3P1MA

Crystal structure of human ferredoxin-1 (fdx1) in complex with iron-sulfur cluster
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
b'KITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTSAENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenodoxin, mitochondrial
publication title Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster
rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 30
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p1mA00
1N63A 1FM0D 1PFDA 2L52A 2CU3A 1ZP0B 3AE1B 1FRDA 3FAHA 1A70A 3NVWA 4KX6B 2H88B 1TKEA 3LXFA 3SFDB 1YJIA 2MH7A 3AEFB 1VDVA 2W54A 1OQQA 2KAJA 1YJJA 1WRIA 3DWMA 1WWTA 1YQ3B 1FXAA 4USAA 1E6EB 2M19A 1J7BA 3P4PB 3AN1A 1L6UA 3AE7B 3AH7A 1RM6C 1J7CA 3AMZA 1JRPA 2M56B 3AEDB 2K9XA 3NVYA 2N0SB 5AUIA 3VRAB 1E9MA 1PUTA 1FIQA 1EWYC 1XO3A 3P4SB 4N58A 1E7PB 4WWMA 3W5UB 4ZHOA 1GAQB 2L83A 3KWLA 2ACZB 3VRBB 5C3JB 1VLBA 1ZUD2 3B2FA 4US9A 4YSYB 1PDXA 5AUKA 3SR6A 1SIJA 1RYJA 3W9CB 1E10A 1JWAD 3AV8A 3AEAB 1J7AA 3EUB2 5GXGB 2WU5B 1QT9A 1T3QA 3AE4B 4JWSC 4C7YA 3VR9B 1N5WA 3PO0A 2W3RA 1AWDA 2KMMA 4N6EB 2WDVB 3AEEB 1DGJA 3AE9B 3BIID 2PVGC 4ZOHC 3RPFC 4C7ZA 5C2TB 3AEBB 4A9AA 2MJDA 5G5GA 1TJEA 1QOBA 1XLOA 2WP9B 2G1EA 2QIEB 1I7HA 1OFFA 3LB8C 1IUEA 5H8YE 1XLQA 3CIRB 5EE0A 2WS3B 4YXDB 3L4PA 4YTMB 1VJKA 2Y5CA 1NI3A 3AE5B 1N61A 1NYRA 4WQMA 1SF0A 1CJEA 2W3SA 1QOFA 1N62A 2PVOD 2Q5WD 3B2GA 3P63A 5MPOA 1SB3C 1KF6B 1N5XA 2CJNA 2BS3B 1QOAA 4JWUC 1L0VB 3WCQA 4C80A 3NRZA 2JX5A 2WLBA 1TYGB 1WGKA 3HVZA 3NVVA 1QF6A 2WDQB 2DBYA 5H92C 1OQRA 2OHFA 1L6VA 3ETRA 1WYGA 1TKGA 1UWMA 1FFVA 4ITKA 1KRHA 2EKIA 1E0ZA 4YSXB 4N59A 3W5VB 1KFYB 2WDRB 1JROA 3AE8B 1B9RA 5EE3A 3FC4A 3SFEB 2MJEA 2E3TA 1ZXIA 4HROA 4YTPB 4JX1C 1TKYA 4IDIA 1JQ4A 2FBWB 1JALA 1NENB 3HRDD 5EE9A 1NEKB 3VR8B 3P4RB 2JQRB 1AYFA 1RFKA 1FO4A 3P1MA 1GPXA 1FFUA 2AX5A 4US8A 2H89B 4HRSA 3AECB 1ZOYB 2BT6A 3NS1A 4YTNB 3AE3B 1DOYA 5G5HA 4ZHPA 1WXQA 2LEKA 3NVZA 3DWGC 1FMAD 2DWQA 1ROEA 1QLBB 2PIAA 1DOIA 1V97A 3ZYYX 4YSZB 1JWBD 2K22A 2W55A 1F0ZA 3AEGB 1XLNA 1YQ4B 1N60A 1XLPA 2QJLA 2WU2B 2PKOA 3HUIA 5EE1A 1RWSA 1QOGA 2BS2B 3P4QB 1DOXA 1V8CA 4LTUA 2MJ3A 4YT0B 3B9JA 2BS4B 3ABVB 3AB5A 2B76B 1FXIA 1FRRA 2WQYB 1NVID 2CJOA 1JW9D 2HTME 3AM9A 4FXCA 2K5PA 1CZPA 3AE6B 3CWIA 3AE2B 4P6VF 1L5PA 1NYQA 1R7SA
chains in the Genus database with same CATH superfamily
3PZ7A 2L0FA 3NVWA 3NG0A 4REZA 3X23A 1YN3A 1FCCC 1IYFA 3BVGA 1GJZA 1E6EB 5D3DA 1WR1A 4FJZA 2M56B 3N9YC 4HJKA 4N58A 3ZNHB 3B08A 2L83A 3U30A 2N7EA 4NAWA 4YL8A 1QZEA 2L76A 3B2FA 3PPAA 1QILA 4MGZE 3KYCD 2MWSB 3E9SA 1QT9A 4K3BA 2X38A 4FHJA 1DGJA 5IN7A 3DVGX 1QOBA 1F2RC 4ZRIA 3JVZX 2LVOA 1Z5SB 4WQMA 1SF0A 1KF6B 1MHXA 1NI2A 1Q5WB 3B1LX 4F7ZA 2GI9A 2C7HA 2MX2A 2KWDA 3TEWA 1YN4A 1MVKA 3IHPC 2WXFA 1P7FA 2FCMA 2EKEC 3MC9A 2M8SA 3O13A 1TKYA 2INDC 2ZPNA 1NENB 2GBRA 4RMAA 3VVWB 4WJPA 2INNE 3H7SA 1P3QU 2LD9A 3AECB 3PZ8A 2NPTA 1WGGA 2RPQA 5G55A 1E90A 3U7ZA 3ZYYX 1JWBD 1RFAA 2K22A 1MG4A 1YQ4B 1XLPA 2QJLA 4LK0M 4M0WA 2KDMA 2W82A 2IO3B 3QAQA 4G11A 3EA6A 3BINA 3ZDMC 2BS4B 1V9JA 3NHEB 4I6PA 4BKGA 2Y3AA 5IP4D 3CWIA 1P98A 4G3XB 3EFUA 2D3GA 4EZLA 5LLIA 2MH7A 4I6LB 4RGNA 2CR5A 1WX7A 3DVNU 1WSPA 2JSVX 3MHSD 1I4RA 4S0RA 1J7CA 3VRAB 1TGZB 4XE0A 5AUIA 5TSSA 3R2IA 4RM8A 4W9FA 2BB5A 2IZVB 2FAZA 3DOWA 3CMMB 1KLVA 2MP2A 4DXAB 3KH0A 3RPFC 2IO1B 2KC2A 3WA0A 2KDFB 2NPTB 2K6QA 3KWVA 4XWWA 1HEZE 3L4PA 2WXMA 5DPTA 3N1XC 1QOFA 3PGEA 1QOAA 4B95A 3V3XA 2WHIA 2KNBA 2JY6A 3ETRA 1HZ6A 4HVBA 1TKGA 3Q3OC 5JH5C 2LVPA 3U4EG 4ZRPA 4C4VB 5HFYA 1JQ4A 5EE9A 1UGJA 2L7RA 4WJQA 3Q14C 1DOYA 1JWSD 1FMAD 3JYUA 1C79A 2OJWA 3EHVA 2QDFA 2C60A 4MSMB 1V8CA 2JZZA 2KYWA 2B76B 2WQYB 1HE8A 3AM9A 2V3SA 3AE6B 2XEWA 3OAWA 2SAKA 3MC0B 1WM3A 3FAHA 3T3OA 5IOIA 3OWEB 3R2TA 2VH1A 3WANA 2Y5BB 1RM6C 1EF5A 1WXVA 1YJ1A 4NY0A 3VUWA 3ZRFA 3NS8A 1FD6A 4OHJA 1TY0A 1PDXA 1WGDA 1UUPA 2C5LC 5CHVC 3K9OB 3OG5A 1LQBA 1SJED 4M00A 5HKHA 1WGHA 3Q8AA 3HM6X 3L13A 3FILB 4C7ZA 3R66C 4IM3A 3BY4B 4L2YA 2N7JA 1RLFA 4P7IA 4HWIB 4YXDB 1A5RA 4RGTA 1NI3A 1ZW7A 5CX3A 4ZRJA 2ICIA 2BS3B 4TMAB 1RRBA 1WH3A 2LFIA 3ZXRA 2KJHB 4EUTA 4IWQA 5CTRC 5C1ZA 4N59A 2VZKB 1FNVA 3R7QA 2AYOB 1R4NI 1VZ7A 4AQ7A 1S1QB 5BMGA 1WMHA 5D2MB 5AEKB 2PPHA 2IBIB 2AEHA 2MEKA 3W1YA 1T0SC 3VDZA 3ML9A 3IBEA 3NS1A 3BVZA 4AP4C 3NVZA 1WRDB 1I4GA 2M0AA 2LXCA 4KKIA 3PVLA 2V4IB 4K7UA 5D3IB 3UI3A 4LTUA 3DHGC 2IGHA 3RD2A 1LFDA 4M02A 1FM0D 1AN8A 2DYBA 2PEAA 2BWES 3GZNB 3L08A 3V61A 4L23A 5BMHA 3RT3B 3CSTA 1EWYC 1XO3A 1TS4A 4MSQB 5DPWA 2J4XA 2ZW0A 1R4MB 2WXRA 1C78A 4MGKE 1FXTB 1JWAD 5GXGB 2WU5B 1T3QA 1WMHB 4TQ1A 1AWDA 2KQ4X 3VQIA 3UF8A 3PLUA 3GE8C 4A9AA 2MJDA 4MEMA 5G5GA 1I42A 1XEEA 2WP9B 3QJZA 2INPE 1XLQA 2LJIA 3TEXA 3C0RB 4CYEA 3R3MA 3A4SC 2OOBB 3NUHB 4ANWA 1JWUD 1NYRA 2W3SA 3Q3JA 1ZXHA 2I2YA 1N5XA 3E56A 1Q1OA 3PLVA 4RGMA 3NVVA 1QF6A 2LUMA 2WXIA 2R2QA 3PRZA 2YLMA 3L17A 3H6NA 1BXTA 3KLSX 3W5VB 3Q3MC 2JXTA 2XK5A 3W1SC 4HROA 5CHWA 4E74A 2D5GA 3P1MA 4FBJB 3ZJTA 1TZ1A 1WJ6A 4IWOA 2LEKA 4H2AA 4A3OA 1E8WA 4URKA 3U8ZA 1FCLA 4DBGA 3R7RA 4DHZB 1F77A 3RNEC 3QC8B 3IXSA 4ACFA 3DBRI 3I5JC 1EO6A 2ZNVB 5C23A 4FXCA 3A1QB 3TCAA 3SEBA 1NYQA 4FJVB 1R7SA 3A4RA 3OJ4B 4HPMB 3AULA 2O6VA 2RDHA 4P16A 2KLCA 4XZ4A 1VDVA 1KOTA 1E7UA 1YJJA 1WRIA 3OLMD 2FCNA 2N4FA 2DENB 3AMZA 4HXDA 1AW7A 1YMHE 3TUOA 1HXYD 3WAMA 3P4SB 3U52E 3BYTB 2ZCCA 4PS8A 1VLBA 1ET9A 3ALBA 1WX8A 4ICUA 2XK5B 1KH0A 3VR9B 3PO0A 2JWZA 2LASA 2KQSA 4TKNA 5D7GA 2N9XA 4NZLB 1IUEA 1V1PB 3CIRB 4E3CA 4GXBA 2Z8LA 1SB3C 5JXVA 2V4LA 4JWUC 1XCQL 2IO0B 3AXCA 3QK0A 3M62B 2N1VA 2KFJA 1P9DU 3I63C 2E6XA 2ON8A 2PE6B 3DVNV 4HPLB 1EM7A 1WE7A 2EMSA 2MSED 1V49A 1GUAB 2KWCA 1XF5L 4B6WA 1VZ6A 2R2OA 2DZIA 4KGRA 3H1UA 1LO5D 2AL3A 3DQVA 1AYFA 4XYCA 1FFUA 2D11A 2QEJC 2G9HD 3H9DA 2RDBC 3L54A 4BOZB 3UQAA 4KVGB 1WE6A 4XDDA 2V3NA 2B3AA 3KVFB 1FRRA 2A4ZA 2AQ3B 1BUIC 4ARCA 4RFBA 1PFDA 3ECIA 1ZP0B 1ZDXA 5J17A 4DQOC 1YJIA 3N1YC 4MACA 1FXAA 1OTRB 1GB4A 5DCNA 2EELA 3AEDB 1TS2A 4RCOA 1E9MA 2DNFA 1E7PB 2MLBA 2VZKD 2JRIB 4PYUA 1E10A 3DPDA 1N5WA 2PE9A 1Q0WB 4A8XC 1TS5A 3NOBA 2NBVB 2LWPA 4B0EA 1SEBD 3C19A 2J0MA 3DHHC 5BYSA 2G1EA 1E7VA 4HDOA 2Y5PA 2Y5CA 3X0WA 3P63A 2L1AA 3MFGA 2JYTA 3WCQA 1TYGB 1SJHD 3TIXA 1L6VA 2G4SA 4TUUA 4ANUA 1KM7A 1UWMA 3Q8EA 1HTOA 1UELA 1C1YB 1YNTE 3RNFC 2HE7A 4XWTA 1K8RB 5EE3A 4FLHA 2HTHA 1LM8B 3ZXVA 2CHXA 2FBWB 1H4RA 4OZBA 4ZYNA 1C76A 1ENFA 2BT6A 5IO9A 1E8XA 3V60A 4AOFA 4ZHPA 3DWGC 1QLBB 2PJHA 2BVCA 3A9KB 2VRRB 3RCZA 1NBFC 4MM3B 4W9HA 3AEGB 1D5MC 2N9KA 3DBHI 3RUIB 2JT4B 5D6JB 3P4QB 2BKRB 1YOVB 1GC7A 2YEPF 2K3UA 4WWOA 4AWJA 1WR6E 1L5PA 3EGRA 1STEA 4HJGE 3AE1B 1P0RA 1OGWA 4KX6B 4W9GA 4ANXA 4HCNB 1WXMA 1OQQA 2DZKA 1YQ3B 1LXDA 2JVCA 3N30A 3AN1A 4MGYE 4LNKA 4RH6A 2OJRA 2HJ8A 1ZGUB 2ZJDA 5LNK1 2JXXA 4US9A 2O2VA 3SR6A 1B1ZA 4F1SA 3J9CA 1CMXB 4DXGA 1JWMD 2MCNB 2MBEA 4C4VA 3RZFA 4OVVA 5HG2A 3MJ5A 4A55A 3T3NA 3IAM1 2QIEB 3TEYA 1VD2A 4YTMB 3VTUA 3RN9C 2MRPA 2LGDA 2PVOD 1N62A 1SXTA 4GDKA 2FUG1 1SGHA 4ZDVA 1IBXB 2DHZA 4UDUC 2JX5A 4ZRQA 2WDQB 2DBYA 3QQ8B 2LVQA 3ZNGC 2CS4A 2BYVE 2BYFA 4OVZA 4K1RB 2JUOA 3VAWA 2DAFA 4RF1A 2LJ5A 3W9CB 2AL6A 2JPHA 2KD0A 1FO4A 2JQRB 3N20C 1RFKA 3N3KB 2NTSA 5G5HA 1J19A 1V97A 1PGAA 3TSSA 1F0ZA 5GMVA 2O2VB 2AQ1B 2WU2B 1WXSA 4PK1A 2MJ3A 3AI5A 1L7YA 4NNJB 2KX3A 2CJOA 1CZPA 3RULA 4FADA 1YX5B 1Z2MA 2WYQA 3FILA 4EKUA 2JYEA 1TY2A 3VH4B 2K8CA 1T0RC 3IFWB 3LYYA 3Q6BA 4GDKB 3P4PB 4GDLB 3NVYA 4MELA 1P1AA 2O6VD 2YVCA 4HK2A 5BYQA 3VRBB 1VRAB 4W9IA 4BFRA 5E6OA 2WX1A 3AEAB 4LDTB 4JGHB 3M95A 2KHWB 2DX5B 5DPSA 2IO2B 3RNCC 2MBQA 5TR5A 2Z0DB 4NJ6A 1RAXA 1WGRA 5IAAC 3W1SA 1UH6A 3QX1A 1SE2A 2IDYA 1WGYA 4BKTA 1CK1A 3Q8CA 3S2AA 4KDIC 2PMVA 1HQRD 1ET6A 1WYGA 1D6EC 2YEPB 1PQSA 3KW5B 3PV1A 4GMVA 2W9NA 2FNJB 4N9F4 4OZCA 4K3CA 2LI5A 1D3ZA 1F9JA 3QARA 1T0QC 2M17A 5HI1A 3KQ4A 2DWQA 2LZ6A 3V6CB 1V5TA 1MHHE 2TSSA 4JL9A 3ENEA 3VUYA 4WJNA 4FA6A 2K6DB 4XDCA 3DVGY 2KDBA 3ZJVA 1NVID 1JW9D 2KKCA 3RZWC 3VH3B 2JWUA 4LNIA 3KUZA 1UBQA 3SU8X 1JRUA 1L0YB 3BWUD 3R8BA 4CO7A 1IGCA 3N1ZC 3AH7A 2WXHA 1KJTA 2Z59B 4IUMB 2KVZA 1GAQB 2X8XX 1M4VA 2HDEA 4J3OD 1K50A 3ZDTA 1J8CA 2FE8A 4DDGD 3AV8A 3HM3A 4JIOU 2FCQA 4IG7B 1WJUA 4ARIA 4ZRKA 3AEEB 2G4DB 1I35A 4KSLC 4D2KA 2M4NA 3H8HA 2KWUB 3L0WB 4TV3A 3A9JA 3NZSA 3B2GA 3RI7C 4JQWC 2D2QA 1SE3A 3NZUA 2KANA 2K0PA 3NRZA 2WXKA 5KHOA 1FPYA 3UINB 4WAFA 3DBLI 4Q2JA 5FR3A 3Q8FA 2IY0B 3A1QA 3AE8B 4XC2A 3RFZB 2PTLA 3RYTA 4E71A 1XQQA 4ICVA 2VH2A 1JMLA 1UZXB 1EWCA 3FKYA 3Q3NC 4US8A 4RNAA 2V9HA 1WXAA 1PYWD 1FEHA 4AJYB 3AE3B 3ML8A 1XCTL 3UIOB 2LGXA 2ZVOA 1P7EA 2M0XA 2ZVNA 5IA7A 1UGMA 2KJ6A 1HTQA 2CHZA 3TEZA 4LJPB 4IM0A 1L4DB 2GBJA 2J7QB 3ABVB 3IT6B 4RF0A 3UQBA 2HD5B 3GP7A 3C8YA 3P4RB 3V6EB 1C9FA 2PW9A 4TQ0A 1A70A 3A9JB 2H88B 5EDSA 2QILA 2RMMA 4IWPA 4GU2A 1V1PA 3K9PB 4PS3A 3Q3FA 4F8CB 1PUTA 3ZNID 3BK1A 1ZKHA 3B0AA 4LCDE 3VUXA 4HEA1 2KT7A 1D5ZC 4PYZA 1ZUD2 1SIJA 1RYJA 2DLBA 1EU3A 3EECA 3AE4B 4JWSC 4KZCA 1GOZA 1K51A 3NJTA 4FULA 2NVUI 2V0GA 2QSDA 2KJRA 1WZ0A 1TBEA 3DBSA 3TJPA 2BYTA 2WS3B 2NR2A 4DWFA 1E8YA 1KLUD 2Q5WD 2JZ3B 3DHIC 1WJ4A 2CJNA 1NDDA 3GE3C 2JF5A 3ZNZB 3HIZA 2BBCA 1X1MA 2RPVA 1MJDA 4HLEA 2KVRA 3I3TB 4ITKA 1KRHA 1AARA 4YSXB 4WIPA 5I4DA 4W9CA 4ZYSA 1B9RA 4GIVA 1G6JA 3LDZE 2NBWB 1C4CA 2E3TA 4PS7A 3ZTDA 1IP9A 4YTPB 1ISNA 2KN4A 4O1NA 4K81A 4G0NB 1NEKB 2BWFA 5E6NA 4KZ0A 1WXQA 1UD7A 3BVMA 4EZJA 1YX6B 3W2DA 3PHXB 4C00A 4IOIE 2K1FA 4IKGA 3HUIA 1XT9B 4FN2A 3QA8A 5EE1A 2J0KA 3JSVB 2LHDA 2K8HA 3I57A 4W9KA 1R4NB 4DHJB 2DAJA 4BBNC 1TS3A 1IGDA 1N63A 2CU3A 1TKEA 4M01A 3GS2A 1EU4A 3APFA 1WF9A 1JCKB 1EF1A 2KLGA 3DWMA 2IYDB 4KGSA 2KQ7A 1F52A 2GRIA 2ONQA 3L10B 3UGBB 2UWQA 1FIQA 4HCPB 4W9JA 4WWMA 2J0JA 2L3ZA 3HHMA 2NCNA 2ACZB 1C4AA 2WDTB 1T6BX 3LJ3A 4EZKA 5JZEB 2KTRA 3V05A 2KMMA 2GLSA 1XXGA 2V3PA 4KIKA 1XLOA 4MGIE 1OFFA 4S17A 4M8MA 1VJKA 5JHAA 2J42A 5J2RA 4W9DA 1N61A 3A9KA 2Z0EB 4MM3A 1T5XD 3KYDD 4I6NB 1WGKA 1WJNA 1VZ8A 5H92C 2OHFA 1KLGD 1I4PA 1KFYB 4TSSA 4NQLB 3RNBC 2C7NB 1WM2A 3TMPB 1TZOA 3ONSA 3VR8B 5FKAC 3QIJA 1H8CA 2BKFA 1GG3A 4HPPA 4MDKE 2W55A 2MHJA 1S3SG 4W9EA 2ZCBA 3TL5A 3KUCB 4OZAA 4YT0B 4X57B 2KTRB 4II3B 3ZRCA 3DCGA 2KFKA 4KIKB 4P6VF 3MP9A 1ESFA 1BMLC 5LXIB 4RM9A 3ZO5B 2DYOA 4PT5A 3LXFA 5FR6A 2LUEA 4LNOA 2WXPA 4LLGM 1GC6A 2K8BA 2G45B 2RDGA 1WWTA 2RR9A 1MPEA 1L6UA 4G50A 4ANVA 1VCBA 3HK0A 1IBXA 2N9PC 5BMIA 4EOYA 2LGYA 3DBRB 1GB1A 2KN5A 2UYZB 5C3JB 3APDA 3IAS1 4QAYA 3OJ3A 5BYRA 2FCSA 2KTFA 1K53A 1V5OA 2BQQA 3M3JA 2IGDA 2IY1B 2NS5A 5C2TB 2JZPA 1I7HA 2QC8A 2AQ2B 2WNMA 2BYEA 2IGGA 1CJEA 4FJYA 1OQRA 1U4AA 2KFKB 4NAWB 1L0XB 3AU4A 2EKIA 5KHQA 3ZLZA 4BVUC 2WXNA 1WYWB 1ZXIA 2KX0A 4P1CC 4DXFA 4WH4A 2UU7A 3SHQA 1E8ZA 2H89B 2KACA 4GDLA 5AZGA 4OVUA 2RD0A 3GZNI 1DOIA 4GOCA 4YSZB 1FNUA 3TBLD 1XLNA 2WXLA 3Q2AC 4KKJA 1OQYA 2PKOA 1QOGA 4K7WA 3B9JA 2BGFA 3AB5A 2C9WB 3WALA 1FXIA 2GOWA 1R4MI 4A20A 3ZIMA 1SE9A 2K5PA 2WXQA 2NBUA 1I4XA 2I1JA 2L52A 1TT5B 1FRDA 2KXJA 3QHTA 4W9LA 4DHZE 3SFDB 2PLPA 2J53A 2KAJA 3IG3A 1PGXA 4USAA 2M19A 5BO4B 3T9LA 2R61A 4HKQA 1HA5A 1EUVB 2K9XA 2N0SB 1VR9A 3KWLA 4M0WB 2FUHB 4EEWA 1OEYA 3DDCB 2NMQA 4DDID 1L4ZB 4A6QA 3ZGZA 3BK2A 2GMIC 1UWXA 1ACCA 4WJOA 3APCA 4BKSA 4N6EB 1HZ5A 2WDVB 3RNAC 3AE9B 2PVGC 2N9EB 2AWTA 2MQJA 5HHDG 2C7MB 1GNUA 4B0MA 3I9V1 4DK5A 1XD3B 2K25A 2GB1A 2XBBC 3MTNB 2WXOA 4CHKA 1UNSA 3L16A 2ZEQA 1J0GA 4NQKE 3IT4B 3HVZA 2ZW1A 2BW2A 4DHJD 4KGTA 3ZUNA 2BF8B 2RGFA 2N9LA 2WDRB 2K39A 1C3TA 2BB6A 4BBNF 2EMTA 1IPGA 2GBKA 2MP2B 2G3QB 1TTNA 4YWGG 1JALA 2WGSA 3HRDD 1WZ3A 4GSWA 2LXAA 2LGSA 1ZOYB 4WQOB 4GLSC 1ROEA 5FK9C 2WX0A 2L00B 2BPSA 1N60A 3EFCA 1UBIA 5L83A 4M8NA 1DYQA 4B9KA 5JHBA 1DOXA 1WX9A 2MW5A 2HJ1A 5G2NA 1QQRA 1CQVA 5T8IA 2KMCA 2XNAC 4CQNA 3VXWA 5L95C 2DZJA 1V1OA 3AEFB 4L1BA 3ZQ4A 4LNNA 3SD5A 4K7SA 2LRWA 4MH8A 3AE7B 3A33B 2LGIA 3DBHB 3VTVA 4ZHOA 3IVFA 1WI0A 1V80A 2RSUA 4BAXA 5IKCM 3EUB2 4BOSC 3GB1A 4GN1A 3BIID 1WIAA 2D07B 4KV2A 4EFOA 1TJEA 5LXHA 2L05A 3URYA 3LB8C 5H8YE 1F1HA 2KO3A 2JRHA 1YD8U 4C56C 1WFYA 3AE5B 1F2RI 4MT5A 2D3BA 4C80A 1LGRA 2WLBA 2KWVB 1V81A 4KDLB 3Q69A 2D10A 4IW0A 1V6EA 2I38A 3H7PA 1C77A 2MBBB 1L2NA 2D3CA 1Q10A 4HKZE 4WURA 1ZDVA 4NAMA 1V2YA 3FC4A 4JLCA 2MJEA 4IDIA 5MPOA 3PRPB 4NPNA 2NTTA 1ZE3D 4YTNB 3MJWA 3PREA 3O65B 3NZ3A 3WAPA 2JU6X 2PIAA 4JPSA 4AUQC 2L32A 3P42A 3RMKC 4AS1A 4KSKC 3PZDA 1MG8A 3AE2B 1D5XC 3M63B 2KDIA 4BZAA 3VHTC 2W54A 1ZPSA 4EE2A 2SEBD 3MHZA 1J7BA 2WXJA 2N1WA 1Y56A 3ZKJC 3NY5A 2CKHB 4R3DA 2IJ0A 3H7PB 5AUKA 3ZJUA 2BTEA 1J7AA 4C7YA 3BYYB 2I1KA 2W3RA 4XX5A 2ZPYA 4ZOHC 2ASQA 2J52A 5AZHA 2L0TA 2D3AA 3QCAA 3D32A 3WAOA 5EE0A 2INCC 2REXA 1OEYJ 5AZFA 2L8JA 2KK8A 2M1MA 5CHFA 1L0VB 2KDEB 2ZZPB 3UIPB 3JSVA 1V86A 3ZW3A 1FFVA 1E0ZA 2QCZA 4XGAB 1K52A 3SDLC 1JROA 2MA9B 4OW0A 4II2B 4AJWA 1FNWA 1N6ZA 5D94A 4JX1C 3CSFA 4ASWC 1YIWA 1YQBA 2N7DA 1GPXA 3PT2B 3RNGC 5E6JA 1MI0A 2XN9C 1SIFA 4NJ7A 3ZVVA 3PS6A 4WAAA 3N32A 4MJSA 3T8MA 2IPKD 2A5UA 1QKZA 2MBOA 2BS2B 2WWZA 3GOEA 2WXGA 1UF0A 2FIFA 3KUDB 4MH0E 4P1BC 3V62A 1KTKA 3MC8A 1MFWA 4WWPA 4GGQA 4LDTD 4J6IA 1JRPA 1BT0A 4RGOS 3W5UB 1T0YA 2GBMA 4YSYB 3VFKA 2LRUA 3QWZB 2QHOA 3CF6E 3JW0X 1PGBA 4FHKA 2KC1A 5E6PA 3U2SC 2KOXA 4IM2A 3ZTCA 2MBHA 2O6VB 1M94A 3AEBB 2LHEA 4GB9A 2CHWA 3Q8BA 5DPRA 1I4HA 2KMAA 4MJSB 3VTWA 2FIDA 1TIFA 1WY8A 2OEDA 2V1YA 4BKSD 2DYMA 3PTFC 1D4BA 2QMTA 2ZNVC 4WWNA 1C4PA 3SFEB 5J18A 3P2BA 4LNFA 4HDQA 2KZRA 2GBNA 1E5WA 2AX5A 4HRSA 3AU5A 3PHWB 4LJOB 3WIMA 4NJCA 3EC8A 3PRMB 3PSEB 2LMCA 4JE3B 3U7DA 1SSNA 3DBLB 1SBBB 4IC7B 1I4QA 2DZMA 3HVDA 1RWSA 3BZDB 4A3PA 1SE4A 4A90A 1Y8RC 2HTME 1YN5A 2CU1A
chains in the Genus database with same CATH topology
2L52A 3PZ7A 1FRDA 3NVWA 2RDHA 4REZA 4P16A 3SFDB 1YN3A 1FCCC 1VDVA 2PLPA 2J53A 2KAJA 1L0YB 1YJJA 3BWUD 1WRIA 3BVGA 3R8BA 1PGXA 1IGCA 4USAA 1E6EB 2M19A 5D3DA 2R61A 4HKQA 1HA5A 3AH7A 3AMZA 1AW7A 1YMHE 2M56B 2K9XA 3N9YC 2N0SB 1HXYD 2WXHA 1VR9A 3TUOA 3P4SB 4N58A 3U52E 1GAQB 2L83A 1M4VA 3BYTB 3KWLA 2HDEA 4J3OD 1VLBA 1ET9A 1K50A 3B2FA 2NMQA 1QILA 2FE8A 1L4ZB 4A6QA 3AV8A 3ZGZA 3BK2A 3E9SA 1QT9A 1KH0A 1UWXA 1ACCA 3VR9B 2X38A 3PO0A 4ARIA 4N6EB 1HZ5A 2WDVB 3AEEB 1DGJA 3AE9B 2PVGC 5HHDG 4D2KA 5D7GA 1QOBA 3H8HA 1F2RC 4NZLB 3I9V1 4B0MA 1IUEA 1V1PB 3CIRB 2GB1A 2Z8LA 4WQMA 1SF0A 3B2GA 1KF6B 1SB3C 2WXOA 5JXVA 1MHXA 1UNSA 1SE3A 4JWUC 2K0PA 3NRZA 2WXKA 3IT4B 2GI9A 1XCQL 2ZW1A 2BW2A 3HVZA 4WAFA 4Q2JA 5FR3A 2KWDA 2E6XA 2ON8A 3Q8FA 4KGTA 3TEWA 1EM7A 1YN4A 2N9LA 1MVKA 2WDRB 3AE8B 2BB6A 2WXFA 3RFZB 1P7FA 1XF5L 2PTLA 1VZ6A 4KGRA 1LO5D 3O13A 1JMLA 1TKYA 4YWGG 1JALA 1EWCA 1NENB 3HRDD 1AYFA 1FFUA 4US8A 4RNAA 2INNE 3AECB 1ZOYB 2QEJC 1PYWD 1FEHA 3PZ8A 3AE3B 2G9HD 1XCTL 3U7ZA 1P7EA 1ROEA 4GLSC 3ZYYX 5FK9C 1JWBD 2K22A 1YQ4B 3TEZA 1N60A 1XLPA 2QJLA 4LK0M 4M0WA 2KDMA 2W82A 4XDDA 2V3NA 1DYQA 1DOXA 3EA6A 1L4DB 2BS4B 3ABVB 3IT6B 1FRRA 1QQRA 4RF0A 1CQVA 5T8IA 2Y3AA 3CWIA 2AQ3B 1BUIC 3GP7A 3C8YA 3P4RB 4ARCA 2XNAC 1C9FA 4RFBA 4CQNA 1PFDA 2PW9A 4TQ0A 1ZP0B 1ZDXA 1A70A 2H88B 1V1OA 4DQOC 1YJIA 2MH7A 2QILA 3AEFB 2RMMA 4L1BA 3ZQ4A 1V1PA 4RGNA 4MACA 1WSPA 1FXAA 4MH8A 2JSVX 1GB4A 1I4RA 3AE7B 1J7CA 2EELA 3AEDB 4XE0A 5AUIA 1TS2A 4RCOA 1E9MA 1PUTA 3BK1A 3VRAB 2LGIA 5TSSA 1E7PB 3R2IA 4ZHOA 2BB5A 4HEA1 2VZKD 1D5ZC 1ZUD2 1SIJA 1RYJA 1E10A 3EUB2 2DLBA 1EU3A 3GB1A 3AE4B 4JWSC 1GOZA 1K51A 1N5WA 4A8XC 2V0GA 1TS5A 2QSDA 3BIID 3RPFC 1TJEA 4B0EA 1SEBD 2BYTA 3URYA 5BYSA 2G1EA 3KWVA 3LB8C 5H8YE 4XWWA 2WS3B 1HEZE 3L4PA 2WXMA 4C56C 2Y5PA 2Y5CA 1KLUD 3AE5B 1F2RI 3P63A 1QOFA 2Q5WD 2L1AA 4MT5A 3MFGA 2CJNA 2JYTA 1QOAA 3WCQA 4C80A 2WLBA 3V3XA 1TYGB 1SJHD 2BBCA 1L6VA 3ETRA 1HZ6A 2RPVA 1TKGA 1UWMA 3Q8EA 3Q69A 4ITKA 1KRHA 4YSXB 1YNTE 4WIPA 2I38A 4XWTA 5I4DA 1C77A 4ZYSA 1B9RA 1Q10A 3U4EG 5EE3A 4HKZE 4WURA 1ZDVA 4NAMA 4ZRPA 3FC4A 1C4CA 5HFYA 2MJEA 2E3TA 4YTPB 2KN4A 4IDIA 4O1NA 2FBWB 5MPOA 1JQ4A 5EE9A 1NEKB 4OZBA 1UGJA 1C76A 1ENFA 2NTTA 1ZE3D 2BT6A 4YTNB 1DOYA 4ZHPA 1WXQA 3NZ3A 1JWSD 1FMAD 3DWGC 3BVMA 1QLBB 2JU6X 2PIAA 3W2DA 4JPSA 4MM3B 1C79A 2L32A 3AEGB 1D5MC 2N9KA 4IOIE 4IKGA 3P42A 3HUIA 5EE1A 3P4QB 1V8CA 4AS1A 2LHDA 3I57A 2B76B 2WQYB 2YEPF 2K3UA 3AM9A 3AE6B 1TS3A 3AE2B 1L5PA 2SAKA 3EGRA 3MC0B 1STEA 1D5XC 1IGDA 1N63A 2CU3A 4HJGE 3AE1B 3FAHA 3T3OA 4KX6B 1TKEA 3GS2A 1EU4A 2W54A 1OQQA 1JCKB 1ZPSA 3OWEB 3R2TA 3DWMA 4EE2A 1YQ3B 4KGSA 2SEBD 3MHZA 1J7BA 3AN1A 2WXJA 2GRIA 1RM6C 1Y56A 2ONQA 1FIQA 4WWMA 1FD6A 4R3DA 2IJ0A 2ACZB 4OHJA 4RH6A 1C4AA 1TY0A 5LNK1 4US9A 1PDXA 1UUPA 5AUKA 3SR6A 1T6BX 3ZJUA 1B1ZA 2BTEA 1J7AA 3J9CA 4DXGA 1JWMD 4C7YA 3BYYB 1SJED 2W3RA 2KMMA 3V05A 3Q8AA 1XXGA 2V3PA 3FILB 4ZOHC 4C7ZA 2J52A 5HG2A 3MJ5A 4L2YA 2N7JA 4A55A 1XLOA 3IAM1 3T3NA 2QIEB 1OFFA 3TEYA 5EE0A 4YXDB 4YTMB 1VJKA 4RGTA 1NI3A 2J42A 1N61A 2PVOD 1N62A 1SXTA 2FUG1 2ICIA 2BS3B 4TMAB 1T5XD 1IBXB 1L0VB 4UDUC 2JX5A 1WGKA 4ZRQA 2LFIA 2WDQB 2DBYA 1VZ8A 5H92C 2OHFA 1FFVA 1E0ZA 1KLGD 1I4PA 4N59A 1K52A 1KFYB 2VZKB 4TSSA 1JROA 1FNVA 4OW0A 4OVZA 1VZ7A 4AQ7A 1FNWA 4JX1C 4RF1A 5BMGA 1TZOA 3VR8B 3W9CB 5FKAC 1FO4A 2JQRB 1RFKA 1GPXA 2MEKA 3NS1A 1MI0A 5E6JA 2XN9C 2NTSA 3BVZA 5G5HA 3NVZA 1V97A 1I4GA 2M0AA 1PGAA 3TSSA 2W55A 1F0ZA 4KKIA 2AQ1B 2V4IB 2IPKD 2WU2B 5D3IB 1QKZA 2BS2B 3UI3A 4LTUA 2MJ3A 4OZAA 4YT0B 2WXGA 2IGHA 2CJOA 1CZPA 4P6VF 3MP9A 1ESFA 1BMLC 1FM0D 3FILA 1AN8A 2JYEA 2DYOA 1TY2A 3LXFA 4PT5A 3LYYA 4GDKB 2WXPA 1KTKA 4LLGM 2RDGA 1WWTA 3P4PB 1MPEA 4GDLB 4L23A 1L6UA 5BMHA 1JRPA 3NVYA 1IBXA 5BMIA 1EWYC 1XO3A 4RGOS 3W5UB 1GB1A 1TS4A 2J4XA 2ZW0A 3VRBB 2WXRA 5BYQA 5C3JB 1C78A 4YSYB 1VRAB 3IAS1 1JWAD 5BYRA 3AEAB 5GXGB 1K53A 2WU5B 1T3QA 1PGBA 4TQ1A 3U2SC 1AWDA 2KQ4X 3VQIA 2IGDA 5C2TB 3AEBB 4A9AA 2JZPA 2MJDA 2LHEA 5G5GA 3Q8BA 1XEEA 2WP9B 2INPE 1I4HA 1I7HA 2AQ2B 1XLQA 3W1SA 2LJIA 2WNMA 3TEXA 3NUHB 2IGGA 1JWUD 1NYRA 1SE2A 2W3SA 1CJEA 2IDYA 1ZXHA 1CK1A 2I2YA 1N5XA 3E56A 3Q8CA 2OEDA 4RGMA 3NVVA 1QF6A 2PMVA 2DYMA 1OQRA 1HQRD 1ET6A 2LUMA 4NAWB 1WYGA 1L0XB 1D6EC 1D4BA 2WXIA 2QMTA 2EKIA 2YEPB 1BXTA 3KLSX 3W5VB 2JXTA 1C4PA 3SFEB 2WXNA 4OZCA 1ZXIA 4HROA 4DXFA 2D5GA 4WH4A 3P1MA 2AX5A 2H89B 4HRSA 2KACA 3ZJTA 5HI1A 4NJCA 2LEKA 4H2AA 3KQ4A 2DWQA 1DOIA 1FCLA 4YSZB 2LMCA 4JE3B 1FNUA 1MHHE 1SSNA 2TSSA 1F77A 1SBBB 1XLNA 2WXLA 4KKJA 1I4QA 3HVDA 2PKOA 3IXSA 1RWSA 1QOGA 3BZDB 3B9JA 1SE4A 4A90A 3AB5A 4XDCA 1FXIA 3ZJVA 1NVID 1JW9D 2HTME 1YN5A 4FXCA 2K5PA 2WXQA 3SEBA 1I4XA 1NYQA 1R7SA 2JWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N63 A;  1FM0 D;  1PFD A;  2L52 A;  2CU3 A;  1ZP0 B;  3AE1 B;  1FRD A;  3FAH A;  1A70 A;  3NVW A;  4KX6 B;  2H88 B;  1TKE A;  3LXF A;  3SFD B;  1YJI A;  2MH7 A;  3AEF B;  1VDV A;  2W54 A;  1OQQ A;  2KAJ A;  1YJJ A;  1WRI A;  3DWM A;  1WWT A;  1YQ3 B;  1FXA A;  4USA A;  1E6E B;  2M19 A;  1J7B A;  3P4P B;  3AN1 A;  1L6U A;  3AE7 B;  3AH7 A;  1RM6 C;  1J7C A;  3AMZ A;  1JRP A;  2M56 B;  3AED B;  2K9X A;  3NVY A;  2N0S B;  5AUI A;  3VRA B;  1E9M A;  1PUT A;  1FIQ A;  1EWY C;  1XO3 A;  3P4S B;  4N58 A;  1E7P B;  4WWM A;  3W5U B;  4ZHO A;  1GAQ B;  2L83 A;  3KWL A;  2ACZ B;  3VRB B;  5C3J B;  1VLB A;  1ZUD 2;  3B2F A;  4US9 A;  4YSY B;  1PDX A;  5AUK A;  3SR6 A;  1SIJ A;  1RYJ A;  3W9C B;  1E10 A;  1JWA D;  3AV8 A;  3AEA B;  1J7A A;  3EUB 2;  5GXG B;  2WU5 B;  1QT9 A;  1T3Q A;  3AE4 B;  4JWS C;  4C7Y A;  3VR9 B;  1N5W A;  3PO0 A;  2W3R A;  1AWD A;  2KMM A;  4N6E B;  2WDV B;  3AEE B;  1DGJ A;  3AE9 B;  3BII D;  2PVG C;  4ZOH C;  3RPF C;  4C7Z A;  5C2T B;  3AEB B;  4A9A A;  2MJD A;  5G5G A;  1TJE A;  1QOB A;  1XLO A;  2WP9 B;  2G1E A;  2QIE B;  1I7H A;  1OFF A;  3LB8 C;  1IUE A;  5H8Y E;  1XLQ A;  3CIR B;  5EE0 A;  2WS3 B;  4YXD B;  3L4P A;  4YTM B;  1VJK A;  2Y5C A;  1NI3 A;  3AE5 B;  1N61 A;  1NYR A;  4WQM A;  1SF0 A;  1CJE A;  2W3S A;  1QOF A;  1N62 A;  2PVO D;  2Q5W D;  3B2G A;  3P63 A;  5MPO A;  1SB3 C;  1KF6 B;  1N5X A;  2CJN A;  2BS3 B;  1QOA A;  4JWU C;  1L0V B;  3WCQ A;  4C80 A;  3NRZ A;  2JX5 A;  2WLB A;  1TYG B;  1WGK A;  3HVZ A;  3NVV A;  1QF6 A;  2WDQ B;  2DBY A;  5H92 C;  1OQR A;  2OHF A;  1L6V A;  3ETR A;  1WYG A;  1TKG A;  1UWM A;  1FFV A;  4ITK A;  1KRH A;  2EKI A;  1E0Z A;  4YSX B;  4N59 A;  3W5V B;  1KFY B;  2WDR B;  1JRO A;  3AE8 B;  1B9R A;  5EE3 A;  3FC4 A;  3SFE B;  2MJE A;  2E3T A;  1ZXI A;  4HRO A;  4YTP B;  4JX1 C;  1TKY A;  4IDI A;  1JQ4 A;  2FBW B;  1JAL A;  1NEN B;  3HRD D;  5EE9 A;  1NEK B;  3VR8 B;  3P4R B;  2JQR B;  1AYF A;  1RFK A;  1FO4 A;  3P1M A;  1GPX A;  1FFU A;  2AX5 A;  4US8 A;  2H89 B;  4HRS A;  3AEC B;  1ZOY B;  2BT6 A;  3NS1 A;  4YTN B;  3AE3 B;  1DOY A;  5G5H A;  4ZHP A;  1WXQ A;  2LEK A;  3NVZ A;  3DWG C;  1FMA D;  2DWQ A;  1ROE A;  1QLB B;  2PIA A;  1DOI A;  1V97 A;  3ZYY X;  4YSZ B;  1JWB D;  2K22 A;  2W55 A;  1F0Z A;  3AEG B;  1XLN A;  1YQ4 B;  1N60 A;  1XLP A;  2QJL A;  2WU2 B;  2PKO A;  3HUI A;  5EE1 A;  1RWS A;  1QOG A;  2BS2 B;  3P4Q B;  1DOX A;  1V8C A;  4LTU A;  2MJ3 A;  4YT0 B;  3B9J A;  2BS4 B;  3ABV B;  3AB5 A;  2B76 B;  1FXI A;  1FRR A;  2WQY B;  1NVI D;  2CJO A;  1JW9 D;  2HTM E;  3AM9 A;  4FXC A;  2K5P A;  1CZP A;  3AE6 B;  3CWI A;  3AE2 B;  4P6V F;  1L5P A;  1NYQ A;  1R7S A; 
#chains in the Genus database with same CATH topology
 3PZ7 A;  2L0F A;  3NVW A;  3NG0 A;  4REZ A;  3X23 A;  1YN3 A;  1FCC C;  1IYF A;  3BVG A;  1GJZ A;  1E6E B;  5D3D A;  1WR1 A;  4FJZ A;  2M56 B;  3N9Y C;  4HJK A;  4N58 A;  3ZNH B;  3B08 A;  2L83 A;  3U30 A;  2N7E A;  4NAW A;  4YL8 A;  1QZE A;  2L76 A;  3B2F A;  3PPA A;  1QIL A;  4MGZ E;  3KYC D;  2MWS B;  3E9S A;  1QT9 A;  4K3B A;  2X38 A;  4FHJ A;  1DGJ A;  5IN7 A;  3DVG X;  1QOB A;  1F2R C;  4ZRI A;  3JVZ X;  2LVO A;  1Z5S B;  4WQM A;  1SF0 A;  1KF6 B;  1MHX A;  1NI2 A;  1Q5W B;  3B1L X;  4F7Z A;  2GI9 A;  2C7H A;  2MX2 A;  2KWD A;  3TEW A;  1YN4 A;  1MVK A;  3IHP C;  2WXF A;  1P7F A;  2FCM A;  2EKE C;  3MC9 A;  2M8S A;  3O13 A;  1TKY A;  2IND C;  2ZPN A;  1NEN B;  2GBR A;  4RMA A;  3VVW B;  4WJP A;  2INN E;  3H7S A;  1P3Q U;  2LD9 A;  3AEC B;  3PZ8 A;  2NPT A;  1WGG A;  2RPQ A;  5G55 A;  1E90 A;  3U7Z A;  3ZYY X;  1JWB D;  1RFA A;  2K22 A;  1MG4 A;  1YQ4 B;  1XLP A;  2QJL A;  4LK0 M;  4M0W A;  2KDM A;  2W82 A;  2IO3 B;  3QAQ A;  4G11 A;  3EA6 A;  3BIN A;  3ZDM C;  2BS4 B;  1V9J A;  3NHE B;  4I6P A;  4BKG A;  2Y3A A;  5IP4 D;  3CWI A;  1P98 A;  4G3X B;  3EFU A;  2D3G A;  4EZL A;  5LLI A;  2MH7 A;  4I6L B;  4RGN A;  2CR5 A;  1WX7 A;  3DVN U;  1WSP A;  2JSV X;  3MHS D;  1I4R A;  4S0R A;  1J7C A;  3VRA B;  1TGZ B;  4XE0 A;  5AUI A;  5TSS A;  3R2I A;  4RM8 A;  4W9F A;  2BB5 A;  2IZV B;  2FAZ A;  3DOW A;  3CMM B;  1KLV A;  2MP2 A;  4DXA B;  3KH0 A;  3RPF C;  2IO1 B;  2KC2 A;  3WA0 A;  2KDF B;  2NPT B;  2K6Q A;  3KWV A;  4XWW A;  1HEZ E;  3L4P A;  2WXM A;  5DPT A;  3N1X C;  1QOF A;  3PGE A;  1QOA A;  4B95 A;  3V3X A;  2WHI A;  2KNB A;  2JY6 A;  3ETR A;  1HZ6 A;  4HVB A;  1TKG A;  3Q3O C;  5JH5 C;  2LVP A;  3U4E G;  4ZRP A;  4C4V B;  5HFY A;  1JQ4 A;  5EE9 A;  1UGJ A;  2L7R A;  4WJQ A;  3Q14 C;  1DOY A;  1JWS D;  1FMA D;  3JYU A;  1C79 A;  2OJW A;  3EHV A;  2QDF A;  2C60 A;  4MSM B;  1V8C A;  2JZZ A;  2KYW A;  2B76 B;  2WQY B;  1HE8 A;  3AM9 A;  2V3S A;  3AE6 B;  2XEW A;  3OAW A;  2SAK A;  3MC0 B;  1WM3 A;  3FAH A;  3T3O A;  5IOI A;  3OWE B;  3R2T A;  2VH1 A;  3WAN A;  2Y5B B;  1RM6 C;  1EF5 A;  1WXV A;  1YJ1 A;  4NY0 A;  3VUW A;  3ZRF A;  3NS8 A;  1FD6 A;  4OHJ A;  1TY0 A;  1PDX A;  1WGD A;  1UUP A;  2C5L C;  5CHV C;  3K9O B;  3OG5 A;  1LQB A;  1SJE D;  4M00 A;  5HKH A;  1WGH A;  3Q8A A;  3HM6 X;  3L13 A;  3FIL B;  4C7Z A;  3R66 C;  4IM3 A;  3BY4 B;  4L2Y A;  2N7J A;  1RLF A;  4P7I A;  4HWI B;  4YXD B;  1A5R A;  4RGT A;  1NI3 A;  1ZW7 A;  5CX3 A;  4ZRJ A;  2ICI A;  2BS3 B;  4TMA B;  1RRB A;  1WH3 A;  2LFI A;  3ZXR A;  2KJH B;  4EUT A;  4IWQ A;  5CTR C;  5C1Z A;  4N59 A;  2VZK B;  1FNV A;  3R7Q A;  2AYO B;  1R4N I;  1VZ7 A;  4AQ7 A;  1S1Q B;  5BMG A;  1WMH A;  5D2M B;  5AEK B;  2PPH A;  2IBI B;  2AEH A;  2MEK A;  3W1Y A;  1T0S C;  3VDZ A;  3ML9 A;  3IBE A;  3NS1 A;  3BVZ A;  4AP4 C;  3NVZ A;  1WRD B;  1I4G A;  2M0A A;  2LXC A;  4KKI A;  3PVL A;  2V4I B;  4K7U A;  5D3I B;  3UI3 A;  4LTU A;  3DHG C;  2IGH A;  3RD2 A;  1LFD A;  4M02 A;  1FM0 D;  1AN8 A;  2DYB A;  2PEA A;  2BWE S;  3GZN B;  3L08 A;  3V61 A;  4L23 A;  5BMH A;  3RT3 B;  3CST A;  1EWY C;  1XO3 A;  1TS4 A;  4MSQ B;  5DPW A;  2J4X A;  2ZW0 A;  1R4M B;  2WXR A;  1C78 A;  4MGK E;  1FXT B;  1JWA D;  5GXG B;  2WU5 B;  1T3Q A;  1WMH B;  4TQ1 A;  1AWD A;  2KQ4 X;  3VQI A;  3UF8 A;  3PLU A;  3GE8 C;  4A9A A;  2MJD A;  4MEM A;  5G5G A;  1I42 A;  1XEE A;  2WP9 B;  3QJZ A;  2INP E;  1XLQ A;  2LJI A;  3TEX A;  3C0R B;  4CYE A;  3R3M A;  3A4S C;  2OOB B;  3NUH B;  4ANW A;  1JWU D;  1NYR A;  2W3S A;  3Q3J A;  1ZXH A;  2I2Y A;  1N5X A;  3E56 A;  1Q1O A;  3PLV A;  4RGM A;  3NVV A;  1QF6 A;  2LUM A;  2WXI A;  2R2Q A;  3PRZ A;  2YLM A;  3L17 A;  3H6N A;  1BXT A;  3KLS X;  3W5V B;  3Q3M C;  2JXT A;  2XK5 A;  3W1S C;  4HRO A;  5CHW A;  4E74 A;  2D5G A;  3P1M A;  4FBJ B;  3ZJT A;  1TZ1 A;  1WJ6 A;  4IWO A;  2LEK A;  4H2A A;  4A3O A;  1E8W A;  4URK A;  3U8Z A;  1FCL A;  4DBG A;  3R7R A;  4DHZ B;  1F77 A;  3RNE C;  3QC8 B;  3IXS A;  4ACF A;  3DBR I;  3I5J C;  1EO6 A;  2ZNV B;  5C23 A;  4FXC A;  3A1Q B;  3TCA A;  3SEB A;  1NYQ A;  4FJV B;  1R7S A;  3A4R A;  3OJ4 B;  4HPM B;  3AUL A;  2O6V A;  2RDH A;  4P16 A;  2KLC A;  4XZ4 A;  1VDV A;  1KOT A;  1E7U A;  1YJJ A;  1WRI A;  3OLM D;  2FCN A;  2N4F A;  2DEN B;  3AMZ A;  4HXD A;  1AW7 A;  1YMH E;  3TUO A;  1HXY D;  3WAM A;  3P4S B;  3U52 E;  3BYT B;  2ZCC A;  4PS8 A;  1VLB A;  1ET9 A;  3ALB A;  1WX8 A;  4ICU A;  2XK5 B;  1KH0 A;  3VR9 B;  3PO0 A;  2JWZ A;  2LAS A;  2KQS A;  4TKN A;  5D7G A;  2N9X A;  4NZL B;  1IUE A;  1V1P B;  3CIR B;  4E3C A;  4GXB A;  2Z8L A;  1SB3 C;  5JXV A;  2V4L A;  4JWU C;  1XCQ L;  2IO0 B;  3AXC A;  3QK0 A;  3M62 B;  2N1V A;  2KFJ A;  1P9D U;  3I63 C;  2E6X A;  2ON8 A;  2PE6 B;  3DVN V;  4HPL B;  1EM7 A;  1WE7 A;  2EMS A;  2MSE D;  1V49 A;  1GUA B;  2KWC A;  1XF5 L;  4B6W A;  1VZ6 A;  2R2O A;  2DZI A;  4KGR A;  3H1U A;  1LO5 D;  2AL3 A;  3DQV A;  1AYF A;  4XYC A;  1FFU A;  2D11 A;  2QEJ C;  2G9H D;  3H9D A;  2RDB C;  3L54 A;  4BOZ B;  3UQA A;  4KVG B;  1WE6 A;  4XDD A;  2V3N A;  2B3A A;  3KVF B;  1FRR A;  2A4Z A;  2AQ3 B;  1BUI C;  4ARC A;  4RFB A;  1PFD A;  3ECI A;  1ZP0 B;  1ZDX A;  5J17 A;  4DQO C;  1YJI A;  3N1Y C;  4MAC A;  1FXA A;  1OTR B;  1GB4 A;  5DCN A;  2EEL A;  3AED B;  1TS2 A;  4RCO A;  1E9M A;  2DNF A;  1E7P B;  2MLB A;  2VZK D;  2JRI B;  4PYU A;  1E10 A;  3DPD A;  1N5W A;  2PE9 A;  1Q0W B;  4A8X C;  1TS5 A;  3NOB A;  2NBV B;  2LWP A;  4B0E A;  1SEB D;  3C19 A;  2J0M A;  3DHH C;  5BYS A;  2G1E A;  1E7V A;  4HDO A;  2Y5P A;  2Y5C A;  3X0W A;  3P63 A;  2L1A A;  3MFG A;  2JYT A;  3WCQ A;  1TYG B;  1SJH D;  3TIX A;  1L6V A;  2G4S A;  4TUU A;  4ANU A;  1KM7 A;  1UWM A;  3Q8E A;  1HTO A;  1UEL A;  1C1Y B;  1YNT E;  3RNF C;  2HE7 A;  4XWT A;  1K8R B;  5EE3 A;  4FLH A;  2HTH A;  1LM8 B;  3ZXV A;  2CHX A;  2FBW B;  1H4R A;  4OZB A;  4ZYN A;  1C76 A;  1ENF A;  2BT6 A;  5IO9 A;  1E8X A;  3V60 A;  4AOF A;  4ZHP A;  3DWG C;  1QLB B;  2PJH A;  2BVC A;  3A9K B;  2VRR B;  3RCZ A;  1NBF C;  4MM3 B;  4W9H A;  3AEG B;  1D5M C;  2N9K A;  3DBH I;  3RUI B;  2JT4 B;  5D6J B;  3P4Q B;  2BKR B;  1YOV B;  1GC7 A;  2YEP F;  2K3U A;  4WWO A;  4AWJ A;  1WR6 E;  1L5P A;  3EGR A;  1STE A;  4HJG E;  3AE1 B;  1P0R A;  1OGW A;  4KX6 B;  4W9G A;  4ANX A;  4HCN B;  1WXM A;  1OQQ A;  2DZK A;  1YQ3 B;  1LXD A;  2JVC A;  3N30 A;  3AN1 A;  4MGY E;  4LNK A;  4RH6 A;  2OJR A;  2HJ8 A;  1ZGU B;  2ZJD A;  5LNK 1;  2JXX A;  4US9 A;  2O2V A;  3SR6 A;  1B1Z A;  4F1S A;  3J9C A;  1CMX B;  4DXG A;  1JWM D;  2MCN B;  2MBE A;  4C4V A;  3RZF A;  4OVV A;  5HG2 A;  3MJ5 A;  4A55 A;  3T3N A;  3IAM 1;  2QIE B;  3TEY A;  1VD2 A;  4YTM B;  3VTU A;  3RN9 C;  2MRP A;  2LGD A;  2PVO D;  1N62 A;  1SXT A;  4GDK A;  2FUG 1;  1SGH A;  4ZDV A;  1IBX B;  2DHZ A;  4UDU C;  2JX5 A;  4ZRQ A;  2WDQ B;  2DBY A;  3QQ8 B;  2LVQ A;  3ZNG C;  2CS4 A;  2BYV E;  2BYF A;  4OVZ A;  4K1R B;  2JUO A;  3VAW A;  2DAF A;  4RF1 A;  2LJ5 A;  3W9C B;  2AL6 A;  2JPH A;  2KD0 A;  1FO4 A;  2JQR B;  3N20 C;  1RFK A;  3N3K B;  2NTS A;  5G5H A;  1J19 A;  1V97 A;  1PGA A;  3TSS A;  1F0Z A;  5GMV A;  2O2V B;  2AQ1 B;  2WU2 B;  1WXS A;  4PK1 A;  2MJ3 A;  3AI5 A;  1L7Y A;  4NNJ B;  2KX3 A;  2CJO A;  1CZP A;  3RUL A;  4FAD A;  1YX5 B;  1Z2M A;  2WYQ A;  3FIL A;  4EKU A;  2JYE A;  1TY2 A;  3VH4 B;  2K8C A;  1T0R C;  3IFW B;  3LYY A;  3Q6B A;  4GDK B;  3P4P B;  4GDL B;  3NVY A;  4MEL A;  1P1A A;  2O6V D;  2YVC A;  4HK2 A;  5BYQ A;  3VRB B;  1VRA B;  4W9I A;  4BFR A;  5E6O A;  2WX1 A;  3AEA B;  4LDT B;  4JGH B;  3M95 A;  2KHW B;  2DX5 B;  5DPS A;  2IO2 B;  3RNC C;  2MBQ A;  5TR5 A;  2Z0D B;  4NJ6 A;  1RAX A;  1WGR A;  5IAA C;  3W1S A;  1UH6 A;  3QX1 A;  1SE2 A;  2IDY A;  1WGY A;  4BKT A;  1CK1 A;  3Q8C A;  3S2A A;  4KDI C;  2PMV A;  1HQR D;  1ET6 A;  1WYG A;  1D6E C;  2YEP B;  1PQS A;  3KW5 B;  3PV1 A;  4GMV A;  2W9N A;  2FNJ B;  4N9F 4;  4OZC A;  4K3C A;  2LI5 A;  1D3Z A;  1F9J A;  3QAR A;  1T0Q C;  2M17 A;  5HI1 A;  3KQ4 A;  2DWQ A;  2LZ6 A;  3V6C B;  1V5T A;  1MHH E;  2TSS A;  4JL9 A;  3ENE A;  3VUY A;  4WJN A;  4FA6 A;  2K6D B;  4XDC A;  3DVG Y;  2KDB A;  3ZJV A;  1NVI D;  1JW9 D;  2KKC A;  3RZW C;  3VH3 B;  2JWU A;  4LNI A;  3KUZ A;  1UBQ A;  3SU8 X;  1JRU A;  1L0Y B;  3BWU D;  3R8B A;  4CO7 A;  1IGC A;  3N1Z C;  3AH7 A;  2WXH A;  1KJT A;  2Z59 B;  4IUM B;  2KVZ A;  1GAQ B;  2X8X X;  1M4V A;  2HDE A;  4J3O D;  1K50 A;  3ZDT A;  1J8C A;  2FE8 A;  4DDG D;  3AV8 A;  3HM3 A;  4JIO U;  2FCQ A;  4IG7 B;  1WJU A;  4ARI A;  4ZRK A;  3AEE B;  2G4D B;  1I35 A;  4KSL C;  4D2K A;  2M4N A;  3H8H A;  2KWU B;  3L0W B;  4TV3 A;  3A9J A;  3NZS A;  3B2G A;  3RI7 C;  4JQW C;  2D2Q A;  1SE3 A;  3NZU A;  2KAN A;  2K0P A;  3NRZ A;  2WXK A;  5KHO A;  1FPY A;  3UIN B;  4WAF A;  3DBL I;  4Q2J A;  5FR3 A;  3Q8F A;  2IY0 B;  3A1Q A;  3AE8 B;  4XC2 A;  3RFZ B;  2PTL A;  3RYT A;  4E71 A;  1XQQ A;  4ICV A;  2VH2 A;  1JML A;  1UZX B;  1EWC A;  3FKY A;  3Q3N C;  4US8 A;  4RNA A;  2V9H A;  1WXA A;  1PYW D;  1FEH A;  4AJY B;  3AE3 B;  3ML8 A;  1XCT L;  3UIO B;  2LGX A;  2ZVO A;  1P7E A;  2M0X A;  2ZVN A;  5IA7 A;  1UGM A;  2KJ6 A;  1HTQ A;  2CHZ A;  3TEZ A;  4LJP B;  4IM0 A;  1L4D B;  2GBJ A;  2J7Q B;  3ABV B;  3IT6 B;  4RF0 A;  3UQB A;  2HD5 B;  3GP7 A;  3C8Y A;  3P4R B;  3V6E B;  1C9F A;  2PW9 A;  4TQ0 A;  1A70 A;  3A9J B;  2H88 B;  5EDS A;  2QIL A;  2RMM A;  4IWP A;  4GU2 A;  1V1P A;  3K9P B;  4PS3 A;  3Q3F A;  4F8C B;  1PUT A;  3ZNI D;  3BK1 A;  1ZKH A;  3B0A A;  4LCD E;  3VUX A;  4HEA 1;  2KT7 A;  1D5Z C;  4PYZ A;  1ZUD 2;  1SIJ A;  1RYJ A;  2DLB A;  1EU3 A;  3EEC A;  3AE4 B;  4JWS C;  4KZC A;  1GOZ A;  1K51 A;  3NJT A;  4FUL A;  2NVU I;  2V0G A;  2QSD A;  2KJR A;  1WZ0 A;  1TBE A;  3DBS A;  3TJP A;  2BYT A;  2WS3 B;  2NR2 A;  4DWF A;  1E8Y A;  1KLU D;  2Q5W D;  2JZ3 B;  3DHI C;  1WJ4 A;  2CJN A;  1NDD A;  3GE3 C;  2JF5 A;  3ZNZ B;  3HIZ A;  2BBC A;  1X1M A;  2RPV A;  1MJD A;  4HLE A;  2KVR A;  3I3T B;  4ITK A;  1KRH A;  1AAR A;  4YSX B;  4WIP A;  5I4D A;  4W9C A;  4ZYS A;  1B9R A;  4GIV A;  1G6J A;  3LDZ E;  2NBW B;  1C4C A;  2E3T A;  4PS7 A;  3ZTD A;  1IP9 A;  4YTP B;  1ISN A;  2KN4 A;  4O1N A;  4K81 A;  4G0N B;  1NEK B;  2BWF A;  5E6N A;  4KZ0 A;  1WXQ A;  1UD7 A;  3BVM A;  4EZJ A;  1YX6 B;  3W2D A;  3PHX B;  4C00 A;  4IOI E;  2K1F A;  4IKG A;  3HUI A;  1XT9 B;  4FN2 A;  3QA8 A;  5EE1 A;  2J0K A;  3JSV B;  2LHD A;  2K8H A;  3I57 A;  4W9K A;  1R4N B;  4DHJ B;  2DAJ A;  4BBN C;  1TS3 A;  1IGD A;  1N63 A;  2CU3 A;  1TKE A;  4M01 A;  3GS2 A;  1EU4 A;  3APF A;  1WF9 A;  1JCK B;  1EF1 A;  2KLG A;  3DWM A;  2IYD B;  4KGS A;  2KQ7 A;  1F52 A;  2GRI A;  2ONQ A;  3L10 B;  3UGB B;  2UWQ A;  1FIQ A;  4HCP B;  4W9J A;  4WWM A;  2J0J A;  2L3Z A;  3HHM A;  2NCN A;  2ACZ B;  1C4A A;  2WDT B;  1T6B X;  3LJ3 A;  4EZK A;  5JZE B;  2KTR A;  3V05 A;  2KMM A;  2GLS A;  1XXG A;  2V3P A;  4KIK A;  1XLO A;  4MGI E;  1OFF A;  4S17 A;  4M8M A;  1VJK A;  5JHA A;  2J42 A;  5J2R A;  4W9D A;  1N61 A;  3A9K A;  2Z0E B;  4MM3 A;  1T5X D;  3KYD D;  4I6N B;  1WGK A;  1WJN A;  1VZ8 A;  5H92 C;  2OHF A;  1KLG D;  1I4P A;  1KFY B;  4TSS A;  4NQL B;  3RNB C;  2C7N B;  1WM2 A;  3TMP B;  1TZO A;  3ONS A;  3VR8 B;  5FKA C;  3QIJ A;  1H8C A;  2BKF A;  1GG3 A;  4HPP A;  4MDK E;  2W55 A;  2MHJ A;  1S3S G;  4W9E A;  2ZCB A;  3TL5 A;  3KUC B;  4OZA A;  4YT0 B;  4X57 B;  2KTR B;  4II3 B;  3ZRC A;  3DCG A;  2KFK A;  4KIK B;  4P6V F;  3MP9 A;  1ESF A;  1BML C;  5LXI B;  4RM9 A;  3ZO5 B;  2DYO A;  4PT5 A;  3LXF A;  5FR6 A;  2LUE A;  4LNO A;  2WXP A;  4LLG M;  1GC6 A;  2K8B A;  2G45 B;  2RDG A;  1WWT A;  2RR9 A;  1MPE A;  1L6U A;  4G50 A;  4ANV A;  1VCB A;  3HK0 A;  1IBX A;  2N9P C;  5BMI A;  4EOY A;  2LGY A;  3DBR B;  1GB1 A;  2KN5 A;  2UYZ B;  5C3J B;  3APD A;  3IAS 1;  4QAY A;  3OJ3 A;  5BYR A;  2FCS A;  2KTF A;  1K53 A;  1V5O A;  2BQQ A;  3M3J A;  2IGD A;  2IY1 B;  2NS5 A;  5C2T B;  2JZP A;  1I7H A;  2QC8 A;  2AQ2 B;  2WNM A;  2BYE A;  2IGG A;  1CJE A;  4FJY A;  1OQR A;  1U4A A;  2KFK B;  4NAW B;  1L0X B;  3AU4 A;  2EKI A;  5KHQ A;  3ZLZ A;  4BVU C;  2WXN A;  1WYW B;  1ZXI A;  2KX0 A;  4P1C C;  4DXF A;  4WH4 A;  2UU7 A;  3SHQ A;  1E8Z A;  2H89 B;  2KAC A;  4GDL A;  5AZG A;  4OVU A;  2RD0 A;  3GZN I;  1DOI A;  4GOC A;  4YSZ B;  1FNU A;  3TBL D;  1XLN A;  2WXL A;  3Q2A C;  4KKJ A;  1OQY A;  2PKO A;  1QOG A;  4K7W A;  3B9J A;  2BGF A;  3AB5 A;  2C9W B;  3WAL A;  1FXI A;  2GOW A;  1R4M I;  4A20 A;  3ZIM A;  1SE9 A;  2K5P A;  2WXQ A;  2NBU A;  1I4X A;  2I1J A;  2L52 A;  1TT5 B;  1FRD A;  2KXJ A;  3QHT A;  4W9L A;  4DHZ E;  3SFD B;  2PLP A;  2J53 A;  2KAJ A;  3IG3 A;  1PGX A;  4USA A;  2M19 A;  5BO4 B;  3T9L A;  2R61 A;  4HKQ A;  1HA5 A;  1EUV B;  2K9X A;  2N0S B;  1VR9 A;  3KWL A;  4M0W B;  2FUH B;  4EEW A;  1OEY A;  3DDC B;  2NMQ A;  4DDI D;  1L4Z B;  4A6Q A;  3ZGZ A;  3BK2 A;  2GMI C;  1UWX A;  1ACC A;  4WJO A;  3APC A;  4BKS A;  4N6E B;  1HZ5 A;  2WDV B;  3RNA C;  3AE9 B;  2PVG C;  2N9E B;  2AWT A;  2MQJ A;  5HHD G;  2C7M B;  1GNU A;  4B0M A;  3I9V 1;  4DK5 A;  1XD3 B;  2K25 A;  2GB1 A;  2XBB C;  3MTN B;  2WXO A;  4CHK A;  1UNS A;  3L16 A;  2ZEQ A;  1J0G A;  4NQK E;  3IT4 B;  3HVZ A;  2ZW1 A;  2BW2 A;  4DHJ D;  4KGT A;  3ZUN A;  2BF8 B;  2RGF A;  2N9L A;  2WDR B;  2K39 A;  1C3T A;  2BB6 A;  4BBN F;  2EMT A;  1IPG A;  2GBK A;  2MP2 B;  2G3Q B;  1TTN A;  4YWG G;  1JAL A;  2WGS A;  3HRD D;  1WZ3 A;  4GSW A;  2LXA A;  2LGS A;  1ZOY B;  4WQO B;  4GLS C;  1ROE A;  5FK9 C;  2WX0 A;  2L00 B;  2BPS A;  1N60 A;  3EFC A;  1UBI A;  5L83 A;  4M8N A;  1DYQ A;  4B9K A;  5JHB A;  1DOX A;  1WX9 A;  2MW5 A;  2HJ1 A;  5G2N A;  1QQR A;  1CQV A;  5T8I A;  2KMC A;  2XNA C;  4CQN A;  3VXW A;  5L95 C;  2DZJ A;  1V1O A;  3AEF B;  4L1B A;  3ZQ4 A;  4LNN A;  3SD5 A;  4K7S A;  2LRW A;  4MH8 A;  3AE7 B;  3A33 B;  2LGI A;  3DBH B;  3VTV A;  4ZHO A;  3IVF A;  1WI0 A;  1V80 A;  2RSU A;  4BAX A;  5IKC M;  3EUB 2;  4BOS C;  3GB1 A;  4GN1 A;  3BII D;  1WIA A;  2D07 B;  4KV2 A;  4EFO A;  1TJE A;  5LXH A;  2L05 A;  3URY A;  3LB8 C;  5H8Y E;  1F1H A;  2KO3 A;  2JRH A;  1YD8 U;  4C56 C;  1WFY A;  3AE5 B;  1F2R I;  4MT5 A;  2D3B A;  4C80 A;  1LGR A;  2WLB A;  2KWV B;  1V81 A;  4KDL B;  3Q69 A;  2D10 A;  4IW0 A;  1V6E A;  2I38 A;  3H7P A;  1C77 A;  2MBB B;  1L2N A;  2D3C A;  1Q10 A;  4HKZ E;  4WUR A;  1ZDV A;  4NAM A;  1V2Y A;  3FC4 A;  4JLC A;  2MJE A;  4IDI A;  5MPO A;  3PRP B;  4NPN A;  2NTT A;  1ZE3 D;  4YTN B;  3MJW A;  3PRE A;  3O65 B;  3NZ3 A;  3WAP A;  2JU6 X;  2PIA A;  4JPS A;  4AUQ C;  2L32 A;  3P42 A;  3RMK C;  4AS1 A;  4KSK C;  3PZD A;  1MG8 A;  3AE2 B;  1D5X C;  3M63 B;  2KDI A;  4BZA A;  3VHT C;  2W54 A;  1ZPS A;  4EE2 A;  2SEB D;  3MHZ A;  1J7B A;  2WXJ A;  2N1W A;  1Y56 A;  3ZKJ C;  3NY5 A;  2CKH B;  4R3D A;  2IJ0 A;  3H7P B;  5AUK A;  3ZJU A;  2BTE A;  1J7A A;  4C7Y A;  3BYY B;  2I1K A;  2W3R A;  4XX5 A;  2ZPY A;  4ZOH C;  2ASQ A;  2J52 A;  5AZH A;  2L0T A;  2D3A A;  3QCA A;  3D32 A;  3WAO A;  5EE0 A;  2INC C;  2REX A;  1OEY J;  5AZF A;  2L8J A;  2KK8 A;  2M1M A;  5CHF A;  1L0V B;  2KDE B;  2ZZP B;  3UIP B;  3JSV A;  1V86 A;  3ZW3 A;  1FFV A;  1E0Z A;  2QCZ A;  4XGA B;  1K52 A;  3SDL C;  1JRO A;  2MA9 B;  4OW0 A;  4II2 B;  4AJW A;  1FNW A;  1N6Z A;  5D94 A;  4JX1 C;  3CSF A;  4ASW C;  1YIW A;  1YQB A;  2N7D A;  1GPX A;  3PT2 B;  3RNG C;  5E6J A;  1MI0 A;  2XN9 C;  1SIF A;  4NJ7 A;  3ZVV A;  3PS6 A;  4WAA A;  3N32 A;  4MJS A;  3T8M A;  2IPK D;  2A5U A;  1QKZ A;  2MBO A;  2BS2 B;  2WWZ A;  3GOE A;  2WXG A;  1UF0 A;  2FIF A;  3KUD B;  4MH0 E;  4P1B C;  3V62 A;  1KTK A;  3MC8 A;  1MFW A;  4WWP A;  4GGQ A;  4LDT D;  4J6I A;  1JRP A;  1BT0 A;  4RGO S;  3W5U B;  1T0Y A;  2GBM A;  4YSY B;  3VFK A;  2LRU A;  3QWZ B;  2QHO A;  3CF6 E;  3JW0 X;  1PGB A;  4FHK A;  2KC1 A;  5E6P A;  3U2S C;  2KOX A;  4IM2 A;  3ZTC A;  2MBH A;  2O6V B;  1M94 A;  3AEB B;  2LHE A;  4GB9 A;  2CHW A;  3Q8B A;  5DPR A;  1I4H A;  2KMA A;  4MJS B;  3VTW A;  2FID A;  1TIF A;  1WY8 A;  2OED A;  2V1Y A;  4BKS D;  2DYM A;  3PTF C;  1D4B A;  2QMT A;  2ZNV C;  4WWN A;  1C4P A;  3SFE B;  5J18 A;  3P2B A;  4LNF A;  4HDQ A;  2KZR A;  2GBN A;  1E5W A;  2AX5 A;  4HRS A;  3AU5 A;  3PHW B;  4LJO B;  3WIM A;  4NJC A;  3EC8 A;  3PRM B;  3PSE B;  2LMC A;  4JE3 B;  3U7D A;  1SSN A;  3DBL B;  1SBB B;  4IC7 B;  1I4Q A;  2DZM A;  3HVD A;  1RWS A;  3BZD B;  4A3P A;  1SE4 A;  4A90 A;  1Y8R C;  2HTM E;  1YN5 A;  2CU1 A; 
#chains in the Genus database with same CATH homology
 2L52 A;  3PZ7 A;  1FRD A;  3NVW A;  2RDH A;  4REZ A;  4P16 A;  3SFD B;  1YN3 A;  1FCC C;  1VDV A;  2PLP A;  2J53 A;  2KAJ A;  1L0Y B;  1YJJ A;  3BWU D;  1WRI A;  3BVG A;  3R8B A;  1PGX A;  1IGC A;  4USA A;  1E6E B;  2M19 A;  5D3D A;  2R61 A;  4HKQ A;  1HA5 A;  3AH7 A;  3AMZ A;  1AW7 A;  1YMH E;  2M56 B;  2K9X A;  3N9Y C;  2N0S B;  1HXY D;  2WXH A;  1VR9 A;  3TUO A;  3P4S B;  4N58 A;  3U52 E;  1GAQ B;  2L83 A;  1M4V A;  3BYT B;  3KWL A;  2HDE A;  4J3O D;  1VLB A;  1ET9 A;  1K50 A;  3B2F A;  2NMQ A;  1QIL A;  2FE8 A;  1L4Z B;  4A6Q A;  3AV8 A;  3ZGZ A;  3BK2 A;  3E9S A;  1QT9 A;  1KH0 A;  1UWX A;  1ACC A;  3VR9 B;  2X38 A;  3PO0 A;  4ARI A;  4N6E B;  1HZ5 A;  2WDV B;  3AEE B;  1DGJ A;  3AE9 B;  2PVG C;  5HHD G;  4D2K A;  5D7G A;  1QOB A;  3H8H A;  1F2R C;  4NZL B;  3I9V 1;  4B0M A;  1IUE A;  1V1P B;  3CIR B;  2GB1 A;  2Z8L A;  4WQM A;  1SF0 A;  3B2G A;  1KF6 B;  1SB3 C;  2WXO A;  5JXV A;  1MHX A;  1UNS A;  1SE3 A;  4JWU C;  2K0P A;  3NRZ A;  2WXK A;  3IT4 B;  2GI9 A;  1XCQ L;  2ZW1 A;  2BW2 A;  3HVZ A;  4WAF A;  4Q2J A;  5FR3 A;  2KWD A;  2E6X A;  2ON8 A;  3Q8F A;  4KGT A;  3TEW A;  1EM7 A;  1YN4 A;  2N9L A;  1MVK A;  2WDR B;  3AE8 B;  2BB6 A;  2WXF A;  3RFZ B;  1P7F A;  1XF5 L;  2PTL A;  1VZ6 A;  4KGR A;  1LO5 D;  3O13 A;  1JML A;  1TKY A;  4YWG G;  1JAL A;  1EWC A;  1NEN B;  3HRD D;  1AYF A;  1FFU A;  4US8 A;  4RNA A;  2INN E;  3AEC B;  1ZOY B;  2QEJ C;  1PYW D;  1FEH A;  3PZ8 A;  3AE3 B;  2G9H D;  1XCT L;  3U7Z A;  1P7E A;  1ROE A;  4GLS C;  3ZYY X;  5FK9 C;  1JWB D;  2K22 A;  1YQ4 B;  3TEZ A;  1N60 A;  1XLP A;  2QJL A;  4LK0 M;  4M0W A;  2KDM A;  2W82 A;  4XDD A;  2V3N A;  1DYQ A;  1DOX A;  3EA6 A;  1L4D B;  2BS4 B;  3ABV B;  3IT6 B;  1FRR A;  1QQR A;  4RF0 A;  1CQV A;  5T8I A;  2Y3A A;  3CWI A;  2AQ3 B;  1BUI C;  3GP7 A;  3C8Y A;  3P4R B;  4ARC A;  2XNA C;  1C9F A;  4RFB A;  4CQN A;  1PFD A;  2PW9 A;  4TQ0 A;  1ZP0 B;  1ZDX A;  1A70 A;  2H88 B;  1V1O A;  4DQO C;  1YJI A;  2MH7 A;  2QIL A;  3AEF B;  2RMM A;  4L1B A;  3ZQ4 A;  1V1P A;  4RGN A;  4MAC A;  1WSP A;  1FXA A;  4MH8 A;  2JSV X;  1GB4 A;  1I4R A;  3AE7 B;  1J7C A;  2EEL A;  3AED B;  4XE0 A;  5AUI A;  1TS2 A;  4RCO A;  1E9M A;  1PUT A;  3BK1 A;  3VRA B;  2LGI A;  5TSS A;  1E7P B;  3R2I A;  4ZHO A;  2BB5 A;  4HEA 1;  2VZK D;  1D5Z C;  1ZUD 2;  1SIJ A;  1RYJ A;  1E10 A;  3EUB 2;  2DLB A;  1EU3 A;  3GB1 A;  3AE4 B;  4JWS C;  1GOZ A;  1K51 A;  1N5W A;  4A8X C;  2V0G A;  1TS5 A;  2QSD A;  3BII D;  3RPF C;  1TJE A;  4B0E A;  1SEB D;  2BYT A;  3URY A;  5BYS A;  2G1E A;  3KWV A;  3LB8 C;  5H8Y E;  4XWW A;  2WS3 B;  1HEZ E;  3L4P A;  2WXM A;  4C56 C;  2Y5P A;  2Y5C A;  1KLU D;  3AE5 B;  1F2R I;  3P63 A;  1QOF A;  2Q5W D;  2L1A A;  4MT5 A;  3MFG A;  2CJN A;  2JYT A;  1QOA A;  3WCQ A;  4C80 A;  2WLB A;  3V3X A;  1TYG B;  1SJH D;  2BBC A;  1L6V A;  3ETR A;  1HZ6 A;  2RPV A;  1TKG A;  1UWM A;  3Q8E A;  3Q69 A;  4ITK A;  1KRH A;  4YSX B;  1YNT E;  4WIP A;  2I38 A;  4XWT A;  5I4D A;  1C77 A;  4ZYS A;  1B9R A;  1Q10 A;  3U4E G;  5EE3 A;  4HKZ E;  4WUR A;  1ZDV A;  4NAM A;  4ZRP A;  3FC4 A;  1C4C A;  5HFY A;  2MJE A;  2E3T A;  4YTP B;  2KN4 A;  4IDI A;  4O1N A;  2FBW B;  5MPO A;  1JQ4 A;  5EE9 A;  1NEK B;  4OZB A;  1UGJ A;  1C76 A;  1ENF A;  2NTT A;  1ZE3 D;  2BT6 A;  4YTN B;  1DOY A;  4ZHP A;  1WXQ A;  3NZ3 A;  1JWS D;  1FMA D;  3DWG C;  3BVM A;  1QLB B;  2JU6 X;  2PIA A;  3W2D A;  4JPS A;  4MM3 B;  1C79 A;  2L32 A;  3AEG B;  1D5M C;  2N9K A;  4IOI E;  4IKG A;  3P42 A;  3HUI A;  5EE1 A;  3P4Q B;  1V8C A;  4AS1 A;  2LHD A;  3I57 A;  2B76 B;  2WQY B;  2YEP F;  2K3U A;  3AM9 A;  3AE6 B;  1TS3 A;  3AE2 B;  1L5P A;  2SAK A;  3EGR A;  3MC0 B;  1STE A;  1D5X C;  1IGD A;  1N63 A;  2CU3 A;  4HJG E;  3AE1 B;  3FAH A;  3T3O A;  4KX6 B;  1TKE A;  3GS2 A;  1EU4 A;  2W54 A;  1OQQ A;  1JCK B;  1ZPS A;  3OWE B;  3R2T A;  3DWM A;  4EE2 A;  1YQ3 B;  4KGS A;  2SEB D;  3MHZ A;  1J7B A;  3AN1 A;  2WXJ A;  2GRI A;  1RM6 C;  1Y56 A;  2ONQ A;  1FIQ A;  4WWM A;  1FD6 A;  4R3D A;  2IJ0 A;  2ACZ B;  4OHJ A;  4RH6 A;  1C4A A;  1TY0 A;  5LNK 1;  4US9 A;  1PDX A;  1UUP A;  5AUK A;  3SR6 A;  1T6B X;  3ZJU A;  1B1Z A;  2BTE A;  1J7A A;  3J9C A;  4DXG A;  1JWM D;  4C7Y A;  3BYY B;  1SJE D;  2W3R A;  2KMM A;  3V05 A;  3Q8A A;  1XXG A;  2V3P A;  3FIL B;  4ZOH C;  4C7Z A;  2J52 A;  5HG2 A;  3MJ5 A;  4L2Y A;  2N7J A;  4A55 A;  1XLO A;  3IAM 1;  3T3N A;  2QIE B;  1OFF A;  3TEY A;  5EE0 A;  4YXD B;  4YTM B;  1VJK A;  4RGT A;  1NI3 A;  2J42 A;  1N61 A;  2PVO D;  1N62 A;  1SXT A;  2FUG 1;  2ICI A;  2BS3 B;  4TMA B;  1T5X D;  1IBX B;  1L0V B;  4UDU C;  2JX5 A;  1WGK A;  4ZRQ A;  2LFI A;  2WDQ B;  2DBY A;  1VZ8 A;  5H92 C;  2OHF A;  1FFV A;  1E0Z A;  1KLG D;  1I4P A;  4N59 A;  1K52 A;  1KFY B;  2VZK B;  4TSS A;  1JRO A;  1FNV A;  4OW0 A;  4OVZ A;  1VZ7 A;  4AQ7 A;  1FNW A;  4JX1 C;  4RF1 A;  5BMG A;  1TZO A;  3VR8 B;  3W9C B;  5FKA C;  1FO4 A;  2JQR B;  1RFK A;  1GPX A;  2MEK A;  3NS1 A;  1MI0 A;  5E6J A;  2XN9 C;  2NTS A;  3BVZ A;  5G5H A;  3NVZ A;  1V97 A;  1I4G A;  2M0A A;  1PGA A;  3TSS A;  2W55 A;  1F0Z A;  4KKI A;  2AQ1 B;  2V4I B;  2IPK D;  2WU2 B;  5D3I B;  1QKZ A;  2BS2 B;  3UI3 A;  4LTU A;  2MJ3 A;  4OZA A;  4YT0 B;  2WXG A;  2IGH A;  2CJO A;  1CZP A;  4P6V F;  3MP9 A;  1ESF A;  1BML C;  1FM0 D;  3FIL A;  1AN8 A;  2JYE A;  2DYO A;  1TY2 A;  3LXF A;  4PT5 A;  3LYY A;  4GDK B;  2WXP A;  1KTK A;  4LLG M;  2RDG A;  1WWT A;  3P4P B;  1MPE A;  4GDL B;  4L23 A;  1L6U A;  5BMH A;  1JRP A;  3NVY A;  1IBX A;  5BMI A;  1EWY C;  1XO3 A;  4RGO S;  3W5U B;  1GB1 A;  1TS4 A;  2J4X A;  2ZW0 A;  3VRB B;  2WXR A;  5BYQ A;  5C3J B;  1C78 A;  4YSY B;  1VRA B;  3IAS 1;  1JWA D;  5BYR A;  3AEA B;  5GXG B;  1K53 A;  2WU5 B;  1T3Q A;  1PGB A;  4TQ1 A;  3U2S C;  1AWD A;  2KQ4 X;  3VQI A;  2IGD A;  5C2T B;  3AEB B;  4A9A A;  2JZP A;  2MJD A;  2LHE A;  5G5G A;  3Q8B A;  1XEE A;  2WP9 B;  2INP E;  1I4H A;  1I7H A;  2AQ2 B;  1XLQ A;  3W1S A;  2LJI A;  2WNM A;  3TEX A;  3NUH B;  2IGG A;  1JWU D;  1NYR A;  1SE2 A;  2W3S A;  1CJE A;  2IDY A;  1ZXH A;  1CK1 A;  2I2Y A;  1N5X A;  3E56 A;  3Q8C A;  2OED A;  4RGM A;  3NVV A;  1QF6 A;  2PMV A;  2DYM A;  1OQR A;  1HQR D;  1ET6 A;  2LUM A;  4NAW B;  1WYG A;  1L0X B;  1D6E C;  1D4B A;  2WXI A;  2QMT A;  2EKI A;  2YEP B;  1BXT A;  3KLS X;  3W5V B;  2JXT A;  1C4P A;  3SFE B;  2WXN A;  4OZC A;  1ZXI A;  4HRO A;  4DXF A;  2D5G A;  4WH4 A;  3P1M A;  2AX5 A;  2H89 B;  4HRS A;  2KAC A;  3ZJT A;  5HI1 A;  4NJC A;  2LEK A;  4H2A A;  3KQ4 A;  2DWQ A;  1DOI A;  1FCL A;  4YSZ B;  2LMC A;  4JE3 B;  1FNU A;  1MHH E;  1SSN A;  2TSS A;  1F77 A;  1SBB B;  1XLN A;  2WXL A;  4KKJ A;  1I4Q A;  3HVD A;  2PKO A;  3IXS A;  1RWS A;  1QOG A;  3BZD B;  3B9J A;  1SE4 A;  4A90 A;  3AB5 A;  4XDC A;  1FXI A;  3ZJV A;  1NVI D;  1JW9 D;  2HTM E;  1YN5 A;  4FXC A;  2K5P A;  2WXQ A;  3SEB A;  1I4X A;  1NYQ A;  1R7S A;  2JWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...