3P1MA

Crystal structure of human ferredoxin-1 (fdx1) in complex with iron-sulfur cluster
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
KITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTSAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster
rcsb
source organism Homo sapiens
molecule tags Electron transport
molecule keywords Adrenodoxin, mitochondrial
total genus 30
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p1mA00
1FRDA 3AEDB 1N5WA 3AE5B 2WQYB 3AB5A 4IDIA 3AE3B 4JWUC 4LTUA 4ZHOA 1GPXA 1NENB 2W3RA 2L83A 3P4QB 1OFFA 2WP9B 2W54A 2BS3B 1JW9D 1DOYA 1QOBA 1DGJA 3HVZA 3AE6B 3NVZA 2WU5B 1IUEA 1RWSA 1YQ4B 3NVYA 1XO3A 1T3QA 3SFDB 3FC4A 1AYFA 2WS3B 4JWSC 4HROA 1AWDA 2FBWB 1TKYA 3AE1B 2MJ3A 3ETRA 1YJJA 1ZXIA 3AE4B 1J7BA 1E7PB 1NYRA 1QOFA 2LEKA 3NVVA 1N62A 1RFKA 3AN1A 3SFEB 1E10A 2PVOD 1SB3C 1ZOYB 1NYQA 2L52A 1DOXA 1OQRA 3CIRB 4A9AA 1L6UA 2QJLA 2AX5A 3AEFB 4US9A 1JWAD 1JRPA 2B76B 3B2GA 3PO0A 1NVID 2K5PA 2K9XA 5EE0A 2BS2B 4C80A 2E3TA 2BS4B 3L4PA 4N58A 1QOGA 4YTMB 4N6EB 4WQMA 1TKGA 3W5VB 4ITKA 2JX5A 3P4SB 5G5GA 3NRZA 1RYJA 2EKIA 2H88B 1J7AA 2K22A 2G1EA 5GXGB 3VR9B 2W3SA 2MJEA 3VR8B 4US8A 1FXAA 1VLBA 3KWLA 1WRIA 2KAJA 2KMMA 3P1MA 3DWMA 2DWQA 4YSYB 2Y5CA 3WCQA 2WLBA 4YXDB 2DBYA 3B2FA 2CU3A 1B9RA 2MJDA 4P6VF 3P4PB 1SIJA 2CJNA 1E6EB 1NI3A 1XLOA 1UWMA 1L0VB 2M56B 3NVWA 4ZOHC 3AEAB 5EE3A 4WWMA 1WGKA 1JWBD 3AEEB 1FRRA 1YQ3B 1N61A 3VRBB 1KFYB 3AE8B 1L5PA 2M19A 1N60A 5C2TB 3B9JA 1JROA 1E0ZA 1FM0D 1KF6B 1VJKA 1F0ZA 3AE7B 4N59A 3CWIA 5EE1A 2MH7A 3AE2B 2HTME 5H92C 1EWYC 5C3JB 1SF0A 2H89B 1V97A 5MPOA 2QIEB 4ZHPA 1TJEA 1FMAD 2PIAA 1ZUD2 3HRDD 2N0SB 3HUIA 4KX6B 4FXCA 1WXQA 2ACZB 5AUIA 3W9CB 4C7ZA 4YSXB 1I7HA 2Q5WD 3EUB2 3LXFA 1N5XA 1RM6C 3AH7A 1WYGA 3P63A 1PDXA 3AM9A 4YT0B 2WU2B 5EE9A 3VRAB 3AECB 3AEGB 1JQ4A 5G5HA 1XLQA 1XLNA 1L6VA 2PKOA 3ABVB 5H8YE 1QOAA 3W5UB 3LB8C 1GAQB 4USAA 4YTNB 1QLBB 1J7CA 1E9MA 1FO4A 3P4RB 1XLPA 4HRSA 4YTPB 1FIQA 2CJOA 1FFVA 3AEBB 4C7YA 1YJIA 2JQRB 1PUTA 1QT9A 1V8CA 1FFUA 1VDVA 1JALA 2WDQB 3DWGC 4JX1C 5AUKA 1PFDA 1NEKB 1TKEA 1DOIA 1CZPA 1FXIA 1ROEA 1A70A 3BIID 3AV8A 3AE9B 4YSZB 1KRHA 1R7SA 2WDVB 3NS1A 3ZYYX 1ZP0B 1QF6A 2WDRB 2BT6A 3AMZA 1WWTA 2OHFA 1OQQA 1TYGB 3RPFC 2W55A 1CJEA 2PVGC 3FAHA 3SR6A 1N63A
chains in the Genus database with same CATH superfamily
3RNFC 2GBJA 1N5WA 4TQ1A 4F1SA 3SDLC 2BYVE 1QOBA 2IDYA 3QA8A 3JSVB 2KC1A 3URYA 1YJJA 3L10B 1J7BA 4JE3B 1N62A 4NQLB 2WXQA 2L52A 1DOXA 2IO3B 2WXMA 3N32A 2CHXA 3TIXA 1XF5L 4DQOC 3GE8C 2DAFA 3VR9B 2NPTB 1T0YA 1EWCA 2D10A 1J0GA 2KWVB 2BWFA 2KFKA 2DBYA 3DVGY 2WDTB 2C9WB 1WR6E 1BT0A 2KKCA 2BF8B 4RMAA 1Z2MA 1FEHA 2DZMA 4P16A 5FR3A 1C4PA 2ZVOA 3KYCD 1KJTA 5H92C 3PRMB 1V6EA 1SF0A 2V9HA 4XGAB 5HI1A 2N9XA 4WWOA 3QK0A 4EFOA 2INDC 3PLVA 5G55A 2FIFA 1P1AA 1E7VA 2J0MA 1KLUD 2IY1B 2KO3A 5J17A 3Q8CA 1WJUA 3KQ4A 1UELA 3K9PB 3H7PB 4GU2A 1TZOA 2K1FA 2WXOA 1KLVA 5FKAC 1PUTA 1MJDA 3BYYB 1X1MA 4KZ0A 3SU8X 1A70A 3IAM1 3FILA 1I4PA 1ZP0B 4MELA 1WWTA 4P1CC 2N7DA 3AEDB 3AB5A 4ZHOA 2ZJDA 2BS3B 4LK0M 1RWSA 3TSSA 2JZZA 2QC8A 4HVBA 3AE4B 1E7PB 2W9NA 1M94A 3SD5A 4D2KA 1V86A 1E90A 1C77A 5T8IA 2CKHB 2IYDB 3AEFB 3PZ8A 4A3OA 2KNBA 4RM9A 3DVGX 2E3TA 3BK1A 2ZNVB 1K8RB 2Y3AA 1QQRA 2EKIA 4MEMA 2JT4B 1QILA 3KWLA 2KAJA 2KC2A 1YD8U 4JL9A 4GDLA 2CU3A 1B9RA 3TJPA 2LHDA 4P6VF 3N20C 5HKHA 3H9DA 4WAFA 2KWDA 4WWMA 2HJ1A 2INCC 3DBLB 4AOFA 4FJZA 3WAOA 2MBQA 4ACFA 1BUIC 2EELA 1F0ZA 2NS5A 2IZVB 1ZPSA 1EWYC 4B0EA 5TSSA 3ONSA 2SAKA 3OJ4B 5AZFA 3AEGB 1PGAA 1WMHB 4NJCA 2NBVB 1T5XD 2KDBA 2ZW0A 3FILB 3B1LX 3RFZB 2M1MA 1SE3A 4FBJB 3KUCB 4LNKA 4M8MA 4YSZB 1KRHA 4HJKA 4BKSA 3APFA 1JWUD 2WDRB 3LYYA 2RSUA 3H7SA 4C4VA 2MBHA 1LXDA 3VTUA 2PVGC 1C3TA 3IXSA 1Q10A 5IKCM 2NTTA 4M0WA 1NENB 4URKA 4KSLC 2J42A 4HEA1 3R66C 3IT4B 2N9LA 1XQQA 1SB3C 1NYQA 2JZPA 1SJHD 1L6UA 4EZKA 1D5XC 4US9A 1AN8A 2LRUA 1F1HA 2IPKD 2BS2B 1WZ3A 3ZVVA 2ASQA 1J7AA 2PEAA 2J0KA 3VQIA 4A6QA 1MI0A 2Y5CA 2CHZA 2CJNA 4W9IA 3N3KB 2CU1A 2HDEA 1PYWD 2LRWA 3AEAB 2WXRA 1JRUA 2WXNA 2K6DB 1ENFA 5C1ZA 1HEZE 4GOCA 4FN2A 3R7QA 2JRHA 5DCNA 2N4FA 3UIOB 5C3JB 3TUOA 1WXAA 3N1ZC 1QKZA 4BKGA 1FMAD 4ZHPA 4FXCA 1TTNA 5HHDG 2K6QA 3PSEB 2FUHB 5EE9A 4M0WB 5G5HA 1SJED 3RZWC 2Y5BB 1OEYJ 3P4RB 1RAXA 3MC0B 3AEBB 2L32A 2KN4A 4PS8A 2MBEA 3DBHI 1OQQA 1VD2A 3RPFC 1UGMA 1CJEA 1P7EA 2V4LA 2BKRB 4M8NA 4A8XC 1E8ZA 1D5MC 4QAYA 4N9F4 3DCGA 3HVZA 2VH1A 2WU5B 4AQ7A 4MJSB 2KDMA 1SEBD 3AE1B 3RNCC 1D4BA 3PZDA 3SFEB 3NHEB 2LJIA 1WM2A 2KFJA 3X23A 4I6NB 4OZBA 2K0PA 2LUEA 1KTKA 2KVZA 3PLUA 3ZXVA 3B2GA 3L13A 3UINB 4HXDA 2BQQA 2JF5A 4XX5A 4N6EB 1E8YA 3IG3A 1VR9A 4BBNC 1WSPA 5D7GA 2LZ6A 4US8A 1VLBA 4MDKE 1V5TA 4IWQA 4S17A 5KHOA 4NY0A 3CMMB 2QCZA 3HM3A 1VZ6A 4HPMB 2WHIA 1XLOA 2WXPA 4ICUA 1EU3A 2QEJC 4IM3A 1FRRA 4BKSD 1UBQA 2JZ3B 4F7ZA 4X57B 5LNK1 3VHTC 1P98A 2OJRA 3KWVA 1KM7A 2LVOA 3HHMA 2LMCA 2JU6X 3OWEB 1U4AA 3W1SA 1TY0A 3NY5A 2I1JA 5AUIA 3VH4B 4IUMB 2J53A 2BKFA 2AWTA 3R8BA 3AM9A 4YT0B 3IAS1 3DVNU 4GSWA 4LJPB 3VFKA 1J7CA 4W9DA 2MP2A 1CK1A 3TCAA 1YJIA 2CS4A 1ACCA 1FFUA 5AUKA 1L0YB 5AZGA 1G6JA 2MHJA 4MM3A 4JGHB 4WIPA 1DOIA 2BPSA 3Q8EA 5HFYA 2UU7A 3PS6A 2AQ1B 1FRDA 5IP4D 3NZSA 3GS2A 4FADA 4KV2A 4IDIA 4E74A 2LHEA 2WYQA 3P4QB 2C7MB 2PPHA 2WP9B 1DOYA 1MPEA 2LD9A 3N1XC 1PGBA 3SFDB 3FC4A 2OJWA 2JYTA 2FCSA 2C5LC 4H2AA 3NVVA 1RFKA 2QSDA 2I2YA 4CQNA 3ZNHB 2DZIA 1WGHA 3CIRB 1UD7A 3TMPB 2G4DB 2KZRA 4W9FA 4ITKA 3P4SB 2N7JA 3QAQA 4RGOS 4XYCA 2KMMA 4TUUA 5J2RA 1F77A 3AI5A 2AQ2B 4FLHA 2D3GA 1IPGA 1YOVB 4IM0A 3A9KA 3A9JA 4ZOHC 2D2QA 3LDZE 3Q8AA 3GB1A 1Y8RC 5BMIA 2L7RA 2K25A 2KMAA 4KGRA 1EF5A 2Y5PA 3VXWA 3Q3FA 4W9CA 4PS3A 4N59A 1TIFA 3VVWB 2IO2B 4HPPA 5E6OA 1JWMD 1V97A 2IGHA 1TZ1A 1D6EC 3CSTA 2BB5A 3EUB2 3Q3MC 2Z8LA 3N30A 3PZ7A 2KYWA 3VRAB 2J4XA 2KDIA 4B95A 1UH6A 1J19A 1SGHA 3MFGA 2MP2B 5JXVA 3LB8C 2JWZA 2NBUA 1E8XA 4L1BA 1V1PB 2GBNA 5IA7A 1QT9A 4W9LA 3N9YC 3DVNV 2PE9A 3ZYYX 2INNE 1CMXB 4FJVB 3FAHA 1WMHA 3RD2A 2FUG1 1YX5B 1Q5WB 2L83A 3UIPB 3NVZA 3ZJTA 3KUDB 4LDTB 4MSQB 4JQWC 2V0GA 2V3NA 1ZXIA 3NUHB 1DYQA 3ZLZA 2XN9C 2O2VA 3C8YA 2XK5A 4A9AA 1FNUA 3W1SC 4AS1A 3NZ3A 2K39A 2L8JA 3ZDMC 1XD3B 4I6LB 1S1QB 1TKGA 5G5GA 1L7YA 2NBWB 3ENEA 4AJWA 3M62B 3NS8A 1ZDXA 1YIWA 4C56C 1ZKHA 1XT9B 1L0VB 1WE7A 1P0RA 2DENB 3GZNB 2KK8A 4MJSA 2KDEB 1WF9A 4ANXA 2KN5A 1L5PA 4GB9A 4KDIC 1V9JA 4UDUC 1KF6B 4XDDA 2AQ3B 3CWIA 2MH7A 3AE2B 2H89B 4IM2A 2MCNB 2KANA 3BINA 2LGSA 5JHAA 2M17A 2V4IB 2Q5WD 1NDDA 3K9OB 4NAWB 1UBIA 3TEXA 2WU2B 4RNAA 2YEPF 3QIJA 4MGKE 3KH0A 4XZ4A 1I35A 2MSED 4EEWA 3C0RB 4YTNB 1UUPA 3TEZA 1FIQA 3WAMA 4ANWA 4EE2A 4ARCA 4ANUA 1WR1A 3R2TA 1FNVA 1UZXB 1V1PA 1HA5A 3NS1A 4K3CA 1TYGB 3SR6A 3KVFB 1GB1A 3AE3B 3HK0A 4M00A 3AE6B 1IUEA 1YQ4B 1TGZB 4W9JA 4JWSC 2ZZPB 2DZKA 1TKYA 2KACA 4NQKE 2CHWA 1SE9A 5J18A 1VZ8A 1WJNA 1ZOYB 2LJ5A 3ZO5B 3PV1A 2N9EB 2ZPNA 1H8CA 1VRAB 3EGRA 3ZKJC 1NVID 4DHZB 3I63C 3L4PA 2RDHA 4BKTA 2L0FA 4ASWC 1V5OA 4FA6A 1FXAA 4L23A 3VH3B 3MTNB 4FJYA 4K81A 2KFKB 4KGSA 3RT3B 2IY0B 5D6JB 1NI3A 3CF6E 1SE4A 3JVZX 3ZNID 3WAPA 4MGIE 1FD6A 3PTFC 1EM7A 3E9SA 4W9EA 5IO9A 1AW7A 4CO7A 3NZUA 4F8CB 3HIZA 1FNWA 1Y56A 2TSSA 3ZTDA 4OHJA 4J6IA 2BWES 4C4VB 1TJEA 3RI7C 1D3ZA 2ACZB 3JSVA 1BMLC 2QHOA 1WI0A 3A33B 3FKYA 4DXGA 2WGSA 1JQ4A 1FCLA 2KDFB 3JW0X 4ZDVA 2SEBD 3R2IA 2K8BA 3QJZA 5E6NA 2IJ0A 1I42A 2ZW1A 4HLEA 1JMLA 4NAWA 2MBOA 4OZAA 4HPLB 3BVZA 4K7SA 2RDGA 1K51A 4RF0A 2W3RA 2N1WA 2Z0DB 2IBIB 1GG3A 2MJ3A 3ETRA 1P9DU 2INPE 2MWSB 4R3DA 2DAJA 4M02A 4B6WA 2G4SA 1H4RA 1JWAD 5HG2A 1ET6A 2WWZA 4C80A 1IYFA 1IBXA 3DPDA 1Z5SB 2BS4B 4YTMB 1HQRD 4WJNA 2ZNVC 3EC8A 4E71A 3NRZA 3A4SC 3DHHC 3PREA 2MJEA 2B3AA 1TBEA 4IG7B 2V3PA 3BYTB 2IO1B 2XK5B 4JPSA 4II3B 2DX5B 2YVCA 1E6EB 4GDKB 1QZEA 1F2RC 3KYDD 3MP9A 1R4NB 2KXJA 2DNFA 2A4ZA 2ZCBA 1A5RA 4WH4A 3IBEA 2O6VA 2R2QA 3VAWA 4DBGA 1FXTB 4C7ZA 1L0XB 3VUYA 3A1QA 3QQ8B 2FAZA 2N7EA 3BZDB 2KT7A 4A20A 2FE8A 3T3NA 3RNEC 4HRSA 4WWNA 4YTPB 3NOBA 1WGYA 3Q3JA 2C7HA 4XC2A 1WZ0A 3V6CB 3MJWA 2LVPA 2RDBC 1QF6A 3DHGC 3Q14C 3PRPB 1E5WA 2GLSA 5LLIA 2W55A 1VZ7A 4K7UA 4GN1A 4MGZE 1WYWB 3AE5B 3VUWA 1K50A 2REXA 1LFDA 4DK5A 2W54A 1DGJA 1WX7A 3U4EG 2GB1A 4NJ6A 2ON8A 1E10A 3APCA 3OAWA 1B1ZA 2LI5A 2BW2A 5EE0A 1WIAA 4WQMA 1HTOA 1WX8A 1STEA 3MHZA 4EUTA 3P1MA 3DWMA 5DPSA 2JVCA 4FULA 2WLBA 1T0SC 2E6XA 1C76A 3BVMA 2MJDA 3P4PB 1WE6A 2M8SA 1F9JA 5BO4B 1UWMA 3NVWA 2DYMA 2RPVA 1WGKA 1YQ3B 3L0WB 3Q2AC 2UWQA 4NNJB 5FR6A 2DYOA 2KOXA 3R7RA 4FHJA 2QIEB 1R4NI 5L95C 3HUIA 4KX6B 4NJ7A 1EF1A 3LXFA 2KX3A 1JWSD 2GOWA 3QX1A 4HCNB 3OLMD 4AUQC 4LDTD 2L76A 4KIKA 4MH8A 1QLBB 2L3ZA 2PTLA 3L08A 1WXVA 1UWXA 1V1OA 4JX1C 3WANA 1FCCC 3I9V1 2KLGA 3IVFA 2WDVB 4GXBA 1L4DB 4HJGE 4KVGB 5FK9C 4B9KA 3LJ3A 1WXMA 3S2AA 2WQYB 2JXXA 5BMHA 4MACA 2FIDA 2KVRA 1I4QA 3ZQ4A 3NVYA 1ZDVA 4RH6A 4WJQA 4LJOB 1Q0WB 4DDID 2IO0B 4GDKA 3AN1A 2L1AA 4ZRIA 3GE3C 4ZRKA 2UYZB 3PO0A 2YEPB 2K9XA 4RFBA 1MG4A 3UGBB 3V05A 1I4XA 4IWOA 2GBMA 2X8XX 1GB4A 1MG8A 2L00B 3WCQA 1M4VA 5CHWA 2M0AA 4GMVA 4CYEA 5D3DA 3P42A 1EUVB 1I4RA 2D3BA 3DOWA 1JWBD 2D5GA 1SIFA 1YN5A 1WGRA 2VZKB 3AE8B 2KMCA 2NTSA 4LNIA 3QC8B 3BK2A 5L83A 1C4CA 2GI9A 3EFUA 3Q8BA 3ZNGC 4P1BC 2MLBA 4DHZE 1YN3A 4ZYNA 5BMGA 2RR9A 2WXGA 4OVUA 3DHIC 2K8CA 2EMSA 3N1YC 1I7HA 1N5XA 4TSSA 2PE6B 1L2NA 1YNTE 2BBCA 4P7IA 1LO5D 3MC9A 2PKOA 2V3SA 5H8YE 3W5UB 3NJTA 2DYBA 4PK1A 3IT6B 4NZLB 5D94A 4ICVA 4C7YA 4B0MA 2XBBC 2G9HD 1FXIA 2G45B 2KJ6A 2C7NB 3ALBA 3ZGZA 3AMZA 2OHFA 1GC7A 1F52A 1L4ZB 3U7ZA 2NR2A 4XE0A 4LNNA 2PW9A 4Q2JA 1MHHE 3W2DA 5LXIB 2OEDA 1TS5A 1RFAA 2L05A 1C78A 3IHPC 1QOFA 3DBHB 4RM8A 1OTRB 4ZYSA 2KTRB 2HTHA 1JRPA 3ZXRA 2WXKA 2K5PA 3DQVA 1HZ6A 4YL8A 3EHVA 3AU5A 3JYUA 4II2B 2WX0A 2K22A 3VR8B 4L2YA 4YSYB 3RNGC 4IOIE 4C00A 4YXDB 2FCMA 3ZRFA 3MJ5A 1TS4A 2Z59B 5BYSA 2JRIB 2NPTA 2PJHA 1E8WA 5D2MB 1TY2A 2WNMA 3AEEB 3Q69A 1WFYA 2BTEA 3VRBB 1MHXA 1KFYB 3ZUNA 4K1RB 5C2TB 4DXFA 3B9JA 4GIVA 1E0ZA 1VJKA 5IN7A 5EE1A 2L0TA 1OQYA 4RGMA 2GBRA 4ZRJA 2N0SB 3W9CB 1HE8A 3QWZB 2ICIA 2HD5B 4PYZA 1WX9A 3E56A 3MC8A 1PDXA 2LFIA 4O1NA 3ABVB 2WX1A 2A5UA 5G2NA 1P3QU 1WH3A 1FO4A 1XLPA 3ZTCA 1FFVA 1BXTA 4W9KA 3RULA 5JZEB 1T0RC 1TKEA 3IFWB 1CZPA 3RN9C 1K53A 1KLGD 3PHWB 1C4AA 3ZJVA 4WJOA 2BT6A 1WJ6A 3APDA 4KKJA 2QMTA 4XWWA 5CHVC 2NVUI 1NBFC 4YWGG 4LTUA 2J52A 1JW9D 1K52A 1XO3A 2EKEC 2LVQA 3Q6BA 1ZW7A 4JIOU 3VDZA 3ECIA 1TS3A 1HZ5A 1XEEA 3MHSD 3UQBA 3X0WA 1LM8B 2IGGA 2O6VB 2PVOD 4DWFA 2HE7A 3RMKC 4GDLB 1F2RI 1I4GA 2G3QB 1E7UA 1WRDB 3EECA 3GOEA 1V2YA 2B76B 1OGWA 1WY8A 1YMHE 4A3PA 3B08A 1VCBA 2WXHA 4CHKA 3ZNZB 2BB6A 2O6VD 1IBXB 2X38A 2JUOA 4A90A 1SE2A 5GMVA 5IAAC 5BYQA 1N60A 2PMVA 2D3AA 4BBNF 2RD0A 4BZAA 1WXSA 4YSXB 4JLCA 3U8ZA 4MGYE 4XDCA 2IGDA 4HKZE 3RCZA 4AP4C 1C1YB 2CR5A 3CSFA 1YQBA 2LXAA 3H7PA 3WA0A 1MVKA 1SBBB 4USAA 1E9MA 2ONQA 2N9KA 4HCPB 3KLSX 3DWGC 4RCOA 2BYEA 5DPWA 4G0NB 3ZIMA 3L17A 2N9PC 3V6EB 2N1VA 1LQBA 3AU4A 4W9HA 2HJ8A 2NMQA 2MX2A 3D32A 5CTRC 1AYFA 1WGGA 2WS3B 2KHWB 2FBWB 2AEHA 2KQ4X 2LXCA 3A9JB 3Q8FA 1NYRA 1OQRA 2QJLA 1TT5B 4DHJD 2MW5A 4E3CA 1R4MI 2J7QB 3DBRI 1T0QC 1GC6A 3W5VB 2JX5A 4EZLA 4A55A 2XEWA 1WRIA 2VZKD 3HM6X 2EMTA 1SIJA 1P7FA 3SHQA 5KHQA 2M56B 4BVUC 2D11A 1N61A 3RUIB 3BY4B 1XCTL 4AWJA 1EU4A 4PT5A 1HTQA 4DXAB 4OZCA 1JROA 1FM0D 3L54A 3I5JC 3T9LA 1I4HA 3AE7B 5CHFA 3U7DA 1ZGUB 3HVDA 2M0XA 4LLGM 1ZUD2 3HRDD 1WXQA 4NAMA 3SEBA 1WYGA 3P63A 3AECB 1CQVA 3I3TB 1XLNA 1L6VA 1QOAA 2ZVNA 5TR5A 5AEKB 4TMAB 3DDCB 1WGDA 1WM3A 4WQOB 1ISNA 4S0RA 2JSVX 2CJOA 4HK2A 2K8HA 4OW0A 2JQRB 4IW0A 1V81A 1AARA 1J8CA 1PFDA 1NEKB 3A1QB 3RNAC 3O65B 2DHZA 1R7SA 3VTWA 4RGTA 1N63A 3TEYA 1LGRA 5E6JA 3V60A 1GPXA 2WXLA 2WXFA 3RNBC 1AWDA 3UI3A 3EFCA 3WIMA 2DLBA 4TKNA 3R3MA 3M95A 5AZHA 3V3XA 2V1YA 4IWPA 1QOGA 1TS2A 1V49A 4HDOA 3M3JA 2H88B 5GXGB 3Q3OC 2W3SA 2K3UA 4OVVA 2KQSA 2LASA 2GBKA 2WXIA 4PS7A 3C19A 1ZE3D 2AYOB 2C60A 3RYTA 4MT5A 5I4DA 1C9FA 4K3BA 3BVGA 2WXJA 3QARA 2LGYA 1IGDA 3PPAA 2GRIA 3TBLD 5C23A 1IGCA 1RRBA 2MRPA 4G50A 4TQ0A 2D07B 3OG5A 3UF8A 2J0JA 5CX3A 3GZNI 1ET9A 5E6PA 1Q1OA 4ANVA 2MQJA 3U2SC 3I57A 2RMMA 3AE9B 2W82A 3WALA 3L16A 3NG0A 2KWCA 2MA9B 2KJHB 5BYRA 4RGNA 4JWUC 2ZCCA 2I38A 2NCNA 4BFRA 1RLFA 1OEYA 1T3QA 1NI2A 3DBLI 4HROA 1IP9A 1UF0A 2R61A 2LGXA 2QILA 2KJRA 4HKQA 2D3CA 3A9KB 2LEKA 1GUAB 3VUXA 2JPHA 3RZFA 3ZJUA 4KSKC 1GNUA 2JXTA 3U30A 4ZRQA 4BOZB 4N58A 1KH0A 1RYJA 2G1EA 3OJ3A 1YX6B 2DWQA 5EDSA 4LNFA 3H1UA 2JYEA 4DDGD 4WWPA 4PYUA 2BYFA 3O13A 3T3OA 3GP7A 5DPTA 4KDLB 4GLSC 2M19A 2KTRA 4W9GA 1D5ZC 2FNJB 4EKUA 2BYTA 2HTME 4HWIB 4XWTA 5LXHA 3QCAA 5MPOA 3ML8A 3AH7A 4HDQA 4TV3A 2PLPA 3ML9A 3QHTA 2FCNA 3U52E 2QDFA 4WJPA 1JCKB 2MBBB 1MFWA 2KQ7A 2AL6A 4KGTA 1V80A 2WDQB 1VDVA 2FCQA 1JALA 4FHKA 4MM3B 2I1KA 4ZRPA 1GJZA 3V62A 3PGEA 1ROEA 3BIID 4KKIA 1N6ZA 1UGJA 4IKGA 4EOYA 3PT2B 1WJ4A 1PGXA 1XXGA 4RF1A 2OOBB 3AULA 4K7WA 2LGDA 4I6PA 4WAAA 4KZCA 3W1YA 3ZW3A 2LGIA 4ARIA 1OFFA 1R4MB 3DBRB 2AL3A 1XCQL 4J3OD 4OVZA 3KUZA 2LWPA 3H6NA 4G11A 4M01A 2KWUB 4EZJA 1C79A 2RGFA 4BOSC 3Q3NC 2JY6A 3VTVA 5JHBA 2MEKA 4G3XB 2AX5A 1ESFA 2KLCA 3TL5A 3H8HA 2JWUA 1SXTA 4REZA 1PQSA 4AJYB 3EA6A 2BGFA 4WURA 1GOZA 1KOTA 2Z0EB 2VRRB 3B2FA 2O2VB 4GGQA 3TEWA 1FPYA 5DPRA 2BVCA 2LUMA 2ZEQA 2KX0A 5EE3A 3ZRCA 2RPQA 4NPNA 5IOIA 1S3SG 3M63B 1HXYD 3PRZA 4MH0E 4BAXA 1SSNA 1YJ1A 3BWUD 2VH2A 3PHXB 2XNAC 3A4RA 3B0AA 4LNOA 2PIAA 3UQAA 2R2OA 4LCDE 1T6BX 1UNSA 3AXCA 3PVLA 1RM6C 3ZDTA 2DZJA 1XLQA 3V61A 3P2BA 1GAQB 2KTFA 3DBSA 4IC7B 2M4NA 3T8MA 3J9CA 3KW5B 1V8CA 1ZXHA 2KD0A 5D3IB 2GMIC 1EO6A 5JH5C 4DHJB 3AV8A 4MSMB 2YLMA 2ZPYA 1YN4A 4KIKB
chains in the Genus database with same CATH topology
1FRDA 1N5WA 3AE5B 3GS2A 2NMQA 4TQ1A 4IDIA 2LHEA 1K50A 3P4QB 2WP9B 2W54A 1DOYA 1QOBA 1DGJA 1MPEA 2IDYA 3U4EG 1PGBA 3SFDB 2GB1A 1AYFA 2WS3B 3FC4A 2JYTA 3URYA 2FBWB 2KQ4X 1YJJA 1J7BA 4H2AA 2ON8A 1NYRA 3NVVA 3Q8FA 4JE3B 1N62A 1RFKA 2QSDA 1E10A 2I2YA 4CQNA 2WXQA 2L52A 1DOXA 1OQRA 3CIRB 1B1ZA 2WXMA 2QJLA 1XF5L 2BW2A 4DQOC 5EE0A 4WQMA 3W5VB 4ITKA 2JX5A 3P4SB 2N7JA 3VR9B 4A55A 1STEA 1EWCA 3MHZA 4RGOS 1WRIA 3P1MA 2KMMA 2VZKD 3DWMA 1F77A 2WLBA 2E6XA 2AQ2B 2DBYA 1C76A 3BVMA 2MJDA 3P4PB 1SIJA 1P7FA 1UWMA 2M56B 2DYMA 3NVWA 4ZOHC 2RPVA 1WGKA 1YQ3B 1N61A 1FEHA 4P16A 3Q8AA 3GB1A 5FR3A 1C4PA 5BMIA 1XCTL 4KGRA 1EU4A 4PT5A 4OZCA 1JROA 2Y5PA 1FM0D 1I4HA 2DYOA 3AE7B 4N59A 5H92C 1SF0A 1JWMD 1V97A 2IGHA 3HVDA 2QIEB 4LLGM 5HI1A 1ZUD2 3HRDD 3HUIA 1D6EC 4KX6B 1WXQA 4NAMA 3SEBA 2BB5A 3EUB2 3LXFA 1JWSD 2Z8LA 3PZ7A 1WYGA 3P63A 3VRAB 2J4XA 3AECB 1CQVA 1KLUD 1XLNA 1L6VA 3MFGA 1QOAA 5JXVA 3Q8CA 3LB8C 4TMAB 4MH8A 1QLBB 3KQ4A 2PTLA 1TZOA 2JSVX 2CJOA 4L1BA 2WXOA 4OW0A 1V1PB 1UWXA 5FKAC 2JQRB 1PUTA 1QT9A 1V1OA 3BYYB 4JX1C 1PFDA 1NEKB 1FCCC 3I9V1 3N9YC 1A70A 3IAM1 3FILA 1I4PA 1R7SA 2WDVB 3ZYYX 1L4DB 1ZP0B 4HJGE 1WWTA 2INNE 5FK9C 4RGTA 3FAHA 1N63A 3TEYA 3AEDB 2FUG1 2WQYB 3AB5A 5E6JA 4ZHOA 1GPXA 5BMHA 4MACA 2L83A 2BS3B 1I4QA 4LK0M 3ZQ4A 3NVZA 2WXLA 1RWSA 3NVYA 3ZJTA 3TSSA 1ZDVA 2WXFA 4RH6A 1AWDA 3UI3A 2V0GA 2V3NA 1ZXIA 3AE4B 1E7PB 3NUHB 4D2KA 1DYQA 5T8IA 1C77A 2DLBA 3AN1A 2L1AA 2XN9C 3C8YA 4A9AA 3AEFB 3PZ8A 1FNUA 4AS1A 3NZ3A 3PO0A 3V3XA 2YEPB 2K9XA 4RFBA 2E3TA 3BK1A 3V05A 1I4XA 1QOGA 1TS2A 1TKGA 2Y3AA 1QQRA 5G5GA 2H88B 2EKIA 5GXGB 2W3SA 1GB4A 1QILA 2K3UA 3KWLA 2KAJA 1ZDXA 3WCQA 1M4VA 2M0AA 2CU3A 2WXIA 4C56C 1B9RA 2LHDA 4P6VF 5D3DA 1ZE3D 4WAFA 3P42A 2KWDA 1I4RA 1L0VB 4WWMA 1JWBD 2D5GA 1YN5A 4MT5A 2VZKB 3AE8B 5I4DA 2NTSA 1L5PA 1C9FA 4UDUC 1KF6B 1BUIC 2EELA 3BVGA 3BK2A 1F0ZA 4XDDA 2AQ3B 3CWIA 2WXJA 2MH7A 1C4CA 1ZPSA 2GI9A 3AE2B 3Q8BA 1EWYC 2H89B 1YN3A 5BMGA 4B0EA 5TSSA 2WXGA 1IGDA 2V4IB 2GRIA 1I7HA 2Q5WD 2SAKA 1N5XA 4NAWB 4TSSA 3TEXA 1IGCA 1YNTE 2WU2B 4RNAA 2BBCA 2YEPF 3AEGB 1PGAA 1LO5D 2PKOA 4TQ0A 5H8YE 3W5UB 4YTNB 1UUPA 4NJCA 3TEZA 1T5XD 2ZW0A 3IT6B 4NZLB 1FIQA 1ET9A 3FILB 3RFZB 4C7YA 1SE3A 4B0MA 4EE2A 4ARCA 3U2SC 3I57A 2G9HD 1FNVA 1FXIA 3R2TA 1HA5A 1V1PA 2RMMA 3AE9B 4YSZB 1KRHA 3NS1A 2W82A 1JWUD 2WDRB 3AMZA 3LYYA 3ZGZA 2OHFA 1L4ZB 1TYGB 3U7ZA 2PVGC 3SR6A 4XE0A 5BYRA 3IXSA 1Q10A 2NTTA 1GB1A 4RGNA 3AE3B 4JWUC 4M0WA 2PW9A 1NENB 2I38A 4Q2JA 1MHHE 3W2DA 3AE6B 1IUEA 1YQ4B 2J42A 1T3QA 2OEDA 4JWSC 4HROA 4HEA1 2R61A 1TS5A 1TKYA 2KACA 2QILA 3IT4B 4HKQA 1C78A 1VZ8A 1QOFA 2LEKA 2N9LA 1SB3C 1ZOYB 1NYQA 2JZPA 1SJHD 3ZJUA 1L6UA 2JXTA 1VRAB 3EGRA 4ZYSA 1D5XC 4US9A 4ZRQA 1AN8A 1JRPA 2WXKA 1NVID 2IPKD 2K5PA 2BS2B 1HZ6A 3L4PA 4N58A 2RDHA 1KH0A 1RYJA 1J7AA 2K22A 2G1EA 3VR8B 1FXAA 4L2YA 3VQIA 4L23A 4YSYB 1MI0A 2DWQA 4IOIE 2Y5CA 4A6QA 4YXDB 3MJ5A 4KGSA 2JYEA 2CJNA 1TS4A 2HDEA 1NI3A 1PYWD 5BYSA 3AEAB 3O13A 3T3OA 1SE4A 1TY2A 2WNMA 3AEEB 2WXRA 3GP7A 3Q69A 2BTEA 3VRBB 1MHXA 4GLSC 2WXNA 1KFYB 1FD6A 1EM7A 3E9SA 2M19A 1ENFA 5C2TB 1AW7A 1HEZE 4DXFA 3B9JA 1D5ZC 1E0ZA 1FNWA 1VJKA 5EE1A 2BYTA 2HTME 4XWTA 1Y56A 2TSSA 5C3JB 4OHJA 4RGMA 3TUOA 5MPOA 4ZHPA 1QKZA 1TJEA 1FMAD 2N0SB 3W9CB 4FXCA 2ACZB 5HHDG 2ICIA 1BMLC 3AH7A 3E56A 1PDXA 2PLPA 4DXGA 5EE9A 1JQ4A 2LFIA 5G5HA 4O1NA 1FCLA 1SJED 3ABVB 3U52E 2SEBD 1JCKB 3R2IA 1FO4A 3P4RB 3MC0B 1XLPA 1FFVA 1BXTA 3AEBB 4KGTA 2IJ0A 2WDQB 1VDVA 2ZW1A 1JALA 2L32A 4MM3B 1JMLA 1TKEA 4ZRPA 4OZAA 1CZPA 1ROEA 2KN4A 1K53A 3BIID 1KLGD 4KKIA 4IKGA 1UGJA 1C4AA 3BVZA 3ZJVA 1PGXA 2BT6A 1XXGA 4RF1A 2RDGA 1OQQA 4KKJA 3RPFC 1CJEA 2QMTA 1P7EA 4XWWA 4A8XC 1D5MC 1K51A 4YWGG 4RF0A 4LTUA 2W3RA 2J52A 2LGIA 4ARIA 1OFFA 1XCQL 1JW9D 1K52A 4J3OD 3HVZA 4OVZA 2WU5B 4AQ7A 1XO3A 1TS3A 1HZ5A 1XEEA 2KDMA 1SEBD 3AE1B 2MJ3A 3ETRA 1D4BA 1C79A 2IGGA 3SFEB 2INPE 2PVOD 4R3DA 2LJIA 4GDLB 2MEKA 1F2RI 2AX5A 4OZBA 1I4GA 1ESFA 1KTKA 2K0PA 1JWAD 5HG2A 1ET6A 2B76B 3B2GA 4C80A 1YMHE 3H8HA 1IBXA 2JWUA 1SXTA 2BS4B 4YTMB 1HQRD 2WXHA 4N6EB 1VR9A 2BB6A 3NRZA 4REZA 1WSPA 1IBXB 5D7GA 2MJEA 2X38A 3EA6A 4US8A 1VLBA 4A90A 1SE2A 4WURA 1GOZA 2V3PA 3BYTB 3B2FA 4JPSA 3TEWA 1E6EB 1VZ6A 4GDKB 1F2RC 1XLOA 2WXPA 3MP9A 2LUMA 5EE3A 1EU3A 2QEJC 1FRRA 5LNK1 5BYQA 3KWVA 1HXYD 1N60A 2LMCA 4WH4A 1SSNA 2JU6X 2PMVA 3OWEB 3BWUD 3W1SA 1TY0A 2XNAC 2PIAA 5AUIA 4C7ZA 1T6BX 4YSXB 1UNSA 1L0XB 2J53A 1RM6C 4XDCA 3R8BA 2IGDA 3AM9A 4HKZE 4YT0B 1XLQA 3IAS1 3BZDB 1MVKA 1SBBB 1GAQB 2FE8A 4USAA 3T3NA 1J7CA 1E9MA 4HRSA 2ONQA 4YTPB 1CK1A 2N9KA 1YJIA 1ACCA 3DWGC 1V8CA 1FFUA 1ZXHA 3J9CA 3KLSX 4RCOA 1L0YB 5D3IB 5AUKA 4WIPA 1DOIA 3Q8EA 5HFYA 3AV8A 1QF6A 2AQ1B 2W55A 1YN4A 1VZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRD A;  3AED B;  1N5W A;  3AE5 B;  2WQY B;  3AB5 A;  4IDI A;  3AE3 B;  4JWU C;  4LTU A;  4ZHO A;  1GPX A;  1NEN B;  2W3R A;  2L83 A;  3P4Q B;  1OFF A;  2WP9 B;  2W54 A;  2BS3 B;  1JW9 D;  1DOY A;  1QOB A;  1DGJ A;  3HVZ A;  3AE6 B;  3NVZ A;  2WU5 B;  1IUE A;  1RWS A;  1YQ4 B;  3NVY A;  1XO3 A;  1T3Q A;  3SFD B;  3FC4 A;  1AYF A;  2WS3 B;  4JWS C;  4HRO A;  1AWD A;  2FBW B;  1TKY A;  3AE1 B;  2MJ3 A;  3ETR A;  1YJJ A;  1ZXI A;  3AE4 B;  1J7B A;  1E7P B;  1NYR A;  1QOF A;  2LEK A;  3NVV A;  1N62 A;  1RFK A;  3AN1 A;  3SFE B;  1E10 A;  2PVO D;  1SB3 C;  1ZOY B;  1NYQ A;  2L52 A;  1DOX A;  1OQR A;  3CIR B;  4A9A A;  1L6U A;  2QJL A;  2AX5 A;  3AEF B;  4US9 A;  1JWA D;  1JRP A;  2B76 B;  3B2G A;  3PO0 A;  1NVI D;  2K5P A;  2K9X A;  5EE0 A;  2BS2 B;  4C80 A;  2E3T A;  2BS4 B;  3L4P A;  4N58 A;  1QOG A;  4YTM B;  4N6E B;  4WQM A;  1TKG A;  3W5V B;  4ITK A;  2JX5 A;  3P4S B;  5G5G A;  3NRZ A;  1RYJ A;  2EKI A;  2H88 B;  1J7A A;  2K22 A;  2G1E A;  5GXG B;  3VR9 B;  2W3S A;  2MJE A;  3VR8 B;  4US8 A;  1FXA A;  1VLB A;  3KWL A;  1WRI A;  2KAJ A;  2KMM A;  3P1M A;  3DWM A;  2DWQ A;  4YSY B;  2Y5C A;  3WCQ A;  2WLB A;  4YXD B;  2DBY A;  3B2F A;  2CU3 A;  1B9R A;  2MJD A;  4P6V F;  3P4P B;  1SIJ A;  2CJN A;  1E6E B;  1NI3 A;  1XLO A;  1UWM A;  1L0V B;  2M56 B;  3NVW A;  4ZOH C;  3AEA B;  5EE3 A;  4WWM A;  1WGK A;  1JWB D;  3AEE B;  1FRR A;  1YQ3 B;  1N61 A;  3VRB B;  1KFY B;  3AE8 B;  1L5P A;  2M19 A;  1N60 A;  5C2T B;  3B9J A;  1JRO A;  1E0Z A;  1FM0 D;  1KF6 B;  1VJK A;  1F0Z A;  3AE7 B;  4N59 A;  3CWI A;  5EE1 A;  2MH7 A;  3AE2 B;  2HTM E;  5H92 C;  1EWY C;  5C3J B;  1SF0 A;  2H89 B;  1V97 A;  5MPO A;  2QIE B;  4ZHP A;  1TJE A;  1FMA D;  2PIA A;  1ZUD 2;  3HRD D;  2N0S B;  3HUI A;  4KX6 B;  4FXC A;  1WXQ A;  2ACZ B;  5AUI A;  3W9C B;  4C7Z A;  4YSX B;  1I7H A;  2Q5W D;  3EUB 2;  3LXF A;  1N5X A;  1RM6 C;  3AH7 A;  1WYG A;  3P63 A;  1PDX A;  3AM9 A;  4YT0 B;  2WU2 B;  5EE9 A;  3VRA B;  3AEC B;  3AEG B;  1JQ4 A;  5G5H A;  1XLQ A;  1XLN A;  1L6V A;  2PKO A;  3ABV B;  5H8Y E;  1QOA A;  3W5U B;  3LB8 C;  1GAQ B;  4USA A;  4YTN B;  1QLB B;  1J7C A;  1E9M A;  1FO4 A;  3P4R B;  1XLP A;  4HRS A;  4YTP B;  1FIQ A;  2CJO A;  1FFV A;  3AEB B;  4C7Y A;  1YJI A;  2JQR B;  1PUT A;  1QT9 A;  1V8C A;  1FFU A;  1VDV A;  1JAL A;  2WDQ B;  3DWG C;  4JX1 C;  5AUK A;  1PFD A;  1NEK B;  1TKE A;  1DOI A;  1CZP A;  1FXI A;  1ROE A;  1A70 A;  3BII D;  3AV8 A;  3AE9 B;  4YSZ B;  1KRH A;  1R7S A;  2WDV B;  3NS1 A;  3ZYY X;  1ZP0 B;  1QF6 A;  2WDR B;  2BT6 A;  3AMZ A;  1WWT A;  2OHF A;  1OQQ A;  1TYG B;  3RPF C;  2W55 A;  1CJE A;  2PVG C;  3FAH A;  3SR6 A;  1N63 A; 
#chains in the Genus database with same CATH topology
 3RNF C;  2GBJ A;  1N5W A;  4TQ1 A;  4F1S A;  3SDL C;  2BYV E;  1QOB A;  2IDY A;  3QA8 A;  3JSV B;  2KC1 A;  3URY A;  1YJJ A;  3L10 B;  1J7B A;  4JE3 B;  1N62 A;  4NQL B;  2WXQ A;  2L52 A;  1DOX A;  2IO3 B;  2WXM A;  3N32 A;  2CHX A;  3TIX A;  1XF5 L;  4DQO C;  3GE8 C;  2DAF A;  3VR9 B;  2NPT B;  1T0Y A;  1EWC A;  2D10 A;  1J0G A;  2KWV B;  2BWF A;  2KFK A;  2DBY A;  3DVG Y;  2WDT B;  2C9W B;  1WR6 E;  1BT0 A;  2KKC A;  2BF8 B;  4RMA A;  1Z2M A;  1FEH A;  2DZM A;  4P16 A;  5FR3 A;  1C4P A;  2ZVO A;  3KYC D;  1KJT A;  5H92 C;  3PRM B;  1V6E A;  1SF0 A;  2V9H A;  4XGA B;  5HI1 A;  2N9X A;  4WWO A;  3QK0 A;  4EFO A;  2IND C;  3PLV A;  5G55 A;  2FIF A;  1P1A A;  1E7V A;  2J0M A;  1KLU D;  2IY1 B;  2KO3 A;  5J17 A;  3Q8C A;  1WJU A;  3KQ4 A;  1UEL A;  3K9P B;  3H7P B;  4GU2 A;  1TZO A;  2K1F A;  2WXO A;  1KLV A;  5FKA C;  1PUT A;  1MJD A;  3BYY B;  1X1M A;  4KZ0 A;  3SU8 X;  1A70 A;  3IAM 1;  3FIL A;  1I4P A;  1ZP0 B;  4MEL A;  1WWT A;  4P1C C;  2N7D A;  3AED B;  3AB5 A;  4ZHO A;  2ZJD A;  2BS3 B;  4LK0 M;  1RWS A;  3TSS A;  2JZZ A;  2QC8 A;  4HVB A;  3AE4 B;  1E7P B;  2W9N A;  1M94 A;  3SD5 A;  4D2K A;  1V86 A;  1E90 A;  1C77 A;  5T8I A;  2CKH B;  2IYD B;  3AEF B;  3PZ8 A;  4A3O A;  2KNB A;  4RM9 A;  3DVG X;  2E3T A;  3BK1 A;  2ZNV B;  1K8R B;  2Y3A A;  1QQR A;  2EKI A;  4MEM A;  2JT4 B;  1QIL A;  3KWL A;  2KAJ A;  2KC2 A;  1YD8 U;  4JL9 A;  4GDL A;  2CU3 A;  1B9R A;  3TJP A;  2LHD A;  4P6V F;  3N20 C;  5HKH A;  3H9D A;  4WAF A;  2KWD A;  4WWM A;  2HJ1 A;  2INC C;  3DBL B;  4AOF A;  4FJZ A;  3WAO A;  2MBQ A;  4ACF A;  1BUI C;  2EEL A;  1F0Z A;  2NS5 A;  2IZV B;  1ZPS A;  1EWY C;  4B0E A;  5TSS A;  3ONS A;  2SAK A;  3OJ4 B;  5AZF A;  3AEG B;  1PGA A;  1WMH B;  4NJC A;  2NBV B;  1T5X D;  2KDB A;  2ZW0 A;  3FIL B;  3B1L X;  3RFZ B;  2M1M A;  1SE3 A;  4FBJ B;  3KUC B;  4LNK A;  4M8M A;  4YSZ B;  1KRH A;  4HJK A;  4BKS A;  3APF A;  1JWU D;  2WDR B;  3LYY A;  2RSU A;  3H7S A;  4C4V A;  2MBH A;  1LXD A;  3VTU A;  2PVG C;  1C3T A;  3IXS A;  1Q10 A;  5IKC M;  2NTT A;  4M0W A;  1NEN B;  4URK A;  4KSL C;  2J42 A;  4HEA 1;  3R66 C;  3IT4 B;  2N9L A;  1XQQ A;  1SB3 C;  1NYQ A;  2JZP A;  1SJH D;  1L6U A;  4EZK A;  1D5X C;  4US9 A;  1AN8 A;  2LRU A;  1F1H A;  2IPK D;  2BS2 B;  1WZ3 A;  3ZVV A;  2ASQ A;  1J7A A;  2PEA A;  2J0K A;  3VQI A;  4A6Q A;  1MI0 A;  2Y5C A;  2CHZ A;  2CJN A;  4W9I A;  3N3K B;  2CU1 A;  2HDE A;  1PYW D;  2LRW A;  3AEA B;  2WXR A;  1JRU A;  2WXN A;  2K6D B;  1ENF A;  5C1Z A;  1HEZ E;  4GOC A;  4FN2 A;  3R7Q A;  2JRH A;  5DCN A;  2N4F A;  3UIO B;  5C3J B;  3TUO A;  1WXA A;  3N1Z C;  1QKZ A;  4BKG A;  1FMA D;  4ZHP A;  4FXC A;  1TTN A;  5HHD G;  2K6Q A;  3PSE B;  2FUH B;  5EE9 A;  4M0W B;  5G5H A;  1SJE D;  3RZW C;  2Y5B B;  1OEY J;  3P4R B;  1RAX A;  3MC0 B;  3AEB B;  2L32 A;  2KN4 A;  4PS8 A;  2MBE A;  3DBH I;  1OQQ A;  1VD2 A;  3RPF C;  1UGM A;  1CJE A;  1P7E A;  2V4L A;  2BKR B;  4M8N A;  4A8X C;  1E8Z A;  1D5M C;  4QAY A;  4N9F 4;  3DCG A;  3HVZ A;  2VH1 A;  2WU5 B;  4AQ7 A;  4MJS B;  2KDM A;  1SEB D;  3AE1 B;  3RNC C;  1D4B A;  3PZD A;  3SFE B;  3NHE B;  2LJI A;  1WM2 A;  2KFJ A;  3X23 A;  4I6N B;  4OZB A;  2K0P A;  2LUE A;  1KTK A;  2KVZ A;  3PLU A;  3ZXV A;  3B2G A;  3L13 A;  3UIN B;  4HXD A;  2BQQ A;  2JF5 A;  4XX5 A;  4N6E B;  1E8Y A;  3IG3 A;  1VR9 A;  4BBN C;  1WSP A;  5D7G A;  2LZ6 A;  4US8 A;  1VLB A;  4MDK E;  1V5T A;  4IWQ A;  4S17 A;  5KHO A;  4NY0 A;  3CMM B;  2QCZ A;  3HM3 A;  1VZ6 A;  4HPM B;  2WHI A;  1XLO A;  2WXP A;  4ICU A;  1EU3 A;  2QEJ C;  4IM3 A;  1FRR A;  4BKS D;  1UBQ A;  2JZ3 B;  4F7Z A;  4X57 B;  5LNK 1;  3VHT C;  1P98 A;  2OJR A;  3KWV A;  1KM7 A;  2LVO A;  3HHM A;  2LMC A;  2JU6 X;  3OWE B;  1U4A A;  3W1S A;  1TY0 A;  3NY5 A;  2I1J A;  5AUI A;  3VH4 B;  4IUM B;  2J53 A;  2BKF A;  2AWT A;  3R8B A;  3AM9 A;  4YT0 B;  3IAS 1;  3DVN U;  4GSW A;  4LJP B;  3VFK A;  1J7C A;  4W9D A;  2MP2 A;  1CK1 A;  3TCA A;  1YJI A;  2CS4 A;  1ACC A;  1FFU A;  5AUK A;  1L0Y B;  5AZG A;  1G6J A;  2MHJ A;  4MM3 A;  4JGH B;  4WIP A;  1DOI A;  2BPS A;  3Q8E A;  5HFY A;  2UU7 A;  3PS6 A;  2AQ1 B;  1FRD A;  5IP4 D;  3NZS A;  3GS2 A;  4FAD A;  4KV2 A;  4IDI A;  4E74 A;  2LHE A;  2WYQ A;  3P4Q B;  2C7M B;  2PPH A;  2WP9 B;  1DOY A;  1MPE A;  2LD9 A;  3N1X C;  1PGB A;  3SFD B;  3FC4 A;  2OJW A;  2JYT A;  2FCS A;  2C5L C;  4H2A A;  3NVV A;  1RFK A;  2QSD A;  2I2Y A;  4CQN A;  3ZNH B;  2DZI A;  1WGH A;  3CIR B;  1UD7 A;  3TMP B;  2G4D B;  2KZR A;  4W9F A;  4ITK A;  3P4S B;  2N7J A;  3QAQ A;  4RGO S;  4XYC A;  2KMM A;  4TUU A;  5J2R A;  1F77 A;  3AI5 A;  2AQ2 B;  4FLH A;  2D3G A;  1IPG A;  1YOV B;  4IM0 A;  3A9K A;  3A9J A;  4ZOH C;  2D2Q A;  3LDZ E;  3Q8A A;  3GB1 A;  1Y8R C;  5BMI A;  2L7R A;  2K25 A;  2KMA A;  4KGR A;  1EF5 A;  2Y5P A;  3VXW A;  3Q3F A;  4W9C A;  4PS3 A;  4N59 A;  1TIF A;  3VVW B;  2IO2 B;  4HPP A;  5E6O A;  1JWM D;  1V97 A;  2IGH A;  1TZ1 A;  1D6E C;  3CST A;  2BB5 A;  3EUB 2;  3Q3M C;  2Z8L A;  3N30 A;  3PZ7 A;  2KYW A;  3VRA B;  2J4X A;  2KDI A;  4B95 A;  1UH6 A;  1J19 A;  1SGH A;  3MFG A;  2MP2 B;  5JXV A;  3LB8 C;  2JWZ A;  2NBU A;  1E8X A;  4L1B A;  1V1P B;  2GBN A;  5IA7 A;  1QT9 A;  4W9L A;  3N9Y C;  3DVN V;  2PE9 A;  3ZYY X;  2INN E;  1CMX B;  4FJV B;  3FAH A;  1WMH A;  3RD2 A;  2FUG 1;  1YX5 B;  1Q5W B;  2L83 A;  3UIP B;  3NVZ A;  3ZJT A;  3KUD B;  4LDT B;  4MSQ B;  4JQW C;  2V0G A;  2V3N A;  1ZXI A;  3NUH B;  1DYQ A;  3ZLZ A;  2XN9 C;  2O2V A;  3C8Y A;  2XK5 A;  4A9A A;  1FNU A;  3W1S C;  4AS1 A;  3NZ3 A;  2K39 A;  2L8J A;  3ZDM C;  1XD3 B;  4I6L B;  1S1Q B;  1TKG A;  5G5G A;  1L7Y A;  2NBW B;  3ENE A;  4AJW A;  3M62 B;  3NS8 A;  1ZDX A;  1YIW A;  4C56 C;  1ZKH A;  1XT9 B;  1L0V B;  1WE7 A;  1P0R A;  2DEN B;  3GZN B;  2KK8 A;  4MJS A;  2KDE B;  1WF9 A;  4ANX A;  2KN5 A;  1L5P A;  4GB9 A;  4KDI C;  1V9J A;  4UDU C;  1KF6 B;  4XDD A;  2AQ3 B;  3CWI A;  2MH7 A;  3AE2 B;  2H89 B;  4IM2 A;  2MCN B;  2KAN A;  3BIN A;  2LGS A;  5JHA A;  2M17 A;  2V4I B;  2Q5W D;  1NDD A;  3K9O B;  4NAW B;  1UBI A;  3TEX A;  2WU2 B;  4RNA A;  2YEP F;  3QIJ A;  4MGK E;  3KH0 A;  4XZ4 A;  1I35 A;  2MSE D;  4EEW A;  3C0R B;  4YTN B;  1UUP A;  3TEZ A;  1FIQ A;  3WAM A;  4ANW A;  4EE2 A;  4ARC A;  4ANU A;  1WR1 A;  3R2T A;  1FNV A;  1UZX B;  1V1P A;  1HA5 A;  3NS1 A;  4K3C A;  1TYG B;  3SR6 A;  3KVF B;  1GB1 A;  3AE3 B;  3HK0 A;  4M00 A;  3AE6 B;  1IUE A;  1YQ4 B;  1TGZ B;  4W9J A;  4JWS C;  2ZZP B;  2DZK A;  1TKY A;  2KAC A;  4NQK E;  2CHW A;  1SE9 A;  5J18 A;  1VZ8 A;  1WJN A;  1ZOY B;  2LJ5 A;  3ZO5 B;  3PV1 A;  2N9E B;  2ZPN A;  1H8C A;  1VRA B;  3EGR A;  3ZKJ C;  1NVI D;  4DHZ B;  3I63 C;  3L4P A;  2RDH A;  4BKT A;  2L0F A;  4ASW C;  1V5O A;  4FA6 A;  1FXA A;  4L23 A;  3VH3 B;  3MTN B;  4FJY A;  4K81 A;  2KFK B;  4KGS A;  3RT3 B;  2IY0 B;  5D6J B;  1NI3 A;  3CF6 E;  1SE4 A;  3JVZ X;  3ZNI D;  3WAP A;  4MGI E;  1FD6 A;  3PTF C;  1EM7 A;  3E9S A;  4W9E A;  5IO9 A;  1AW7 A;  4CO7 A;  3NZU A;  4F8C B;  3HIZ A;  1FNW A;  1Y56 A;  2TSS A;  3ZTD A;  4OHJ A;  4J6I A;  2BWE S;  4C4V B;  1TJE A;  3RI7 C;  1D3Z A;  2ACZ B;  3JSV A;  1BML C;  2QHO A;  1WI0 A;  3A33 B;  3FKY A;  4DXG A;  2WGS A;  1JQ4 A;  1FCL A;  2KDF B;  3JW0 X;  4ZDV A;  2SEB D;  3R2I A;  2K8B A;  3QJZ A;  5E6N A;  2IJ0 A;  1I42 A;  2ZW1 A;  4HLE A;  1JML A;  4NAW A;  2MBO A;  4OZA A;  4HPL B;  3BVZ A;  4K7S A;  2RDG A;  1K51 A;  4RF0 A;  2W3R A;  2N1W A;  2Z0D B;  2IBI B;  1GG3 A;  2MJ3 A;  3ETR A;  1P9D U;  2INP E;  2MWS B;  4R3D A;  2DAJ A;  4M02 A;  4B6W A;  2G4S A;  1H4R A;  1JWA D;  5HG2 A;  1ET6 A;  2WWZ A;  4C80 A;  1IYF A;  1IBX A;  3DPD A;  1Z5S B;  2BS4 B;  4YTM B;  1HQR D;  4WJN A;  2ZNV C;  3EC8 A;  4E71 A;  3NRZ A;  3A4S C;  3DHH C;  3PRE A;  2MJE A;  2B3A A;  1TBE A;  4IG7 B;  2V3P A;  3BYT B;  2IO1 B;  2XK5 B;  4JPS A;  4II3 B;  2DX5 B;  2YVC A;  1E6E B;  4GDK B;  1QZE A;  1F2R C;  3KYD D;  3MP9 A;  1R4N B;  2KXJ A;  2DNF A;  2A4Z A;  2ZCB A;  1A5R A;  4WH4 A;  3IBE A;  2O6V A;  2R2Q A;  3VAW A;  4DBG A;  1FXT B;  4C7Z A;  1L0X B;  3VUY A;  3A1Q A;  3QQ8 B;  2FAZ A;  2N7E A;  3BZD B;  2KT7 A;  4A20 A;  2FE8 A;  3T3N A;  3RNE C;  4HRS A;  4WWN A;  4YTP B;  3NOB A;  1WGY A;  3Q3J A;  2C7H A;  4XC2 A;  1WZ0 A;  3V6C B;  3MJW A;  2LVP A;  2RDB C;  1QF6 A;  3DHG C;  3Q14 C;  3PRP B;  1E5W A;  2GLS A;  5LLI A;  2W55 A;  1VZ7 A;  4K7U A;  4GN1 A;  4MGZ E;  1WYW B;  3AE5 B;  3VUW A;  1K50 A;  2REX A;  1LFD A;  4DK5 A;  2W54 A;  1DGJ A;  1WX7 A;  3U4E G;  2GB1 A;  4NJ6 A;  2ON8 A;  1E10 A;  3APC A;  3OAW A;  1B1Z A;  2LI5 A;  2BW2 A;  5EE0 A;  1WIA A;  4WQM A;  1HTO A;  1WX8 A;  1STE A;  3MHZ A;  4EUT A;  3P1M A;  3DWM A;  5DPS A;  2JVC A;  4FUL A;  2WLB A;  1T0S C;  2E6X A;  1C76 A;  3BVM A;  2MJD A;  3P4P B;  1WE6 A;  2M8S A;  1F9J A;  5BO4 B;  1UWM A;  3NVW A;  2DYM A;  2RPV A;  1WGK A;  1YQ3 B;  3L0W B;  3Q2A C;  2UWQ A;  4NNJ B;  5FR6 A;  2DYO A;  2KOX A;  3R7R A;  4FHJ A;  2QIE B;  1R4N I;  5L95 C;  3HUI A;  4KX6 B;  4NJ7 A;  1EF1 A;  3LXF A;  2KX3 A;  1JWS D;  2GOW A;  3QX1 A;  4HCN B;  3OLM D;  4AUQ C;  4LDT D;  2L76 A;  4KIK A;  4MH8 A;  1QLB B;  2L3Z A;  2PTL A;  3L08 A;  1WXV A;  1UWX A;  1V1O A;  4JX1 C;  3WAN A;  1FCC C;  3I9V 1;  2KLG A;  3IVF A;  2WDV B;  4GXB A;  1L4D B;  4HJG E;  4KVG B;  5FK9 C;  4B9K A;  3LJ3 A;  1WXM A;  3S2A A;  2WQY B;  2JXX A;  5BMH A;  4MAC A;  2FID A;  2KVR A;  1I4Q A;  3ZQ4 A;  3NVY A;  1ZDV A;  4RH6 A;  4WJQ A;  4LJO B;  1Q0W B;  4DDI D;  2IO0 B;  4GDK A;  3AN1 A;  2L1A A;  4ZRI A;  3GE3 C;  4ZRK A;  2UYZ B;  3PO0 A;  2YEP B;  2K9X A;  4RFB A;  1MG4 A;  3UGB B;  3V05 A;  1I4X A;  4IWO A;  2GBM A;  2X8X X;  1GB4 A;  1MG8 A;  2L00 B;  3WCQ A;  1M4V A;  5CHW A;  2M0A A;  4GMV A;  4CYE A;  5D3D A;  3P42 A;  1EUV B;  1I4R A;  2D3B A;  3DOW A;  1JWB D;  2D5G A;  1SIF A;  1YN5 A;  1WGR A;  2VZK B;  3AE8 B;  2KMC A;  2NTS A;  4LNI A;  3QC8 B;  3BK2 A;  5L83 A;  1C4C A;  2GI9 A;  3EFU A;  3Q8B A;  3ZNG C;  4P1B C;  2MLB A;  4DHZ E;  1YN3 A;  4ZYN A;  5BMG A;  2RR9 A;  2WXG A;  4OVU A;  3DHI C;  2K8C A;  2EMS A;  3N1Y C;  1I7H A;  1N5X A;  4TSS A;  2PE6 B;  1L2N A;  1YNT E;  2BBC A;  4P7I A;  1LO5 D;  3MC9 A;  2PKO A;  2V3S A;  5H8Y E;  3W5U B;  3NJT A;  2DYB A;  4PK1 A;  3IT6 B;  4NZL B;  5D94 A;  4ICV A;  4C7Y A;  4B0M A;  2XBB C;  2G9H D;  1FXI A;  2G45 B;  2KJ6 A;  2C7N B;  3ALB A;  3ZGZ A;  3AMZ A;  2OHF A;  1GC7 A;  1F52 A;  1L4Z B;  3U7Z A;  2NR2 A;  4XE0 A;  4LNN A;  2PW9 A;  4Q2J A;  1MHH E;  3W2D A;  5LXI B;  2OED A;  1TS5 A;  1RFA A;  2L05 A;  1C78 A;  3IHP C;  1QOF A;  3DBH B;  4RM8 A;  1OTR B;  4ZYS A;  2KTR B;  2HTH A;  1JRP A;  3ZXR A;  2WXK A;  2K5P A;  3DQV A;  1HZ6 A;  4YL8 A;  3EHV A;  3AU5 A;  3JYU A;  4II2 B;  2WX0 A;  2K22 A;  3VR8 B;  4L2Y A;  4YSY B;  3RNG C;  4IOI E;  4C00 A;  4YXD B;  2FCM A;  3ZRF A;  3MJ5 A;  1TS4 A;  2Z59 B;  5BYS A;  2JRI B;  2NPT A;  2PJH A;  1E8W A;  5D2M B;  1TY2 A;  2WNM A;  3AEE B;  3Q69 A;  1WFY A;  2BTE A;  3VRB B;  1MHX A;  1KFY B;  3ZUN A;  4K1R B;  5C2T B;  4DXF A;  3B9J A;  4GIV A;  1E0Z A;  1VJK A;  5IN7 A;  5EE1 A;  2L0T A;  1OQY A;  4RGM A;  2GBR A;  4ZRJ A;  2N0S B;  3W9C B;  1HE8 A;  3QWZ B;  2ICI A;  2HD5 B;  4PYZ A;  1WX9 A;  3E56 A;  3MC8 A;  1PDX A;  2LFI A;  4O1N A;  3ABV B;  2WX1 A;  2A5U A;  5G2N A;  1P3Q U;  1WH3 A;  1FO4 A;  1XLP A;  3ZTC A;  1FFV A;  1BXT A;  4W9K A;  3RUL A;  5JZE B;  1T0R C;  1TKE A;  3IFW B;  1CZP A;  3RN9 C;  1K53 A;  1KLG D;  3PHW B;  1C4A A;  3ZJV A;  4WJO A;  2BT6 A;  1WJ6 A;  3APD A;  4KKJ A;  2QMT A;  4XWW A;  5CHV C;  2NVU I;  1NBF C;  4YWG G;  4LTU A;  2J52 A;  1JW9 D;  1K52 A;  1XO3 A;  2EKE C;  2LVQ A;  3Q6B A;  1ZW7 A;  4JIO U;  3VDZ A;  3ECI A;  1TS3 A;  1HZ5 A;  1XEE A;  3MHS D;  3UQB A;  3X0W A;  1LM8 B;  2IGG A;  2O6V B;  2PVO D;  4DWF A;  2HE7 A;  3RMK C;  4GDL B;  1F2R I;  1I4G A;  2G3Q B;  1E7U A;  1WRD B;  3EEC A;  3GOE A;  1V2Y A;  2B76 B;  1OGW A;  1WY8 A;  1YMH E;  4A3P A;  3B08 A;  1VCB A;  2WXH A;  4CHK A;  3ZNZ B;  2BB6 A;  2O6V D;  1IBX B;  2X38 A;  2JUO A;  4A90 A;  1SE2 A;  5GMV A;  5IAA C;  5BYQ A;  1N60 A;  2PMV A;  2D3A A;  4BBN F;  2RD0 A;  4BZA A;  1WXS A;  4YSX B;  4JLC A;  3U8Z A;  4MGY E;  4XDC A;  2IGD A;  4HKZ E;  3RCZ A;  4AP4 C;  1C1Y B;  2CR5 A;  3CSF A;  1YQB A;  2LXA A;  3H7P A;  3WA0 A;  1MVK A;  1SBB B;  4USA A;  1E9M A;  2ONQ A;  2N9K A;  4HCP B;  3KLS X;  3DWG C;  4RCO A;  2BYE A;  5DPW A;  4G0N B;  3ZIM A;  3L17 A;  2N9P C;  3V6E B;  2N1V A;  1LQB A;  3AU4 A;  4W9H A;  2HJ8 A;  2NMQ A;  2MX2 A;  3D32 A;  5CTR C;  1AYF A;  1WGG A;  2WS3 B;  2KHW B;  2FBW B;  2AEH A;  2KQ4 X;  2LXC A;  3A9J B;  3Q8F A;  1NYR A;  1OQR A;  2QJL A;  1TT5 B;  4DHJ D;  2MW5 A;  4E3C A;  1R4M I;  2J7Q B;  3DBR I;  1T0Q C;  1GC6 A;  3W5V B;  2JX5 A;  4EZL A;  4A55 A;  2XEW A;  1WRI A;  2VZK D;  3HM6 X;  2EMT A;  1SIJ A;  1P7F A;  3SHQ A;  5KHQ A;  2M56 B;  4BVU C;  2D11 A;  1N61 A;  3RUI B;  3BY4 B;  1XCT L;  4AWJ A;  1EU4 A;  4PT5 A;  1HTQ A;  4DXA B;  4OZC A;  1JRO A;  1FM0 D;  3L54 A;  3I5J C;  3T9L A;  1I4H A;  3AE7 B;  5CHF A;  3U7D A;  1ZGU B;  3HVD A;  2M0X A;  4LLG M;  1ZUD 2;  3HRD D;  1WXQ A;  4NAM A;  3SEB A;  1WYG A;  3P63 A;  3AEC B;  1CQV A;  3I3T B;  1XLN A;  1L6V A;  1QOA A;  2ZVN A;  5TR5 A;  5AEK B;  4TMA B;  3DDC B;  1WGD A;  1WM3 A;  4WQO B;  1ISN A;  4S0R A;  2JSV X;  2CJO A;  4HK2 A;  2K8H A;  4OW0 A;  2JQR B;  4IW0 A;  1V81 A;  1AAR A;  1J8C A;  1PFD A;  1NEK B;  3A1Q B;  3RNA C;  3O65 B;  2DHZ A;  1R7S A;  3VTW A;  4RGT A;  1N63 A;  3TEY A;  1LGR A;  5E6J A;  3V60 A;  1GPX A;  2WXL A;  2WXF A;  3RNB C;  1AWD A;  3UI3 A;  3EFC A;  3WIM A;  2DLB A;  4TKN A;  3R3M A;  3M95 A;  5AZH A;  3V3X A;  2V1Y A;  4IWP A;  1QOG A;  1TS2 A;  1V49 A;  4HDO A;  3M3J A;  2H88 B;  5GXG B;  3Q3O C;  2W3S A;  2K3U A;  4OVV A;  2KQS A;  2LAS A;  2GBK A;  2WXI A;  4PS7 A;  3C19 A;  1ZE3 D;  2AYO B;  2C60 A;  3RYT A;  4MT5 A;  5I4D A;  1C9F A;  4K3B A;  3BVG A;  2WXJ A;  3QAR A;  2LGY A;  1IGD A;  3PPA A;  2GRI A;  3TBL D;  5C23 A;  1IGC A;  1RRB A;  2MRP A;  4G50 A;  4TQ0 A;  2D07 B;  3OG5 A;  3UF8 A;  2J0J A;  5CX3 A;  3GZN I;  1ET9 A;  5E6P A;  1Q1O A;  4ANV A;  2MQJ A;  3U2S C;  3I57 A;  2RMM A;  3AE9 B;  2W82 A;  3WAL A;  3L16 A;  3NG0 A;  2KWC A;  2MA9 B;  2KJH B;  5BYR A;  4RGN A;  4JWU C;  2ZCC A;  2I38 A;  2NCN A;  4BFR A;  1RLF A;  1OEY A;  1T3Q A;  1NI2 A;  3DBL I;  4HRO A;  1IP9 A;  1UF0 A;  2R61 A;  2LGX A;  2QIL A;  2KJR A;  4HKQ A;  2D3C A;  3A9K B;  2LEK A;  1GUA B;  3VUX A;  2JPH A;  3RZF A;  3ZJU A;  4KSK C;  1GNU A;  2JXT A;  3U30 A;  4ZRQ A;  4BOZ B;  4N58 A;  1KH0 A;  1RYJ A;  2G1E A;  3OJ3 A;  1YX6 B;  2DWQ A;  5EDS A;  4LNF A;  3H1U A;  2JYE A;  4DDG D;  4WWP A;  4PYU A;  2BYF A;  3O13 A;  3T3O A;  3GP7 A;  5DPT A;  4KDL B;  4GLS C;  2M19 A;  2KTR A;  4W9G A;  1D5Z C;  2FNJ B;  4EKU A;  2BYT A;  2HTM E;  4HWI B;  4XWT A;  5LXH A;  3QCA A;  5MPO A;  3ML8 A;  3AH7 A;  4HDQ A;  4TV3 A;  2PLP A;  3ML9 A;  3QHT A;  2FCN A;  3U52 E;  2QDF A;  4WJP A;  1JCK B;  2MBB B;  1MFW A;  2KQ7 A;  2AL6 A;  4KGT A;  1V80 A;  2WDQ B;  1VDV A;  2FCQ A;  1JAL A;  4FHK A;  4MM3 B;  2I1K A;  4ZRP A;  1GJZ A;  3V62 A;  3PGE A;  1ROE A;  3BII D;  4KKI A;  1N6Z A;  1UGJ A;  4IKG A;  4EOY A;  3PT2 B;  1WJ4 A;  1PGX A;  1XXG A;  4RF1 A;  2OOB B;  3AUL A;  4K7W A;  2LGD A;  4I6P A;  4WAA A;  4KZC A;  3W1Y A;  3ZW3 A;  2LGI A;  4ARI A;  1OFF A;  1R4M B;  3DBR B;  2AL3 A;  1XCQ L;  4J3O D;  4OVZ A;  3KUZ A;  2LWP A;  3H6N A;  4G11 A;  4M01 A;  2KWU B;  4EZJ A;  1C79 A;  2RGF A;  4BOS C;  3Q3N C;  2JY6 A;  3VTV A;  5JHB A;  2MEK A;  4G3X B;  2AX5 A;  1ESF A;  2KLC A;  3TL5 A;  3H8H A;  2JWU A;  1SXT A;  4REZ A;  1PQS A;  4AJY B;  3EA6 A;  2BGF A;  4WUR A;  1GOZ A;  1KOT A;  2Z0E B;  2VRR B;  3B2F A;  2O2V B;  4GGQ A;  3TEW A;  1FPY A;  5DPR A;  2BVC A;  2LUM A;  2ZEQ A;  2KX0 A;  5EE3 A;  3ZRC A;  2RPQ A;  4NPN A;  5IOI A;  1S3S G;  3M63 B;  1HXY D;  3PRZ A;  4MH0 E;  4BAX A;  1SSN A;  1YJ1 A;  3BWU D;  2VH2 A;  3PHX B;  2XNA C;  3A4R A;  3B0A A;  4LNO A;  2PIA A;  3UQA A;  2R2O A;  4LCD E;  1T6B X;  1UNS A;  3AXC A;  3PVL A;  1RM6 C;  3ZDT A;  2DZJ A;  1XLQ A;  3V61 A;  3P2B A;  1GAQ B;  2KTF A;  3DBS A;  4IC7 B;  2M4N A;  3T8M A;  3J9C A;  3KW5 B;  1V8C A;  1ZXH A;  2KD0 A;  5D3I B;  2GMI C;  1EO6 A;  5JH5 C;  4DHJ B;  3AV8 A;  4MSM B;  2YLM A;  2ZPY A;  1YN4 A;  4KIK B; 
#chains in the Genus database with same CATH homology
 1FRD A;  1N5W A;  3AE5 B;  3GS2 A;  2NMQ A;  4TQ1 A;  4IDI A;  2LHE A;  1K50 A;  3P4Q B;  2WP9 B;  2W54 A;  1DOY A;  1QOB A;  1DGJ A;  1MPE A;  2IDY A;  3U4E G;  1PGB A;  3SFD B;  2GB1 A;  1AYF A;  2WS3 B;  3FC4 A;  2JYT A;  3URY A;  2FBW B;  2KQ4 X;  1YJJ A;  1J7B A;  4H2A A;  2ON8 A;  1NYR A;  3NVV A;  3Q8F A;  4JE3 B;  1N62 A;  1RFK A;  2QSD A;  1E10 A;  2I2Y A;  4CQN A;  2WXQ A;  2L52 A;  1DOX A;  1OQR A;  3CIR B;  1B1Z A;  2WXM A;  2QJL A;  1XF5 L;  2BW2 A;  4DQO C;  5EE0 A;  4WQM A;  3W5V B;  4ITK A;  2JX5 A;  3P4S B;  2N7J A;  3VR9 B;  4A55 A;  1STE A;  1EWC A;  3MHZ A;  4RGO S;  1WRI A;  3P1M A;  2KMM A;  2VZK D;  3DWM A;  1F77 A;  2WLB A;  2E6X A;  2AQ2 B;  2DBY A;  1C76 A;  3BVM A;  2MJD A;  3P4P B;  1SIJ A;  1P7F A;  1UWM A;  2M56 B;  2DYM A;  3NVW A;  4ZOH C;  2RPV A;  1WGK A;  1YQ3 B;  1N61 A;  1FEH A;  4P16 A;  3Q8A A;  3GB1 A;  5FR3 A;  1C4P A;  5BMI A;  1XCT L;  4KGR A;  1EU4 A;  4PT5 A;  4OZC A;  1JRO A;  2Y5P A;  1FM0 D;  1I4H A;  2DYO A;  3AE7 B;  4N59 A;  5H92 C;  1SF0 A;  1JWM D;  1V97 A;  2IGH A;  3HVD A;  2QIE B;  4LLG M;  5HI1 A;  1ZUD 2;  3HRD D;  3HUI A;  1D6E C;  4KX6 B;  1WXQ A;  4NAM A;  3SEB A;  2BB5 A;  3EUB 2;  3LXF A;  1JWS D;  2Z8L A;  3PZ7 A;  1WYG A;  3P63 A;  3VRA B;  2J4X A;  3AEC B;  1CQV A;  1KLU D;  1XLN A;  1L6V A;  3MFG A;  1QOA A;  5JXV A;  3Q8C A;  3LB8 C;  4TMA B;  4MH8 A;  1QLB B;  3KQ4 A;  2PTL A;  1TZO A;  2JSV X;  2CJO A;  4L1B A;  2WXO A;  4OW0 A;  1V1P B;  1UWX A;  5FKA C;  2JQR B;  1PUT A;  1QT9 A;  1V1O A;  3BYY B;  4JX1 C;  1PFD A;  1NEK B;  1FCC C;  3I9V 1;  3N9Y C;  1A70 A;  3IAM 1;  3FIL A;  1I4P A;  1R7S A;  2WDV B;  3ZYY X;  1L4D B;  1ZP0 B;  4HJG E;  1WWT A;  2INN E;  5FK9 C;  4RGT A;  3FAH A;  1N63 A;  3TEY A;  3AED B;  2FUG 1;  2WQY B;  3AB5 A;  5E6J A;  4ZHO A;  1GPX A;  5BMH A;  4MAC A;  2L83 A;  2BS3 B;  1I4Q A;  4LK0 M;  3ZQ4 A;  3NVZ A;  2WXL A;  1RWS A;  3NVY A;  3ZJT A;  3TSS A;  1ZDV A;  2WXF A;  4RH6 A;  1AWD A;  3UI3 A;  2V0G A;  2V3N A;  1ZXI A;  3AE4 B;  1E7P B;  3NUH B;  4D2K A;  1DYQ A;  5T8I A;  1C77 A;  2DLB A;  3AN1 A;  2L1A A;  2XN9 C;  3C8Y A;  4A9A A;  3AEF B;  3PZ8 A;  1FNU A;  4AS1 A;  3NZ3 A;  3PO0 A;  3V3X A;  2YEP B;  2K9X A;  4RFB A;  2E3T A;  3BK1 A;  3V05 A;  1I4X A;  1QOG A;  1TS2 A;  1TKG A;  2Y3A A;  1QQR A;  5G5G A;  2H88 B;  2EKI A;  5GXG B;  2W3S A;  1GB4 A;  1QIL A;  2K3U A;  3KWL A;  2KAJ A;  1ZDX A;  3WCQ A;  1M4V A;  2M0A A;  2CU3 A;  2WXI A;  4C56 C;  1B9R A;  2LHD A;  4P6V F;  5D3D A;  1ZE3 D;  4WAF A;  3P42 A;  2KWD A;  1I4R A;  1L0V B;  4WWM A;  1JWB D;  2D5G A;  1YN5 A;  4MT5 A;  2VZK B;  3AE8 B;  5I4D A;  2NTS A;  1L5P A;  1C9F A;  4UDU C;  1KF6 B;  1BUI C;  2EEL A;  3BVG A;  3BK2 A;  1F0Z A;  4XDD A;  2AQ3 B;  3CWI A;  2WXJ A;  2MH7 A;  1C4C A;  1ZPS A;  2GI9 A;  3AE2 B;  3Q8B A;  1EWY C;  2H89 B;  1YN3 A;  5BMG A;  4B0E A;  5TSS A;  2WXG A;  1IGD A;  2V4I B;  2GRI A;  1I7H A;  2Q5W D;  2SAK A;  1N5X A;  4NAW B;  4TSS A;  3TEX A;  1IGC A;  1YNT E;  2WU2 B;  4RNA A;  2BBC A;  2YEP F;  3AEG B;  1PGA A;  1LO5 D;  2PKO A;  4TQ0 A;  5H8Y E;  3W5U B;  4YTN B;  1UUP A;  4NJC A;  3TEZ A;  1T5X D;  2ZW0 A;  3IT6 B;  4NZL B;  1FIQ A;  1ET9 A;  3FIL B;  3RFZ B;  4C7Y A;  1SE3 A;  4B0M A;  4EE2 A;  4ARC A;  3U2S C;  3I57 A;  2G9H D;  1FNV A;  1FXI A;  3R2T A;  1HA5 A;  1V1P A;  2RMM A;  3AE9 B;  4YSZ B;  1KRH A;  3NS1 A;  2W82 A;  1JWU D;  2WDR B;  3AMZ A;  3LYY A;  3ZGZ A;  2OHF A;  1L4Z B;  1TYG B;  3U7Z A;  2PVG C;  3SR6 A;  4XE0 A;  5BYR A;  3IXS A;  1Q10 A;  2NTT A;  1GB1 A;  4RGN A;  3AE3 B;  4JWU C;  4M0W A;  2PW9 A;  1NEN B;  2I38 A;  4Q2J A;  1MHH E;  3W2D A;  3AE6 B;  1IUE A;  1YQ4 B;  2J42 A;  1T3Q A;  2OED A;  4JWS C;  4HRO A;  4HEA 1;  2R61 A;  1TS5 A;  1TKY A;  2KAC A;  2QIL A;  3IT4 B;  4HKQ A;  1C78 A;  1VZ8 A;  1QOF A;  2LEK A;  2N9L A;  1SB3 C;  1ZOY B;  1NYQ A;  2JZP A;  1SJH D;  3ZJU A;  1L6U A;  2JXT A;  1VRA B;  3EGR A;  4ZYS A;  1D5X C;  4US9 A;  4ZRQ A;  1AN8 A;  1JRP A;  2WXK A;  1NVI D;  2IPK D;  2K5P A;  2BS2 B;  1HZ6 A;  3L4P A;  4N58 A;  2RDH A;  1KH0 A;  1RYJ A;  1J7A A;  2K22 A;  2G1E A;  3VR8 B;  1FXA A;  4L2Y A;  3VQI A;  4L23 A;  4YSY B;  1MI0 A;  2DWQ A;  4IOI E;  2Y5C A;  4A6Q A;  4YXD B;  3MJ5 A;  4KGS A;  2JYE A;  2CJN A;  1TS4 A;  2HDE A;  1NI3 A;  1PYW D;  5BYS A;  3AEA B;  3O13 A;  3T3O A;  1SE4 A;  1TY2 A;  2WNM A;  3AEE B;  2WXR A;  3GP7 A;  3Q69 A;  2BTE A;  3VRB B;  1MHX A;  4GLS C;  2WXN A;  1KFY B;  1FD6 A;  1EM7 A;  3E9S A;  2M19 A;  1ENF A;  5C2T B;  1AW7 A;  1HEZ E;  4DXF A;  3B9J A;  1D5Z C;  1E0Z A;  1FNW A;  1VJK A;  5EE1 A;  2BYT A;  2HTM E;  4XWT A;  1Y56 A;  2TSS A;  5C3J B;  4OHJ A;  4RGM A;  3TUO A;  5MPO A;  4ZHP A;  1QKZ A;  1TJE A;  1FMA D;  2N0S B;  3W9C B;  4FXC A;  2ACZ B;  5HHD G;  2ICI A;  1BML C;  3AH7 A;  3E56 A;  1PDX A;  2PLP A;  4DXG A;  5EE9 A;  1JQ4 A;  2LFI A;  5G5H A;  4O1N A;  1FCL A;  1SJE D;  3ABV B;  3U52 E;  2SEB D;  1JCK B;  3R2I A;  1FO4 A;  3P4R B;  3MC0 B;  1XLP A;  1FFV A;  1BXT A;  3AEB B;  4KGT A;  2IJ0 A;  2WDQ B;  1VDV A;  2ZW1 A;  1JAL A;  2L32 A;  4MM3 B;  1JML A;  1TKE A;  4ZRP A;  4OZA A;  1CZP A;  1ROE A;  2KN4 A;  1K53 A;  3BII D;  1KLG D;  4KKI A;  4IKG A;  1UGJ A;  1C4A A;  3BVZ A;  3ZJV A;  1PGX A;  2BT6 A;  1XXG A;  4RF1 A;  2RDG A;  1OQQ A;  4KKJ A;  3RPF C;  1CJE A;  2QMT A;  1P7E A;  4XWW A;  4A8X C;  1D5M C;  1K51 A;  4YWG G;  4RF0 A;  4LTU A;  2W3R A;  2J52 A;  2LGI A;  4ARI A;  1OFF A;  1XCQ L;  1JW9 D;  1K52 A;  4J3O D;  3HVZ A;  4OVZ A;  2WU5 B;  4AQ7 A;  1XO3 A;  1TS3 A;  1HZ5 A;  1XEE A;  2KDM A;  1SEB D;  3AE1 B;  2MJ3 A;  3ETR A;  1D4B A;  1C79 A;  2IGG A;  3SFE B;  2INP E;  2PVO D;  4R3D A;  2LJI A;  4GDL B;  2MEK A;  1F2R I;  2AX5 A;  4OZB A;  1I4G A;  1ESF A;  1KTK A;  2K0P A;  1JWA D;  5HG2 A;  1ET6 A;  2B76 B;  3B2G A;  4C80 A;  1YMH E;  3H8H A;  1IBX A;  2JWU A;  1SXT A;  2BS4 B;  4YTM B;  1HQR D;  2WXH A;  4N6E B;  1VR9 A;  2BB6 A;  3NRZ A;  4REZ A;  1WSP A;  1IBX B;  5D7G A;  2MJE A;  2X38 A;  3EA6 A;  4US8 A;  1VLB A;  4A90 A;  1SE2 A;  4WUR A;  1GOZ A;  2V3P A;  3BYT B;  3B2F A;  4JPS A;  3TEW A;  1E6E B;  1VZ6 A;  4GDK B;  1F2R C;  1XLO A;  2WXP A;  3MP9 A;  2LUM A;  5EE3 A;  1EU3 A;  2QEJ C;  1FRR A;  5LNK 1;  5BYQ A;  3KWV A;  1HXY D;  1N60 A;  2LMC A;  4WH4 A;  1SSN A;  2JU6 X;  2PMV A;  3OWE B;  3BWU D;  3W1S A;  1TY0 A;  2XNA C;  2PIA A;  5AUI A;  4C7Z A;  1T6B X;  4YSX B;  1UNS A;  1L0X B;  2J53 A;  1RM6 C;  4XDC A;  3R8B A;  2IGD A;  3AM9 A;  4HKZ E;  4YT0 B;  1XLQ A;  3IAS 1;  3BZD B;  1MVK A;  1SBB B;  1GAQ B;  2FE8 A;  4USA A;  3T3N A;  1J7C A;  1E9M A;  4HRS A;  2ONQ A;  4YTP B;  1CK1 A;  2N9K A;  1YJI A;  1ACC A;  3DWG C;  1V8C A;  1FFU A;  1ZXH A;  3J9C A;  3KLS X;  4RCO A;  1L0Y B;  5D3I B;  5AUK A;  4WIP A;  1DOI A;  3Q8E A;  5HFY A;  3AV8 A;  1QF6 A;  2AQ1 B;  2W55 A;  1YN4 A;  1VZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...