3P1MA

Crystal structure of human ferredoxin-1 (fdx1) in complex with iron-sulfur cluster
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
KITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTSAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster
rcsb
source organism Homo sapiens
molecule tags Electron transport
molecule keywords Adrenodoxin, mitochondrial
total genus 30
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p1mA00
1RM6C 2CU3A 5EE3A 2WDVB 3AE7B 3AV8A 3ETRA 3VRBB 1NI3A 1TJEA 1RFKA 3P1MA 1DOIA 3B2FA 2H89B 1YJJA 3NVWA 4ZOHC 3VR8B 2MJEA 1NYRA 1B9RA 3AE9B 4WWMA 4KX6B 4HRSA 1T3QA 1WGKA 5H92C 3KWLA 3NRZA 2HTME 1QOBA 1ZP0B 1N61A 1XLPA 1N63A 1QOAA 2JQRB 3NVZA 1DOXA 3CWIA 1N5XA 2MH7A 1NYQA 5MPOA 1AYFA 4YSZB 3P4SB 2MJ3A 4JWUC 1KF6B 1XO3A 1ZOYB 1E0ZA 5G5HA 1OQRA 4A9AA 1GPXA 1PUTA 2PVGC 3HUIA 2PKOA 1JWBD 3WCQA 1FFVA 1FM0D 4HROA 1R7SA 2BS2B 2K22A 3AEDB 3HVZA 5C2TB 3SFEB 4WQMA 3AEGB 1FXAA 1ZUD2 4ZHOA 4ZHPA 1FFUA 3EUB2 4P6VF 1QT9A 2WU5B 2W55A 2Y5CA 4JWSC 2BT6A 2DBYA 3P4RB 2EKIA 2H88B 4C7YA 1I7HA 1CJEA 2M19A 2M56B 1PDXA 3LXFA 3AE2B 2KMMA 3AECB 3HRDD 4YSXB 1N62A 2MJDA 2WS3B 3FC4A 5EE9A 5C3JB 1V97A 2QJLA 1OFFA 1FRRA 2K9XA 3P4PB 1RYJA 4N58A 1FMAD 1ROEA 2FBWB 1V8CA 2BS4B 1TKGA 4YXDB 2L83A 1TYGB 1XLOA 5EE1A 4FXCA 4N6EB 3AEBB 3AEFB 1E9MA 1J7AA 3AE6B 5H8YE 2QIEB 1FO4A 1JW9D 3BIID 3SR6A 2WLBA 1CZPA 3NVYA 5G5GA 3W9CB 1VLBA 3P63A 3P4QB 2Q5WD 2DWQA 3AE4B 1AWDA 3B2GA 2KAJA 1DOYA 1E7PB 1E6EB 3AN1A 1WWTA 4YTNB 3AMZA 1XLQA 2K5PA 1TKEA 1TKYA 1FRDA 2PVOD 2E3TA 1PFDA 2CJNA 4C7ZA 5AUIA 2W54A 3LB8C 2B76B 3L4PA 1QF6A 2ACZB 1JRPA 3VR9B 1FXIA 1YQ3B 3DWMA 2PIAA 2OHFA 4N59A 3VRAB 1QOGA 1L0VB 1J7CA 2JX5A 3B9JA 3ABVB 1NENB 1VDVA 3PO0A 1OQQA 2WDRB 2WU2B 5EE0A 1SIJA 4YTMB 1VJKA 2W3SA 1YQ4B 3RPFC 4LTUA 4C80A 1SB3C 3DWGC 4USAA 1J7BA 5AUKA 1A70A 1L5PA 1N60A 2LEKA 2BS3B 2N0SB 1YJIA 4YT0B 1GAQB 1IUEA 3AE3B 3NVVA 1EWYC 4US9A 3AE5B 3W5UB 3AH7A 3AM9A 1RWSA 5GXGB 4IDIA 1QLBB 1WYGA 2CJOA 1L6VA 3AEAB 3FAHA 2G1EA 2L52A 1JROA 1N5WA 1JALA 3AE8B 4ITKA 3ZYYX 4YTPB 1NEKB 1JWAD 2WQYB 1NVID 1QOFA 1F0ZA 1WRIA 3CIRB 1KRHA 3SFDB 3AE1B 1FIQA 1SF0A 1JQ4A 2WDQB 1XLNA 3W5VB 4JX1C 1UWMA 1ZXIA 4US8A 1E10A 2AX5A 3AB5A 2W3RA 4YSYB 1KFYB 1WXQA 3AEEB 2WP9B 3NS1A 1DGJA 1L6UA
chains in the Genus database with same CATH superfamily
3JW0X 2CU3A 3Q8CA 2CHXA 1VZ7A 3ZLZA 4ZOHC 1NYRA 1V1PA 1WE6A 1EF5A 2DZKA 4FJYA 4JQWC 3TL5A 4FA6A 3ZNHB 4DK5A 1AARA 2I1KA 2QILA 5CHWA 3T3NA 2AYOB 5DPTA 3EFUA 1TBEA 1EU4A 2O6VA 2PVGC 5J18A 1QKZA 3APCA 2K22A 2MEKA 3RCZA 3E56A 3I63C 3PZ7A 1E7UA 3VH3B 4REZA 4JWSC 2BT6A 2DBYA 2AL6A 4ZYNA 4RM8A 4B6WA 2FIDA 3VVWB 1OQYA 2MP2A 4E3CA 4YSXB 1N62A 2WS3B 3PT2B 1C79A 4RM9A 3DVNV 1YN3A 2X38A 4DBGA 1C1YB 3TEYA 2D11A 5G5GA 2K3UA 4A3PA 3BZDB 2RD0A 3RNEC 3RNCC 3B2GA 3QCAA 3KUZA 2KHWB 1TKYA 2B76B 2V3SA 3OG5A 3VR9B 5KHQA 4GGQA 2N1VA 1C4PA 1WYWB 3B9JA 1D4BA 1NENB 2AWTA 3PO0A 1VJKA 4FBJB 1WR6E 3IXSA 1V49A 5JH5C 4OVUA 1E8YA 3PREA 1SJHD 3IVFA 4C56C 1L6VA 1UUPA 3DBLB 2JXXA 2O6VD 2WQYB 3HHMA 5AEKB 2MSED 1F1HA 1PGBA 1NI2A 2M0XA 3V62A 5BMIA 1V9JA 3AV8A 1IYFA 3VRBB 3N20C 2JRHA 2ZVNA 2MJEA 2GI9A 1TS4A 3OLMD 4A8XC 5D2MB 3KWVA 4LDTD 4IKGA 1LO5D 4ZDVA 2UYZB 3O13A 4RH6A 1ZDVA 1UZXB 2LI5A 4WAFA 4BAXA 2KZRA 3KLSX 1AN8A 3A33B 2CKHB 4AUQC 1P7FA 1V2YA 3U30A 4DWFA 1WXSA 4NAWA 3FC4A 2M4NA 2QJLA 2K9XA 1V8CA 3AEBB 4BVUC 4W9HA 3Q3OC 2KQ4X 5CHFA 2N7DA 1DOYA 1KH0A 5J17A 4L23A 4BZAA 1M94A 4L1BA 2CHZA 4LNFA 2L1AA 1I4HA 1K8RB 3MHSD 2OOBB 1VDVA 1TY0A 2WXIA 3MC9A 1A70A 4P1CC 4DDID 4B0EA 2NPTA 1T6BX 2MBBB 2G1EA 4ITKA 3GOEA 1KLGD 1KLUD 3BYTB 3SDLC 4WURA 4US8A 1E8XA 1ZKHA 2LFIA 2HE7A 4ICUA 3UQAA 2JZPA 4LDTB 2QEJC 1J8CA 2KTRB 1Z5SB 3A9JA 2LGDA 1HXYD 5HHDG 2BF8B 5H92C 3PHXB 3ZKJC 3OJ3A 4W9LA 3NHEB 2BKFA 2DAFA 2RDHA 1PGXA 4C00A 3ZO5B 2WGSA 2BYFA 1ENFA 2GLSA 1FEHA 2G45B 3L0WB 2KACA 4BKGA 4P7IA 2LHDA 2J0MA 1I4GA 1L7YA 2PLPA 3P2BA 1D5MC 4KDLB 3AE2B 2KMMA 3QJZA 2LASA 4URKA 5HG2A 3MJWA 5D7GA 1FMAD 1JWSD 1VR9A 4HEA1 2J52A 4GLSC 3AE6B 2O2VA 3IFWB 1YQBA 2HTHA 2KKCA 1TGZB 4HPMB 4CO7A 2IGHA 2R61A 3QWZB 1ZE3D 4LJOB 1WR1A 4MSMB 2IO1B 1J7CA 1F9JA 3L17A 2VH1A 4YTMB 4FULA 2W3SA 3NZSA 4G50A 4RGMA 4MEMA 3BVGA 1HE8A 3BWUD 4S17A 1GAQB 2KWVB 3NJTA 5IKCM 1T0QC 1FO4A 4RMAA 4NZLB 1NVID 4E71A 3Q8EA 1V5OA 3CSFA 1FIQA 1KLVA 1S1QB 1FXTB 1WGGA 2TSSA 3R3MA 2RGFA 4BOSC 2JWZA 4HLEA 3DBHI 3P1MA 3RNGC 2V0GA 2QHOA 4A20A 1LQBA 1KJTA 1ZW7A 1ET9A 3VUYA 1N61A 4OHJA 3TEXA 1HZ5A 4MT5A 4EFOA 4IWOA 5MPOA 1TZOA 3MJ5A 4K7WA 4M0WB 1ZOYB 5G5HA 1GPXA 5HFYA 3WCQA 2BS2B 1DYQA 3C19A 3RNFC 2MRPA 2GMIC 4KGRA 3ML8A 1H4RA 3GE3C 5JZEB 4HPLB 3ZRFA 4NAMA 3P4PB 4RF1A 1ROEA 5EE1A 4N6EB 2KNBA 3ALBA 4HXDA 4M0WA 3NVYA 5I4DA 1L4DB 4EOYA 1EUVB 2I1JA 1E6EB 1RAXA 1WGDA 2MA9B 4YTNB 3EA6A 2GBRA 3DBLI 4GSWA 1GJZA 3R2TA 1L0VB 5IP4D 2N1WA 1RRBA 2WDRB 4GIVA 2DAJA 4XWTA 1SB3C 2J4XA 3DPDA 1WY8A 5C23A 1YN4A 2RR9A 3AE3B 4OW0A 5FK9C 3PHWB 2NMQA 2LGIA 2K6QA 2LJ5A 2L05A 3AEAB 1WGRA 4YTPB 3NOBA 2YVCA 1QOFA 4WIPA 3TJPA 1C9FA 3UIOB 1UWMA 1YIWA 2LGSA 1ZGUB 1UNSA 1BT0A 4XE0A 4YSYB 3JVZX 3MFGA 1L6UA 4K7UA 2BYEA 1VRAB 2EMTA 3ETRA 5DPWA 2H89B 3IT4B 1R4NI 3P42A 2JVCA 3W2DA 2WXHA 2WXGA 3VAWA 3NRZA 2LVPA 1ESFA 1QOBA 2LRWA 1MJDA 1XLPA 2BVCA 2KC2A 3C8YA 4M8MA 5D6JB 1N5XA 2I2YA 2V4IB 1PYWD 2ZNVB 3DDCB 2KC1A 3HUIA 2G4DB 1R7SA 3AEDB 3PV1A 2E6XA 1FPYA 1I4RA 2KLGA 5JHBA 4IUMB 2ICIA 4EZLA 2W9NA 1I7HA 4I6PA 1GB4A 2HJ1A 3VFKA 3QHTA 4OVZA 2LXCA 1WZ3A 1EM7A 2PJHA 2DHZA 1A5RA 1IBXA 2C7MB 2K5PA 5BYQA 4MSQB 3A1QA 3KYCD 1D3ZA 4W9JA 2C9WB 2K8HA 3L08A 4KGTA 2XN9C 3Q8FA 3QARA 3EFCA 1QILA 2WWZA 2FE8A 4MACA 1SIJA 4DHZB 3PTFC 2L32A 4IC7B 4GDKB 5IN7A 5TR5A 2FCSA 3NVVA 3HIZA 4YWGG 4IM3A 3ZDTA 1RWSA 1ZXHA 4ARIA 1E7VA 3A1QB 4DXAB 1NEKB 3R7QA 1OTRB 3I3TB 2Y3AA 3KYDD 4IG7B 4ANXA 1OEYJ 1KFYB 3AEEB 3MTNB 2WP9B 3NY5A 1YD8U 1BMLC 1WM3A 1F77A 2L7RA 1E10A 1YJJA 1C78A 2GB1A 2K8BA 3VTUA 1IP9A 4NJ6A 2RPVA 4MJSB 2KANA 1QOAA 1T5XD 1K52A 1B1ZA 2XNAC 3RFZB 2V3NA 3P4SB 1ET6A 2ZPNA 1V5TA 4JE3B 5BMGA 4JGHB 1FXAA 4G11A 4WJOA 1SEBD 4XYCA 3QA8A 3ZDMC 2A4ZA 1UBQA 2W82A 2KDEB 1CJEA 5LXIB 1SE4A 3VQIA 3UGBB 1C76A 2X8XX 4IWQA 4HCPB 2KDMA 4W9EA 1MG8A 3ZUNA 1JW9D 3BIID 1GB1A 2B3AA 4HCNB 3UIPB 2DWQA 3Q3NC 2D5GA 3TIXA 1ACCA 2IY1B 3V61A 4M00A 2I38A 2BKRB 1SE2A 1WX7A 3LJ3A 3RI7C 1K53A 4O1NA 1X1MA 4AQ7A 2MBHA 4MM3B 3OAWA 1WXMA 3Q3FA 1J7BA 2K1FA 2IBIB 1H8CA 1FCCC 5GXGB 3ECIA 4ICVA 2GRIA 4C4VA 1FNWA 2JZ3B 2ZCBA 4KVGB 1JALA 3H7SA 2IGDA 4CYEA 2Y5PA 3CIRB 1KRHA 1XLNA 1P7EA 2WYQA 2DZMA 1ZPSA 3I9V1 4BBNF 3NS1A 1YN5A 1TY2A 1XCTL 2INCC 3AE7B 1EO6A 1SSNA 1FCLA 1TJEA 3V05A 2KD0A 4WWMA 4N9F4 4KIKA 3TBLD 2KWUB 4HPPA 1VZ8A 4NY0A 3QK0A 4RNAA 3NVZA 4KV2A 4PK1A 3N1ZC 1WJ6A 1KF6B 3DCGA 3DBSA 1FFVA 1FM0D 5C2TB 3H9DA 2KVRA 3Q69A 4ANWA 3DBRI 4ZHPA 2Z59B 2WU5B 3HK0A 3I57A 4L2YA 2FCMA 3AU5A 1WRDB 4KIKB 1YX5B 2M19A 2DLBA 1UH6A 3AECB 2MBOA 1S3SG 3WANA 4IOIE 4I6NB 1RYJA 1TKGA 1UGMA 1UGJA 2WLBA 3VUWA 3KW5B 3NS8A 4F1SA 5EDSA 2K8CA 3VDZA 2WX0A 3LB8C 2KN4A 2MW5A 4JL9A 3R8BA 3ZIMA 1C4CA 3EGRA 1QOGA 3C0RB 1E5WA 2AEHA 3N9YC 3Q14C 4HDOA 4BKSA 2KJHB 1HA5A 3CF6E 3U7DA 1KTKA 2BS3B 2JT4B 1YJIA 1Y8RC 3UF8A 2R2OA 1TS5A 3W5UB 2ZZPB 4IDIA 4II2B 3V3XA 3ZYYX 3ZTCA 2L0FA 5BYRA 2WDTB 3QAQA 2WX1A 3ZXRA 2N9PC 2GBMA 3D32A 1ZXIA 1J19A 4PT5A 1EF1A 1K50A 2WXFA 1YQ3B 1PQSA 3A9KB 5EE3A 1YX6B 3AU4A 2M1MA 4EE2A 3VR8B 4ARCA 3X0WA 1WM2A 5G2NA 2N9EB 2RDBC 4BKTA 3ONSA 3EECA 2LMCA 2QMTA 5G55A 4A55A 3U8ZA 4YSZB 2M8SA 4ZRJA 1MHXA 1KM7A 2PKOA 3PVLA 3QX1A 3W1SC 2QSDA 2INNE 3LDZE 3HVZA 3R66C 4WWNA 1TT5B 4ZHOA 2DX5B 2Y5CA 1IGCA 1MVKA 3PS6A 3LXFA 1V97A 4N58A 3GP7A 2L83A 1J7AA 2VH2A 1CZPA 3HM6X 3L10B 3GS2A 4BOZB 4HKQA 1WWTA 2ONQA 2E3TA 1E8ZA 5CHVC 3N1XC 3BVZA 2ACZB 3ZQ4A 1I42A 1WXAA 1XCQL 2OHFA 4QAYA 2M0AA 4NNJB 1OQQA 2M17A 3MC0B 1QZEA 2VZKB 1SE9A 3RPFC 3IAS1 4LNOA 2O2VB 2J0JA 2RPQA 5FKAC 2JXTA 3CMMB 1WGHA 4ZYSA 4HK2A 4PS3A 2L0TA 3TSSA 3FAHA 2QDFA 4RFBA 2JYEA 2JRIB 3URYA 2WNMA 1Y56A 2LGYA 1WJUA 1ZDXA 2MH7A 2C7NB 3QC8B 4GU2A 4KDIC 3ZJUA 1DOIA 3VTWA 4WWOA 3L13A 4RGOS 1IPGA 3V6CB 3KWLA 2VRRB 2HTME 4P1BC 5JHAA 4KZ0A 2JQRB 4K3BA 1DOXA 2HD5B 2D07B 2EMSA 3RZFA 4JWUC 1E0ZA 2IGGA 2LVQA 2D3BA 2D3GA 4NJCA 4OZAA 3SFEB 3DHHC 3T8MA 3TEZA 4WQMA 1T0YA 2MHJA 1C4AA 3EUB2 3B1LX 3P4RB 1WX8A 1QQRA 4C7YA 3VHTC 2UWQA 5HKHA 4GOCA 1F52A 2KVZA 2LWPA 2FBWB 2WXLA 1TYGB 3ZNGC 3WAMA 3CSTA 1VLBA 3P63A 2Q5WD 1SIFA 5KHOA 1TKEA 4R3DA 4DXFA 2W54A 2DZJA 2FAZA 1QF6A 2VZKD 1F2RC 3SD5A 2IPKD 2PIAA 4M02A 4TQ1A 2KMAA 3I5JC 3W1SA 2KX0A 1WIAA 5IO9A 2CU1A 2N0SB 3AI5A 4IW0A 2KJRA 3AE5B 5E6PA 4EUTA 3AM9A 3IG3A 4K1RB 1WYGA 4LTUA 3W9CB 1F0ZA 2FUHB 3MP9A 2WXPA 3GZNB 2J7QB 4AWJA 4B95A 1D5ZC 3K9PB 1J0GA 2L00B 1V86A 3RZWC 2BB6A 2W3RA 4IM0A 3W1YA 4HKZE 2LZ6A 1TS3A 4TSSA 5HI1A 2KWDA 1MFWA 2WHIA 3DBRB 2KT7A 1LM8B 2PEAA 2WXQA 2LXAA 4KZCA 4GDKA 2IZVB 4NAWB 2CHWA 2PPHA 1IBXB 1UWXA 4HVBA 4A9AA 1D5XC 3Q3JA 3DVNU 4HROA 1VD2A 1V81A 4YL8A 5D3IB 1MHHE 1R4NB 5LXHA 4WWPA 2Y5BB 2W55A 3ZXVA 1F2RI 3DQVA 4RF0A 2N9KA 2NCNA 3PSEB 2RMMA 3APFA 3VXWA 2OJWA 1L0YB 3ZGZA 3KQ4A 1Z2MA 4G3XB 3IT6B 3P4QB 3A4RA 3WAOA 2KDBA 1SBBB 3BYYB 3AMZA 4RGTA 1PFDA 1L4ZB 4RCOA 1V6EA 2UU7A 5BYSA 2JPHA 2MP2B 2PMVA 2JY6A 3H6NA 2OEDA 4ACFA 2WU2B 5EE0A 1GG3A 5IA7A 2Z0DB 1V1OA 1P98A 4C80A 4MJSA 5L83A 1M4VA 2KQSA 4DHZE 4MDKE 1N5WA 2J53A 2LRUA 1JQ4A 4M01A 2AX5A 3PZDA 3KH0A 4EEWA 1DGJA 1OQRA 3FILB 1JRUA 5CX3A 5E6JA 1YOVB 2K0PA 2KFKB 3H7PA 5LNK1 3AE9B 1T3QA 5LLIA 2KTFA 2A5UA 3RULA 2C60A 2CS4A 3TCAA 2WXNA 1AYFA 4FHJA 2GBKA 1NBFC 1V1PB 2IYDB 2XBBC 2EELA 4XDDA 3B0AA 4AOFA 2LD9A 1WF9A 1Q0WB 2MBEA 2INPE 3RN9C 1SJED 5DPSA 3HRDD 3JSVA 3BINA 2NVUI 3WALA 2FIFA 4OZBA 3V60A 3BK2A 4KSLC 1K51A 3RT3B 1E7PB 1G6JA 4WJPA 4UDUC 1WJNA 1UD7A 2BGFA 1MI0A 4ZRIA 1HEZE 1WJ4A 3VRAB 4GDLA 3UQBA 3A9KA 3ABVB 2C7HA 4FN2A 4E74A 4I6LB 4USAA 4M8NA 2DYBA 2K6DB 4HWIB 2ZCCA 2MBQA 3PRZA 2ZPYA 3ZVVA 3PLVA 4B9KA 1L2NA 3AE8B 2N7EA 1CK1A 4K3CA 2NS5A 2OJRA 1JWUD 3AE1B 3NG0A 4S0RA 4GMVA 4IWPA 4J3OD 4LJPB 4XDCA 2KO3A 1WZ0A 5AZFA 1WMHB 3TMPB 4NJ7A 4H2AA 4K7SA 2KDFB 4NPNA 1WSPA 4II3B 3U7ZA 4P16A 1WH3A 2LUMA 1FNVA 2K25A 3J9CA 2JU6X 1WGKA 3ZW3A 4KKJA 4GN1A 1N63A 3OWEB 4TKNA 3CWIA 1FD6A 5IOIA 1NYQA 2JUOA 1RLFA 3E9SA 2PW9A 3A4SC 1WI0A 2MX2A 2KFKA 1U4AA 4WH4A 3KVFB 2N9XA 3SHQA 3KUDB 2MJDA 1I4QA 2REXA 4WJQA 4HJGE 3FKYA 3HVDA 2MWSB 5H8YE 1E9MA 3SR6A 3GE8C 1T0RC 1MPEA 1KOTA 1WXVA 4MELA 3ZTDA 4B0MA 3ZNID 3AULA 4MH8A 4ZRQA 3VH4B 4LNIA 4XC2A 2NTTA 2AQ2B 3GB1A 4DQOC 2V4LA 3MC8A 2NPTB 4PS7A 3QQ8B 2NBUA 2DNFA 4K81A 2XEWA 2LEKA 2FCQA 2HDEA 4MH0E 2NTSA 5AZHA 3AH7A 3X23A 1SGHA 2ON8A 2KK8A 2L52A 2V3PA 3VTVA 1JWAD 1R4MB 2N9LA 2IO2B 1CMXB 2WDQB 4G0NB 1BUIC 5DCNA 3BK1A 4DXGA 2WXRA 3A9JB 1EWYC 4CHKA 2R2QA 2WDVB 1YMHE 2L3ZA 2WXJA 2BQQA 1MG4A 1VZ6A 2WXMA 4FHKA 4KKIA 2Z8LA 1ZP0B 3U52E 2KWCA 2LJIA 4XWWA 3RNAC 1BXTA 2FCNA 4FLHA 2DZIA 2KJ6A 4LK0M 1JWBD 1TS2A 1I4PA 3JSVB 1E8WA 4MGYE 2KQ7A 4AJYB 4OVVA 2EKIA 1PDXA 3OJ4B 2WXKA 3N32A 2XK5B 2JSVX 5C3JB 3T3OA 2BS4B 3PZ8A 3R7RA 3M63B 4IM2A 4NQLB 2BW2A 2JF5A 1OEYA 2YEPF 4W9FA 3NZ3A 5DPRA 2GBJA 2K39A 3L4PA 4NQKE 3DVGY 4W9KA 3DWMA 5IAAC 4Q2JA 4TMAB 1LGRA 3EC8A 3PPAA 3M3JA 4KGSA 3S2AA 1GOZA 5T8IA 4DDGD 4YT0B 3H7PB 2C5LC 2D2QA 4GDLB 3PRMB 2YLMA 3N3KB 4F7ZA 1WRIA 3DBHB 5FR3A 1AW7A 5GMVA 5J2RA 1YNTE 3W5VB 4JX1C 4WAAA 4D2KA 4MGZE 4ZRPA 2G4SA 2ZNVC 1Q5WB 4LLGM 2ZW0A 3UI3A 5C1ZA 2KOXA 3U4EG 4HDQA 1NI3A 2JZZA 3B2FA 1UBIA 4GXBA 4FJZA 2J42A 1WX9A 4ANUA 1R4MI 1I4XA 1C77A 4WQOB 5E6NA 1WMHA 2PE6B 4KSKC 3SU8X 2DENB 5D94A 2L8JA 1I35A 4W9IA 3Q3MC 3ZJVA 3DVGX 3TEWA 3V6EB 1IGDA 2RSUA 1ZUD2 1GUAB 3H1UA 1VCBA 2SAKA 1FNUA 5EE9A 2KDIA 5AZGA 3PRPB 3Q6BA 1Q10A 3RNBC 3QIJA 4AP4C 2BWFA 1XLOA 4BKSD 2QIEB 3K9OB 5FR6A 4AS1A 4GB9A 4HJKA 1WE7A 3VUXA 1JWMD 1AWDA 1EWCA 2KAJA 2GBNA 3WIMA 3AN1A 5JXVA 1XLQA 3N30A 1FRDA 2L76A 3HM3A 3APDA 4C7ZA 4F8CB 1EU3A 1FXIA 2XK5A 3O65B 2JX5A 4PYZA 2IJ0A 3DOWA 2JYTA 5AUKA 1L5PA 2D10A 2KYWA 1HQRD 4MGKE 2IY0B 4US9A 3ZJTA 1E90A 1RFAA 5CTRC 1P3QU 1TZ1A 2QCZA 3SFDB 1SF0A 1TTNA 2GOWA 4LNNA 4PYUA 1HZ6A 2G9HD 3RUIB 2G3QB 3DHIC 2V1YA 1P9DU 1RM6C 2D3AA 2BB5A 4LCDE 3Q2AC 1CQVA 3N1YC 2DYMA 3R2IA 1HTOA 4DHJD 3L16A 3PLUA 1V80A 3B08A 4RGNA 3T9LA 2MJ3A 3H8HA 1XO3A 4FADA 2ZEQA 4TQ0A 2LGXA 1Q1OA 2IDYA 2CR5A 1JMLA 1ISNA 3BY4B 3WAPA 4P6VF 3FILA 2MLBA 4ASWC 2FNJB 2ZVOA 1XF5L 2M56B 1N6ZA 2D3CA 2KTRA 4EZJA 5D3DA 2PTLA 1STEA 3Q8AA 1TIFA 4YXDB 1L0XB 4FXCA 3RMKC 3AEFB 3IAM1 2MQJA 3KUCB 3ML9A 1P1AA 4WJNA 2AQ1B 3PGEA 4OZCA 2PVOD 2CJNA 1C3TA 1JRPA 1NDDA 2WXOA 4N59A 3RD2A 4EKUA 2LVOA 3WA0A 1XXGA 1XT9B 4EZKA 5TSSA 2YEPB 2J0KA 3ZRCA 1YQ4B 2AQ3B 3DWGC 1SXTA 4W9GA 3GZNI 2INDC 1IUEA 1D6EC 1PGAA 4W9DA 3RYTA 1JCKB 3DHGC 1QLBB 1GC7A 2AL3A 2CJOA 4ANVA 1JROA 3ENEA 2KXJA 3L54A 2QC8A 4W9CA 2BTEA 4MM3A 2JWUA 4JIOU 2ZJDA 4J6IA 4JPSA 4MGIE 2IO3B 4XGAB 4ZRKA 2IO0B 1LXDA 2ZW1A 4XX5A 2BWES 1RFKA 2Z0EB 4AJWA 2DYOA 3NVWA 4C4VB 4DHJB 1B9RA 1YJ1A 3M95A 4KX6B 4HRSA 2LHEA 2SEBD 1XQQA 3NUHB 2FUG1 3M62B 2KX3A 1GC6A 2NBWB 2N7JA 2BYTA 2KN5A 3MHZA 4A6QA 1XD3B 1SE3A 1XEEA 4BBNC 1PUTA 1UF0A 3EHVA 3AEGB 1FFUA 1QT9A 1WFYA 4XZ4A 2H88B 2N4FA 4BFRA 2LUEA 2MCNB 4CQNA 4FJVB 3IBEA 3LYYA 4LNKA 1GNUA 1LFDA 3SEBA 4JLCA 2BYVE 3TUOA 1OFFA 1FRRA 2BBCA 2ASQA 3UINB 4PS8A 2KLCA 2V9HA 2NR2A 4A90A 4TV3A 2RDGA 3AE4B 5BMHA 4A3OA 1HTQA 1T0SC 3NZUA 3AXCA 5AUIA 3JYUA 1UELA 2NBVB 2BPSA 5BO4B 2HJ8A 1OGWA 3U2SC 1N60A 3BVMA 3IHPC 3Q8BA 2PE9A 2KMCA 5L95C 1WGYA 1P0RA 4X57B 2EKEC 4TUUA 5E6OA 3ZNZB 3AB5A 2KFJA 2O6VB 1WXQA
chains in the Genus database with same CATH topology
2CU3A 2WDVB 3Q8CA 1YMHE 1VRAB 3ETRA 1VZ7A 2WXJA 3ZJUA 1DOIA 2H89B 3IT4B 4ZOHC 1NYRA 1V1PA 3P42A 1VZ6A 2WXMA 2WXHA 3W2DA 4RGOS 2WXGA 4KKIA 2Z8LA 3KWLA 3NRZA 2HTME 1ESFA 1QOBA 2QILA 1ZP0B 3U52E 1XLPA 3T3NA 2JQRB 3C8YA 1DOXA 1N5XA 2LJIA 4XWWA 1BXTA 2I2YA 2V4IB 4JWUC 1PYWD 1EU4A 1E0ZA 2IGGA 4LK0M 2PVGC 3HUIA 1JWBD 1TS2A 1QKZA 4NJCA 1R7SA 1I4PA 2K22A 2MEKA 3AEDB 4OZAA 3SFEB 3TEZA 2E6XA 4WQMA 3E56A 1I4RA 3PZ7A 1C4AA 3EUB2 4REZA 2ICIA 4JWSC 2BT6A 2DBYA 3P4RB 2EKIA 1QQRA 4C7YA 1I7HA 1PDXA 1GB4A 2WXKA 4YSXB 1N62A 2WS3B 2JSVX 5C3JB 1C79A 3T3OA 2FBWB 2BS4B 1YN3A 2WXLA 1TYGB 3PZ8A 2X38A 3TEYA 4OVZA 5G5GA 2K3UA 1VLBA 3P63A 2BW2A 2Q5WD 3BZDB 1EM7A 2YEPF 1IBXA 3B2GA 3NZ3A 2K5PA 1TKEA 1TKYA 4R3DA 5BYQA 4DXFA 2W54A 2B76B 3L4PA 1QF6A 4KGTA 2VZKD 1F2RC 3VR9B 2IPKD 2XN9C 3Q8FA 3DWMA 2PIAA 4Q2JA 4TQ1A 4TMAB 1C4PA 1QILA 3B9JA 1D4BA 1NENB 3PO0A 3W1SA 2FE8A 4MACA 1SIJA 4KGSA 1VJKA 3IXSA 1GOZA 2L32A 5T8IA 2N0SB 4GDKB 4YT0B 3NVVA 1SJHD 4YWGG 3AE5B 4C56C 3AM9A 1RWSA 4GDLB 1WYGA 4LTUA 1L6VA 1UUPA 3W9CB 1ZXHA 4ARIA 1NEKB 2WQYB 1F0ZA 1WRIA 5FR3A 1AW7A 3MP9A 2WXPA 1YNTE 3W5VB 2Y3AA 1D5ZC 1PGBA 4JX1C 4D2KA 2BB6A 2W3RA 1KFYB 3AEEB 2WP9B 4ZRPA 4LLGM 1BMLC 5BMIA 4HKZE 2ZW0A 3UI3A 1TS3A 3AV8A 4TSSA 5HI1A 3U4EG 1F77A 2KWDA 3VRBB 1NI3A 3B2FA 1E10A 1YJJA 2MJEA 2GI9A 1C78A 1TS4A 2WXQA 2J42A 4A8XC 2GB1A 4NAWB 3KWVA 1I4XA 2RPVA 1C77A 4IKGA 1LO5D 1IBXB 1QOAA 1T5XD 1K52A 1B1ZA 2XNAC 1UWXA 3O13A 3RFZB 2V3NA 3P4SB 1ET6A 4JE3B 5BMGA 4A9AA 4RH6A 1ZDVA 3ZJVA 1D5XC 3TEWA 1IGDA 4HROA 5D3IB 1FXAA 1MHHE 1ZUD2 4WAFA 1SEBD 2W55A 3KLSX 1F2RI 1AN8A 4RF0A 2N9KA 2W82A 1P7FA 1CJEA 2SAKA 1FNUA 1SE4A 2RMMA 3VQIA 3FC4A 5EE9A 1C76A 2QJLA 2K9XA 1Q10A 1V8CA 1L0YB 3ZGZA 2KDMA 1XLOA 3AEBB 3KQ4A 2QIEB 1JW9D 3BIID 4AS1A 1GB1A 3IT6B 3P4QB 2KQ4X 1JWMD 2DWQA 1AWDA 1EWCA 2D5GA 1SBBB 1KH0A 2KAJA 1DOYA 3BYYB 1ACCA 3AN1A 5JXVA 3AMZA 1XLQA 4L23A 4RGTA 1FRDA 1PFDA 1L4ZB 4C7ZA 1EU3A 4L1BA 2I38A 4RCOA 1FXIA 5BYSA 2L1AA 1SE2A 2PMVA 1I4HA 1K53A 2OEDA 2JX5A 4O1NA 1VDVA 4AQ7A 2WU2B 5EE0A 4MM3B 1V1OA 4C80A 2IJ0A 1TY0A 2WXIA 1J7BA 2JYTA 5AUKA 1A70A 1L5PA 1M4VA 1HQRD 4US9A 4B0EA 3ZJTA 1FCCC 5GXGB 1T6BX 2GRIA 1FNWA 2G1EA 4ITKA 1N5WA 1JALA 1KLGD 1KLUD 2IGDA 3BYTB 2Y5PA 3CIRB 1KRHA 2J53A 3SFDB 1SF0A 1JQ4A 1XLNA 1P7EA 4WURA 4US8A 1ZPSA 2AX5A 3I9V1 1HZ6A 2G9HD 2LFIA 3NS1A 1DGJA 1OQRA 3FILB 1YN5A 1RM6C 1TY2A 1XCTL 2BB5A 3AE7B 1SSNA 1FCLA 5E6JA 1TJEA 2JZPA 2K0PA 2QEJC 1CQVA 1L6UA 3V05A 5LNK1 3AE9B 4WWMA 2DYMA 1T3QA 1HXYD 5HHDG 5H92C 1VZ8A 3R2IA 2RDHA 1PGXA 4RNAA 3NVZA 2WXNA 1AYFA 1ENFA 4RGNA 2MJ3A 3H8HA 1KF6B 1XO3A 4TQ0A 1V1PB 1FEHA 2EELA 1FFVA 2IDYA 1FM0D 4XDDA 5C2TB 2KACA 3Q69A 1JMLA 2LHDA 4ZHPA 1I4GA 4P6VF 2WU5B 3FILA 3I57A 4L2YA 2INPE 2PLPA 1XF5L 1D5MC 2DLBA 2M19A 2M56B 3AE2B 1SJED 2KMMA 3AECB 3HRDD 5D3DA 2PTLA 5HG2A 1STEA 4IOIE 3Q8AA 1RYJA 5D7GA 1FMAD 1JWSD 1TKGA 1VR9A 4HEA1 2J52A 4GLSC 4YXDB 1L0XB 4FXCA 3AEFB 3AE6B 2WLBA 1UGJA 4OZBA 3IAM1 3BK2A 1K51A 2AQ1B 1E7PB 4OZCA 2PVOD 2CJNA 2IGHA 2R61A 3LB8C 4UDUC 2KN4A 1JRPA 1ZE3D 1MI0A 1HEZE 3R8BA 2WXOA 1C4CA 4N59A 3EGRA 3VRAB 1QOGA 1J7CA 3ABVB 4YTMB 1XXGA 2W3SA 5TSSA 2YEPB 4RGMA 1YQ4B 3N9YC 4USAA 2AQ3B 3DWGC 1HA5A 1SXTA 3BVGA 3BWUD 1KTKA 2BS3B 1YJIA 1GAQB 1IUEA 1D6EC 1PGAA 1TS5A 3W5UB 1JCKB 4IDIA 1QLBB 3V3XA 2CJOA 1FO4A 3ZYYX 1JROA 3AE8B 1CK1A 5BYRA 4NZLB 1NVID 3Q8EA 1JWUD 3AE1B 1FIQA 2BTEA 1ZXIA 4J3OD 2JWUA 4XDCA 4PT5A 1K50A 2TSSA 2WXFA 1YQ3B 4JPSA 4H2AA 5EE3A 1WSPA 2ZW1A 4EE2A 1RFKA 3P1MA 3U7ZA 2DYOA 3NVWA 4P16A 2LUMA 3VR8B 1FNVA 2V0GA 4ARCA 1B9RA 3J9CA 2JU6X 1ET9A 4KX6B 4HRSA 2LHEA 2SEBD 3NUHB 1WGKA 4KKJA 1N61A 4OHJA 3TEXA 1HZ5A 1N63A 4MT5A 2FUG1 3OWEB 2LMCA 2QMTA 3CWIA 1FD6A 1NYQA 5MPOA 2N7JA 4A55A 4YSZB 2BYTA 1TZOA 3MJ5A 3MHZA 4A6QA 3E9SA 1SE3A 1ZOYB 2PW9A 1MHXA 1XEEA 5G5HA 1GPXA 1PUTA 5HFYA 2PKOA 2QSDA 3WCQA 2INNE 2BS2B 3HVZA 1DYQA 3AEGB 4WH4A 4ZHOA 1FFUA 1QT9A 2Y5CA 1IGCA 1MVKA 2H88B 4CQNA 4KGRA 3LYYA 3LXFA 2MJDA 3SEBA 1I4QA 1V97A 4HJGE 1OFFA 1FRRA 4NAMA 3TUOA 3P4PB 3HVDA 4N58A 3GP7A 4RF1A 1ROEA 2BBCA 2L83A 5EE1A 5H8YE 4N6EB 1E9MA 1J7AA 4M0WA 3SR6A 1CZPA 3NVYA 1MPEA 5I4DA 1L4DB 4A90A 2RDGA 3AE4B 3GS2A 5BMHA 1E6EB 4HKQA 1WWTA 2ONQA 4YTNB 2E3TA 5AUIA 3EA6A 4B0MA 3BVZA 2ACZB 3ZQ4A 4MH8A 4ZRQA 2NTTA 2AQ2B 1XCQL 3R2TA 2OHFA 3GB1A 4DQOC 1L0VB 2M0AA 1OQQA 2WDRB 3MC0B 2VZKB 3RPFC 3IAS1 4XWTA 1SB3C 3U2SC 2J4XA 1N60A 2LEKA 2HDEA 3BVMA 5FKAC 2JXTA 1YN4A 3AE3B 4OW0A 5FK9C 2NTSA 2NMQA 4ZYSA 2LGIA 3AH7A 2ON8A 3TSSA 3Q8BA 3FAHA 3AEAB 2L52A 2V3PA 4YTPB 1JWAD 1QOFA 2N9LA 4RFBA 4WIPA 2JYEA 1C9FA 2WDQB 1BUIC 2WNMA 3URYA 1UWMA 1Y56A 3BK1A 4DXGA 2WXRA 3AB5A 1UNSA 4XE0A 4YSYB 1WXQA 1ZDXA 3MFGA 1EWYC 2MH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM6 C;  2CU3 A;  5EE3 A;  2WDV B;  3AE7 B;  3AV8 A;  3ETR A;  3VRB B;  1NI3 A;  1TJE A;  1RFK A;  3P1M A;  1DOI A;  3B2F A;  2H89 B;  1YJJ A;  3NVW A;  4ZOH C;  3VR8 B;  2MJE A;  1NYR A;  1B9R A;  3AE9 B;  4WWM A;  4KX6 B;  4HRS A;  1T3Q A;  1WGK A;  5H92 C;  3KWL A;  3NRZ A;  2HTM E;  1QOB A;  1ZP0 B;  1N61 A;  1XLP A;  1N63 A;  1QOA A;  2JQR B;  3NVZ A;  1DOX A;  3CWI A;  1N5X A;  2MH7 A;  1NYQ A;  5MPO A;  1AYF A;  4YSZ B;  3P4S B;  2MJ3 A;  4JWU C;  1KF6 B;  1XO3 A;  1ZOY B;  1E0Z A;  5G5H A;  1OQR A;  4A9A A;  1GPX A;  1PUT A;  2PVG C;  3HUI A;  2PKO A;  1JWB D;  3WCQ A;  1FFV A;  1FM0 D;  4HRO A;  1R7S A;  2BS2 B;  2K22 A;  3AED B;  3HVZ A;  5C2T B;  3SFE B;  4WQM A;  3AEG B;  1FXA A;  1ZUD 2;  4ZHO A;  4ZHP A;  1FFU A;  3EUB 2;  4P6V F;  1QT9 A;  2WU5 B;  2W55 A;  2Y5C A;  4JWS C;  2BT6 A;  2DBY A;  3P4R B;  2EKI A;  2H88 B;  4C7Y A;  1I7H A;  1CJE A;  2M19 A;  2M56 B;  1PDX A;  3LXF A;  3AE2 B;  2KMM A;  3AEC B;  3HRD D;  4YSX B;  1N62 A;  2MJD A;  2WS3 B;  3FC4 A;  5EE9 A;  5C3J B;  1V97 A;  2QJL A;  1OFF A;  1FRR A;  2K9X A;  3P4P B;  1RYJ A;  4N58 A;  1FMA D;  1ROE A;  2FBW B;  1V8C A;  2BS4 B;  1TKG A;  4YXD B;  2L83 A;  1TYG B;  1XLO A;  5EE1 A;  4FXC A;  4N6E B;  3AEB B;  3AEF B;  1E9M A;  1J7A A;  3AE6 B;  5H8Y E;  2QIE B;  1FO4 A;  1JW9 D;  3BII D;  3SR6 A;  2WLB A;  1CZP A;  3NVY A;  5G5G A;  3W9C B;  1VLB A;  3P63 A;  3P4Q B;  2Q5W D;  2DWQ A;  3AE4 B;  1AWD A;  3B2G A;  2KAJ A;  1DOY A;  1E7P B;  1E6E B;  3AN1 A;  1WWT A;  4YTN B;  3AMZ A;  1XLQ A;  2K5P A;  1TKE A;  1TKY A;  1FRD A;  2PVO D;  2E3T A;  1PFD A;  2CJN A;  4C7Z A;  5AUI A;  2W54 A;  3LB8 C;  2B76 B;  3L4P A;  1QF6 A;  2ACZ B;  1JRP A;  3VR9 B;  1FXI A;  1YQ3 B;  3DWM A;  2PIA A;  2OHF A;  4N59 A;  3VRA B;  1QOG A;  1L0V B;  1J7C A;  2JX5 A;  3B9J A;  3ABV B;  1NEN B;  1VDV A;  3PO0 A;  1OQQ A;  2WDR B;  2WU2 B;  5EE0 A;  1SIJ A;  4YTM B;  1VJK A;  2W3S A;  1YQ4 B;  3RPF C;  4LTU A;  4C80 A;  1SB3 C;  3DWG C;  4USA A;  1J7B A;  5AUK A;  1A70 A;  1L5P A;  1N60 A;  2LEK A;  2BS3 B;  2N0S B;  1YJI A;  4YT0 B;  1GAQ B;  1IUE A;  3AE3 B;  3NVV A;  1EWY C;  4US9 A;  3AE5 B;  3W5U B;  3AH7 A;  3AM9 A;  1RWS A;  5GXG B;  4IDI A;  1QLB B;  1WYG A;  2CJO A;  1L6V A;  3AEA B;  3FAH A;  2G1E A;  2L52 A;  1JRO A;  1N5W A;  1JAL A;  3AE8 B;  4ITK A;  3ZYY X;  4YTP B;  1NEK B;  1JWA D;  2WQY B;  1NVI D;  1QOF A;  1F0Z A;  1WRI A;  3CIR B;  1KRH A;  3SFD B;  3AE1 B;  1FIQ A;  1SF0 A;  1JQ4 A;  2WDQ B;  1XLN A;  3W5V B;  4JX1 C;  1UWM A;  1ZXI A;  4US8 A;  1E10 A;  2AX5 A;  3AB5 A;  2W3R A;  4YSY B;  1KFY B;  1WXQ A;  3AEE B;  2WP9 B;  3NS1 A;  1DGJ A;  1L6U A; 
#chains in the Genus database with same CATH topology
 3JW0 X;  2CU3 A;  3Q8C A;  2CHX A;  1VZ7 A;  3ZLZ A;  4ZOH C;  1NYR A;  1V1P A;  1WE6 A;  1EF5 A;  2DZK A;  4FJY A;  4JQW C;  3TL5 A;  4FA6 A;  3ZNH B;  4DK5 A;  1AAR A;  2I1K A;  2QIL A;  5CHW A;  3T3N A;  2AYO B;  5DPT A;  3EFU A;  1TBE A;  1EU4 A;  2O6V A;  2PVG C;  5J18 A;  1QKZ A;  3APC A;  2K22 A;  2MEK A;  3RCZ A;  3E56 A;  3I63 C;  3PZ7 A;  1E7U A;  3VH3 B;  4REZ A;  4JWS C;  2BT6 A;  2DBY A;  2AL6 A;  4ZYN A;  4RM8 A;  4B6W A;  2FID A;  3VVW B;  1OQY A;  2MP2 A;  4E3C A;  4YSX B;  1N62 A;  2WS3 B;  3PT2 B;  1C79 A;  4RM9 A;  3DVN V;  1YN3 A;  2X38 A;  4DBG A;  1C1Y B;  3TEY A;  2D11 A;  5G5G A;  2K3U A;  4A3P A;  3BZD B;  2RD0 A;  3RNE C;  3RNC C;  3B2G A;  3QCA A;  3KUZ A;  2KHW B;  1TKY A;  2B76 B;  2V3S A;  3OG5 A;  3VR9 B;  5KHQ A;  4GGQ A;  2N1V A;  1C4P A;  1WYW B;  3B9J A;  1D4B A;  1NEN B;  2AWT A;  3PO0 A;  1VJK A;  4FBJ B;  1WR6 E;  3IXS A;  1V49 A;  5JH5 C;  4OVU A;  1E8Y A;  3PRE A;  1SJH D;  3IVF A;  4C56 C;  1L6V A;  1UUP A;  3DBL B;  2JXX A;  2O6V D;  2WQY B;  3HHM A;  5AEK B;  2MSE D;  1F1H A;  1PGB A;  1NI2 A;  2M0X A;  3V62 A;  5BMI A;  1V9J A;  3AV8 A;  1IYF A;  3VRB B;  3N20 C;  2JRH A;  2ZVN A;  2MJE A;  2GI9 A;  1TS4 A;  3OLM D;  4A8X C;  5D2M B;  3KWV A;  4LDT D;  4IKG A;  1LO5 D;  4ZDV A;  2UYZ B;  3O13 A;  4RH6 A;  1ZDV A;  1UZX B;  2LI5 A;  4WAF A;  4BAX A;  2KZR A;  3KLS X;  1AN8 A;  3A33 B;  2CKH B;  4AUQ C;  1P7F A;  1V2Y A;  3U30 A;  4DWF A;  1WXS A;  4NAW A;  3FC4 A;  2M4N A;  2QJL A;  2K9X A;  1V8C A;  3AEB B;  4BVU C;  4W9H A;  3Q3O C;  2KQ4 X;  5CHF A;  2N7D A;  1DOY A;  1KH0 A;  5J17 A;  4L23 A;  4BZA A;  1M94 A;  4L1B A;  2CHZ A;  4LNF A;  2L1A A;  1I4H A;  1K8R B;  3MHS D;  2OOB B;  1VDV A;  1TY0 A;  2WXI A;  3MC9 A;  1A70 A;  4P1C C;  4DDI D;  4B0E A;  2NPT A;  1T6B X;  2MBB B;  2G1E A;  4ITK A;  3GOE A;  1KLG D;  1KLU D;  3BYT B;  3SDL C;  4WUR A;  4US8 A;  1E8X A;  1ZKH A;  2LFI A;  2HE7 A;  4ICU A;  3UQA A;  2JZP A;  4LDT B;  2QEJ C;  1J8C A;  2KTR B;  1Z5S B;  3A9J A;  2LGD A;  1HXY D;  5HHD G;  2BF8 B;  5H92 C;  3PHX B;  3ZKJ C;  3OJ3 A;  4W9L A;  3NHE B;  2BKF A;  2DAF A;  2RDH A;  1PGX A;  4C00 A;  3ZO5 B;  2WGS A;  2BYF A;  1ENF A;  2GLS A;  1FEH A;  2G45 B;  3L0W B;  2KAC A;  4BKG A;  4P7I A;  2LHD A;  2J0M A;  1I4G A;  1L7Y A;  2PLP A;  3P2B A;  1D5M C;  4KDL B;  3AE2 B;  2KMM A;  3QJZ A;  2LAS A;  4URK A;  5HG2 A;  3MJW A;  5D7G A;  1FMA D;  1JWS D;  1VR9 A;  4HEA 1;  2J52 A;  4GLS C;  3AE6 B;  2O2V A;  3IFW B;  1YQB A;  2HTH A;  2KKC A;  1TGZ B;  4HPM B;  4CO7 A;  2IGH A;  2R61 A;  3QWZ B;  1ZE3 D;  4LJO B;  1WR1 A;  4MSM B;  2IO1 B;  1J7C A;  1F9J A;  3L17 A;  2VH1 A;  4YTM B;  4FUL A;  2W3S A;  3NZS A;  4G50 A;  4RGM A;  4MEM A;  3BVG A;  1HE8 A;  3BWU D;  4S17 A;  1GAQ B;  2KWV B;  3NJT A;  5IKC M;  1T0Q C;  1FO4 A;  4RMA A;  4NZL B;  1NVI D;  4E71 A;  3Q8E A;  1V5O A;  3CSF A;  1FIQ A;  1KLV A;  1S1Q B;  1FXT B;  1WGG A;  2TSS A;  3R3M A;  2RGF A;  4BOS C;  2JWZ A;  4HLE A;  3DBH I;  3P1M A;  3RNG C;  2V0G A;  2QHO A;  4A20 A;  1LQB A;  1KJT A;  1ZW7 A;  1ET9 A;  3VUY A;  1N61 A;  4OHJ A;  3TEX A;  1HZ5 A;  4MT5 A;  4EFO A;  4IWO A;  5MPO A;  1TZO A;  3MJ5 A;  4K7W A;  4M0W B;  1ZOY B;  5G5H A;  1GPX A;  5HFY A;  3WCQ A;  2BS2 B;  1DYQ A;  3C19 A;  3RNF C;  2MRP A;  2GMI C;  4KGR A;  3ML8 A;  1H4R A;  3GE3 C;  5JZE B;  4HPL B;  3ZRF A;  4NAM A;  3P4P B;  4RF1 A;  1ROE A;  5EE1 A;  4N6E B;  2KNB A;  3ALB A;  4HXD A;  4M0W A;  3NVY A;  5I4D A;  1L4D B;  4EOY A;  1EUV B;  2I1J A;  1E6E B;  1RAX A;  1WGD A;  2MA9 B;  4YTN B;  3EA6 A;  2GBR A;  3DBL I;  4GSW A;  1GJZ A;  3R2T A;  1L0V B;  5IP4 D;  2N1W A;  1RRB A;  2WDR B;  4GIV A;  2DAJ A;  4XWT A;  1SB3 C;  2J4X A;  3DPD A;  1WY8 A;  5C23 A;  1YN4 A;  2RR9 A;  3AE3 B;  4OW0 A;  5FK9 C;  3PHW B;  2NMQ A;  2LGI A;  2K6Q A;  2LJ5 A;  2L05 A;  3AEA B;  1WGR A;  4YTP B;  3NOB A;  2YVC A;  1QOF A;  4WIP A;  3TJP A;  1C9F A;  3UIO B;  1UWM A;  1YIW A;  2LGS A;  1ZGU B;  1UNS A;  1BT0 A;  4XE0 A;  4YSY B;  3JVZ X;  3MFG A;  1L6U A;  4K7U A;  2BYE A;  1VRA B;  2EMT A;  3ETR A;  5DPW A;  2H89 B;  3IT4 B;  1R4N I;  3P42 A;  2JVC A;  3W2D A;  2WXH A;  2WXG A;  3VAW A;  3NRZ A;  2LVP A;  1ESF A;  1QOB A;  2LRW A;  1MJD A;  1XLP A;  2BVC A;  2KC2 A;  3C8Y A;  4M8M A;  5D6J B;  1N5X A;  2I2Y A;  2V4I B;  1PYW D;  2ZNV B;  3DDC B;  2KC1 A;  3HUI A;  2G4D B;  1R7S A;  3AED B;  3PV1 A;  2E6X A;  1FPY A;  1I4R A;  2KLG A;  5JHB A;  4IUM B;  2ICI A;  4EZL A;  2W9N A;  1I7H A;  4I6P A;  1GB4 A;  2HJ1 A;  3VFK A;  3QHT A;  4OVZ A;  2LXC A;  1WZ3 A;  1EM7 A;  2PJH A;  2DHZ A;  1A5R A;  1IBX A;  2C7M B;  2K5P A;  5BYQ A;  4MSQ B;  3A1Q A;  3KYC D;  1D3Z A;  4W9J A;  2C9W B;  2K8H A;  3L08 A;  4KGT A;  2XN9 C;  3Q8F A;  3QAR A;  3EFC A;  1QIL A;  2WWZ A;  2FE8 A;  4MAC A;  1SIJ A;  4DHZ B;  3PTF C;  2L32 A;  4IC7 B;  4GDK B;  5IN7 A;  5TR5 A;  2FCS A;  3NVV A;  3HIZ A;  4YWG G;  4IM3 A;  3ZDT A;  1RWS A;  1ZXH A;  4ARI A;  1E7V A;  3A1Q B;  4DXA B;  1NEK B;  3R7Q A;  1OTR B;  3I3T B;  2Y3A A;  3KYD D;  4IG7 B;  4ANX A;  1OEY J;  1KFY B;  3AEE B;  3MTN B;  2WP9 B;  3NY5 A;  1YD8 U;  1BML C;  1WM3 A;  1F77 A;  2L7R A;  1E10 A;  1YJJ A;  1C78 A;  2GB1 A;  2K8B A;  3VTU A;  1IP9 A;  4NJ6 A;  2RPV A;  4MJS B;  2KAN A;  1QOA A;  1T5X D;  1K52 A;  1B1Z A;  2XNA C;  3RFZ B;  2V3N A;  3P4S B;  1ET6 A;  2ZPN A;  1V5T A;  4JE3 B;  5BMG A;  4JGH B;  1FXA A;  4G11 A;  4WJO A;  1SEB D;  4XYC A;  3QA8 A;  3ZDM C;  2A4Z A;  1UBQ A;  2W82 A;  2KDE B;  1CJE A;  5LXI B;  1SE4 A;  3VQI A;  3UGB B;  1C76 A;  2X8X X;  4IWQ A;  4HCP B;  2KDM A;  4W9E A;  1MG8 A;  3ZUN A;  1JW9 D;  3BII D;  1GB1 A;  2B3A A;  4HCN B;  3UIP B;  2DWQ A;  3Q3N C;  2D5G A;  3TIX A;  1ACC A;  2IY1 B;  3V61 A;  4M00 A;  2I38 A;  2BKR B;  1SE2 A;  1WX7 A;  3LJ3 A;  3RI7 C;  1K53 A;  4O1N A;  1X1M A;  4AQ7 A;  2MBH A;  4MM3 B;  3OAW A;  1WXM A;  3Q3F A;  1J7B A;  2K1F A;  2IBI B;  1H8C A;  1FCC C;  5GXG B;  3ECI A;  4ICV A;  2GRI A;  4C4V A;  1FNW A;  2JZ3 B;  2ZCB A;  4KVG B;  1JAL A;  3H7S A;  2IGD A;  4CYE A;  2Y5P A;  3CIR B;  1KRH A;  1XLN A;  1P7E A;  2WYQ A;  2DZM A;  1ZPS A;  3I9V 1;  4BBN F;  3NS1 A;  1YN5 A;  1TY2 A;  1XCT L;  2INC C;  3AE7 B;  1EO6 A;  1SSN A;  1FCL A;  1TJE A;  3V05 A;  2KD0 A;  4WWM A;  4N9F 4;  4KIK A;  3TBL D;  2KWU B;  4HPP A;  1VZ8 A;  4NY0 A;  3QK0 A;  4RNA A;  3NVZ A;  4KV2 A;  4PK1 A;  3N1Z C;  1WJ6 A;  1KF6 B;  3DCG A;  3DBS A;  1FFV A;  1FM0 D;  5C2T B;  3H9D A;  2KVR A;  3Q69 A;  4ANW A;  3DBR I;  4ZHP A;  2Z59 B;  2WU5 B;  3HK0 A;  3I57 A;  4L2Y A;  2FCM A;  3AU5 A;  1WRD B;  4KIK B;  1YX5 B;  2M19 A;  2DLB A;  1UH6 A;  3AEC B;  2MBO A;  1S3S G;  3WAN A;  4IOI E;  4I6N B;  1RYJ A;  1TKG A;  1UGM A;  1UGJ A;  2WLB A;  3VUW A;  3KW5 B;  3NS8 A;  4F1S A;  5EDS A;  2K8C A;  3VDZ A;  2WX0 A;  3LB8 C;  2KN4 A;  2MW5 A;  4JL9 A;  3R8B A;  3ZIM A;  1C4C A;  3EGR A;  1QOG A;  3C0R B;  1E5W A;  2AEH A;  3N9Y C;  3Q14 C;  4HDO A;  4BKS A;  2KJH B;  1HA5 A;  3CF6 E;  3U7D A;  1KTK A;  2BS3 B;  2JT4 B;  1YJI A;  1Y8R C;  3UF8 A;  2R2O A;  1TS5 A;  3W5U B;  2ZZP B;  4IDI A;  4II2 B;  3V3X A;  3ZYY X;  3ZTC A;  2L0F A;  5BYR A;  2WDT B;  3QAQ A;  2WX1 A;  3ZXR A;  2N9P C;  2GBM A;  3D32 A;  1ZXI A;  1J19 A;  4PT5 A;  1EF1 A;  1K50 A;  2WXF A;  1YQ3 B;  1PQS A;  3A9K B;  5EE3 A;  1YX6 B;  3AU4 A;  2M1M A;  4EE2 A;  3VR8 B;  4ARC A;  3X0W A;  1WM2 A;  5G2N A;  2N9E B;  2RDB C;  4BKT A;  3ONS A;  3EEC A;  2LMC A;  2QMT A;  5G55 A;  4A55 A;  3U8Z A;  4YSZ B;  2M8S A;  4ZRJ A;  1MHX A;  1KM7 A;  2PKO A;  3PVL A;  3QX1 A;  3W1S C;  2QSD A;  2INN E;  3LDZ E;  3HVZ A;  3R66 C;  4WWN A;  1TT5 B;  4ZHO A;  2DX5 B;  2Y5C A;  1IGC A;  1MVK A;  3PS6 A;  3LXF A;  1V97 A;  4N58 A;  3GP7 A;  2L83 A;  1J7A A;  2VH2 A;  1CZP A;  3HM6 X;  3L10 B;  3GS2 A;  4BOZ B;  4HKQ A;  1WWT A;  2ONQ A;  2E3T A;  1E8Z A;  5CHV C;  3N1X C;  3BVZ A;  2ACZ B;  3ZQ4 A;  1I42 A;  1WXA A;  1XCQ L;  2OHF A;  4QAY A;  2M0A A;  4NNJ B;  1OQQ A;  2M17 A;  3MC0 B;  1QZE A;  2VZK B;  1SE9 A;  3RPF C;  3IAS 1;  4LNO A;  2O2V B;  2J0J A;  2RPQ A;  5FKA C;  2JXT A;  3CMM B;  1WGH A;  4ZYS A;  4HK2 A;  4PS3 A;  2L0T A;  3TSS A;  3FAH A;  2QDF A;  4RFB A;  2JYE A;  2JRI B;  3URY A;  2WNM A;  1Y56 A;  2LGY A;  1WJU A;  1ZDX A;  2MH7 A;  2C7N B;  3QC8 B;  4GU2 A;  4KDI C;  3ZJU A;  1DOI A;  3VTW A;  4WWO A;  3L13 A;  4RGO S;  1IPG A;  3V6C B;  3KWL A;  2VRR B;  2HTM E;  4P1B C;  5JHA A;  4KZ0 A;  2JQR B;  4K3B A;  1DOX A;  2HD5 B;  2D07 B;  2EMS A;  3RZF A;  4JWU C;  1E0Z A;  2IGG A;  2LVQ A;  2D3B A;  2D3G A;  4NJC A;  4OZA A;  3SFE B;  3DHH C;  3T8M A;  3TEZ A;  4WQM A;  1T0Y A;  2MHJ A;  1C4A A;  3EUB 2;  3B1L X;  3P4R B;  1WX8 A;  1QQR A;  4C7Y A;  3VHT C;  2UWQ A;  5HKH A;  4GOC A;  1F52 A;  2KVZ A;  2LWP A;  2FBW B;  2WXL A;  1TYG B;  3ZNG C;  3WAM A;  3CST A;  1VLB A;  3P63 A;  2Q5W D;  1SIF A;  5KHO A;  1TKE A;  4R3D A;  4DXF A;  2W54 A;  2DZJ A;  2FAZ A;  1QF6 A;  2VZK D;  1F2R C;  3SD5 A;  2IPK D;  2PIA A;  4M02 A;  4TQ1 A;  2KMA A;  3I5J C;  3W1S A;  2KX0 A;  1WIA A;  5IO9 A;  2CU1 A;  2N0S B;  3AI5 A;  4IW0 A;  2KJR A;  3AE5 B;  5E6P A;  4EUT A;  3AM9 A;  3IG3 A;  4K1R B;  1WYG A;  4LTU A;  3W9C B;  1F0Z A;  2FUH B;  3MP9 A;  2WXP A;  3GZN B;  2J7Q B;  4AWJ A;  4B95 A;  1D5Z C;  3K9P B;  1J0G A;  2L00 B;  1V86 A;  3RZW C;  2BB6 A;  2W3R A;  4IM0 A;  3W1Y A;  4HKZ E;  2LZ6 A;  1TS3 A;  4TSS A;  5HI1 A;  2KWD A;  1MFW A;  2WHI A;  3DBR B;  2KT7 A;  1LM8 B;  2PEA A;  2WXQ A;  2LXA A;  4KZC A;  4GDK A;  2IZV B;  4NAW B;  2CHW A;  2PPH A;  1IBX B;  1UWX A;  4HVB A;  4A9A A;  1D5X C;  3Q3J A;  3DVN U;  4HRO A;  1VD2 A;  1V81 A;  4YL8 A;  5D3I B;  1MHH E;  1R4N B;  5LXH A;  4WWP A;  2Y5B B;  2W55 A;  3ZXV A;  1F2R I;  3DQV A;  4RF0 A;  2N9K A;  2NCN A;  3PSE B;  2RMM A;  3APF A;  3VXW A;  2OJW A;  1L0Y B;  3ZGZ A;  3KQ4 A;  1Z2M A;  4G3X B;  3IT6 B;  3P4Q B;  3A4R A;  3WAO A;  2KDB A;  1SBB B;  3BYY B;  3AMZ A;  4RGT A;  1PFD A;  1L4Z B;  4RCO A;  1V6E A;  2UU7 A;  5BYS A;  2JPH A;  2MP2 B;  2PMV A;  2JY6 A;  3H6N A;  2OED A;  4ACF A;  2WU2 B;  5EE0 A;  1GG3 A;  5IA7 A;  2Z0D B;  1V1O A;  1P98 A;  4C80 A;  4MJS A;  5L83 A;  1M4V A;  2KQS A;  4DHZ E;  4MDK E;  1N5W A;  2J53 A;  2LRU A;  1JQ4 A;  4M01 A;  2AX5 A;  3PZD A;  3KH0 A;  4EEW A;  1DGJ A;  1OQR A;  3FIL B;  1JRU A;  5CX3 A;  5E6J A;  1YOV B;  2K0P A;  2KFK B;  3H7P A;  5LNK 1;  3AE9 B;  1T3Q A;  5LLI A;  2KTF A;  2A5U A;  3RUL A;  2C60 A;  2CS4 A;  3TCA A;  2WXN A;  1AYF A;  4FHJ A;  2GBK A;  1NBF C;  1V1P B;  2IYD B;  2XBB C;  2EEL A;  4XDD A;  3B0A A;  4AOF A;  2LD9 A;  1WF9 A;  1Q0W B;  2MBE A;  2INP E;  3RN9 C;  1SJE D;  5DPS A;  3HRD D;  3JSV A;  3BIN A;  2NVU I;  3WAL A;  2FIF A;  4OZB A;  3V60 A;  3BK2 A;  4KSL C;  1K51 A;  3RT3 B;  1E7P B;  1G6J A;  4WJP A;  4UDU C;  1WJN A;  1UD7 A;  2BGF A;  1MI0 A;  4ZRI A;  1HEZ E;  1WJ4 A;  3VRA B;  4GDL A;  3UQB A;  3A9K A;  3ABV B;  2C7H A;  4FN2 A;  4E74 A;  4I6L B;  4USA A;  4M8N A;  2DYB A;  2K6D B;  4HWI B;  2ZCC A;  2MBQ A;  3PRZ A;  2ZPY A;  3ZVV A;  3PLV A;  4B9K A;  1L2N A;  3AE8 B;  2N7E A;  1CK1 A;  4K3C A;  2NS5 A;  2OJR A;  1JWU D;  3AE1 B;  3NG0 A;  4S0R A;  4GMV A;  4IWP A;  4J3O D;  4LJP B;  4XDC A;  2KO3 A;  1WZ0 A;  5AZF A;  1WMH B;  3TMP B;  4NJ7 A;  4H2A A;  4K7S A;  2KDF B;  4NPN A;  1WSP A;  4II3 B;  3U7Z A;  4P16 A;  1WH3 A;  2LUM A;  1FNV A;  2K25 A;  3J9C A;  2JU6 X;  1WGK A;  3ZW3 A;  4KKJ A;  4GN1 A;  1N63 A;  3OWE B;  4TKN A;  3CWI A;  1FD6 A;  5IOI A;  1NYQ A;  2JUO A;  1RLF A;  3E9S A;  2PW9 A;  3A4S C;  1WI0 A;  2MX2 A;  2KFK A;  1U4A A;  4WH4 A;  3KVF B;  2N9X A;  3SHQ A;  3KUD B;  2MJD A;  1I4Q A;  2REX A;  4WJQ A;  4HJG E;  3FKY A;  3HVD A;  2MWS B;  5H8Y E;  1E9M A;  3SR6 A;  3GE8 C;  1T0R C;  1MPE A;  1KOT A;  1WXV A;  4MEL A;  3ZTD A;  4B0M A;  3ZNI D;  3AUL A;  4MH8 A;  4ZRQ A;  3VH4 B;  4LNI A;  4XC2 A;  2NTT A;  2AQ2 B;  3GB1 A;  4DQO C;  2V4L A;  3MC8 A;  2NPT B;  4PS7 A;  3QQ8 B;  2NBU A;  2DNF A;  4K81 A;  2XEW A;  2LEK A;  2FCQ A;  2HDE A;  4MH0 E;  2NTS A;  5AZH A;  3AH7 A;  3X23 A;  1SGH A;  2ON8 A;  2KK8 A;  2L52 A;  2V3P A;  3VTV A;  1JWA D;  1R4M B;  2N9L A;  2IO2 B;  1CMX B;  2WDQ B;  4G0N B;  1BUI C;  5DCN A;  3BK1 A;  4DXG A;  2WXR A;  3A9J B;  1EWY C;  4CHK A;  2R2Q A;  2WDV B;  1YMH E;  2L3Z A;  2WXJ A;  2BQQ A;  1MG4 A;  1VZ6 A;  2WXM A;  4FHK A;  4KKI A;  2Z8L A;  1ZP0 B;  3U52 E;  2KWC A;  2LJI A;  4XWW A;  3RNA C;  1BXT A;  2FCN A;  4FLH A;  2DZI A;  2KJ6 A;  4LK0 M;  1JWB D;  1TS2 A;  1I4P A;  3JSV B;  1E8W A;  4MGY E;  2KQ7 A;  4AJY B;  4OVV A;  2EKI A;  1PDX A;  3OJ4 B;  2WXK A;  3N32 A;  2XK5 B;  2JSV X;  5C3J B;  3T3O A;  2BS4 B;  3PZ8 A;  3R7R A;  3M63 B;  4IM2 A;  4NQL B;  2BW2 A;  2JF5 A;  1OEY A;  2YEP F;  4W9F A;  3NZ3 A;  5DPR A;  2GBJ A;  2K39 A;  3L4P A;  4NQK E;  3DVG Y;  4W9K A;  3DWM A;  5IAA C;  4Q2J A;  4TMA B;  1LGR A;  3EC8 A;  3PPA A;  3M3J A;  4KGS A;  3S2A A;  1GOZ A;  5T8I A;  4DDG D;  4YT0 B;  3H7P B;  2C5L C;  2D2Q A;  4GDL B;  3PRM B;  2YLM A;  3N3K B;  4F7Z A;  1WRI A;  3DBH B;  5FR3 A;  1AW7 A;  5GMV A;  5J2R A;  1YNT E;  3W5V B;  4JX1 C;  4WAA A;  4D2K A;  4MGZ E;  4ZRP A;  2G4S A;  2ZNV C;  1Q5W B;  4LLG M;  2ZW0 A;  3UI3 A;  5C1Z A;  2KOX A;  3U4E G;  4HDQ A;  1NI3 A;  2JZZ A;  3B2F A;  1UBI A;  4GXB A;  4FJZ A;  2J42 A;  1WX9 A;  4ANU A;  1R4M I;  1I4X A;  1C77 A;  4WQO B;  5E6N A;  1WMH A;  2PE6 B;  4KSK C;  3SU8 X;  2DEN B;  5D94 A;  2L8J A;  1I35 A;  4W9I A;  3Q3M C;  3ZJV A;  3DVG X;  3TEW A;  3V6E B;  1IGD A;  2RSU A;  1ZUD 2;  1GUA B;  3H1U A;  1VCB A;  2SAK A;  1FNU A;  5EE9 A;  2KDI A;  5AZG A;  3PRP B;  3Q6B A;  1Q10 A;  3RNB C;  3QIJ A;  4AP4 C;  2BWF A;  1XLO A;  4BKS D;  2QIE B;  3K9O B;  5FR6 A;  4AS1 A;  4GB9 A;  4HJK A;  1WE7 A;  3VUX A;  1JWM D;  1AWD A;  1EWC A;  2KAJ A;  2GBN A;  3WIM A;  3AN1 A;  5JXV A;  1XLQ A;  3N30 A;  1FRD A;  2L76 A;  3HM3 A;  3APD A;  4C7Z A;  4F8C B;  1EU3 A;  1FXI A;  2XK5 A;  3O65 B;  2JX5 A;  4PYZ A;  2IJ0 A;  3DOW A;  2JYT A;  5AUK A;  1L5P A;  2D10 A;  2KYW A;  1HQR D;  4MGK E;  2IY0 B;  4US9 A;  3ZJT A;  1E90 A;  1RFA A;  5CTR C;  1P3Q U;  1TZ1 A;  2QCZ A;  3SFD B;  1SF0 A;  1TTN A;  2GOW A;  4LNN A;  4PYU A;  1HZ6 A;  2G9H D;  3RUI B;  2G3Q B;  3DHI C;  2V1Y A;  1P9D U;  1RM6 C;  2D3A A;  2BB5 A;  4LCD E;  3Q2A C;  1CQV A;  3N1Y C;  2DYM A;  3R2I A;  1HTO A;  4DHJ D;  3L16 A;  3PLU A;  1V80 A;  3B08 A;  4RGN A;  3T9L A;  2MJ3 A;  3H8H A;  1XO3 A;  4FAD A;  2ZEQ A;  4TQ0 A;  2LGX A;  1Q1O A;  2IDY A;  2CR5 A;  1JML A;  1ISN A;  3BY4 B;  3WAP A;  4P6V F;  3FIL A;  2MLB A;  4ASW C;  2FNJ B;  2ZVO A;  1XF5 L;  2M56 B;  1N6Z A;  2D3C A;  2KTR A;  4EZJ A;  5D3D A;  2PTL A;  1STE A;  3Q8A A;  1TIF A;  4YXD B;  1L0X B;  4FXC A;  3RMK C;  3AEF B;  3IAM 1;  2MQJ A;  3KUC B;  3ML9 A;  1P1A A;  4WJN A;  2AQ1 B;  3PGE A;  4OZC A;  2PVO D;  2CJN A;  1C3T A;  1JRP A;  1NDD A;  2WXO A;  4N59 A;  3RD2 A;  4EKU A;  2LVO A;  3WA0 A;  1XXG A;  1XT9 B;  4EZK A;  5TSS A;  2YEP B;  2J0K A;  3ZRC A;  1YQ4 B;  2AQ3 B;  3DWG C;  1SXT A;  4W9G A;  3GZN I;  2IND C;  1IUE A;  1D6E C;  1PGA A;  4W9D A;  3RYT A;  1JCK B;  3DHG C;  1QLB B;  1GC7 A;  2AL3 A;  2CJO A;  4ANV A;  1JRO A;  3ENE A;  2KXJ A;  3L54 A;  2QC8 A;  4W9C A;  2BTE A;  4MM3 A;  2JWU A;  4JIO U;  2ZJD A;  4J6I A;  4JPS A;  4MGI E;  2IO3 B;  4XGA B;  4ZRK A;  2IO0 B;  1LXD A;  2ZW1 A;  4XX5 A;  2BWE S;  1RFK A;  2Z0E B;  4AJW A;  2DYO A;  3NVW A;  4C4V B;  4DHJ B;  1B9R A;  1YJ1 A;  3M95 A;  4KX6 B;  4HRS A;  2LHE A;  2SEB D;  1XQQ A;  3NUH B;  2FUG 1;  3M62 B;  2KX3 A;  1GC6 A;  2NBW B;  2N7J A;  2BYT A;  2KN5 A;  3MHZ A;  4A6Q A;  1XD3 B;  1SE3 A;  1XEE A;  4BBN C;  1PUT A;  1UF0 A;  3EHV A;  3AEG B;  1FFU A;  1QT9 A;  1WFY A;  4XZ4 A;  2H88 B;  2N4F A;  4BFR A;  2LUE A;  2MCN B;  4CQN A;  4FJV B;  3IBE A;  3LYY A;  4LNK A;  1GNU A;  1LFD A;  3SEB A;  4JLC A;  2BYV E;  3TUO A;  1OFF A;  1FRR A;  2BBC A;  2ASQ A;  3UIN B;  4PS8 A;  2KLC A;  2V9H A;  2NR2 A;  4A90 A;  4TV3 A;  2RDG A;  3AE4 B;  5BMH A;  4A3O A;  1HTQ A;  1T0S C;  3NZU A;  3AXC A;  5AUI A;  3JYU A;  1UEL A;  2NBV B;  2BPS A;  5BO4 B;  2HJ8 A;  1OGW A;  3U2S C;  1N60 A;  3BVM A;  3IHP C;  3Q8B A;  2PE9 A;  2KMC A;  5L95 C;  1WGY A;  1P0R A;  4X57 B;  2EKE C;  4TUU A;  5E6O A;  3ZNZ B;  3AB5 A;  2KFJ A;  2O6V B;  1WXQ A; 
#chains in the Genus database with same CATH homology
 2CU3 A;  2WDV B;  3Q8C A;  1YMH E;  1VRA B;  3ETR A;  1VZ7 A;  2WXJ A;  3ZJU A;  1DOI A;  2H89 B;  3IT4 B;  4ZOH C;  1NYR A;  1V1P A;  3P42 A;  1VZ6 A;  2WXM A;  2WXH A;  3W2D A;  4RGO S;  2WXG A;  4KKI A;  2Z8L A;  3KWL A;  3NRZ A;  2HTM E;  1ESF A;  1QOB A;  2QIL A;  1ZP0 B;  3U52 E;  1XLP A;  3T3N A;  2JQR B;  3C8Y A;  1DOX A;  1N5X A;  2LJI A;  4XWW A;  1BXT A;  2I2Y A;  2V4I B;  4JWU C;  1PYW D;  1EU4 A;  1E0Z A;  2IGG A;  4LK0 M;  2PVG C;  3HUI A;  1JWB D;  1TS2 A;  1QKZ A;  4NJC A;  1R7S A;  1I4P A;  2K22 A;  2MEK A;  3AED B;  4OZA A;  3SFE B;  3TEZ A;  2E6X A;  4WQM A;  3E56 A;  1I4R A;  3PZ7 A;  1C4A A;  3EUB 2;  4REZ A;  2ICI A;  4JWS C;  2BT6 A;  2DBY A;  3P4R B;  2EKI A;  1QQR A;  4C7Y A;  1I7H A;  1PDX A;  1GB4 A;  2WXK A;  4YSX B;  1N62 A;  2WS3 B;  2JSV X;  5C3J B;  1C79 A;  3T3O A;  2FBW B;  2BS4 B;  1YN3 A;  2WXL A;  1TYG B;  3PZ8 A;  2X38 A;  3TEY A;  4OVZ A;  5G5G A;  2K3U A;  1VLB A;  3P63 A;  2BW2 A;  2Q5W D;  3BZD B;  1EM7 A;  2YEP F;  1IBX A;  3B2G A;  3NZ3 A;  2K5P A;  1TKE A;  1TKY A;  4R3D A;  5BYQ A;  4DXF A;  2W54 A;  2B76 B;  3L4P A;  1QF6 A;  4KGT A;  2VZK D;  1F2R C;  3VR9 B;  2IPK D;  2XN9 C;  3Q8F A;  3DWM A;  2PIA A;  4Q2J A;  4TQ1 A;  4TMA B;  1C4P A;  1QIL A;  3B9J A;  1D4B A;  1NEN B;  3PO0 A;  3W1S A;  2FE8 A;  4MAC A;  1SIJ A;  4KGS A;  1VJK A;  3IXS A;  1GOZ A;  2L32 A;  5T8I A;  2N0S B;  4GDK B;  4YT0 B;  3NVV A;  1SJH D;  4YWG G;  3AE5 B;  4C56 C;  3AM9 A;  1RWS A;  4GDL B;  1WYG A;  4LTU A;  1L6V A;  1UUP A;  3W9C B;  1ZXH A;  4ARI A;  1NEK B;  2WQY B;  1F0Z A;  1WRI A;  5FR3 A;  1AW7 A;  3MP9 A;  2WXP A;  1YNT E;  3W5V B;  2Y3A A;  1D5Z C;  1PGB A;  4JX1 C;  4D2K A;  2BB6 A;  2W3R A;  1KFY B;  3AEE B;  2WP9 B;  4ZRP A;  4LLG M;  1BML C;  5BMI A;  4HKZ E;  2ZW0 A;  3UI3 A;  1TS3 A;  3AV8 A;  4TSS A;  5HI1 A;  3U4E G;  1F77 A;  2KWD A;  3VRB B;  1NI3 A;  3B2F A;  1E10 A;  1YJJ A;  2MJE A;  2GI9 A;  1C78 A;  1TS4 A;  2WXQ A;  2J42 A;  4A8X C;  2GB1 A;  4NAW B;  3KWV A;  1I4X A;  2RPV A;  1C77 A;  4IKG A;  1LO5 D;  1IBX B;  1QOA A;  1T5X D;  1K52 A;  1B1Z A;  2XNA C;  1UWX A;  3O13 A;  3RFZ B;  2V3N A;  3P4S B;  1ET6 A;  4JE3 B;  5BMG A;  4A9A A;  4RH6 A;  1ZDV A;  3ZJV A;  1D5X C;  3TEW A;  1IGD A;  4HRO A;  5D3I B;  1FXA A;  1MHH E;  1ZUD 2;  4WAF A;  1SEB D;  2W55 A;  3KLS X;  1F2R I;  1AN8 A;  4RF0 A;  2N9K A;  2W82 A;  1P7F A;  1CJE A;  2SAK A;  1FNU A;  1SE4 A;  2RMM A;  3VQI A;  3FC4 A;  5EE9 A;  1C76 A;  2QJL A;  2K9X A;  1Q10 A;  1V8C A;  1L0Y B;  3ZGZ A;  2KDM A;  1XLO A;  3AEB B;  3KQ4 A;  2QIE B;  1JW9 D;  3BII D;  4AS1 A;  1GB1 A;  3IT6 B;  3P4Q B;  2KQ4 X;  1JWM D;  2DWQ A;  1AWD A;  1EWC A;  2D5G A;  1SBB B;  1KH0 A;  2KAJ A;  1DOY A;  3BYY B;  1ACC A;  3AN1 A;  5JXV A;  3AMZ A;  1XLQ A;  4L23 A;  4RGT A;  1FRD A;  1PFD A;  1L4Z B;  4C7Z A;  1EU3 A;  4L1B A;  2I38 A;  4RCO A;  1FXI A;  5BYS A;  2L1A A;  1SE2 A;  2PMV A;  1I4H A;  1K53 A;  2OED A;  2JX5 A;  4O1N A;  1VDV A;  4AQ7 A;  2WU2 B;  5EE0 A;  4MM3 B;  1V1O A;  4C80 A;  2IJ0 A;  1TY0 A;  2WXI A;  1J7B A;  2JYT A;  5AUK A;  1A70 A;  1L5P A;  1M4V A;  1HQR D;  4US9 A;  4B0E A;  3ZJT A;  1FCC C;  5GXG B;  1T6B X;  2GRI A;  1FNW A;  2G1E A;  4ITK A;  1N5W A;  1JAL A;  1KLG D;  1KLU D;  2IGD A;  3BYT B;  2Y5P A;  3CIR B;  1KRH A;  2J53 A;  3SFD B;  1SF0 A;  1JQ4 A;  1XLN A;  1P7E A;  4WUR A;  4US8 A;  1ZPS A;  2AX5 A;  3I9V 1;  1HZ6 A;  2G9H D;  2LFI A;  3NS1 A;  1DGJ A;  1OQR A;  3FIL B;  1YN5 A;  1RM6 C;  1TY2 A;  1XCT L;  2BB5 A;  3AE7 B;  1SSN A;  1FCL A;  5E6J A;  1TJE A;  2JZP A;  2K0P A;  2QEJ C;  1CQV A;  1L6U A;  3V05 A;  5LNK 1;  3AE9 B;  4WWM A;  2DYM A;  1T3Q A;  1HXY D;  5HHD G;  5H92 C;  1VZ8 A;  3R2I A;  2RDH A;  1PGX A;  4RNA A;  3NVZ A;  2WXN A;  1AYF A;  1ENF A;  4RGN A;  2MJ3 A;  3H8H A;  1KF6 B;  1XO3 A;  4TQ0 A;  1V1P B;  1FEH A;  2EEL A;  1FFV A;  2IDY A;  1FM0 D;  4XDD A;  5C2T B;  2KAC A;  3Q69 A;  1JML A;  2LHD A;  4ZHP A;  1I4G A;  4P6V F;  2WU5 B;  3FIL A;  3I57 A;  4L2Y A;  2INP E;  2PLP A;  1XF5 L;  1D5M C;  2DLB A;  2M19 A;  2M56 B;  3AE2 B;  1SJE D;  2KMM A;  3AEC B;  3HRD D;  5D3D A;  2PTL A;  5HG2 A;  1STE A;  4IOI E;  3Q8A A;  1RYJ A;  5D7G A;  1FMA D;  1JWS D;  1TKG A;  1VR9 A;  4HEA 1;  2J52 A;  4GLS C;  4YXD B;  1L0X B;  4FXC A;  3AEF B;  3AE6 B;  2WLB A;  1UGJ A;  4OZB A;  3IAM 1;  3BK2 A;  1K51 A;  2AQ1 B;  1E7P B;  4OZC A;  2PVO D;  2CJN A;  2IGH A;  2R61 A;  3LB8 C;  4UDU C;  2KN4 A;  1JRP A;  1ZE3 D;  1MI0 A;  1HEZ E;  3R8B A;  2WXO A;  1C4C A;  4N59 A;  3EGR A;  3VRA B;  1QOG A;  1J7C A;  3ABV B;  4YTM B;  1XXG A;  2W3S A;  5TSS A;  2YEP B;  4RGM A;  1YQ4 B;  3N9Y C;  4USA A;  2AQ3 B;  3DWG C;  1HA5 A;  1SXT A;  3BVG A;  3BWU D;  1KTK A;  2BS3 B;  1YJI A;  1GAQ B;  1IUE A;  1D6E C;  1PGA A;  1TS5 A;  3W5U B;  1JCK B;  4IDI A;  1QLB B;  3V3X A;  2CJO A;  1FO4 A;  3ZYY X;  1JRO A;  3AE8 B;  1CK1 A;  5BYR A;  4NZL B;  1NVI D;  3Q8E A;  1JWU D;  3AE1 B;  1FIQ A;  2BTE A;  1ZXI A;  4J3O D;  2JWU A;  4XDC A;  4PT5 A;  1K50 A;  2TSS A;  2WXF A;  1YQ3 B;  4JPS A;  4H2A A;  5EE3 A;  1WSP A;  2ZW1 A;  4EE2 A;  1RFK A;  3P1M A;  3U7Z A;  2DYO A;  3NVW A;  4P16 A;  2LUM A;  3VR8 B;  1FNV A;  2V0G A;  4ARC A;  1B9R A;  3J9C A;  2JU6 X;  1ET9 A;  4KX6 B;  4HRS A;  2LHE A;  2SEB D;  3NUH B;  1WGK A;  4KKJ A;  1N61 A;  4OHJ A;  3TEX A;  1HZ5 A;  1N63 A;  4MT5 A;  2FUG 1;  3OWE B;  2LMC A;  2QMT A;  3CWI A;  1FD6 A;  1NYQ A;  5MPO A;  2N7J A;  4A55 A;  4YSZ B;  2BYT A;  1TZO A;  3MJ5 A;  3MHZ A;  4A6Q A;  3E9S A;  1SE3 A;  1ZOY B;  2PW9 A;  1MHX A;  1XEE A;  5G5H A;  1GPX A;  1PUT A;  5HFY A;  2PKO A;  2QSD A;  3WCQ A;  2INN E;  2BS2 B;  3HVZ A;  1DYQ A;  3AEG B;  4WH4 A;  4ZHO A;  1FFU A;  1QT9 A;  2Y5C A;  1IGC A;  1MVK A;  2H88 B;  4CQN A;  4KGR A;  3LYY A;  3LXF A;  2MJD A;  3SEB A;  1I4Q A;  1V97 A;  4HJG E;  1OFF A;  1FRR A;  4NAM A;  3TUO A;  3P4P B;  3HVD A;  4N58 A;  3GP7 A;  4RF1 A;  1ROE A;  2BBC A;  2L83 A;  5EE1 A;  5H8Y E;  4N6E B;  1E9M A;  1J7A A;  4M0W A;  3SR6 A;  1CZP A;  3NVY A;  1MPE A;  5I4D A;  1L4D B;  4A90 A;  2RDG A;  3AE4 B;  3GS2 A;  5BMH A;  1E6E B;  4HKQ A;  1WWT A;  2ONQ A;  4YTN B;  2E3T A;  5AUI A;  3EA6 A;  4B0M A;  3BVZ A;  2ACZ B;  3ZQ4 A;  4MH8 A;  4ZRQ A;  2NTT A;  2AQ2 B;  1XCQ L;  3R2T A;  2OHF A;  3GB1 A;  4DQO C;  1L0V B;  2M0A A;  1OQQ A;  2WDR B;  3MC0 B;  2VZK B;  3RPF C;  3IAS 1;  4XWT A;  1SB3 C;  3U2S C;  2J4X A;  1N60 A;  2LEK A;  2HDE A;  3BVM A;  5FKA C;  2JXT A;  1YN4 A;  3AE3 B;  4OW0 A;  5FK9 C;  2NTS A;  2NMQ A;  4ZYS A;  2LGI A;  3AH7 A;  2ON8 A;  3TSS A;  3Q8B A;  3FAH A;  3AEA B;  2L52 A;  2V3P A;  4YTP B;  1JWA D;  1QOF A;  2N9L A;  4RFB A;  4WIP A;  2JYE A;  1C9F A;  2WDQ B;  1BUI C;  2WNM A;  3URY A;  1UWM A;  1Y56 A;  3BK1 A;  4DXG A;  2WXR A;  3AB5 A;  1UNS A;  4XE0 A;  4YSY B;  1WXQ A;  1ZDX A;  3MFG A;  1EWY C;  2MH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...