3P1MA

Crystal structure of human ferredoxin-1 (fdx1) in complex with iron-sulfur cluster
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
KITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTSAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster
rcsb
source organism Homo sapiens
molecule tags Electron transport
molecule keywords Adrenodoxin, mitochondrial
total genus 30
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p1mA00
1E0ZA 1WWTA 1CZPA 1DOIA 2JX5A 2MH7A 2WS3B 3AE5B 3SFEB 1OQQA 3AEBB 3AN1A 3AEDB 1NENB 2KMMA 1XLOA 2WDVB 1DGJA 3AEFB 3DWGC 5AUKA 4N6EB 4ZHOA 2DWQA 4IDIA 1FXIA 4ITKA 2DBYA 1IUEA 1PFDA 3AE4B 1E7PB 2K9XA 1WXQA 5C3JB 1GPXA 1WGKA 5G5HA 1E10A 1N61A 2K22A 4ZHPA 3W5VB 1J7AA 1XO3A 2PKOA 3AE3B 3SR6A 1PDXA 1OQRA 3NVYA 3VR9B 4YTNB 1FRRA 2MJEA 2Y5CA 3KWLA 1UWMA 4YT0B 1N63A 2FBWB 1RFKA 2PVGC 2W3RA 3NVZA 4HRSA 2M56B 2MJDA 1FO4A 3LB8C 5C2TB 4US8A 1JQ4A 1ZOYB 1PUTA 1F0ZA 1QF6A 2WQYB 1R7SA 2ACZB 4JX1C 2Q5WD 4YSYB 2WLBA 1RWSA 1ROEA 1EWYC 1QLBB 2M19A 3AE6B 1JALA 1FRDA 1JWAD 1SIJA 2EKIA 1NYQA 1NEKB 2WU5B 1QOFA 3W5UB 2JQRB 1SF0A 2QIEB 4ZOHC 1KFYB 3VRAB 4WQMA 1I7HA 1YJJA 3AE7B 5GXGB 1E6EB 1YJIA 2BS2B 2QJLA 3P1MA 4WWMA 3VRBB 1B9RA 1NYRA 1QOAA 1RYJA 1XLNA 3L4PA 4N59A 5EE0A 4C7YA 4YXDB 2H88B 1N5XA 3AECB 1L6VA 3P4PB 4JWUC 1XLQA 3AM9A 1FMAD 1NI3A 3AB5A 2BS3B 4YTMB 1AWDA 3W9CB 2W54A 1ZP0B 3AMZA 2B76B 1JWBD 1CJEA 1JW9D 2CJOA 1WRIA 3AE9B 3P4QB 4C7ZA 4FXCA 4A9AA 1RM6C 3NS1A 1WYGA 1V8CA 3AH7A 3CWIA 4HROA 1N60A 1T3QA 1V97A 1VDVA 3AEGB 1N62A 1YQ4B 3AE8B 5EE3A 1TKEA 1VJKA 2LEKA 4JWSC 1SB3C 1A70A 2L52A 3ZYYX 3ABVB 1FFVA 3HRDD 5H8YE 1TJEA 2AX5A 3FC4A 3HUIA 1GAQB 3SFDB 2G1EA 2WU2B 2E3TA 3NVWA 3P4SB 3VR8B 4YSZB 3P63A 1J7BA 1OFFA 3EUB2 2WDQB 4N58A 2BS4B 1JRPA 3HVZA 3BIID 2N0SB 1VLBA 4YSXB 2CU3A 1YQ3B 2W55A 2HTME 4P6VF 1NVID 5EE9A 3P4RB 1L6UA 2CJNA 4YTPB 4C80A 2WP9B 3ETRA 1DOXA 1DOYA 1TKYA 3PO0A 5AUIA 1J7CA 1N5WA 3B9JA 1XLPA 5MPOA 1FXAA 1ZUD2 1FIQA 2BT6A 2K5PA 2MJ3A 3AE2B 1FFUA 3B2FA 1KF6B 2OHFA 2H89B 4LTUA 3RPFC 3NRZA 1JROA 4KX6B 4USAA 1AYFA 3AEAB 5H92C 1L5PA 1TYGB 3DWMA 1ZXIA 2PVOD 3CIRB 3FAHA 1L0VB 2PIAA 3B2GA 3AE1B 1KRHA 2KAJA 1TKGA 1QOGA 2W3SA 4US9A 1FM0D 1QT9A 1E9MA 2L83A 3WCQA 2WDRB 3LXFA 5EE1A 5G5GA 3AEEB 3NVVA 1QOBA 3AV8A
chains in the Genus database with same CATH superfamily
1HTOA 3ZTCA 1I42A 2Z59B 2JRHA 1V1PA 3DWGC 2WXQA 1WM3A 2DWQA 4RM8A 1M4VA 1WGKA 3H7PA 4MACA 1P0RA 4YTNB 3KWLA 1UWMA 1N63A 3UGBB 1FO4A 4ANWA 1WRDB 1TS5A 2GBRA 4WJPA 1D5XC 5T8IA 5CHWA 1I35A 2D2QA 2N7DA 3NY5A 3Q2AC 2KLCA 3Q8EA 1SF0A 4N9F4 3VRAB 2ZNVB 1I7HA 1YIWA 3A9JA 2C7MB 2FUHB 4WQOB 2RGFA 3VVWB 5C1ZA 2J53A 4BBNF 2A4ZA 3KVFB 4KGRA 4HK2A 4A9AA 3NS1A 2C7HA 3T3NA 2L0FA 5D3DA 3P2BA 4J3OD 2MSED 4JIOU 1FFVA 4II2B 2QCZA 2NMQA 1JWMD 5JHAA 3Q69A 1NVID 4FHJA 3ZNGC 3PO0A 1MPEA 3B08A 3B2FA 3IG3A 3MP9A 4IM2A 5H92C 4R3DA 4BKGA 4GMVA 4IOIE 2N1VA 2G3QB 2JWUA 1QT9A 2KFKA 2L8JA 5EE1A 5G5GA 2L32A 1E8ZA 3V05A 3AN1A 3AEBB 4LNNA 1UBIA 1D6EC 1YX6B 1WM2A 5CTRC 4NJ6A 4TKNA 2IPKD 2JPHA 2K9XA 2MBHA 4G3XB 3L08A 5LXIB 3AE3B 1P3QU 2EMTA 2MJEA 2WX1A 4HRSA 2WWZA 1C4CA 1ZDXA 3W1YA 2GI9A 1PUTA 4KGSA 2DAFA 4HPMB 1WJ4A 2WLBA 1JWAD 2IO2B 2WXLA 4JL9A 3VRBB 4JLCA 1WGDA 4MH0E 5EE0A 3QA8A 2XK5A 1GC6A 1E7UA 1S1QB 4FN2A 3ZXVA 1TS4A 2O6VD 2BS3B 2FUG1 1V80A 3L13A 1ZGUB 2KQ4X 2RR9A 5BYSA 1ZKHA 3EGRA 3ZO5B 1V8CA 3UI3A 3DBLB 3ZIMA 3MHSD 5AZFA 2BBCA 4HPPA 2PMVA 3Q3MC 3SFDB 4I6LB 4K1RB 3U4EG 4AP4C 2N0SB 4O1NA 2ASQA 4B9KA 4KSLC 4EUTA 3M95A 3QQ8B 5BMHA 1N5WA 2WHIA 4M0WB 1L7YA 4LLGM 3NRZA 5EDSA 3LDZE 1Q10A 4KSKC 2FIFA 3V6CB 2GRIA 2BWES 2JY6A 2N9XA 3I9V1 3RZWC 2MH7A 3Q8BA 1Y8RC 4B0EA 2IGDA 3UF8A 5IAAC 1VCBA 5LXHA 2WDVB 5BYRA 1IUEA 1PFDA 1KLVA 1N61A 1ET6A 1ESFA 3VUXA 2BF8B 3U52E 2LD9A 4W9FA 3NVYA 4MM3B 2KANA 4ZRQA 2Y5CA 1WX7A 3VTUA 1CK1A 4BKTA 3X0WA 1JQ4A 3ZRFA 1LGRA 1HE8A 4C4VA 2L0TA 4MH8A 4YSYB 1EF5A 5CHVC 5TR5A 4TSSA 4WURA 2LXCA 4IWPA 3R8BA 1B9RA 3L4PA 4OW0A 1WMHA 2PEAA 4C56C 4RH6A 4II3B 2K25A 2GBNA 2W54A 2BQQA 2C5LC 2JT4B 3JW0X 4WWPA 1CJEA 2INPE 2JYEA 4GDLA 2D3BA 3W1SA 4EE2A 2B3AA 3Q3NC 1MG8A 3W1SC 1TKEA 1WXAA 2WXOA 2X38A 2XNAC 2GBJA 3A1QB 2DYOA 2G1EA 3CSTA 1MFWA 2V3SA 2PLPA 3RNEC 2AWTA 1BMLC 1SE4A 1UGJA 2ICIA 3HVZA 2W55A 2HTME 4WWOA 1PQSA 3DPDA 2M0XA 2NVUI 2LVQA 4C4VB 3RYTA 1MHXA 1JROA 2KMCA 1IGDA 5L95C 4CHKA 1SBBB 2WXIA 4DDGD 1J19A 3JSVB 2LUMA 1TKGA 4G50A 3CF6E 4PYUA 1UH6A 4W9CA 1MG4A 1YMHE 4N6EB 4OZCA 4ICUA 4ITKA 3A33B 1V49A 4EFOA 2NPTA 4ZRJA 5D6JB 2MA9B 3H6NA 2KDMA 2KNBA 3BVZA 5DCNA 5C2TB 4US8A 3T3OA 2C60A 1RWSA 1C79A 2M19A 1E90A 3R2IA 5JH5C 1Q5WB 2O6VB 4YXDB 3NJTA 5I4DA 3IHPC 2M8SA 1M94A 4F8CB 2N9LA 3GZNB 2JU6X 2DAJA 4LCDE 1E8WA 2B76B 3TJPA 3ZGZA 4GLSC 2MP2A 1TBEA 4OZBA 2AQ1B 3TBLD 3TL5A 4JPSA 4NQKE 4E71A 5DPTA 3ZW3A 1MHHE 3P4SB 2PE6B 3DHGC 3P63A 2BTEA 1TTNA 2M4NA 2WXGA 4KZ0A 4LNOA 2WP9B 3ETRA 3OJ4B 2OEDA 4RFBA 4RGTA 2K5PA 2MJ3A 1FFUA 2OHFA 1GOZA 1OTRB 1C9FA 4USAA 3KUDB 4KVGB 4PK1A 2BWFA 2J0MA 1UWXA 3GZNI 2EMSA 1RRBA 4HKQA 2WXRA 3WCQA 2LWPA 1MI0A 3PLUA 1R4NI 3QJZA 2BYVE 4TMAB 3BYTB 4GOCA 1E8YA 3D32A 2IJ0A 4IDIA 1FXIA 1SXTA 2DBYA 3KQ4A 3R7RA 2D10A 1K53A 5G5HA 2UU7A 2YEPB 3MC0B 4IM0A 2IY0B 1XO3A 2KVZA 3DHHC 1TS3A 4FJVB 1HZ6A 2INDC 2MW5A 3HM6X 2KACA 2BYFA 4BOZB 1QF6A 2WQYB 4RCOA 4W9KA 4LNIA 4TV3A 1I4HA 3E56A 3ZDTA 1QOFA 3RNFC 3ZDMC 4WQMA 1EUVB 3URYA 5JZEB 1FCLA 3TIXA 2BB6A 2ZW1A 2FE8A 2JUOA 1L6VA 3P4PB 1XLQA 1PGBA 2GBKA 2JZZA 4MEMA 4KIKB 3OAWA 3UIPB 2NTSA 3RNAC 1JWBD 4A3OA 1RM6C 1KM7A 3DVNV 2UYZB 3H8HA 1YQ4B 3KYCD 3Q8FA 5GMVA 4KDLB 3PGEA 4MGYE 2LXAA 1GAQB 2DZMA 1E8XA 1OFFA 1QKZA 3SU8X 2R2OA 3RUIB 1VLBA 3N32A 4BZAA 4ASWC 3TEXA 3EFCA 3IT4B 2LFIA 2KK8A 1YNTE 3SDLC 4MGKE 1FXAA 2JYTA 4LTUA 2LHEA 4BAXA 3W2DA 2LZ6A 3NHEB 4BKSD 3B2GA 1KRHA 3ALBA 2OJWA 2ZPYA 3AEEB 3DCGA 3U7DA 1J8CA 1OQQA 2I1JA 3AEDB 1CMXB 4M01A 2W9NA 4WAAA 1XCTL 3V3XA 2KZRA 3AULA 1X1MA 3U30A 1L4DB 1MJDA 3VQIA 1FPYA 1SIFA 4GN1A 5LLIA 1C3TA 2M56B 1VZ6A 2PTLA 4JQWC 2LMCA 2CKHB 1P7FA 4EZJA 1ROEA 1QLBB 3ECIA 5J17A 1NYQA 2JQRB 3R2TA 1KFYB 4WWMA 4MSMB 1NYRA 1QOAA 4C7YA 5IN7A 2Z0DB 1UF0A 4TQ0A 4EOYA 3R3MA 3Q6BA 4W9LA 4ANXA 2J7QB 4CYEA 2NR2A 3MC9A 5LNK1 3N9YC 2AL3A 3NS8A 1P9DU 3TMPB 2E6XA 1I4PA 1Q1OA 4DHJB 3PPAA 3CWIA 3FILA 1T3QA 3OWEB 1V97A 1N62A 5CHFA 4HEA1 3NOBA 3U7ZA 3NZSA 5HKHA 4HDQA 3HRDD 1TJEA 4RM9A 2WU2B 1IP9A 1TY0A 2LVPA 2N1WA 2ZCCA 3IXSA 3ML9A 3VHTC 4YTPB 1HXYD 3RNCC 2PW9A 2KTFA 3N1ZC 1D5MC 1F2RI 4HDOA 3N1YC 1KF6B 1P7EA 4KX6B 4PS3A 4A3PA 3Q8AA 2AEHA 2PIAA 4Q2JA 1B1ZA 4AOFA 1K50A 2VH2A 2FNJB 1P1AA 1QOBA 1GC7A 2JX5A 3AE5B 2KN4A 2VH1A 1Z5SB 4QAYA 1WR1A 2ZVOA 3ZUNA 3PS6A 5C3JB 4NAMA 3B0AA 4IWOA 1SGHA 1IBXA 2MBEA 1EWCA 4MJSA 1EU4A 2KOXA 4LK0M 1ZOYB 4JX1C 2XBBC 2HD5B 3MC8A 3ZVVA 4HWIB 3ML8A 1SIJA 1R4MB 1SJED 2WU5B 2KXJA 3OJ3A 1PYWD 1XT9B 4M0WA 2DNFA 1XLNA 4S0RA 4HKZE 1UBQA 1VZ8A 4B0MA 5HG2A 2K8BA 2I1KA 4EZLA 5G55A 2EKEC 1ZW7A 5D2MB 1WJ6A 1RFAA 1RLFA 3AEGB 3UIOB 3EECA 3FKYA 2L52A 4LDTB 2Y5PA 1JCKB 3Q3JA 5CX3A 4A6QA 2KDBA 2K0PA 3H7PB 2KVRA 5E6NA 4TQ1A 1JRPA 1V86A 3BVMA 3ZRCA 4P6VF 3GE3C 1L6UA 2CJNA 4C80A 1DOXA 1BUIC 1FCCC 1TKYA 2YEPF 5MPOA 1Z2MA 2MBQA 4PT5A 1AYFA 3P42A 1YOVB 1KOTA 2AQ2B 2WGSA 3A9KA 1WR6E 1P98A 4G0NB 1QQRA 4G11A 3TEZA 4WJQA 3QCAA 1HQRD 1VZ7A 4D2KA 1DOIA 4K7SA 2KTRA 1YJ1A 1SE3A 5AUKA 4ZHOA 2NS5A 3MFGA 1GB1A 3IVFA 3TCAA 4DK5A 4BFRA 3ONSA 3ZNID 4ZYSA 3APFA 3W5VB 1GG3A 2BW2A 4F1SA 1WI0A 3VH3B 1OEYA 5HHDG 1RFKA 2W3RA 1OGWA 3IAM1 3IFWB 2QEJC 2VRRB 2DENB 5AZHA 4DXGA 2IO1B 3DBRI 1YJJA 1GPXA 3O65B 4IKGA 2G45B 3DBLI 4P1BC 3AB5A 1WGHA 3A9KB 4YTMB 2WXJA 1ZXHA 1KTKA 3N30A 1HZ5A 1ZE3D 4K3CA 4MT5A 3QC8B 3MJ5A 3PZ8A 2AX5A 2DYMA 5KHQA 3QWZB 2NTTA 4FADA 4HVBA 3EUB2 2LJIA 2LVOA 2YLMA 1UGMA 4ZRKA 4K7WA 4GSWA 3L17A 5AUIA 3N3KB 1L0XB 5L83A 1I4RA 2AL6A 4ICVA 2K3UA 1FNUA 1WGGA 2K8HA 1WE7A 1T0RC 3E9SA 3RNGC 3NG0A 3PHWB 2PVOD 3FAHA 4S17A 1BXTA 5JHBA 1L4ZB 2KDEB 2DHZA 4HXDA 3WAOA 2WS3B 3SFEB 4FJZA 1BT0A 2Z8LA 3C19A 2V4IB 3VH4B 1EM7A 1EF1A 2L7RA 1G6JA 2J0KA 3FILB 1T5XD 1ZPSA 2LGIA 4ZHPA 3RI7C 4NQLB 2PKOA 4W9DA 2C9WB 5FKAC 2J0JA 3HIZA 2DYBA 4H2AA 1ACCA 2BGFA 4LJOB 4RGMA 1QZEA 3ZNZB 2ON8A 2LGSA 5JXVA 3IT6B 3RFZB 1J0GA 1WF9A 2QIEB 4KZCA 4XE0A 2BKRB 2D3CA 4MSQB 2D3GA 1N5XA 4P16A 2V1YA 2BYTA 3KYDD 3GE8C 3HK0A 4LNKA 3AMZA 3BYYB 4KV2A 2JWZA 3U8ZA 3V61A 1WXSA 2XN9C 1D5ZC 1LO5D 3ENEA 1JRUA 4OVVA 2TSSA 3GP7A 2WDQB 1E5WA 4HPLB 1WYWB 1IBXB 2JZ3B 2KKCA 2LUEA 3T8MA 4XX5A 1TZ1A 3QX1A 4P1CC 2BT6A 2LRUA 2RSUA 4FLHA 3AEAB 2YVCA 3M3JA 3VTVA 3L16A 2DLBA 2DX5B 1FD6A 4RNAA 2LRWA 2KWVB 2R2QA 3X23A 3QAQA 3RULA 4RGOS 4NNJB 1AW7A 1YD8U 2KFKB 3M62B 4M8MA 3DHIC 3PSEB 2IDYA 1WH3A 3WAMA 3KLSX 2L00B 1YN3A 4DXFA 5HFYA 1FRRA 3A1QA 4EKUA 3MTNB 3PZDA 4M02A 3KH0A 3Q8CA 3RMKC 3C8YA 2Z0EB 3IBEA 2FCNA 3W5UB 3AE7B 1YJIA 4E74A 1NI2A 4IW0A 4DBGA 4ZRIA 3M63B 3VTWA 1FMAD 3A4SC 1N6ZA 1NI3A 4PYZA 3W9CB 2KWCA 2RPQA 5IA7A 1EO6A 1N60A 4FHKA 3ZKJC 2N9PC 4KGTA 5BO4B 4F7ZA 2Y5BB 3H7SA 2VZKD 4ARCA 1VRAB 1VD2A 5H8YE 1WY8A 4RMAA 3FC4A 4W9EA 2KLGA 1WFYA 2W82A 2FCSA 3TUOA 2J52A 3H1UA 3P4RB 3R7QA 2ZVNA 1J7CA 3B9JA 1XLPA 2ONQA 3DBHI 2I38A 2KC1A 2LHDA 5FR3A 5FK9C 2M17A 1R4NB 4A20A 4NZLB 3DBSA 1WJNA 4KIKA 1L0VB 4GXBA 2FIDA 1L0YB 5D94A 2CS4A 4J6IA 1WWTA 5D7GA 2SAKA 1V81A 4DDID 1YN5A 1NENB 4NJCA 4A8XC 3RZFA 5IP4D 2RDHA 4XGAB 2J42A 4BVUC 2IYDB 2V3PA 4IC7B 1WIAA 1XD3B 4AJWA 4MGZE 3HM3A 2N9KA 1IPGA 2WYQA 5IO9A 4A55A 3PREA 4MM3A 4KKJA 4GB9A 2ACZB 2A5UA 3EA6A 3CMMB 2Q5WD 4WWNA 5TSSA 2KQSA 2OOBB 3J9CA 3WA0A 5GXGB 3P1MA 4EZKA 3UQBA 4CQNA 1RYJA 1SJHD 2KQ7A 2ZZPB 3V62A 4L23A 3A9JB 1FNWA 3WAPA 2KD0A 4NAWA 4I6NB 3K9PB 1AWDA 2KTRB 1V5OA 2QHOA 3V6EB 4E3CA 1WRIA 1WSPA 3ZNHB 2IY1B 2GBMA 5FR6A 1WYGA 3DBRB 3AH7A 2NPTB 2WXFA 2WXNA 2ZCBA 3BY4B 5C23A 1I4QA 2KN5A 1A70A 3ABVB 4IWQA 1SE2A 4HCPB 3LYYA 2KJ6A 4RF0A 3RT3B 1VR9A 4LDTD 4FULA 4YSZB 1WE6A 1WX8A 3BIID 2JSVX 3MHZA 3BINA 1YQ3B 4MJSB 3NUHB 1FNVA 2CHXA 2BPSA 2GMIC 2Y3AA 1ZUD2 2EELA 4K81A 3SEBA 5BYQA 2MX2A 3VFKA 3I5JC 3CIRB 4W9IA 4WH4A 2IGHA 4US9A 5IOIA 1FM0D 1NDDA 2L83A 2WDRB 2MLBA 4HCNB 3SHQA 1C77A 5KHOA 2WXMA 4OZAA 1T0SC 3OG5A 4MDKE 4PS7A 1DGJA 3R66C 1AARA 3K9OB 5E6PA 3AE4B 2QILA 2L05A 3BK1A 2FCMA 4XDDA 4NPNA 1E10A 1PDXA 2I2YA 4XC2A 3RN9C 2ZNVC 1GJZA 2HJ1A 1TT5B 2OJRA 4DQOC 1AN8A 4MGIE 1JALA 1FRDA 2M1MA 1WXVA 3SD5A 4TUUA 2KWUB 2QJLA 5J2RA 1DYQA 4DXAB 1LFDA 4C00A 4FA6A 3N1XC 3HVDA 2PPHA 2MP2B 2L1AA 5E6JA 5DPWA 2FAZA 3L10B 4AQ7A 3KUCB 3P4QB 2MWSB 3DBHB 2WX0A 2NCNA 3PV1A 4ANVA 4HROA 1C4PA 1VDVA 4WJNA 1JMLA 4ACFA 5DPSA 1HA5A 3MJWA 1LXDA 1WZ0A 3DOWA 4P7IA 2DZKA 2QSDA 2QMTA 3TEWA 3O13A 2K8CA 2INCC 2GOWA 1FIQA 4GDKA 2G4DB 4BBNC 3RPFC 1SEBD 1V6EA 3DWMA 4GDKB 4XZ4A 2LASA 1QOGA 2GB1A 1UZXB 1E9MA 2RDGA 2IO0B 1XF5L 3LXFA 3APDA 3DVGX 4L2YA 1JWSD 2FCQA 3AEFB 1MVKA 5G2NA 3VDZA 1UUPA 2HTHA 2RDBC 4REZA 3VR9B 3S2AA 4DHZE 5DPRA 3PZ7A 2K6QA 2PE9A 3Q3FA 4GGQA 3JVZX 2KMAA 3ZJVA 2BS2B 2MBBB 2DZJA 4M00A 4X57B 2ZJDA 2KJHB 4ZRPA 4JWUC 3AM9A 1WGYA 2RMMA 3H9DA 4GDLB 1WMHB 2BYEA 1ZP0B 2RPVA 1ISNA 1LQBA 3VAWA 2JZPA 4XYCA 4C7ZA 2IZVB 4FXCA 5BMGA 2HJ8A 1V1PB 2LEKA 4NJ7A 1Y56A 1FEHA 1I4XA 2REXA 3VR8B 4WJOA 2O6VA 4UDUC 1TZOA 3AI5A 2NBWB 1XCQL 1SE9A 2XK5B 1V5TA 1L5PA 2WDTB 1WZ3A 1WXMA 2KO3A 3EC8A 1ZXIA 2D07B 1WJUA 1EU3A 4RF1A 4L1BA 3OLMD 1YQBA 4BKSA 3APCA 3AV8A 3CSFA 1CZPA 3U2SC 3I3TB 4NAWB 2JVCA 4NY0A 3AXCA 1KH0A 2BB5A 2N7EA 5E6OA 3RCZA 2V4LA 3C0RB 2WXHA 4A90A 1GB4A 1C76A 4W9JA 2K22A 1V2YA 2JXXA 4ANUA 1J7AA 2G9HD 2O2VB 3AU5A 2N7JA 1S3SG 1TIFA 2PVGC 3A4RA 2LGYA 2XEWA 3UQAA 2MJDA 3VUWA 1Q0WB 3PRMB 3AE6B 4EEWA 1YX5B 2EKIA 5J18A 1NEKB 2NBUA 4IG7B 2J4XA 2LGDA 1F0ZA 1V9JA 2D11A 2VZKB 4N59A 2H88B 3AECB 3RNBC 1T0YA 3PRZA 2R61A 3GB1A 1U4AA 4DHJD 2G4SA 1F52A 1F1HA 1JW9D 2CJOA 3PRPB 4I6PA 4AS1A 2ZEQA 1XXGA 4HLEA 3GS2A 3BWUD 2WXPA 2DZIA 5EE3A 1C4AA 1VJKA 4RGNA 3QHTA 1SB3C 4JWSC 4WIPA 2IO3B 4XWWA 1IGCA 5IKCM 4AWJA 4GU2A 1H4RA 4ARIA 4N58A 4IM3A 3PTFC 2K6DB 3LJ3A 2MCNB 2AQ3B 1UD7A 2H89B 2MRPA 3TEYA 2LGXA 2JXTA 3BK2A 3ZLZA 2KAJA 2CU1A 3NVVA 1KJTA 1XEEA 1F2RC 1XQQA 1XLOA 1IYFA 4K7UA 3ZTDA 1WX9A 2D3AA 3PT2B 1I4GA 1WXQA 1CQVA 1ET9A 2AYOB 2V3NA 3BVGA 3L0WB 2LI5A 1QILA 1OQRA 2JF5A 3RD2A 1GNUA 4YT0B 4OVUA 2L76A 2M0AA 1R7SA 1JWUD 1HEZE 1F9JA 1V1OA 3ZXRA 1YN4A 1ENFA 3WALA 4K3BA 3DDCB 2N4FA 4ZYNA 3V60A 2QC8A 3QIJA 3VUYA 2D5GA 1E6EB 3JSVA 1H8CA 2CR5A 1TGZB 2MQJA 1WGRA 1NBFC 1TS2A 1K8RB 2LJ5A 3UINB 4XWTA 3Q14C 3AE9B 4AJYB 1LM8B 4B6WA 1RAXA 3PVLA 2PJHA 2ZW0A 3PHXB 4GIVA 3AE8B 2V0GA 2CHWA 2HE7A 1R4MI 4IUMB 3ZYYX 2NBVB 3QK0A 4B95A 2K39A 2BVCA 4YWGG 2E3TA 3NVWA 4FJYA 1J7BA 4M8NA 1C78A 2BS4B 4WAFA 1KLGD 4YSXB 2CU3A 3KWVA 2KX0A 3WANA 2IBIB 1DOYA 3WIMA 2L3ZA 3AE2B 2MHJA 2INNE 2KHWB 2KDIA 4AUQC 1T0QC 3GOEA 4LJPB 1TYGB 2HDEA 2GLSA 2W3SA 4JGHB 1E0ZA 4YL8A 3I57A 4OVZA 4JE3B 2KMMA 1A5RA 1HTQA 2ZPNA 1E7PB 4MELA 1KLUD 1E7VA 3DQVA 4BOSC 4CO7A 1OEYJ 3BZDB 1PGAA 3SR6A 4URKA 1K52A 3ZJUA 3NZ3A 1C1YB 3TSSA 2FBWB 3NVZA 2O2VA 3LB8C 3HHMA 2MBOA 2KJRA 1TY2A 1K51A 4PS8A 5AZGA 1EWYC 3I63C 2KX3A 5HI1A 3IAS1 3ZJTA 5AEKB 4ZOHC 1OQYA 2QDFA 3AU4A 2MEKA 2KC2A 2KFJA 1PGXA 1UNSA 4KKIA 4XDCA 2WXKA 4KDIC 2BKFA 2C7NB 2WNMA 2UWQA 3KW5B 5D3IB 3NZUA 2KYWA 2KDFB 3KUZA 1F77A 3EHVA 4OHJA 1SSNA 4ZDVA 1UELA 3T9LA 5BMIA 1GUAB 3HUIA 4FBJB 3VXWA 3N20C 4HJKA 2X8XX 3Q3OC 3DVNU 4DWFA 5EE9A 4W9HA 3ZQ4A 2V9HA 2JRIB 1FXTB 2KWDA 2CHZA 1D4BA 3L54A 3EFUA 1D3ZA 1ZDVA 2SEBD 2K1FA 3B1LX 3DVGY 3JYUA 1T6BX 3QARA 4LNFA 4W9GA 3AE1B 2RD0A 2KT7A 1L2NA 2N9EB 2IGGA 4HJGE 3PLVA 1STEA 4DHZB
chains in the Genus database with same CATH topology
2WS3B 3SFEB 1MI0A 4L2YA 1JWSD 2Z8LA 2V4IB 4TMAB 3BYTB 1V1PA 3AEFB 3DWGC 1MVKA 2WXQA 2DWQA 2IJ0A 1FXIA 4IDIA 1SXTA 2DBYA 1EM7A 3KQ4A 1M4VA 1UUPA 1WGKA 1K53A 3FILB 5G5HA 4MACA 1T5XD 1ZPSA 2YEPB 2LGIA 3MC0B 4ZHPA 2PKOA 1XO3A 5FKAC 4REZA 3VR9B 4YTNB 1TS3A 4H2AA 1ACCA 1UWMA 3KWLA 1N63A 1FO4A 1HZ6A 4RGMA 2KACA 2ON8A 1TS5A 2WQYB 1QF6A 4RCOA 1D5XC 5T8IA 5JXVA 3IT6B 3PZ7A 1I4HA 3RFZB 3E56A 1QOFA 3Q8EA 1SF0A 2QIEB 3ZJVA 3VRAB 4WQMA 1I7HA 4XE0A 3URYA 1FCLA 2BS2B 2BB6A 2ZW1A 1N5XA 2FE8A 1L6VA 4ZRPA 3P4PB 2J53A 1XLQA 3AM9A 1PGBA 4JWUC 4P16A 4HKQA 2RMMA 4KGRA 4GDLB 2BYTA 1ZP0B 2NTSA 2RPVA 3AMZA 3BYYB 1JWBD 2JZPA 4C7ZA 4FXCA 4A9AA 1RM6C 3NS1A 5BMGA 3H8HA 3T3NA 1YQ4B 5D3DA 1V1PB 2XN9C 3Q8FA 1D5ZC 2LEKA 4J3OD 1LO5D 1FFVA 1Y56A 1GAQB 1FEHA 1I4XA 2NMQA 3VR8B 2TSSA 3GP7A 1OFFA 1QKZA 1JWMD 2WDQB 1VLBA 3Q69A 1IBXB 1NVID 3TEXA 3IT4B 2LFIA 3PO0A 1MPEA 1YNTE 4UDUC 1FXAA 2BT6A 1TZOA 2JYTA 3B2FA 1XCQL 3MP9A 4LTUA 2LHEA 3AEAB 5H92C 1L5PA 3W2DA 4R3DA 1ZXIA 2DLBA 4IOIE 1FD6A 4RNAA 1EU3A 4RF1A 3B2GA 4L1BA 1KRHA 2JWUA 1QT9A 5EE1A 5G5GA 3AEEB 3AV8A 4RGOS 1CZPA 2L32A 3U2SC 1AW7A 3V05A 4NAWB 1OQQA 3AEBB 3AN1A 3AEDB 1KH0A 2BB5A 2IDYA 1D6EC 2IPKD 1XCTL 2WXHA 3V3XA 2K9XA 3KLSX 4A90A 1GB4A 1C76A 1L4DB 3VQIA 2K22A 1J7AA 3AE3B 1YN3A 4DXFA 2G9HD 5HFYA 2N7JA 1FRRA 2MJEA 4HRSA 2PVGC 1C4CA 1ZDXA 2M56B 2MJDA 3Q8CA 2GI9A 1VZ6A 2PTLA 1PUTA 4KGSA 2LMCA 3C8YA 1P7FA 2WLBA 3AE6B 1ROEA 1QLBB 1JWAD 2EKIA 1NYQA 1NEKB 3W5UB 2JQRB 2WXLA 3R2TA 2J4XA 1KFYB 3VRBB 1F0ZA 3AE7B 4WWMA 1YJIA 1NYRA 1QOAA 2VZKB 4N59A 4C7YA 5EE0A 2H88B 3AECB 4TQ0A 1FMAD 2R61A 3GB1A 1NI3A 1TS4A 2BS3B 5LNK1 2FUG1 3N9YC 3W9CB 2KQ4X 5BYSA 1JW9D 2CJOA 2E6XA 3EGRA 1I4PA 4AS1A 1XXGA 3GS2A 1V8CA 3CWIA 3FILA 3UI3A 1N60A 1T3QA 3BWUD 3OWEB 1V97A 1N62A 4KGTA 2WXPA 4HEA1 3U7ZA 5EE3A 1C4AA 2VZKD 1VJKA 2BBCA 1VRAB 1SB3C 4JWSC 4RGNA 4ARCA 4WIPA 3HRDD 5H8YE 4XWWA 1TJEA 1IGCA 2PMVA 3FC4A 3SFDB 2WU2B 1TY0A 2W82A 3U4EG 4ARIA 4N58A 3TUOA 3IXSA 2N0SB 4O1NA 2J52A 3P4RB 4YTPB 1HXYD 5BMHA 2PW9A 1J7CA 1N5WA 3B9JA 1XLPA 2AQ3B 2ONQA 1D5MC 1F2RI 2I38A 2LHDA 1KF6B 1P7EA 5FR3A 2H89B 5FK9C 4LLGM 3NRZA 4KX6B 3TEYA 2JXTA 4NZLB 3BK2A 1Q10A 3Q8AA 1L0VB 2PIAA 2GRIA 4Q2JA 1B1ZA 2KAJA 1K50A 1L0YB 3I9V1 3NVVA 1QOBA 1WWTA 2JX5A 2MH7A 3Q8BA 3AE5B 1XEEA 2SAKA 5D7GA 2IGDA 4B0EA 2KN4A 1F2RC 1YN5A 1NENB 4NJCA 1XLOA 2WDVB 4A8XC 2RDHA 5BYRA 1IUEA 1PFDA 2J42A 1I4GA 1WXQA 5C3JB 1CQVA 1ET9A 1N61A 4NAMA 2V3NA 1ET6A 2V3PA 1ESFA 3BVGA 3U52E 1QILA 1OQRA 3NVYA 2N9KA 4MM3B 4ZRQA 2Y5CA 1IBXA 4YT0B 1EWCA 1CK1A 1EU4A 4A55A 2M0AA 1JQ4A 4LK0M 1ZOYB 4KKJA 1R7SA 2ACZB 1JWUD 1HEZE 3EA6A 2Q5WD 4JX1C 4MH8A 1V1OA 4YSYB 3J9CA 5TSSA 1YN4A 1ENFA 1SIJA 4TSSA 1SJED 2WU5B 4WURA 2D5GA 5GXGB 1E6EB 1PYWD 3P1MA 4M0WA 3R8BA 4CQNA 1B9RA 1RYJA 1XLNA 3L4PA 4OW0A 1SJHD 4HKZE 4L23A 4C56C 1FNWA 1VZ8A 4B0MA 4RH6A 5HG2A 1AWDA 2W54A 1TS2A 4XWTA 1CJEA 2INPE 2JYEA 1WRIA 3AE9B 1WSPA 1WYGA 3AH7A 3W1SA 4EE2A 2WXFA 2WXNA 2ZW0A 3AEGB 3AE8B 2V0GA 1I4QA 1TKEA 2XNAC 2WXOA 2X38A 1A70A 2L52A 3ZYYX 3ABVB 2Y5PA 1JCKB 1SE2A 4A6QA 3LYYA 4RF0A 2K0PA 2DYOA 2G1EA 4YWGG 2E3TA 1VR9A 3NVWA 2PLPA 4TQ1A 4YSZB 1J7BA 1C78A 1BMLC 1SE4A 1UGJA 2ICIA 2BS4B 1JRPA 3HVZA 3BIID 1KLGD 4WAFA 2JSVX 3BVMA 3MHZA 2CU3A 1YQ3B 2W55A 2HTME 3KWVA 4P6VF 4YSXB 3NUHB 1L6UA 2CJNA 1FNVA 4C80A 1DOXA 1BUIC 1DOYA 2Y3AA 1FCCC 1TKYA 2YEPF 5MPOA 2EELA 1ZUD2 3AE2B 2INNE 3SEBA 5BYQA 4PT5A 1MHXA 1JROA 1AYFA 3P42A 1IGDA 1TYGB 1SBBB 2AQ2B 2HDEA 2WXIA 3CIRB 1QQRA 3TEZA 4WH4A 2IGHA 1TKGA 2LUMA 2W3SA 4US9A 1FM0D 2L83A 1HQRD 2WDRB 1VZ7A 1E0ZA 4D2KA 1C77A 1DOIA 3I57A 4OVZA 2WXMA 4OZAA 4JE3B 1YMHE 2KMMA 1SE3A 1DGJA 5AUKA 4N6EB 4OZCA 4ZHOA 4ITKA 3MFGA 3AE4B 1GB1A 2QILA 1E7PB 3BK1A 4XDDA 1KLUD 1E10A 4ZYSA 3BZDB 3W5VB 1PGAA 2BW2A 3SR6A 1PDXA 2I2YA 1K52A 3ZJUA 3NZ3A 5HHDG 3TSSA 2KDMA 2FBWB 1RFKA 2W3RA 3BVZA 3NVZA 3LB8C 5C2TB 4US8A 3T3OA 3IAM1 2QEJC 1TY2A 4DQOC 1K51A 1AN8A 1RWSA 1C79A 1EWYC 2M19A 4DXGA 1JALA 1FRDA 3R2IA 5HI1A 3IAS1 3ZJTA 4ZOHC 1YJJA 1GPXA 2QJLA 2MEKA 4YXDB 1DYQA 1PGXA 4IKGA 5I4DA 1UNSA 4KKIA 4XDCA 2WXKA 3AB5A 3HVDA 2N9LA 4YTMB 2WXJA 2L1AA 2JU6X 1ZXHA 1KTKA 5E6JA 2WNMA 2B76B 5D3IB 3ZGZA 1HZ5A 1ZE3D 4GLSC 4AQ7A 3P4QB 4MT5A 1F77A 4HROA 4OZBA 4OHJA 1C4PA 1SSNA 1VDVA 2AQ1B 1JMLA 4JPSA 1HA5A 3MJ5A 3PZ8A 5BMIA 2AX5A 2DYMA 3HUIA 2NTTA 1MHHE 3P4SB 3P63A 3EUB2 2BTEA 2QSDA 2LJIA 2QMTA 2WXGA 3TEWA 5EE9A 3O13A 3ZQ4A 2WP9B 3ETRA 2OEDA 4RFBA 4RGTA 2KWDA 5AUIA 1D4BA 2K5PA 1L0XB 1FIQA 1ZDVA 2MJ3A 1FFUA 2SEBD 1I4RA 2K3UA 1FNUA 1GOZA 2OHFA 1C9FA 3RPFC 1SEBD 4USAA 1T6BX 3DWMA 3E9SA 4GDKB 2PVOD 1UWXA 3FAHA 3AE1B 1QOGA 2GB1A 1BXTA 2WXRA 1E9MA 1L4ZB 2IGGA 1XF5L 2RDGA 4HJGE 3LXFA 3WCQA 1STEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0Z A;  1WWT A;  1CZP A;  1DOI A;  2JX5 A;  2MH7 A;  2WS3 B;  3AE5 B;  3SFE B;  1OQQ A;  3AEB B;  3AN1 A;  3AED B;  1NEN B;  2KMM A;  1XLO A;  2WDV B;  1DGJ A;  3AEF B;  3DWG C;  5AUK A;  4N6E B;  4ZHO A;  2DWQ A;  4IDI A;  1FXI A;  4ITK A;  2DBY A;  1IUE A;  1PFD A;  3AE4 B;  1E7P B;  2K9X A;  1WXQ A;  5C3J B;  1GPX A;  1WGK A;  5G5H A;  1E10 A;  1N61 A;  2K22 A;  4ZHP A;  3W5V B;  1J7A A;  1XO3 A;  2PKO A;  3AE3 B;  3SR6 A;  1PDX A;  1OQR A;  3NVY A;  3VR9 B;  4YTN B;  1FRR A;  2MJE A;  2Y5C A;  3KWL A;  1UWM A;  4YT0 B;  1N63 A;  2FBW B;  1RFK A;  2PVG C;  2W3R A;  3NVZ A;  4HRS A;  2M56 B;  2MJD A;  1FO4 A;  3LB8 C;  5C2T B;  4US8 A;  1JQ4 A;  1ZOY B;  1PUT A;  1F0Z A;  1QF6 A;  2WQY B;  1R7S A;  2ACZ B;  4JX1 C;  2Q5W D;  4YSY B;  2WLB A;  1RWS A;  1ROE A;  1EWY C;  1QLB B;  2M19 A;  3AE6 B;  1JAL A;  1FRD A;  1JWA D;  1SIJ A;  2EKI A;  1NYQ A;  1NEK B;  2WU5 B;  1QOF A;  3W5U B;  2JQR B;  1SF0 A;  2QIE B;  4ZOH C;  1KFY B;  3VRA B;  4WQM A;  1I7H A;  1YJJ A;  3AE7 B;  5GXG B;  1E6E B;  1YJI A;  2BS2 B;  2QJL A;  3P1M A;  4WWM A;  3VRB B;  1B9R A;  1NYR A;  1QOA A;  1RYJ A;  1XLN A;  3L4P A;  4N59 A;  5EE0 A;  4C7Y A;  4YXD B;  2H88 B;  1N5X A;  3AEC B;  1L6V A;  3P4P B;  4JWU C;  1XLQ A;  3AM9 A;  1FMA D;  1NI3 A;  3AB5 A;  2BS3 B;  4YTM B;  1AWD A;  3W9C B;  2W54 A;  1ZP0 B;  3AMZ A;  2B76 B;  1JWB D;  1CJE A;  1JW9 D;  2CJO A;  1WRI A;  3AE9 B;  3P4Q B;  4C7Z A;  4FXC A;  4A9A A;  1RM6 C;  3NS1 A;  1WYG A;  1V8C A;  3AH7 A;  3CWI A;  4HRO A;  1N60 A;  1T3Q A;  1V97 A;  1VDV A;  3AEG B;  1N62 A;  1YQ4 B;  3AE8 B;  5EE3 A;  1TKE A;  1VJK A;  2LEK A;  4JWS C;  1SB3 C;  1A70 A;  2L52 A;  3ZYY X;  3ABV B;  1FFV A;  3HRD D;  5H8Y E;  1TJE A;  2AX5 A;  3FC4 A;  3HUI A;  1GAQ B;  3SFD B;  2G1E A;  2WU2 B;  2E3T A;  3NVW A;  3P4S B;  3VR8 B;  4YSZ B;  3P63 A;  1J7B A;  1OFF A;  3EUB 2;  2WDQ B;  4N58 A;  2BS4 B;  1JRP A;  3HVZ A;  3BII D;  2N0S B;  1VLB A;  4YSX B;  2CU3 A;  1YQ3 B;  2W55 A;  2HTM E;  4P6V F;  1NVI D;  5EE9 A;  3P4R B;  1L6U A;  2CJN A;  4YTP B;  4C80 A;  2WP9 B;  3ETR A;  1DOX A;  1DOY A;  1TKY A;  3PO0 A;  5AUI A;  1J7C A;  1N5W A;  3B9J A;  1XLP A;  5MPO A;  1FXA A;  1ZUD 2;  1FIQ A;  2BT6 A;  2K5P A;  2MJ3 A;  3AE2 B;  1FFU A;  3B2F A;  1KF6 B;  2OHF A;  2H89 B;  4LTU A;  3RPF C;  3NRZ A;  1JRO A;  4KX6 B;  4USA A;  1AYF A;  3AEA B;  5H92 C;  1L5P A;  1TYG B;  3DWM A;  1ZXI A;  2PVO D;  3CIR B;  3FAH A;  1L0V B;  2PIA A;  3B2G A;  3AE1 B;  1KRH A;  2KAJ A;  1TKG A;  1QOG A;  2W3S A;  4US9 A;  1FM0 D;  1QT9 A;  1E9M A;  2L83 A;  3WCQ A;  2WDR B;  3LXF A;  5EE1 A;  5G5G A;  3AEE B;  3NVV A;  1QOB A;  3AV8 A; 
#chains in the Genus database with same CATH topology
 1HTO A;  3ZTC A;  1I42 A;  2Z59 B;  2JRH A;  1V1P A;  3DWG C;  2WXQ A;  1WM3 A;  2DWQ A;  4RM8 A;  1M4V A;  1WGK A;  3H7P A;  4MAC A;  1P0R A;  4YTN B;  3KWL A;  1UWM A;  1N63 A;  3UGB B;  1FO4 A;  4ANW A;  1WRD B;  1TS5 A;  2GBR A;  4WJP A;  1D5X C;  5T8I A;  5CHW A;  1I35 A;  2D2Q A;  2N7D A;  3NY5 A;  3Q2A C;  2KLC A;  3Q8E A;  1SF0 A;  4N9F 4;  3VRA B;  2ZNV B;  1I7H A;  1YIW A;  3A9J A;  2C7M B;  2FUH B;  4WQO B;  2RGF A;  3VVW B;  5C1Z A;  2J53 A;  4BBN F;  2A4Z A;  3KVF B;  4KGR A;  4HK2 A;  4A9A A;  3NS1 A;  2C7H A;  3T3N A;  2L0F A;  5D3D A;  3P2B A;  4J3O D;  2MSE D;  4JIO U;  1FFV A;  4II2 B;  2QCZ A;  2NMQ A;  1JWM D;  5JHA A;  3Q69 A;  1NVI D;  4FHJ A;  3ZNG C;  3PO0 A;  1MPE A;  3B08 A;  3B2F A;  3IG3 A;  3MP9 A;  4IM2 A;  5H92 C;  4R3D A;  4BKG A;  4GMV A;  4IOI E;  2N1V A;  2G3Q B;  2JWU A;  1QT9 A;  2KFK A;  2L8J A;  5EE1 A;  5G5G A;  2L32 A;  1E8Z A;  3V05 A;  3AN1 A;  3AEB B;  4LNN A;  1UBI A;  1D6E C;  1YX6 B;  1WM2 A;  5CTR C;  4NJ6 A;  4TKN A;  2IPK D;  2JPH A;  2K9X A;  2MBH A;  4G3X B;  3L08 A;  5LXI B;  3AE3 B;  1P3Q U;  2EMT A;  2MJE A;  2WX1 A;  4HRS A;  2WWZ A;  1C4C A;  1ZDX A;  3W1Y A;  2GI9 A;  1PUT A;  4KGS A;  2DAF A;  4HPM B;  1WJ4 A;  2WLB A;  1JWA D;  2IO2 B;  2WXL A;  4JL9 A;  3VRB B;  4JLC A;  1WGD A;  4MH0 E;  5EE0 A;  3QA8 A;  2XK5 A;  1GC6 A;  1E7U A;  1S1Q B;  4FN2 A;  3ZXV A;  1TS4 A;  2O6V D;  2BS3 B;  2FUG 1;  1V80 A;  3L13 A;  1ZGU B;  2KQ4 X;  2RR9 A;  5BYS A;  1ZKH A;  3EGR A;  3ZO5 B;  1V8C A;  3UI3 A;  3DBL B;  3ZIM A;  3MHS D;  5AZF A;  2BBC A;  4HPP A;  2PMV A;  3Q3M C;  3SFD B;  4I6L B;  4K1R B;  3U4E G;  4AP4 C;  2N0S B;  4O1N A;  2ASQ A;  4B9K A;  4KSL C;  4EUT A;  3M95 A;  3QQ8 B;  5BMH A;  1N5W A;  2WHI A;  4M0W B;  1L7Y A;  4LLG M;  3NRZ A;  5EDS A;  3LDZ E;  1Q10 A;  4KSK C;  2FIF A;  3V6C B;  2GRI A;  2BWE S;  2JY6 A;  2N9X A;  3I9V 1;  3RZW C;  2MH7 A;  3Q8B A;  1Y8R C;  4B0E A;  2IGD A;  3UF8 A;  5IAA C;  1VCB A;  5LXH A;  2WDV B;  5BYR A;  1IUE A;  1PFD A;  1KLV A;  1N61 A;  1ET6 A;  1ESF A;  3VUX A;  2BF8 B;  3U52 E;  2LD9 A;  4W9F A;  3NVY A;  4MM3 B;  2KAN A;  4ZRQ A;  2Y5C A;  1WX7 A;  3VTU A;  1CK1 A;  4BKT A;  3X0W A;  1JQ4 A;  3ZRF A;  1LGR A;  1HE8 A;  4C4V A;  2L0T A;  4MH8 A;  4YSY B;  1EF5 A;  5CHV C;  5TR5 A;  4TSS A;  4WUR A;  2LXC A;  4IWP A;  3R8B A;  1B9R A;  3L4P A;  4OW0 A;  1WMH A;  2PEA A;  4C56 C;  4RH6 A;  4II3 B;  2K25 A;  2GBN A;  2W54 A;  2BQQ A;  2C5L C;  2JT4 B;  3JW0 X;  4WWP A;  1CJE A;  2INP E;  2JYE A;  4GDL A;  2D3B A;  3W1S A;  4EE2 A;  2B3A A;  3Q3N C;  1MG8 A;  3W1S C;  1TKE A;  1WXA A;  2WXO A;  2X38 A;  2XNA C;  2GBJ A;  3A1Q B;  2DYO A;  2G1E A;  3CST A;  1MFW A;  2V3S A;  2PLP A;  3RNE C;  2AWT A;  1BML C;  1SE4 A;  1UGJ A;  2ICI A;  3HVZ A;  2W55 A;  2HTM E;  4WWO A;  1PQS A;  3DPD A;  2M0X A;  2NVU I;  2LVQ A;  4C4V B;  3RYT A;  1MHX A;  1JRO A;  2KMC A;  1IGD A;  5L95 C;  4CHK A;  1SBB B;  2WXI A;  4DDG D;  1J19 A;  3JSV B;  2LUM A;  1TKG A;  4G50 A;  3CF6 E;  4PYU A;  1UH6 A;  4W9C A;  1MG4 A;  1YMH E;  4N6E B;  4OZC A;  4ICU A;  4ITK A;  3A33 B;  1V49 A;  4EFO A;  2NPT A;  4ZRJ A;  5D6J B;  2MA9 B;  3H6N A;  2KDM A;  2KNB A;  3BVZ A;  5DCN A;  5C2T B;  4US8 A;  3T3O A;  2C60 A;  1RWS A;  1C79 A;  2M19 A;  1E90 A;  3R2I A;  5JH5 C;  1Q5W B;  2O6V B;  4YXD B;  3NJT A;  5I4D A;  3IHP C;  2M8S A;  1M94 A;  4F8C B;  2N9L A;  3GZN B;  2JU6 X;  2DAJ A;  4LCD E;  1E8W A;  2B76 B;  3TJP A;  3ZGZ A;  4GLS C;  2MP2 A;  1TBE A;  4OZB A;  2AQ1 B;  3TBL D;  3TL5 A;  4JPS A;  4NQK E;  4E71 A;  5DPT A;  3ZW3 A;  1MHH E;  3P4S B;  2PE6 B;  3DHG C;  3P63 A;  2BTE A;  1TTN A;  2M4N A;  2WXG A;  4KZ0 A;  4LNO A;  2WP9 B;  3ETR A;  3OJ4 B;  2OED A;  4RFB A;  4RGT A;  2K5P A;  2MJ3 A;  1FFU A;  2OHF A;  1GOZ A;  1OTR B;  1C9F A;  4USA A;  3KUD B;  4KVG B;  4PK1 A;  2BWF A;  2J0M A;  1UWX A;  3GZN I;  2EMS A;  1RRB A;  4HKQ A;  2WXR A;  3WCQ A;  2LWP A;  1MI0 A;  3PLU A;  1R4N I;  3QJZ A;  2BYV E;  4TMA B;  3BYT B;  4GOC A;  1E8Y A;  3D32 A;  2IJ0 A;  4IDI A;  1FXI A;  1SXT A;  2DBY A;  3KQ4 A;  3R7R A;  2D10 A;  1K53 A;  5G5H A;  2UU7 A;  2YEP B;  3MC0 B;  4IM0 A;  2IY0 B;  1XO3 A;  2KVZ A;  3DHH C;  1TS3 A;  4FJV B;  1HZ6 A;  2IND C;  2MW5 A;  3HM6 X;  2KAC A;  2BYF A;  4BOZ B;  1QF6 A;  2WQY B;  4RCO A;  4W9K A;  4LNI A;  4TV3 A;  1I4H A;  3E56 A;  3ZDT A;  1QOF A;  3RNF C;  3ZDM C;  4WQM A;  1EUV B;  3URY A;  5JZE B;  1FCL A;  3TIX A;  2BB6 A;  2ZW1 A;  2FE8 A;  2JUO A;  1L6V A;  3P4P B;  1XLQ A;  1PGB A;  2GBK A;  2JZZ A;  4MEM A;  4KIK B;  3OAW A;  3UIP B;  2NTS A;  3RNA C;  1JWB D;  4A3O A;  1RM6 C;  1KM7 A;  3DVN V;  2UYZ B;  3H8H A;  1YQ4 B;  3KYC D;  3Q8F A;  5GMV A;  4KDL B;  3PGE A;  4MGY E;  2LXA A;  1GAQ B;  2DZM A;  1E8X A;  1OFF A;  1QKZ A;  3SU8 X;  2R2O A;  3RUI B;  1VLB A;  3N32 A;  4BZA A;  4ASW C;  3TEX A;  3EFC A;  3IT4 B;  2LFI A;  2KK8 A;  1YNT E;  3SDL C;  4MGK E;  1FXA A;  2JYT A;  4LTU A;  2LHE A;  4BAX A;  3W2D A;  2LZ6 A;  3NHE B;  4BKS D;  3B2G A;  1KRH A;  3ALB A;  2OJW A;  2ZPY A;  3AEE B;  3DCG A;  3U7D A;  1J8C A;  1OQQ A;  2I1J A;  3AED B;  1CMX B;  4M01 A;  2W9N A;  4WAA A;  1XCT L;  3V3X A;  2KZR A;  3AUL A;  1X1M A;  3U30 A;  1L4D B;  1MJD A;  3VQI A;  1FPY A;  1SIF A;  4GN1 A;  5LLI A;  1C3T A;  2M56 B;  1VZ6 A;  2PTL A;  4JQW C;  2LMC A;  2CKH B;  1P7F A;  4EZJ A;  1ROE A;  1QLB B;  3ECI A;  5J17 A;  1NYQ A;  2JQR B;  3R2T A;  1KFY B;  4WWM A;  4MSM B;  1NYR A;  1QOA A;  4C7Y A;  5IN7 A;  2Z0D B;  1UF0 A;  4TQ0 A;  4EOY A;  3R3M A;  3Q6B A;  4W9L A;  4ANX A;  2J7Q B;  4CYE A;  2NR2 A;  3MC9 A;  5LNK 1;  3N9Y C;  2AL3 A;  3NS8 A;  1P9D U;  3TMP B;  2E6X A;  1I4P A;  1Q1O A;  4DHJ B;  3PPA A;  3CWI A;  3FIL A;  1T3Q A;  3OWE B;  1V97 A;  1N62 A;  5CHF A;  4HEA 1;  3NOB A;  3U7Z A;  3NZS A;  5HKH A;  4HDQ A;  3HRD D;  1TJE A;  4RM9 A;  2WU2 B;  1IP9 A;  1TY0 A;  2LVP A;  2N1W A;  2ZCC A;  3IXS A;  3ML9 A;  3VHT C;  4YTP B;  1HXY D;  3RNC C;  2PW9 A;  2KTF A;  3N1Z C;  1D5M C;  1F2R I;  4HDO A;  3N1Y C;  1KF6 B;  1P7E A;  4KX6 B;  4PS3 A;  4A3P A;  3Q8A A;  2AEH A;  2PIA A;  4Q2J A;  1B1Z A;  4AOF A;  1K50 A;  2VH2 A;  2FNJ B;  1P1A A;  1QOB A;  1GC7 A;  2JX5 A;  3AE5 B;  2KN4 A;  2VH1 A;  1Z5S B;  4QAY A;  1WR1 A;  2ZVO A;  3ZUN A;  3PS6 A;  5C3J B;  4NAM A;  3B0A A;  4IWO A;  1SGH A;  1IBX A;  2MBE A;  1EWC A;  4MJS A;  1EU4 A;  2KOX A;  4LK0 M;  1ZOY B;  4JX1 C;  2XBB C;  2HD5 B;  3MC8 A;  3ZVV A;  4HWI B;  3ML8 A;  1SIJ A;  1R4M B;  1SJE D;  2WU5 B;  2KXJ A;  3OJ3 A;  1PYW D;  1XT9 B;  4M0W A;  2DNF A;  1XLN A;  4S0R A;  4HKZ E;  1UBQ A;  1VZ8 A;  4B0M A;  5HG2 A;  2K8B A;  2I1K A;  4EZL A;  5G55 A;  2EKE C;  1ZW7 A;  5D2M B;  1WJ6 A;  1RFA A;  1RLF A;  3AEG B;  3UIO B;  3EEC A;  3FKY A;  2L52 A;  4LDT B;  2Y5P A;  1JCK B;  3Q3J A;  5CX3 A;  4A6Q A;  2KDB A;  2K0P A;  3H7P B;  2KVR A;  5E6N A;  4TQ1 A;  1JRP A;  1V86 A;  3BVM A;  3ZRC A;  4P6V F;  3GE3 C;  1L6U A;  2CJN A;  4C80 A;  1DOX A;  1BUI C;  1FCC C;  1TKY A;  2YEP F;  5MPO A;  1Z2M A;  2MBQ A;  4PT5 A;  1AYF A;  3P42 A;  1YOV B;  1KOT A;  2AQ2 B;  2WGS A;  3A9K A;  1WR6 E;  1P98 A;  4G0N B;  1QQR A;  4G11 A;  3TEZ A;  4WJQ A;  3QCA A;  1HQR D;  1VZ7 A;  4D2K A;  1DOI A;  4K7S A;  2KTR A;  1YJ1 A;  1SE3 A;  5AUK A;  4ZHO A;  2NS5 A;  3MFG A;  1GB1 A;  3IVF A;  3TCA A;  4DK5 A;  4BFR A;  3ONS A;  3ZNI D;  4ZYS A;  3APF A;  3W5V B;  1GG3 A;  2BW2 A;  4F1S A;  1WI0 A;  3VH3 B;  1OEY A;  5HHD G;  1RFK A;  2W3R A;  1OGW A;  3IAM 1;  3IFW B;  2QEJ C;  2VRR B;  2DEN B;  5AZH A;  4DXG A;  2IO1 B;  3DBR I;  1YJJ A;  1GPX A;  3O65 B;  4IKG A;  2G45 B;  3DBL I;  4P1B C;  3AB5 A;  1WGH A;  3A9K B;  4YTM B;  2WXJ A;  1ZXH A;  1KTK A;  3N30 A;  1HZ5 A;  1ZE3 D;  4K3C A;  4MT5 A;  3QC8 B;  3MJ5 A;  3PZ8 A;  2AX5 A;  2DYM A;  5KHQ A;  3QWZ B;  2NTT A;  4FAD A;  4HVB A;  3EUB 2;  2LJI A;  2LVO A;  2YLM A;  1UGM A;  4ZRK A;  4K7W A;  4GSW A;  3L17 A;  5AUI A;  3N3K B;  1L0X B;  5L83 A;  1I4R A;  2AL6 A;  4ICV A;  2K3U A;  1FNU A;  1WGG A;  2K8H A;  1WE7 A;  1T0R C;  3E9S A;  3RNG C;  3NG0 A;  3PHW B;  2PVO D;  3FAH A;  4S17 A;  1BXT A;  5JHB A;  1L4Z B;  2KDE B;  2DHZ A;  4HXD A;  3WAO A;  2WS3 B;  3SFE B;  4FJZ A;  1BT0 A;  2Z8L A;  3C19 A;  2V4I B;  3VH4 B;  1EM7 A;  1EF1 A;  2L7R A;  1G6J A;  2J0K A;  3FIL B;  1T5X D;  1ZPS A;  2LGI A;  4ZHP A;  3RI7 C;  4NQL B;  2PKO A;  4W9D A;  2C9W B;  5FKA C;  2J0J A;  3HIZ A;  2DYB A;  4H2A A;  1ACC A;  2BGF A;  4LJO B;  4RGM A;  1QZE A;  3ZNZ B;  2ON8 A;  2LGS A;  5JXV A;  3IT6 B;  3RFZ B;  1J0G A;  1WF9 A;  2QIE B;  4KZC A;  4XE0 A;  2BKR B;  2D3C A;  4MSQ B;  2D3G A;  1N5X A;  4P16 A;  2V1Y A;  2BYT A;  3KYD D;  3GE8 C;  3HK0 A;  4LNK A;  3AMZ A;  3BYY B;  4KV2 A;  2JWZ A;  3U8Z A;  3V61 A;  1WXS A;  2XN9 C;  1D5Z C;  1LO5 D;  3ENE A;  1JRU A;  4OVV A;  2TSS A;  3GP7 A;  2WDQ B;  1E5W A;  4HPL B;  1WYW B;  1IBX B;  2JZ3 B;  2KKC A;  2LUE A;  3T8M A;  4XX5 A;  1TZ1 A;  3QX1 A;  4P1C C;  2BT6 A;  2LRU A;  2RSU A;  4FLH A;  3AEA B;  2YVC A;  3M3J A;  3VTV A;  3L16 A;  2DLB A;  2DX5 B;  1FD6 A;  4RNA A;  2LRW A;  2KWV B;  2R2Q A;  3X23 A;  3QAQ A;  3RUL A;  4RGO S;  4NNJ B;  1AW7 A;  1YD8 U;  2KFK B;  3M62 B;  4M8M A;  3DHI C;  3PSE B;  2IDY A;  1WH3 A;  3WAM A;  3KLS X;  2L00 B;  1YN3 A;  4DXF A;  5HFY A;  1FRR A;  3A1Q A;  4EKU A;  3MTN B;  3PZD A;  4M02 A;  3KH0 A;  3Q8C A;  3RMK C;  3C8Y A;  2Z0E B;  3IBE A;  2FCN A;  3W5U B;  3AE7 B;  1YJI A;  4E74 A;  1NI2 A;  4IW0 A;  4DBG A;  4ZRI A;  3M63 B;  3VTW A;  1FMA D;  3A4S C;  1N6Z A;  1NI3 A;  4PYZ A;  3W9C B;  2KWC A;  2RPQ A;  5IA7 A;  1EO6 A;  1N60 A;  4FHK A;  3ZKJ C;  2N9P C;  4KGT A;  5BO4 B;  4F7Z A;  2Y5B B;  3H7S A;  2VZK D;  4ARC A;  1VRA B;  1VD2 A;  5H8Y E;  1WY8 A;  4RMA A;  3FC4 A;  4W9E A;  2KLG A;  1WFY A;  2W82 A;  2FCS A;  3TUO A;  2J52 A;  3H1U A;  3P4R B;  3R7Q A;  2ZVN A;  1J7C A;  3B9J A;  1XLP A;  2ONQ A;  3DBH I;  2I38 A;  2KC1 A;  2LHD A;  5FR3 A;  5FK9 C;  2M17 A;  1R4N B;  4A20 A;  4NZL B;  3DBS A;  1WJN A;  4KIK A;  1L0V B;  4GXB A;  2FID A;  1L0Y B;  5D94 A;  2CS4 A;  4J6I A;  1WWT A;  5D7G A;  2SAK A;  1V81 A;  4DDI D;  1YN5 A;  1NEN B;  4NJC A;  4A8X C;  3RZF A;  5IP4 D;  2RDH A;  4XGA B;  2J42 A;  4BVU C;  2IYD B;  2V3P A;  4IC7 B;  1WIA A;  1XD3 B;  4AJW A;  4MGZ E;  3HM3 A;  2N9K A;  1IPG A;  2WYQ A;  5IO9 A;  4A55 A;  3PRE A;  4MM3 A;  4KKJ A;  4GB9 A;  2ACZ B;  2A5U A;  3EA6 A;  3CMM B;  2Q5W D;  4WWN A;  5TSS A;  2KQS A;  2OOB B;  3J9C A;  3WA0 A;  5GXG B;  3P1M A;  4EZK A;  3UQB A;  4CQN A;  1RYJ A;  1SJH D;  2KQ7 A;  2ZZP B;  3V62 A;  4L23 A;  3A9J B;  1FNW A;  3WAP A;  2KD0 A;  4NAW A;  4I6N B;  3K9P B;  1AWD A;  2KTR B;  1V5O A;  2QHO A;  3V6E B;  4E3C A;  1WRI A;  1WSP A;  3ZNH B;  2IY1 B;  2GBM A;  5FR6 A;  1WYG A;  3DBR B;  3AH7 A;  2NPT B;  2WXF A;  2WXN A;  2ZCB A;  3BY4 B;  5C23 A;  1I4Q A;  2KN5 A;  1A70 A;  3ABV B;  4IWQ A;  1SE2 A;  4HCP B;  3LYY A;  2KJ6 A;  4RF0 A;  3RT3 B;  1VR9 A;  4LDT D;  4FUL A;  4YSZ B;  1WE6 A;  1WX8 A;  3BII D;  2JSV X;  3MHZ A;  3BIN A;  1YQ3 B;  4MJS B;  3NUH B;  1FNV A;  2CHX A;  2BPS A;  2GMI C;  2Y3A A;  1ZUD 2;  2EEL A;  4K81 A;  3SEB A;  5BYQ A;  2MX2 A;  3VFK A;  3I5J C;  3CIR B;  4W9I A;  4WH4 A;  2IGH A;  4US9 A;  5IOI A;  1FM0 D;  1NDD A;  2L83 A;  2WDR B;  2MLB A;  4HCN B;  3SHQ A;  1C77 A;  5KHO A;  2WXM A;  4OZA A;  1T0S C;  3OG5 A;  4MDK E;  4PS7 A;  1DGJ A;  3R66 C;  1AAR A;  3K9O B;  5E6P A;  3AE4 B;  2QIL A;  2L05 A;  3BK1 A;  2FCM A;  4XDD A;  4NPN A;  1E10 A;  1PDX A;  2I2Y A;  4XC2 A;  3RN9 C;  2ZNV C;  1GJZ A;  2HJ1 A;  1TT5 B;  2OJR A;  4DQO C;  1AN8 A;  4MGI E;  1JAL A;  1FRD A;  2M1M A;  1WXV A;  3SD5 A;  4TUU A;  2KWU B;  2QJL A;  5J2R A;  1DYQ A;  4DXA B;  1LFD A;  4C00 A;  4FA6 A;  3N1X C;  3HVD A;  2PPH A;  2MP2 B;  2L1A A;  5E6J A;  5DPW A;  2FAZ A;  3L10 B;  4AQ7 A;  3KUC B;  3P4Q B;  2MWS B;  3DBH B;  2WX0 A;  2NCN A;  3PV1 A;  4ANV A;  4HRO A;  1C4P A;  1VDV A;  4WJN A;  1JML A;  4ACF A;  5DPS A;  1HA5 A;  3MJW A;  1LXD A;  1WZ0 A;  3DOW A;  4P7I A;  2DZK A;  2QSD A;  2QMT A;  3TEW A;  3O13 A;  2K8C A;  2INC C;  2GOW A;  1FIQ A;  4GDK A;  2G4D B;  4BBN C;  3RPF C;  1SEB D;  1V6E A;  3DWM A;  4GDK B;  4XZ4 A;  2LAS A;  1QOG A;  2GB1 A;  1UZX B;  1E9M A;  2RDG A;  2IO0 B;  1XF5 L;  3LXF A;  3APD A;  3DVG X;  4L2Y A;  1JWS D;  2FCQ A;  3AEF B;  1MVK A;  5G2N A;  3VDZ A;  1UUP A;  2HTH A;  2RDB C;  4REZ A;  3VR9 B;  3S2A A;  4DHZ E;  5DPR A;  3PZ7 A;  2K6Q A;  2PE9 A;  3Q3F A;  4GGQ A;  3JVZ X;  2KMA A;  3ZJV A;  2BS2 B;  2MBB B;  2DZJ A;  4M00 A;  4X57 B;  2ZJD A;  2KJH B;  4ZRP A;  4JWU C;  3AM9 A;  1WGY A;  2RMM A;  3H9D A;  4GDL B;  1WMH B;  2BYE A;  1ZP0 B;  2RPV A;  1ISN A;  1LQB A;  3VAW A;  2JZP A;  4XYC A;  4C7Z A;  2IZV B;  4FXC A;  5BMG A;  2HJ8 A;  1V1P B;  2LEK A;  4NJ7 A;  1Y56 A;  1FEH A;  1I4X A;  2REX A;  3VR8 B;  4WJO A;  2O6V A;  4UDU C;  1TZO A;  3AI5 A;  2NBW B;  1XCQ L;  1SE9 A;  2XK5 B;  1V5T A;  1L5P A;  2WDT B;  1WZ3 A;  1WXM A;  2KO3 A;  3EC8 A;  1ZXI A;  2D07 B;  1WJU A;  1EU3 A;  4RF1 A;  4L1B A;  3OLM D;  1YQB A;  4BKS A;  3APC A;  3AV8 A;  3CSF A;  1CZP A;  3U2S C;  3I3T B;  4NAW B;  2JVC A;  4NY0 A;  3AXC A;  1KH0 A;  2BB5 A;  2N7E A;  5E6O A;  3RCZ A;  2V4L A;  3C0R B;  2WXH A;  4A90 A;  1GB4 A;  1C76 A;  4W9J A;  2K22 A;  1V2Y A;  2JXX A;  4ANU A;  1J7A A;  2G9H D;  2O2V B;  3AU5 A;  2N7J A;  1S3S G;  1TIF A;  2PVG C;  3A4R A;  2LGY A;  2XEW A;  3UQA A;  2MJD A;  3VUW A;  1Q0W B;  3PRM B;  3AE6 B;  4EEW A;  1YX5 B;  2EKI A;  5J18 A;  1NEK B;  2NBU A;  4IG7 B;  2J4X A;  2LGD A;  1F0Z A;  1V9J A;  2D11 A;  2VZK B;  4N59 A;  2H88 B;  3AEC B;  3RNB C;  1T0Y A;  3PRZ A;  2R61 A;  3GB1 A;  1U4A A;  4DHJ D;  2G4S A;  1F52 A;  1F1H A;  1JW9 D;  2CJO A;  3PRP B;  4I6P A;  4AS1 A;  2ZEQ A;  1XXG A;  4HLE A;  3GS2 A;  3BWU D;  2WXP A;  2DZI A;  5EE3 A;  1C4A A;  1VJK A;  4RGN A;  3QHT A;  1SB3 C;  4JWS C;  4WIP A;  2IO3 B;  4XWW A;  1IGC A;  5IKC M;  4AWJ A;  4GU2 A;  1H4R A;  4ARI A;  4N58 A;  4IM3 A;  3PTF C;  2K6D B;  3LJ3 A;  2MCN B;  2AQ3 B;  1UD7 A;  2H89 B;  2MRP A;  3TEY A;  2LGX A;  2JXT A;  3BK2 A;  3ZLZ A;  2KAJ A;  2CU1 A;  3NVV A;  1KJT A;  1XEE A;  1F2R C;  1XQQ A;  1XLO A;  1IYF A;  4K7U A;  3ZTD A;  1WX9 A;  2D3A A;  3PT2 B;  1I4G A;  1WXQ A;  1CQV A;  1ET9 A;  2AYO B;  2V3N A;  3BVG A;  3L0W B;  2LI5 A;  1QIL A;  1OQR A;  2JF5 A;  3RD2 A;  1GNU A;  4YT0 B;  4OVU A;  2L76 A;  2M0A A;  1R7S A;  1JWU D;  1HEZ E;  1F9J A;  1V1O A;  3ZXR A;  1YN4 A;  1ENF A;  3WAL A;  4K3B A;  3DDC B;  2N4F A;  4ZYN A;  3V60 A;  2QC8 A;  3QIJ A;  3VUY A;  2D5G A;  1E6E B;  3JSV A;  1H8C A;  2CR5 A;  1TGZ B;  2MQJ A;  1WGR A;  1NBF C;  1TS2 A;  1K8R B;  2LJ5 A;  3UIN B;  4XWT A;  3Q14 C;  3AE9 B;  4AJY B;  1LM8 B;  4B6W A;  1RAX A;  3PVL A;  2PJH A;  2ZW0 A;  3PHX B;  4GIV A;  3AE8 B;  2V0G A;  2CHW A;  2HE7 A;  1R4M I;  4IUM B;  3ZYY X;  2NBV B;  3QK0 A;  4B95 A;  2K39 A;  2BVC A;  4YWG G;  2E3T A;  3NVW A;  4FJY A;  1J7B A;  4M8N A;  1C78 A;  2BS4 B;  4WAF A;  1KLG D;  4YSX B;  2CU3 A;  3KWV A;  2KX0 A;  3WAN A;  2IBI B;  1DOY A;  3WIM A;  2L3Z A;  3AE2 B;  2MHJ A;  2INN E;  2KHW B;  2KDI A;  4AUQ C;  1T0Q C;  3GOE A;  4LJP B;  1TYG B;  2HDE A;  2GLS A;  2W3S A;  4JGH B;  1E0Z A;  4YL8 A;  3I57 A;  4OVZ A;  4JE3 B;  2KMM A;  1A5R A;  1HTQ A;  2ZPN A;  1E7P B;  4MEL A;  1KLU D;  1E7V A;  3DQV A;  4BOS C;  4CO7 A;  1OEY J;  3BZD B;  1PGA A;  3SR6 A;  4URK A;  1K52 A;  3ZJU A;  3NZ3 A;  1C1Y B;  3TSS A;  2FBW B;  3NVZ A;  2O2V A;  3LB8 C;  3HHM A;  2MBO A;  2KJR A;  1TY2 A;  1K51 A;  4PS8 A;  5AZG A;  1EWY C;  3I63 C;  2KX3 A;  5HI1 A;  3IAS 1;  3ZJT A;  5AEK B;  4ZOH C;  1OQY A;  2QDF A;  3AU4 A;  2MEK A;  2KC2 A;  2KFJ A;  1PGX A;  1UNS A;  4KKI A;  4XDC A;  2WXK A;  4KDI C;  2BKF A;  2C7N B;  2WNM A;  2UWQ A;  3KW5 B;  5D3I B;  3NZU A;  2KYW A;  2KDF B;  3KUZ A;  1F77 A;  3EHV A;  4OHJ A;  1SSN A;  4ZDV A;  1UEL A;  3T9L A;  5BMI A;  1GUA B;  3HUI A;  4FBJ B;  3VXW A;  3N20 C;  4HJK A;  2X8X X;  3Q3O C;  3DVN U;  4DWF A;  5EE9 A;  4W9H A;  3ZQ4 A;  2V9H A;  2JRI B;  1FXT B;  2KWD A;  2CHZ A;  1D4B A;  3L54 A;  3EFU A;  1D3Z A;  1ZDV A;  2SEB D;  2K1F A;  3B1L X;  3DVG Y;  3JYU A;  1T6B X;  3QAR A;  4LNF A;  4W9G A;  3AE1 B;  2RD0 A;  2KT7 A;  1L2N A;  2N9E B;  2IGG A;  4HJG E;  3PLV A;  1STE A;  4DHZ B; 
#chains in the Genus database with same CATH homology
 2WS3 B;  3SFE B;  1MI0 A;  4L2Y A;  1JWS D;  2Z8L A;  2V4I B;  4TMA B;  3BYT B;  1V1P A;  3AEF B;  3DWG C;  1MVK A;  2WXQ A;  2DWQ A;  2IJ0 A;  1FXI A;  4IDI A;  1SXT A;  2DBY A;  1EM7 A;  3KQ4 A;  1M4V A;  1UUP A;  1WGK A;  1K53 A;  3FIL B;  5G5H A;  4MAC A;  1T5X D;  1ZPS A;  2YEP B;  2LGI A;  3MC0 B;  4ZHP A;  2PKO A;  1XO3 A;  5FKA C;  4REZ A;  3VR9 B;  4YTN B;  1TS3 A;  4H2A A;  1ACC A;  1UWM A;  3KWL A;  1N63 A;  1FO4 A;  1HZ6 A;  4RGM A;  2KAC A;  2ON8 A;  1TS5 A;  2WQY B;  1QF6 A;  4RCO A;  1D5X C;  5T8I A;  5JXV A;  3IT6 B;  3PZ7 A;  1I4H A;  3RFZ B;  3E56 A;  1QOF A;  3Q8E A;  1SF0 A;  2QIE B;  3ZJV A;  3VRA B;  4WQM A;  1I7H A;  4XE0 A;  3URY A;  1FCL A;  2BS2 B;  2BB6 A;  2ZW1 A;  1N5X A;  2FE8 A;  1L6V A;  4ZRP A;  3P4P B;  2J53 A;  1XLQ A;  3AM9 A;  1PGB A;  4JWU C;  4P16 A;  4HKQ A;  2RMM A;  4KGR A;  4GDL B;  2BYT A;  1ZP0 B;  2NTS A;  2RPV A;  3AMZ A;  3BYY B;  1JWB D;  2JZP A;  4C7Z A;  4FXC A;  4A9A A;  1RM6 C;  3NS1 A;  5BMG A;  3H8H A;  3T3N A;  1YQ4 B;  5D3D A;  1V1P B;  2XN9 C;  3Q8F A;  1D5Z C;  2LEK A;  4J3O D;  1LO5 D;  1FFV A;  1Y56 A;  1GAQ B;  1FEH A;  1I4X A;  2NMQ A;  3VR8 B;  2TSS A;  3GP7 A;  1OFF A;  1QKZ A;  1JWM D;  2WDQ B;  1VLB A;  3Q69 A;  1IBX B;  1NVI D;  3TEX A;  3IT4 B;  2LFI A;  3PO0 A;  1MPE A;  1YNT E;  4UDU C;  1FXA A;  2BT6 A;  1TZO A;  2JYT A;  3B2F A;  1XCQ L;  3MP9 A;  4LTU A;  2LHE A;  3AEA B;  5H92 C;  1L5P A;  3W2D A;  4R3D A;  1ZXI A;  2DLB A;  4IOI E;  1FD6 A;  4RNA A;  1EU3 A;  4RF1 A;  3B2G A;  4L1B A;  1KRH A;  2JWU A;  1QT9 A;  5EE1 A;  5G5G A;  3AEE B;  3AV8 A;  4RGO S;  1CZP A;  2L32 A;  3U2S C;  1AW7 A;  3V05 A;  4NAW B;  1OQQ A;  3AEB B;  3AN1 A;  3AED B;  1KH0 A;  2BB5 A;  2IDY A;  1D6E C;  2IPK D;  1XCT L;  2WXH A;  3V3X A;  2K9X A;  3KLS X;  4A90 A;  1GB4 A;  1C76 A;  1L4D B;  3VQI A;  2K22 A;  1J7A A;  3AE3 B;  1YN3 A;  4DXF A;  2G9H D;  5HFY A;  2N7J A;  1FRR A;  2MJE A;  4HRS A;  2PVG C;  1C4C A;  1ZDX A;  2M56 B;  2MJD A;  3Q8C A;  2GI9 A;  1VZ6 A;  2PTL A;  1PUT A;  4KGS A;  2LMC A;  3C8Y A;  1P7F A;  2WLB A;  3AE6 B;  1ROE A;  1QLB B;  1JWA D;  2EKI A;  1NYQ A;  1NEK B;  3W5U B;  2JQR B;  2WXL A;  3R2T A;  2J4X A;  1KFY B;  3VRB B;  1F0Z A;  3AE7 B;  4WWM A;  1YJI A;  1NYR A;  1QOA A;  2VZK B;  4N59 A;  4C7Y A;  5EE0 A;  2H88 B;  3AEC B;  4TQ0 A;  1FMA D;  2R61 A;  3GB1 A;  1NI3 A;  1TS4 A;  2BS3 B;  5LNK 1;  2FUG 1;  3N9Y C;  3W9C B;  2KQ4 X;  5BYS A;  1JW9 D;  2CJO A;  2E6X A;  3EGR A;  1I4P A;  4AS1 A;  1XXG A;  3GS2 A;  1V8C A;  3CWI A;  3FIL A;  3UI3 A;  1N60 A;  1T3Q A;  3BWU D;  3OWE B;  1V97 A;  1N62 A;  4KGT A;  2WXP A;  4HEA 1;  3U7Z A;  5EE3 A;  1C4A A;  2VZK D;  1VJK A;  2BBC A;  1VRA B;  1SB3 C;  4JWS C;  4RGN A;  4ARC A;  4WIP A;  3HRD D;  5H8Y E;  4XWW A;  1TJE A;  1IGC A;  2PMV A;  3FC4 A;  3SFD B;  2WU2 B;  1TY0 A;  2W82 A;  3U4E G;  4ARI A;  4N58 A;  3TUO A;  3IXS A;  2N0S B;  4O1N A;  2J52 A;  3P4R B;  4YTP B;  1HXY D;  5BMH A;  2PW9 A;  1J7C A;  1N5W A;  3B9J A;  1XLP A;  2AQ3 B;  2ONQ A;  1D5M C;  1F2R I;  2I38 A;  2LHD A;  1KF6 B;  1P7E A;  5FR3 A;  2H89 B;  5FK9 C;  4LLG M;  3NRZ A;  4KX6 B;  3TEY A;  2JXT A;  4NZL B;  3BK2 A;  1Q10 A;  3Q8A A;  1L0V B;  2PIA A;  2GRI A;  4Q2J A;  1B1Z A;  2KAJ A;  1K50 A;  1L0Y B;  3I9V 1;  3NVV A;  1QOB A;  1WWT A;  2JX5 A;  2MH7 A;  3Q8B A;  3AE5 B;  1XEE A;  2SAK A;  5D7G A;  2IGD A;  4B0E A;  2KN4 A;  1F2R C;  1YN5 A;  1NEN B;  4NJC A;  1XLO A;  2WDV B;  4A8X C;  2RDH A;  5BYR A;  1IUE A;  1PFD A;  2J42 A;  1I4G A;  1WXQ A;  5C3J B;  1CQV A;  1ET9 A;  1N61 A;  4NAM A;  2V3N A;  1ET6 A;  2V3P A;  1ESF A;  3BVG A;  3U52 E;  1QIL A;  1OQR A;  3NVY A;  2N9K A;  4MM3 B;  4ZRQ A;  2Y5C A;  1IBX A;  4YT0 B;  1EWC A;  1CK1 A;  1EU4 A;  4A55 A;  2M0A A;  1JQ4 A;  4LK0 M;  1ZOY B;  4KKJ A;  1R7S A;  2ACZ B;  1JWU D;  1HEZ E;  3EA6 A;  2Q5W D;  4JX1 C;  4MH8 A;  1V1O A;  4YSY B;  3J9C A;  5TSS A;  1YN4 A;  1ENF A;  1SIJ A;  4TSS A;  1SJE D;  2WU5 B;  4WUR A;  2D5G A;  5GXG B;  1E6E B;  1PYW D;  3P1M A;  4M0W A;  3R8B A;  4CQN A;  1B9R A;  1RYJ A;  1XLN A;  3L4P A;  4OW0 A;  1SJH D;  4HKZ E;  4L23 A;  4C56 C;  1FNW A;  1VZ8 A;  4B0M A;  4RH6 A;  5HG2 A;  1AWD A;  2W54 A;  1TS2 A;  4XWT A;  1CJE A;  2INP E;  2JYE A;  1WRI A;  3AE9 B;  1WSP A;  1WYG A;  3AH7 A;  3W1S A;  4EE2 A;  2WXF A;  2WXN A;  2ZW0 A;  3AEG B;  3AE8 B;  2V0G A;  1I4Q A;  1TKE A;  2XNA C;  2WXO A;  2X38 A;  1A70 A;  2L52 A;  3ZYY X;  3ABV B;  2Y5P A;  1JCK B;  1SE2 A;  4A6Q A;  3LYY A;  4RF0 A;  2K0P A;  2DYO A;  2G1E A;  4YWG G;  2E3T A;  1VR9 A;  3NVW A;  2PLP A;  4TQ1 A;  4YSZ B;  1J7B A;  1C78 A;  1BML C;  1SE4 A;  1UGJ A;  2ICI A;  2BS4 B;  1JRP A;  3HVZ A;  3BII D;  1KLG D;  4WAF A;  2JSV X;  3BVM A;  3MHZ A;  2CU3 A;  1YQ3 B;  2W55 A;  2HTM E;  3KWV A;  4P6V F;  4YSX B;  3NUH B;  1L6U A;  2CJN A;  1FNV A;  4C80 A;  1DOX A;  1BUI C;  1DOY A;  2Y3A A;  1FCC C;  1TKY A;  2YEP F;  5MPO A;  2EEL A;  1ZUD 2;  3AE2 B;  2INN E;  3SEB A;  5BYQ A;  4PT5 A;  1MHX A;  1JRO A;  1AYF A;  3P42 A;  1IGD A;  1TYG B;  1SBB B;  2AQ2 B;  2HDE A;  2WXI A;  3CIR B;  1QQR A;  3TEZ A;  4WH4 A;  2IGH A;  1TKG A;  2LUM A;  2W3S A;  4US9 A;  1FM0 D;  2L83 A;  1HQR D;  2WDR B;  1VZ7 A;  1E0Z A;  4D2K A;  1C77 A;  1DOI A;  3I57 A;  4OVZ A;  2WXM A;  4OZA A;  4JE3 B;  1YMH E;  2KMM A;  1SE3 A;  1DGJ A;  5AUK A;  4N6E B;  4OZC A;  4ZHO A;  4ITK A;  3MFG A;  3AE4 B;  1GB1 A;  2QIL A;  1E7P B;  3BK1 A;  4XDD A;  1KLU D;  1E10 A;  4ZYS A;  3BZD B;  3W5V B;  1PGA A;  2BW2 A;  3SR6 A;  1PDX A;  2I2Y A;  1K52 A;  3ZJU A;  3NZ3 A;  5HHD G;  3TSS A;  2KDM A;  2FBW B;  1RFK A;  2W3R A;  3BVZ A;  3NVZ A;  3LB8 C;  5C2T B;  4US8 A;  3T3O A;  3IAM 1;  2QEJ C;  1TY2 A;  4DQO C;  1K51 A;  1AN8 A;  1RWS A;  1C79 A;  1EWY C;  2M19 A;  4DXG A;  1JAL A;  1FRD A;  3R2I A;  5HI1 A;  3IAS 1;  3ZJT A;  4ZOH C;  1YJJ A;  1GPX A;  2QJL A;  2MEK A;  4YXD B;  1DYQ A;  1PGX A;  4IKG A;  5I4D A;  1UNS A;  4KKI A;  4XDC A;  2WXK A;  3AB5 A;  3HVD A;  2N9L A;  4YTM B;  2WXJ A;  2L1A A;  2JU6 X;  1ZXH A;  1KTK A;  5E6J A;  2WNM A;  2B76 B;  5D3I B;  3ZGZ A;  1HZ5 A;  1ZE3 D;  4GLS C;  4AQ7 A;  3P4Q B;  4MT5 A;  1F77 A;  4HRO A;  4OZB A;  4OHJ A;  1C4P A;  1SSN A;  1VDV A;  2AQ1 B;  1JML A;  4JPS A;  1HA5 A;  3MJ5 A;  3PZ8 A;  5BMI A;  2AX5 A;  2DYM A;  3HUI A;  2NTT A;  1MHH E;  3P4S B;  3P63 A;  3EUB 2;  2BTE A;  2QSD A;  2LJI A;  2QMT A;  2WXG A;  3TEW A;  5EE9 A;  3O13 A;  3ZQ4 A;  2WP9 B;  3ETR A;  2OED A;  4RFB A;  4RGT A;  2KWD A;  5AUI A;  1D4B A;  2K5P A;  1L0X B;  1FIQ A;  1ZDV A;  2MJ3 A;  1FFU A;  2SEB D;  1I4R A;  2K3U A;  1FNU A;  1GOZ A;  2OHF A;  1C9F A;  3RPF C;  1SEB D;  4USA A;  1T6B X;  3DWM A;  3E9S A;  4GDK B;  2PVO D;  1UWX A;  3FAH A;  3AE1 B;  1QOG A;  2GB1 A;  1BXT A;  2WXR A;  1E9M A;  1L4Z B;  2IGG A;  1XF5 L;  2RDG A;  4HJG E;  3LXF A;  3WCQ A;  1STE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...