 4UHKA 4GKVA 5T8KA 1KEEB 1J20A 3OZGA 2D74A 1KVQA 1ZRNA 3NU1A 4HDAA 1XTJA 4YLYA 4GDMA 5DEIA 1NBAA 3QXXA 4H60A 1R18A 2FH5B 5MN4A 5D3MA 2VJMB 3AP3A 3B36A 4QEKA 2WD7B 4P80A 3FDZA 2YIVX 4RHEA 1OXVA 1TZJA 3SLGA 4BTEA 1PKEA 1TUGA 2DQYA 2E7ZA 4KQEA 1T2CA 3R6DA 3P0FA 5E4JA 2YW2A 2YWCA 3WGOA 4D9MA 1DSSG 2VPQA 3BJIC 3BCRA 3QU2A 5I9MA 4E7OA 1M3SA 1VPDA 5TVGA 1GU1A 4YRTA 3E0QA 3ZIAD 1Z38A 3REQA 2A14A 2ZIWB 5CB8A 3E4CA 3P20A 3PQ4A 5ELXA 1KJYA 2JIOA 3UWSA 4N7RA 4EHFA 3KQUA 3TLGB 4FI3C 1ZUHA 1JZTA 3ROKA 1LH0A 1XCOA 2DUMA 4IHJF 4QXMA 4HYYA 4H4EA 4ROSA 4F8YA 4FYXA 4ERXA 4UHHA 3CLSD 3MCUA 4BUCA 1NXSA 5A3QA 4WACA 3AF0A 4PCAA 1MO5A 3U4CA 5CB4F 5GMOA 4HB3A 1Q6YA 2QT0A 4REMA 4D9GA 2IS4A 1ATIA 1MLDA 2EX0A 3ZEAA 2Z6QA 2QNBA 3AUYA 3U60B 3BX1A 3KCQA 5CYFA 4J03A 4L08A 3M5WA 3CF2A 4L4UA 1BXRB 3O8CA 3MCTA 4G4IA 4KXYA 4Y18A 3U40A 3FYSA 4LRTB 2BKUA 2B0JA 2QR5A 4C4RA 4Q4CA 1CFZA 3NTUA 2VTBB 4NJOA 3RK1A 1V95A 1X7WA 4YEDA 4ZPJA 3R20A 1J8YF 2XXBA 3Q5GA 1IC6A 1QYCA 2D3TA 4GFDA 1TUBA 2JDIA 2M6SA 2Z8ZA 2ZTSA 3CS3A 3A1FA 4URWR 3TOVA 2CLIB 1SIOA 4ZD6A 5AO9A 2VHEA 3MZ0A 4I6GA 2Y1LA 4F7WA 4ARZB 3EPJA 1QIIA 1NJ5A 3IMGA 4FR0A 3HDGA 3AMVA 5HA5A 1J0EA 2B78A 2PVPA 3N59A 1DDGA 1N2ZA 3C85A 1E6KA 3G2OA 1DMRA 1A4UA 1UAGA 1YRQA 1GPH1 4MW4A 3JX9A 3ZDRA 4RTOA 1PYGA 3UFXA 3LD9A 5JASA 1V39A 4LXQA 4NOLA 2P4UA 4H7DA 1KI6B 3ONDA 3DXXA 4ZOEA 4B3SB 4M1KA 4WASA 3AEUB 4UPEA 4AURA 1CZKA 1OCEA 1WSAA 2QXUA 5IXSA 3AGPA 1L1EA 3ZK8A 2V7EA 1MH9A 4EEZA 4LF5B 4YRRA 4FYKA 5FL7D 1ESCA 3NV7A 1ZMTA 2GD0A 1AMOA 3PL5A 3J81A 4P9NA 2OC9A 5FV7A 4DAOA 1PLLA 4HJXA 1BMTA 1G9TA 1ECPA 1Z7EA 3IDOA 4GPEA 3FFTA 3WMGA 4D3YA 3FCAA 2PM8A 2WYIA 5K20A 2VXBA 3F5FA 2YYSA 3IILA 1FLAA 1ZINA 1UPFA 4NSNA 3EA5A 3GMDA 4H7JA 1IG3A 1TLTA 4DLBA 4ER7A 1EAYA 4FOOA 2PH5A 3QKIA 3OC0A 5HR5A 3QEMA 5H81A 3TZBA 3MINA 1J8MF 1HE1C 1R4MA 3RVMA 3ESDA 1BGXT 2NVOA 1OFHA 4B2PA 5IZCA 2V7UA 2JHPA 1Z2PX 4GMKA 3UHJA 3VH3A 4NICA 3WGLA 1MNQA 4TQUS 1OXKB 2IEDA 4LTNA 5A1TA 4RVCA 4WERA 3SPXA 4X1IB 2VJDA 4A0HA 1OREA 3UGQA 4UC0A 3SQNA 1AD2A 1Z29A 2I3DA 4NLLA 4CM4A 2IELA 1M7BA 2M1XA 5JCJD 1WPXA 4BFZA 1JYFA 3AEXA 2F55A 2NO4A 3RSFA 3NHWA 3A4IA 1Z6YA 4AI6A 4AUMA 2XQGA 4PYKA 3KKZA 4FSDA 4F96A 2ZRDA 5BYAA 1Y8RB 3BGDA 2A0UA 3BZBA 3K3PA 3CM0A 3L1JA 2IX3A 2WJWA 2GKOA 5LZ9A 3ANXA 1JLLB 3ROMA 5BW5A 3WRWA 3NMUF 2RHWA 1XJWA 1EWYA 5CDFA 1RRGA 4EHDA 4ZT7A 3SJCA 4AQYB 4QLAA 1RVV1 4H0CA 3SR4A 1YONA 3DP7A 1RJWA 4IDNA 4V03A 1PVOA 3OQVA 2EZTA 3NEAA 3T4XA 2O0HA 4B3BA 3CT4A 4D6PA 1JJVA 4HV4A 2IEYA 1ECGA 4D9NA 4Q3EA 3VVLA 4R2HA 5L4NA 1SOAA 2XYVA 3GPBA 1WPGA 1YT5A 4HAZA 2WT8A 2D1QA 3DOOA 3F1KA 2O06A 2P90A 4I55A 1PR9A 3BD7A 1QTRA 3PHBE 3O8QA 4MKXA 2WU4A 1PNVA 2ECKA 3ROTA 1SBQA 4BLWA 5HDQA 4RJ2A 4TTVA 5FR2A 2BR5A 2JBHA 1I3CA 3NBYC 1NM5A 1VXOA 3R2JA 4P83A 3W3AD 3SI7A 3T54A 1CC1S 2FR8C 2DR0A 5DYYA 2YOHA 3IIEA 3W8DA 1P8AA 4R1OA 5I7FA 3BDAA 2F3UA 3F7TA 3AVPA 4BO5A 3DEYX 3J7TA 4UEWA 3AL3A 3LKVA 1OXSC 4QA9A 3PX7A 4XSHA 2AW3A 2DFDA 1VGVA 1KH2A 2QAGB 2BGNA 1RRFA 2NU7B 1Y1KE 1V11A 3U1VA 2PZKA 2B35A 4HMPA 1FFEA 1MX1A 1LS1A 3IUNA 1PT6A 3B48A 1SA0A 4E4TA 2F1RA 2YVLA 1BWSA 4DC1A 1YBFA 2CNOA 2Q5QA 1E2PA 1XRPA 2PBFA 2P9TA 4ZTUB 4Q82A 1FS4A 3U49A 4LFBB 2RB4A 5D01A 2Y0CA 5JYCA 4JR2A 1PN3A 4OH1A 3V1LA 1BDHA 4Y30A 4TROA 1AHHA 3A1WA 4LAFA 3QFFA 4A0FA 3K96A 4YRQA 3RNLA 1RABA 5JJBA 3OPXA 4YPFA 1PZEA 1YIOA 4CM8A 4EIWA 2REQA 3MD9A 3T3GA 5A2GA 4KITB 2E5FA 4YI3A 1W36B 2WQ6A 5LWHA 3LHIA 1CUYA 2A78A 1EEXB 4KRFA 4S24A 1JDTA 4NOJA 5F52A 3W4IA 1I5OA 2R751 2EGGA 2VLBA 3Q7RA 2I3AA 2XWSA 2Z58A 4ZQIA 2AD1A 2AMLA 4NWIA 3C39A 2HO4A 1VJCA 3ADCA 4D82A 1YJXA 2RHHA 5K0BA 3DL0A 3UYKA 4OA5A 1SOUA 3DNFA 2CFSA 2C7GA 1W94A 1PVDA 4R7ZA 4K7JA 4PGGA 2XYQA 3PCTA 1O4WA 4IXMA 1P62B 3FWKA 3IYLW 2CN1A 3OWOA 8MHTA 3V8MA 1NMYA 1Z68A 3UM9A 5TS3A 5BVHB 1FE8A 4YAWA 1YRWA 4E94A 1P7VA 2QMYA 1QIFA 2Q28A 5FHRA 1IEQA 4Q4DA 4PLFA 4D4IA 3KEMA 4OM7A 1J5PA 3PHIA 3OU2A 3THYB 4XIJA 4H27A 2XNHA 4GVXA 2YRFA 4YQEA 3W79A 4URFA 1PYDA 4AIRA 2X5OA 2CLKB 4FFPA 5FPQA 1YVPA 2RGUA 5H68A 5L7YA 3IALA 5J23A 4KNVA 3DCNA 3ZWXA 2CBGA 3TVYA 5F5XA 5CM8B 3V7UA 4EITA 3CLRD 3NR2A 2GDZA 4RZ3A 2ZWIA 3FDJA 4GEGA 5AKYA 4AECA 2DQ4A 2WPNA 1YB5A 3KOYA 2EW8A 4PS1A 2QV0A 4NY1A 3U4HA 5M7EA 4CMAA 3T9AA 4OLAA 3GEMA 4PV7A 1XTTA 3DE1X 4QG3A 3OIGA 1KFEB 2OD7A 4M4SA 3V4SA 3UT6A 2EIHA 4HUTA 5HPYB 1UPUA 3ICEA 1J9EA 4PVDA 5BN4A 4YMHA 2J32A 3DMTA 3EC2A 2HW8A 1DFGA 4G2NA 4G0VA 3GP3A 4JSYA 1QHGA 1GUBA 3GDWA 4KTTE 1V1JA 5IJ9A 2EJWA 2C4TA 4MARA 4XFDA 3AF6A 1AGRA 2CXXA 3THOA 4KGZA 2LWIA 1N5RA 1C8VB 5EYPA 4XUGB 2VF7A 4Y67A 5AOCA 3EUWA 4Q6BA 1VL2A 3AP2A 3I1IA 1GDHA 1XRQA 1V9CA 2YV1A 2POCA 3FH0A 3HCAA 5DYGA 5IC6A 4EG7A 5K0EA 1ECCA 2BFFB 3F7NA 2YWBA 3ND5A 4MINA 4PX2A 3FBTA 4IEIA 1HFKA 3D3WB 1Z3CA 3UO8B 3ZE9A 1GGKA 1T0HB 4MCHA 3OLVA 3R3WA 3R77A 3H5LA 4HDRA 1QF6A 3O26A 4KXLA 3CUEF 2VCEA 1D4ZA 1YQDA 4GZMA 5LZ7A 5I9LA 4CLEA 4B76A 5CHYA 5KQGA 3UXEA 1WXWA 1H69A 4F5YA 1QHNA 2O8NA 3JASB 4GG1A 5H9VA 2WF5A 3ESCA 3TO5A 5C8XA 3MFQA 3IESA 4A1OA 2O7RA 1RD4A 1R9MA 2BEKA 1YFZA 3T7TA 1KSGA 3BAFA 3OE1A 1SOVA 5KCZA 3ZH2A 2CE7A 5CT5A 2W8ZA 3TOZA 4NCKA 2AFRA 1ZMRA 4RLFA 1K97A 3JYOA 4LSZA 4ZARA 2XWJI 1DO8A 3G6WA 2GCIA 3MWDB 3QI7A 5C7LO 5CMLA 1AE1A 2QD5A 1EWKA 1QHIA 3FROA 4C4AA 1HY3A 1PG0A 3H3XA 1I1OA 1MB2A 3D8RA 3DMYA 2FPGA 3E8XA 3UAZA 4KP7A 4ZCTA 5CVTA 4OLJA 1T5SA 5DGIA 1NFRA 2A1UA 3MUOA 5HTOA 2E37A 2RH8A 1SWVA 5FWAA 3V32A 4XE5A 5EWMA 4BE7B 3EGIA 4FOSA 4PTLA 2VA8A 3R6WA 1LK0A 2FA9A 3MPUA 3GUYA 2HA5A 3MJSA 1FQJA 4JHLA 2Y1EA 1KZ6A 3AF5A 1V9LA 3H5AA 4DA6A 3FHOA 5AW0A 2DEUA 3ZWCA 4QPNA 4X92A 3NUQA 1AHIA 1TFUA 2CVQA 3VJLA 1NVFA 5IN5A 2EP5A 3GPDG 4IS2A 1GZUA 5FI3A 2FP3A 3BJZA 1Q44A 3OQ1A 4V0LA 5CT4A 4RKWA 1OI7A 4C03A 1QLJA 1XAJA 2QTFA 4YV2A 3PHCA 1JDBB 3VMMA 3DTYA 5IS2A 3TEJA 4QYWA 4DJ5X 5G0SA 4B3IA 1L5HB 4J8PA 2XD9A 3GUZA 4Z9FA 1UQTA 2YN4A 4EVRA 3R3XA 2O8FA 1R0XA 4FC7A 3TCXB 1DFIA 4KR6A 2H9YA 3UUFA 3WYBA 5T57A 2I7DA 2BFDA 2HIHA 2V55B 4EGAA 1FMFA 2XUAA 3CUTA 3H2IA 3R5JA 4U7FA 2BR3A 3GCGA 3TS1A 2V7QA 1TEZA 3L8HA 3KT8A 4L5IA 2QN1A 1F4PA 3T0IA 1A5ZA 4O4LB 3UKOA 2YJZA 3FPSA 3FPFA 3L7YA 4MQ6A 1WQ3A 1TX4B 2HTFA 2ZAYA 1GXSA 3T94A 1Q7RA 4IV8A 1RYEA 4QXPA 2PRZA 4H7HA 1FYWA 4IJWA 1RAAA 3BCSA 4MV9A 3O2QB 5BV0A 4NYMR 2JKVA 3NEYA 3ZLBA 1ND6A 2ID9A 4Q93A 5G0TA 3H2ZA 3U9TA 3L84A 2UUOA 4RA9A 1FDSA 1ZUNB 1U1FA 3IPCA 2C4HA 2AC7A 4KAJA 3MWLA 5FOXA 4RDCA 4C0QC 4BVKA 3CRNA 4NMLA 1XQ6A 1BQ3A 1Z34A 3QW4B 3FIUA 3ZWBA 4CTMA 3KDPA 3FGNA 5JC8A 2FJPA 3ZHVA 1ZMOA 3VHXA 2ZETA 4IDAA 2ODAA 2LCFA 1JH9A 1VXRA 3QOYA 4YK7A 2PD6A 4FZJA 1J1UA 3HYSA 3I2KA 5A5DA 2BBTA 1LUAA 3ABSB 3EHEA 1UZUA 3IP1A 1FFCA 1SKQA 1ZNZA 1FFBA 3I5MA 1R5OA 2ORVA 5CXQA 1O94A 2QLLA 2J6IA 1M6NA 1TEHA 2QXYA 4BBPA 3ITDA 3I32A 3T5AA 1EFVB 1NY5A 4OI1A 3DFMA 3R4CA 3P26A 4DPKA 3CVWA 2NXWA 4JCCA 4J0JA 4DLWA 1G17A 3H0EA 5ARBA 821PA 1UMCB 1M0EA 3HY3A 1TMYA 5B30A 1W44A 5F1YA 4Q47A 5TPZD 2GASA 4S12A 3MUFA 1BRTA 3HVIA 3HEBA 2FUNB 4O2AF 2AI2A 4ILKA 3ELUA 1DEHA 4CT5A 2Z1DA 1V7QA 1XQ9A 4FZ5A 2AOVA 4BQSA 1H66A 4ENTA 2W2OA 1B3RA 4GGPA 4WOJA 3OH8A 1PTKA 3AI3A 1CZOA 1E63A 3RARA 4KPYA 4N5IX 3OAAD 4I8DA 1NVTA 4IKOA 1B6GA 4PHHA 4YNBA 1BQEA 4MJ3A 2EATA 3RS9A 4U8GA 4WNAA 4MDFA 1M2WA 2K2WA 2VJOA 2W2QA 1GG5A 1YKGA 2GHIA 2WOJA 3LUPA 4AW9A 5GPBA 2CJWB 3OX2A 5ALUA 1RWNA 5C8YA 3CZCA 5J5AA 3RUDA 3H5WA 3L4EA 4YO8A 4MA4A 2GT1A 2GFIA 4HNVA 3FCSB 2EU8A 2YQ4A 4D2IA 1W88A 2OV8A 3RSZA 3AI1A 4D9JA 1BHO1 4HR7A 1XL1A 1JPVA 1U2PA 3P0IA 2ECFA 2ZSBA 4K46A 1AUQA 1KC3A 1N2EA 1W75A 1WLSA 2X5JO 4FD3A 3O9MA 4PQGA 5TSDA 1KMMA 3F6PA 4QAJA 3TOXA 1CUDA 2CHUA 3SQWA 4KSBA 1NN1A 5DNEA 3HLKA 2PZGA 5KU7A 3HB4X 4AMUA 5C18A 2FMKA 3F6EX 4K40A 3I23A 4TLAA 4ETNA 2ZXFA 1XCLA 2ZUWA 2VHJA 4MMZB 5C7OO 2XMSA 3FWNA 3WRYC 5DBFA 3TINA 2PZEA 2ZIUB 3HI4A 2JAXA 3KU1A 4XGKA 4C4XA 1EINA 1CUCA 5IXYA 4JB8A 1QHHA 4IOKA 3TKLA 4OCZA 4ZZ1A 3IPRA 3ACCA 4UCQA 5I48A 2JVJA 4QASA 1YL7A 2O0JA 1KQ3A 2J3JA 4RV5A 2FPIB 3KHSA 3F5SA 3EDOA 1H22A 1YHYA 3L0CA 1YQXA 4LHWA 4UBLA 4P2BA 2EBUA 4P98A 1E32A 3U9SA 4AJ4A 1YTUA 2O7NA 1WX1A 4XX1A 3MB8A 1IFXA 4Y1FA 2J3DA 2YOGA 3EIEA 4FNGA 2OUIA 3ZE2B 1HNXB 4ZCRA 1CSEE 1HEUA 1WMSA 2LV8A 3B3AA 1N2XA 4LDJA 4WKCA 3WLKX 1M6HA 5LSAA 3TVDA 4DIBA 3SHTA 3V7NA 3ZCVA 1NSTA 2QLTA 4ZDKA 1XZLA 1QXSA 3K4PA 4C0AC 3PSAA 4GZ3A 4BZZA 1COWD 4R8RA 5EIHA 2ZCJA 3OPYA 3L46A 1EM6A 4PC1A 3HYLA 1AGYA 2BR4A 3DW3X 2Y1OA 4M83A 3WJ2A 2GLUA 1TUEA 1E1LA 1YQ9A 1H5NA 3N75A 1LVUA 1NPDA 2JGRA 3HKCA 2RK4A 3GA0A 5AKHA 2H3EA 4JMLA 4QPZA 1RQPA 3FVQA 4QTUB 1R9NA 2ZRIA 1SHKA 3PCRB 4GD3Q 5EE3A 5TMBA 3PGKA 3TZLA 3N2EA 5L3QB 4FJ2A 1VLHA 4J9UE 4ZRNA 4BO9A 3AX6A 3UA4A 1OF1A 4PANA 1G5HA 4LFAB 1PWXA 3QY9A 1WCIA 3W8FA 2BEWB 3MOIA 1PJZA 4LRYA 1YACA 1E4OA 1OPXA 4FZVA 2NM0A 2B82A 2D5IA 4RIFA 5IK2D 1N36B 3B5IA 1OH6A 3N39C 4GZ6A 2GZMA 3L7JA 4JYPA 2OHIA 1C3JA 1EBUA 1FVFA 2G5PA 3D1LA 4J0EA 1VBMA 3O38A 1ZICA 3BA6A 1N5KA 4O4LF 5FPSA 3ZJVA 1UFVA 1C3OB 1XTPA 3MTGA 1Z0DA 1KPGA 1D2RA 2HDNB 1V16A 1GZDA 3N2GA 4Q4AA 4UHDA 4X93A 4UTVA 3FNBA 1TVKB 1UBOS 3KSUA 3MJHA 4Y6RA 1DV1A 5JCJA 3WQQA 4F6CA 2MTBA 3GMSA 5DN6A 1ZA2A 4F3NA 4EKGA 4Z49A 1UFRA 1VHLA 2GK3A 1L5OA 4MITA 4X63A 1TYDE 1B15A 1ZRMA 4R6XA 4P7BA 5JD3A 4NENA 3W5CA 4L8WB 3CXRA 4ZK6A 1ORRA 3PFKA 1JSRA 2QJOA 2O9JA 2OG2A 3CMCO 5AI6A 2NYRA 1JIKA 5BOSA 3VV2A 2WILA 1E3MA 1MVLA 2JJYA 2P40A 2QHXA 3PDHA 3GOHA 3LRTA 4XQCA 5E7MA 5KCMA 3VO9A 5E1MA 3CZ4A 2BV3A 3DXZA 1CJCA 1CY7A 1HI9A 4S2UA 2XYHA 2ZI9A 1T0BA 2FG6C 3AW9A 4PYRA 3G5LA 2EG9A 1BOOA 2C8KA 4L57A 1B76A 3GELA 2ZWOA 1U9YA 2YWFA 1EVEA 3JD2A 4R16A 3WQRA 1QF7A 2PUEA 1C9MA 4FS8A 2DUNA 4WLNA 4A4DA 3FYUC 5GP1A 5KC8A 2FMUA 2HJSA 4F2WA 2AN1A 3AJDA 2ZBQA 2WMOB 1RKQA 3EXHA 1HEYA 2ZJ6A 4NAUA 1NI5A 1OASA 3LGXA 1SO8A 4Q05A 5JNWA 1EHYA 3EF3A 3ONFA 3OVMA 3PXCX 1SC6A 5CM2Z 2PXAA 4V0OA 4PHFA 2CNBA 1MAWA 4KC0A 3U3KA 1ONNA 5KYGA 5KVVA 5FV4A 2QMUA 2BE7A 2P3SA 3GQBB 4HF7A 4I0WB 5EWLB 2O2HA 2ZWPA 3KLPX 4CMEA 3STTA 3OOSA 4B46A 5BSRA 3S2ZA 4BDSA 3T1OA 2FMIA 2G0TA 3CONA 3IHWA 4A6DA 2XCIA 4FYHA 5FLKA 1U7WA 4QOIA 4V0KA 1YS2X 4JJIA 5ENDA 3WGMA 5HRUA 1GRNA 2IHBA 4KQWA 3ZV5A 3X1KA 1GTMA 3PHGA 4BO4A 3COZA 2YL2A 2OA0A 3JTEA 4IH4A 5SYNA 2GA8A 4X8HA 1UJNA 5EEGA 3IIKA 2Q4DA 3KQSA 2W43A 5HF5A 1A2KC 2XSZA 3A6PC 1ZCFA 2Y1WA 4K6FA 4J43A 2AHRA 5B7PA 1VZ3A 2NSJA 4QIHA 1VMEA 3RC1A 2PN1A 1HLPA 3CXUA 4UUBA 3H65A 1D9XA 2D06A 2DQZA 4PZPA 2QTVB 1H6CA 2QQGA 4DJJA 3GEDA 1NW5A 4YIHA 2G1PA 1AM4D 3W9UA 1U0OC 4LV6A 5BW6B 1KOLA 1TT7A 1PW5A 2D8AA 1Z16A 3TD6A 3L7KA 3I28A 2NYVA 5FD8A 5CDUA 4L74A 4H9GA 3I2IA 3EGDB 1JJIA 2HSEA 5KPJA 1Z0SA 2JFXA 1US8A 1ULHA 3ENVA 1SIBE 4Q01A 4YP5A 1K86A 2QWXA 3JZFA 1CNFA 4BPBA 4ZVPA 1CZRA 3N28A 4RK7A 5JXGA 3T5GA 4I1YA 2GRJA 2JASA 3ZE6A 4MEBA 1BDJA 2BDTA 3NTVA 2FPPB 4DV6B 3E8SA 2O4CA 2BTEA 5F78A 4F2GA 1ONOA 4CQMB 2E55A 3OJEA 2CW5A 4GC5A 5TT0A 2ZR8A 4B0PA 3HKEB 2D13A 3HJTA 5REQB 2GZHA 3JQGA 2B69A 3FF1A 3G8YA 1YZQA 4Y2RA 4MCIA 3QHAA 2F3QA 2O5EA 1U7ZA 4ZI7F 2O2YA 2AH5A 2HU2A 4F3RA 2J30A 5ALIA 4JJAA 1UWVA 1YQGA 3UJ9A 1BS2A 2DJ5A 3CW9A 3Q5EA 4KO2S 3B13B 2L19A 1AS3A 4OGGA 4BWGA 3VO8A 1IMOA 1H4TA 1J42A 1WSBA 1TA9A 2G0NA 2JVIA 2W2NA 1CBUA 1PEDA 1S4QA 2XKAA 4ID9A 1PT7A 3DBRB 2YYYA 4M9RA 1FSZA 1BIFA 1J09A 3AZQA 2V54A 4TYPA 4CM3A 3ECAA 2C4MA 1EFCA 4DG5A 4BNVA 5ALGA 2Q3MA 1CDEA 1T5TA 2D0DA 1CS0A 2NSYA 4KOEC 3UANA 1VGRA 1DAKA 3NBKA 1RXUA 3FI9A 4ZP1A 1P0CA 1OGJA 1N1EA 1R6DA 2IIBA 2IIQA 3EWNA 5FI1B 1U94A 2RGWA 3GNTA 5F12A 3A14A 1QQ5A 4BN4A 1Q2UA 3QMMA 3T4UA 5GIPE 4C0XA 1I7DA 3DV0B 1TCCA 1XF9A 3KYDB 2A5GA 3QYAA 2QUJA 4X94A 3KQNA 3PD7A 2BEJA 3MVEA 1F6DA 5K4AA 3FOEC 3LW8A 4L75A 3H2JA 1LNSA 1REQA 1XXHE 2VOEA 1OYVA 3MTAA 1Y7LA 3NNSA 2AKEA 3PC8C 3A26A 3L4BA 2OGSA 3C4JA 1N1DA 1RE1A 3NHPA 1VQ1A 2ERXA 3FDXA 2Y4NA 3DG9A 3P9KA 2VKTA 3QITA 4MYRA 4XR4A 3R8FA 1RYZA 5AR1A 4UM5A 1NRXA 3H11A 3FTEA 2G36A 5LQAA 3OQNA 1X38A 5G0UA 2Z0MA 4HO1X 4WESB 1FCJA 1JFRA 3DZKA 4IV5A 5I7SA 5IPFA 1T5BA 1M9NA 1K68A 1Q20A 4J0GA 3RRFA 2QRKA 2HGSA 2QN7A 3NVAA 1DLIA 2HLDD 3PXGA 1I14A 3EQ6A 4U5XA 4C22A 2PJRA 2FEOA 2AKAB 5FWYA 3RS8A 4G8JA 1WY7A 2R2AA 1UWCA 3HKBA 3N2NA 1U8YA 3PDWA 3P9RA 5HE9A 1JWBB </