3P1TA

Crystal structure of a putative aminotransferase (bpsl1724) from burkholderia pseudomallei k96243 at 2.60 a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
322
structure length
322
Chain Sequence
AAAQAVCLAFNENPEAVEPRVQAAIAAAAARINRYPFDAEPRVMRKLAEHFSCPEDNLMLVRGIDECFDRISAEFSSMRFVTAWPGFDGYRARIAVSGLRHFEIGLTDDLLLDPNDLAQVSRDDCVVLANPSNPTGQALSAGELDQLRQRAGKLLIDETYVDYSSFRARGLAYGENELVFRSFSKSYGLAGLRLGALFGPSELIAAMKRKQWFCNVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENAAGERTLRFLRERGIQVKDAGQFGLHHHIRISIGREEDNDRLLAALAEYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative histidinol-phosphate aminotransferase
publication title Crystal structure of a putative aminotransferase (BPSL1724) from Burkholderia pseudomallei K96243 at 2.60 A resolution
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 109
structure length 322
sequence length 322
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3p1tA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3p1tA01
1DJEA 1I41A 2JJEA 2V1PA 4F5LA 3BCAA 2HOZA 4IX8A 3TATA 2JISA 2BIEA 2GMSA 3R9AA 1YIYA 2BI9A 4W1XA 1YJZA 5BJ3A 1G7WA 1C0NA 1B4XA 1XI9A 4E3QA 1WKHA 1AIAA 2ZUKA 4ADBA 4MKKA 3LVKA 1S06A 2AY6A 2TPLA 1BS0A 2VMYA 2C44A 4GE7A 4BA4A 2BWNA 2R2NA 3EI8A 3R4TA 2YOBA 1E5FA 4Q31A 5JAYA 4CVQA 3N5MA 2EO5A 3CAIA 1D7SA 2BI3A 4ZWMA 4EFFA 1O69A 1TOIA 2O7CA 1WSTA 2EH6A 1OXPA 2CH2A 2EPJA 3EIAA 4IXSA 3W1IA 3HVYA 2JJHA 4H51A 4BQ0A 1IX7A 2AY2A 4RKDA 1WYUB 1Y4IA 2Z9VA 1W7MA 3E2FA 3AEPA 2RFVA 4CBSA 1KMJA 4U1TA 3CBFA 3AEMC 1DJUA 1MDZA 3HBXA 5M4DA 1B5PA 1PMMA 5G2PA 4ZDPA 2W8WA 2W8UA 3AOWA 3ELEA 1JG8A 1SZUA 5FT4A 2W7HA 2Z9UA 1B9IA 1J32A 4EB5A 4RAEA 3A9ZA 3LVMA 3VAXA 3ZRQA 1DGDA 1CL2A 4HF8A 5G4IA 1DTYA 1AX4A 4F5KA 1ASNA 4WYGA 3GSBA 1ECXA 2OKJA 3GBXA 1WYTB 3PDXA 1YJYA 3NRAA 4W5KA 4ZASA 3FQAA 3FDBA 4F5GA 4PFNA 5BJ4A 3OP7A 4LW2A 1AMRA 1UKJA 4ZAHA 3AEJC 3W1JA 1UU2A 1ASCA 2Q7WA 3NYTA 4OBUA 4K2IA 4BMKA 4RLGA 1KKJA 1S08A 3GETA 4AZJA 2CY8A 3FD0A 3I5TA 4FFCA 2CFBA 3CQ4A 2YHKA 1KMKA 1BQAA 1BKGA 3BWNC 2Z1YA 4B9BA 1QIRA 2AY7A 2VMWA 3QN6A 5C6UA 9AATA 1X0MA 2E7UA 1B8GA 5M4BA 2VLFA 3KE3A 4LC3A 4MQPA 4AO4A 2JJFA 3NTJA 3F9TA 4Q76A 3DODA 4FL0A 4RJ0A 2AEUA 2BI2A 2BI1A 1ASGA 3F6TA 4CBRA 3AOVA 3FTBA 1O62A 1V2EA 3T32A 3DC1A 3GZCA 1E5EA 1TASA 3LG0A 4IW7A 4O6ZA 4PVFA 2EZ2A 2VGUA 2R5CB 1IUGA 2AEVA 4AZKA 2BI5A 4GSAA 2HUUA 2VMOA 2FQ6A 1LW4A 3BCXA 3PGYA 4I8AA 3B8XA 5EFSA 3UAKA 3KKIA 1IAXA 2VMUA 1LK9A 2BIAA 5F8VA 2ORDA 2X8UA 3TFTA 2GB3A 4MQQA 2Z9WA 2BIGA 4WB0A 3FKDA 4ATPA 4KAMA 4RM1A 4W1VA 4ADDA 1V2DA 4M2JA 2W8JA 2X3LA 1M0OA 1ZOBA 3DU4A 1J04A 2D61A 1AHFA 3HT4A 2DGMA 3A9YA 3TFUA 4ZDOA 4ZM4A 3EZ1A 3PA9A 3WKSA 1PMOA 2ZSMA 3TQXA 2OKKA 4P7YA 1S0AA 1D7RA 2YRRA 3NUIA 4WYDA 3ZZJA 1ARSA 3RQ1A 4DBCA 4IY7A 1CL1A 4ITXA 4OT8A 1AHXA 4UHMA 4LNMA 3AELA 2QBTA 3BB8A 3EI6A 1W23A 4P3MA 1AJSB 4UHNA 1TOEA 2HZPA 3RCHB 5DX5A 2CINA 1TOKA 1BQDA 2AY9A 2VIBA 3BC8A 2VIAA 1WYVA 3FVUA 5K8BA 3GR9A 4XJPA 1KL2A 4DQ6A 1C7OA 2BYLA 1H1CA 2CH1A 3JWAA 3QGUA 4WXBA 4ZM3A 2JG2A 3FZ6A 2ZYJA 3UWCA 3WGBA 3ACZA 2Z61A 1H0CA 3QHXA 1O61A 2HP2A 1TOGA 2PB2A 3FQ8A 2QLRA 2CB1A 4PIWA 4JEWA 5HDMA 3L8AA 1B9HA 4LNLA 1ZC9A 2VGVA 2FM1A 1P3WA 1XEYA 3GZDA 1BJNA 3K28A 1W7NA 1GEWA 4OYTA 4ZWVA 5G09A 2CJHA 1IX8A 1WYUA 1G7XA 1GD9A 4M2MA 2W7LA 1GCKA 2HOYA 2VMRA 4ATQA 3MADA 4E77A 3DZZA 4AO9A 4MKJA 3F0HA 4K2BA 1RVUA 3NYSA 5E3KA 3UE8A 2W7JA 4JE5A 4Y0HA 3LWSA 3JW9A 1M32A 2AY1A 1GC2A 4OCAA 2QB2A 1YJSA 2ZJGA 1QJ3A 2YKYA 1LS3A 1KKPA 1T3IA 3FZ7A 2D7YA 1FG7A 1QITA 1Z3ZA 3WZFA 1G4XA 2ZY4A 2W8TA 3PD6B 4A00A 2VGTA 2VGZA 3G0TA 1IX6A 2VMVA 4EMYA 1ARIA 3NNKA 2X5FA 1PFFA 1MLZA 1ARTA 3FFRA 4R8DA 4TV7A 1WYTA 5G2QA 5E5IA 4W8IA 1CS1A 3MEBA 1BJWA 1BT4A 1SFFA 3AENA 4JF0A 2VI9A 4F5IA 1AJRA 4JF1A 3PDBB 2E7JA 2BWOA 1LKCA 1IJIA 3P6KA 4GRXA 4MSOA 4AOAA 2F8JA 2DGLA 2AY8A 1V72A 3E77A 3GWPA 4TN4A 2DR1A 1AMAA 2ZY3A 3PIUA 3VOMA 4N0BA 5EIGB 1S07A 5D95A 2VMSA 1VP4A 1CZCA 2W7KA 1CQ6A 4JEZA 1X2AA 3AEMA 4GE9A 1DGEA 3CQ6A 3RUYA 1C4KA 2BWPA 2E54A 5EUNA 3L44A 1IBJA 5LH9A 5G4JA 2WK8A 1MDXA 5FT5A 4OC9A 2D7ZA 1RVYA 1OHYA 4UOYA 4B98A 4N0WA 4RKCA 1D7VA 2NMPA 2E7IA 1TOJA 2C81A 1TARA 1QJ5A 4KYOA 1KL1A 3WCOA 1SF2A 1YOOA 2OQXA 4BHDA 5E4ZA 5M46A 5M49A 3HL2A 2PO3A 2ZP7A 4L0OA 3MC6C 3K40A 1B5OA 1D7UA 1BJOB 2W7GA 3BN1A 4E1OA 1TPLA 3DXVA 2W7DA 3MKJA 3EZSA 2G6WA 2GQNA 2W7IA 2C7TA 3FVSA 3E2ZA 3I4JA 2VGWA 3HLMA 4CXQA 1M0QA 3W1HA 2GSAA 5IWQA 2Z1ZA 1EQBA 2Z9XA 2CANA 3DR7A 3NDNA 4MQRA 1LW5A 1ASMA 1MAQA 1W7LA 1AAWA 3BWNA 3B1DA 1SVVA 4OBVA 3ZRPA 2AY4A 1N31A 3JU7A 3B46A 1AMSA 3VP6A 1AAMA 3COGA 4NOGA 4K2MA 1JF9A 1QISA 3JZLA 4WYCA 3ASAA 1I43A 2C0RA 1ARHA 4GEBA 4PFFA 3LY1A 2DGKA 4A6TA 3JWBA 1I48A 3WKRA 4F5JA 1OHVA 4UHOA 1GC4A 1ORDA 4WXFA 3B1CA 4MY5A 3LV2A 3IHJA 5EQCA 3MAFB 3PPLA 4J5UA 1AJSA 4KXKA 1N8PA 3FQ7A 3MBBA 4XAUA 1EJIA 3RI6A 5DJ9A 5F9SA 2CTZA 3OKSA 2XBNA 4XEWA 2HUIA 1GDEA 1FG3A 4DGTA 4IYOB 1ZODA 3QBOA 3IF2A 2AY3A 4UQVA 4A6RA 2ZSLA 2CSTA 1N2TA 4WLJA 5G0AA 2QA3A 2GMUA 4JE5D 3A8UX 3AEOA 2DKJA 4ZDLA 1VEFA 1BJ4A 1BW0A 1C7GA 4EU1A 2O1BA 3ISLA 1QZ9A 1SZKA 1GC0A 2WK7A 3MAUA 2Z20A 3EUCA 2JJGA 2YKXA 3DYDA 3ECDA 2OGAA 2EGYA 2VLHA 2HORA 4ZLVA 1ELQA 1UU1A 4WYAA 4LW4A 4E3RA 1C9CA 4W1WA 1AKBA 4A0RA 4RIZA 1UU0A 3BWOA 3GZDC 1SPAA 4GDYA 4WD2A 5FT6A 3WLXA 1MGVA 3RBFA 8AATA 2FN6A 4JEXA 1YAAA 4TMRA 2ZC0A 5D5SA 3DXWA 3PD6A 4A0HA 3KGWA 1DJ9A 3PAAA 1O4SA 4XJOA 3A2BA 1GC3A 3EIBA 1OHWA 4WLHA 4ITGA 4R5FA 2WKAA 1AKCA 3EI5A 4RITA 4WYEA 3EI7A 3PJ0A 3ZRRA 4WXGA 1IAYA 3KGXA 1YNUA 4WYFA 1C7NA 3PDBA 2QMAA 3Q8NA 5FT8A 2CJGA 3AV7A 4EB7A 3ELPA 4Q6RA 3LVLB 2HOXA 3QM2A 3H7FA 4QGRA 4A0FA 2VI8A 1WYVB 2D5YA 5EIGA 1LC8A 4W91A 3ATHA 4A72A 1OXOA 2VMPA 1QGNA 3LVJA 4ADEA 4GE4A 3NUBA 5HXXA 1JS6A 3ASBA 3WCNA 2YCPA 3ZZKA 2ZY5A 1AHGA 2OGEA 3HQTA 2W7FA 4U2HA 2DKBA 1M0PA 3TCMA 1ASLA 3FDDA 2R0TA 2BYJA 3DRDA 4BA5A 4IXOA 4XJMA 1IVRA 2YCNA 4IXZA 2ZY2A 2OATA 4F5HA 3B1EA 1LC7A 2VYCA 1DKAA 3E2YA 2WK9A 1BJOA 1AKAA 1WKGA 3N75A 3BCBA 2HP1A 5I92A 3NYUA 2D66A 2FNUA 2W7MA 2X5DA 2YCTA 3RBLA 4J8LA 4LNJA 1SZSA 2V0YA 3HDOA 3M5UA 2W7EA 3NX3A 3USFA 5HHYA 2AATA 4Y0IA 1GEXA 4MGRA 4AH3A 2YKVA 1CQ8A 4JEYA 4CXRA 2R5CA 1LC5A 2VMQA 3EI9A 1ASDA 2VGSA 1FC4A 1PG8A 4HVKA 2YRIA 3A9XA 5EAAA 3N0LA 1AICA 2QB3A 3G8MA 3AENB 3AATA 2EZ1A 3WX9A 3FCRA 3WY7A 1TATA 2DOUA 3AEJA 1V2FA 2FNIA 1M6SA 3VK4A 1CZEA 1RV3A 1AY5A 2Z67A 1D2FA 3FVXA 3DR4A 1ASEA 2D63A 4OTLA 1MDOA 3BS8A 2VMXA 3NU8A 2HUFA 2AY5A 4ZSWA 3JTXA 3WGCA 1VJOA 2R5EA 1AY4A 1AIBA 1EG5A 3MAFA 4F5FA 1M7YA 1GBNA 4XK1A 3FFHA 1ASFA 3NU7A 1W3UA 5EAVA 1AHEA 1ASAA 4ISYA 3MC6A 1MAPA 2VMTA 3QPGA 5J8QA 2BKWA 3H14A 4F5MA 3HMUA 1AMQA 4IYOA 1JS3A 3P1TA 3CQ5A 1OATA 2XH1A 3K7YA 7AATA 3VK2A 4F4EA 1I29A 1G4VA 4A0GA 2VMNA 3G7QA 1GEYA 1ELUA 1S09A 4Q75A 3RCHA 1Z7DA 2CJDA 1CQ7A 2D65A 1X28A 4Y0DA 4M2KA 3FSLA 3FZ8A 3E9KA 1M4NA 1MLYA 1M0NA 3E6GA 4XJLA 2JGTA 5DB5A 5LHAA 1RV4A 2YKUA 3VK3A 3GJUA 3E2ZB 4OMAA 5EUEA 3I16A 1CJ0A 1AHYA 4R5ZA 2BHXA 1ARGA 1U08A 3D6KA 4RJYA 5AX8A 1AY8A 2PB0A 4JEVA 5EUDA 4ZSYA 4WB0B 4XQ2A 2W8VA 1DFOA 4ADCA 2O0RA 4A6UA 3QI6A 5TF5A 3FRKA 3BV0A 1YIZA 1X29A 2D64A 4R2NA 3II0A 4WBTA 2VMZA 4WP0A 2FYFA 1ASBA 5DJ1A
chains in the Genus database with same CATH superfamily
1DJEA 1I41A 2JJEA 2V1PA 4F5LA 3BCAA 2HOZA 4IX8A 3TATA 2JISA 2BIEA 2GMSA 3R9AA 1YIYA 2BI9A 4W1XA 1YJZA 5BJ3A 1G7WA 1C0NA 1B4XA 1XI9A 4E3QA 1WKHA 1AIAA 2ZUKA 4ADBA 2G7JA 4MKKA 3LVKA 1S06A 2AY6A 2TPLA 1BS0A 2VMYA 2C44A 4GE7A 4BA4A 2BWNA 2R2NA 3EI8A 3R4TA 2YOBA 1E5FA 4Q31A 5JAYA 5KTBA 4CVQA 3N5MA 2EO5A 3CAIA 1D7SA 2BI3A 4ZWMA 4EFFA 1O69A 1TOIA 2O7CA 1WSTA 2EH6A 1OXPA 2CH2A 2EPJA 3EIAA 4IXSA 3W1IA 3HVYA 2JJHA 4H51A 4BQ0A 1IX7A 2AY2A 4RKDA 1WYUB 1Y4IA 2Z9VA 1W7MA 3E2FA 3AEPA 2RFVA 4CBSA 1KMJA 4U1TA 3CBFA 3AEMC 1DJUA 1MDZA 3HBXA 5M4DA 1B5PA 1PMMA 5G2PA 4ZDPA 2W8WA 2W8UA 3AOWA 3ELEA 1JG8A 1SZUA 5FT4A 2W7HA 2Z9UA 1B9IA 1J32A 4EB5A 4RAEA 3A9ZA 3LVMA 3VAXA 3ZRQA 1DGDA 1CL2A 4HF8A 5G4IA 1DTYA 1AX4A 4F5KA 1ASNA 4WYGA 3GSBA 1ECXA 2OKJA 3GBXA 1WYTB 3PDXA 1YJYA 3NRAA 4W5KA 4ZASA 3FQAA 3FDBA 4F5GA 4PFNA 5BJ4A 3OP7A 4LW2A 1AMRA 1UKJA 4ZAHA 3AEJC 3W1JA 1UU2A 1ASCA 2Q7WA 3NYTA 4OBUA 4K2IA 4BMKA 3N4SA 4RLGA 1KKJA 4H63Q 1S08A 3GETA 4AZJA 2CY8A 3FD0A 3I5TA 4FFCA 2CFBA 3CQ4A 2A1VA 2YHKA 1KMKA 1BQAA 1BKGA 3BWNC 2Z1YA 4B9BA 1QIRA 2AY7A 2VMWA 3QN6A 5C6UA 9AATA 1X0MA 2E7UA 1B8GA 5M4BA 2VLFA 3KE3A 4LC3A 4MQPA 4AO4A 2JJFA 3NTJA 3F9TA 4Q76A 3DODA 4FL0A 4RJ0A 2AEUA 2BI2A 2BI1A 1ASGA 3F6TA 4CBRA 3AOVA 3FTBA 1O62A 1V2EA 3T32A 3DC1A 3GZCA 1E5EA 1TASA 3LG0A 4IW7A 4O6ZA 4PVFA 2EZ2A 2VGUA 2R5CB 1IUGA 2AEVA 4AZKA 2BI5A 4GSAA 2HUUA 2VMOA 2FQ6A 1LW4A 3BCXA 3PGYA 4I8AA 3B8XA 5EFSA 3UAKA 3KKIA 1IAXA 2VMUA 1LK9A 2BIAA 5F8VA 2ORDA 2X8UA 3TFTA 2GB3A 4MQQA 2Z9WA 2BIGA 4WB0A 3FKDA 4ATPA 4KAMA 4RM1A 4W1VA 4ADDA 1V2DA 4M2JA 2W8JA 2X3LA 1M0OA 1ZOBA 3DU4A 1J04A 2D61A 1AHFA 3HT4A 2DGMA 3A9YA 3TFUA 4ZDOA 4ZM4A 3EZ1A 3PA9A 3WKSA 1PMOA 2ZSMA 3TQXA 2OKKA 4P7YA 1S0AA 1D7RA 2YRRA 3NUIA 4WYDA 3ZZJA 1ARSA 3RQ1A 4DBCA 4IY7A 1CL1A 4ITXA 4OT8A 1AHXA 4UHMA 4LNMA 3AELA 2QBTA 3BB8A 3EI6A 1W23A 4P3MA 1AJSB 4UHNA 1TOEA 2HZPA 3RCHB 5DX5A 2CINA 1TOKA 1BQDA 2AY9A 2VIBA 3BC8A 2VIAA 2KFPA 1WYVA 3FVUA 5K8BA 3GR9A 4XJPA 1KL2A 4DQ6A 1C7OA 2BYLA 1H1CA 2CH1A 3JWAA 3QGUA 4WXBA 4ZM3A 2JG2A 4K05A 3FZ6A 2ZYJA 3UWCA 3WGBA 3ACZA 2Z61A 1H0CA 3QHXA 1O61A 2HP2A 1TOGA 2PB2A 3FQ8A 2QLRA 2CB1A 4PIWA 4JEWA 5HDMA 3L8AA 1B9HA 4LNLA 1ZC9A 2VGVA 2FM1A 1P3WA 1XEYA 3GZDA 1BJNA 3K28A 1W7NA 1GEWA 4OYTA 4ZWVA 5G09A 2CJHA 1IX8A 1WYUA 1G7XA 1GD9A 4M2MA 2W7LA 1GCKA 2HOYA 2VMRA 4ATQA 3MADA 4E77A 3DZZA 4AO9A 4MKJA 3F0HA 4K2BA 1RVUA 3NYSA 5E3KA 3UE8A 2W7JA 4JE5A 4Y0HA 3LWSA 3JW9A 1M32A 2AY1A 1GC2A 4OCAA 2QB2A 1YJSA 2ZJGA 1QJ3A 2YKYA 1LS3A 1KKPA 1T3IA 3FZ7A 2D7YA 1FG7A 1QITA 1Z3ZA 3WZFA 1G4XA 2ZY4A 2W8TA 3PD6B 4A00A 2VGTA 2VGZA 3G0TA 1IX6A 2VMVA 4EMYA 1ARIA 3NNKA 2X5FA 1PFFA 1MLZA 1ARTA 3FFRA 4R8DA 4TV7A 1WYTA 3N4XA 5G2QA 5E5IA 4W8IA 1CS1A 3MEBA 1BJWA 2WB6A 1BT4A 1SFFA 3AENA 4JF0A 2VI9A 4F5IA 1AJRA 4JF1A 3PDBB 2E7JA 2BWOA 1LKCA 1IJIA 3P6KA 4GRXA 4MSOA 4AOAA 2F8JA 2QSRA 2DGLA 2AY8A 1V72A 3E77A 3GWPA 4TN4A 2DR1A 1AMAA 2ZY3A 3PIUA 3VOMA 4N0BA 5EIGB 1S07A 5D95A 3N4RA 2VMSA 1VP4A 1CZCA 2W7KA 1CQ6A 4JEZA 1X2AA 3AEMA 4GE9A 1DGEA 3CQ6A 3RUYA 1C4KA 2BWPA 2E54A 5EUNA 3L44A 1IBJA 5LH9A 5G4JA 2WK8A 1MDXA 5FT5A 4OC9A 2D7ZA 1RVYA 1OHYA 4UOYA 4B98A 4N0WA 4RKCA 1D7VA 2NMPA 2E7IA 1TOJA 2C81A 1TARA 1QJ5A 4KYOA 1KL1A 3WCOA 1SF2A 1YOOA 2OQXA 4BHDA 5E4ZA 5M46A 5M49A 3HL2A 2PO3A 2ZP7A 4L0OA 3MC6C 2FKIA 3K40A 1B5OA 1D7UA 1BJOB 2W7GA 3BN1A 4E1OA 1TPLA 3DXVA 2W7DA 3MKJA 3EZSA 2G6WA 2GQNA 2W7IA 2C7TA 3FVSA 3E2ZA 3I4JA 2VGWA 3HLMA 4CXQA 1M0QA 3W1HA 2GSAA 5IWQA 2Z1ZA 1EQBA 2Z9XA 2CANA 3DR7A 3NDNA 4MQRA 1LW5A 1ASMA 1MAQA 1W7LA 1AAWA 3BWNA 3B1DA 1SVVA 4OBVA 3ZRPA 2AY4A 1N31A 3JU7A 3B46A 1AMSA 3VP6A 1AAMA 3COGA 4NOGA 4K2MA 1JF9A 1QISA 3JZLA 4WYCA 3ASAA 1I43A 2C0RA 1ARHA 4GEBA 4PFFA 3LY1A 2DGKA 4A6TA 3JWBA 1I48A 3WKRA 4F5JA 1OHVA 4UHOA 1GC4A 1ORDA 4WXFA 3B1CA 4MY5A 3LV2A 3IHJA 5EQCA 3MAFB 3PPLA 4J5UA 1AJSA 4KXKA 1N8PA 3FQ7A 3MBBA 4XAUA 1EJIA 3RI6A 3N7NA 5DJ9A 5F9SA 2CTZA 3OKSA 2XBNA 4XEWA 2HUIA 1GDEA 1FG3A 4DGTA 4IYOB 1ZODA 3QBOA 3IF2A 2AY3A 4UQVA 4A6RA 2ZSLA 2CSTA 1N2TA 4WLJA 5G0AA 2QA3A 2GMUA 4JE5D 3A8UX 3AEOA 2DKJA 4ZDLA 1VEFA 1BJ4A 1BW0A 1C7GA 4EU1A 2O1BA 3ISLA 1QZ9A 2EYQA 1SZKA 1GC0A 2WK7A 3MAUA 2Z20A 3EUCA 2JJGA 2YKXA 3DYDA 3ECDA 2OGAA 2EGYA 2VLHA 2HORA 4ZLVA 1ELQA 1UU1A 4WYAA 4LW4A 4E3RA 1C9CA 4W1WA 1AKBA 4A0RA 4RIZA 1UU0A 3BWOA 3GZDC 1SPAA 4GDYA 4WD2A 5FT6A 3WLXA 1MGVA 3RBFA 8AATA 2FN6A 4JEXA 1YAAA 4TMRA 2ZC0A 5D5SA 3DXWA 3PD6A 4A0HA 3KGWA 1DJ9A 3PAAA 1O4SA 4XJOA 3A2BA 1GC3A 3EIBA 1OHWA 4WLHA 4ITGA 4R5FA 2WKAA 1AKCA 3EI5A 4RITA 4WYEA 3EI7A 3PJ0A 3ZRRA 4WXGA 1IAYA 3KGXA 1YNUA 4WYFA 1C7NA 3PDBA 2QMAA 3Q8NA 5FT8A 2CJGA 3AV7A 4EB7A 3ELPA 4Q6RA 3LVLB 3H9XA 2HOXA 3QM2A 3H7FA 4QGRA 4A0FA 2VI8A 1WYVB 2D5YA 5EIGA 1LC8A 4W91A 3ATHA 4A72A 1OXOA 2VMPA 1QGNA 3LVJA 4ADEA 4GE4A 3NUBA 5HXXA 1JS6A 3ASBA 3WCNA 2YCPA 3ZZKA 2ZY5A 1AHGA 2OGEA 3HQTA 2W7FA 4U2HA 2DKBA 1M0PA 3TCMA 1ASLA 3FDDA 2R0TA 2BYJA 3DRDA 4BA5A 4IXOA 4XJMA 1IVRA 2YCNA 4IXZA 2ZY2A 2OATA 4F5HA 3B1EA 1LC7A 2VYCA 1DKAA 3E2YA 2WK9A 1BJOA 1AKAA 1WKGA 3N75A 3BCBA 2HP1A 5I92A 3NYUA 2D66A 2FNUA 2W7MA 2X5DA 2YCTA 3RBLA 4J8LA 4LNJA 1SZSA 2V0YA 3HDOA 3M5UA 2W7EA 3NX3A 3USFA 5HHYA 2AATA 4Y0IA 1GEXA 4MGRA 4AH3A 2YKVA 1CQ8A 4JEYA 4CXRA 2R5CA 1LC5A 2VMQA 3EI9A 1ASDA 2VGSA 1FC4A 1PG8A 4HVKA 2YRIA 3A9XA 5EAAA 3N0LA 1AICA 2QB3A 3G8MA 3AENB 3AATA 2EZ1A 3WX9A 3FCRA 3WY7A 1TATA 2DOUA 3AEJA 1V2FA 2FNIA 1M6SA 3VK4A 1CZEA 1RV3A 1AY5A 2Z67A 1D2FA 3FVXA 3DR4A 1ASEA 2D63A 4OTLA 1MDOA 3BS8A 2VMXA 3NU8A 2HUFA 2AY5A 1KAFA 4ZSWA 3JTXA 3WGCA 1VJOA 2R5EA 1AY4A 1AIBA 1EG5A 3MAFA 4F5FA 1M7YA 1GBNA 4XK1A 3FFHA 1ASFA 3NU7A 1W3UA 5EAVA 1AHEA 1ASAA 4ISYA 3MC6A 1MAPA 2VMTA 3QPGA 5J8QA 2BKWA 3H14A 4F5MA 3HMUA 1AMQA 4IYOA 1JS3A 3P1TA 3CQ5A 1OATA 2XH1A 3K7YA 7AATA 3VK2A 4F4EA 1I29A 1G4VA 4A0GA 2VMNA 3G7QA 1GEYA 1ELUA 1S09A 4Q75A 3RCHA 1Z7DA 2CJDA 1CQ7A 2D65A 1X28A 4Y0DA 4M2KA 3FSLA 3FZ8A 3E9KA 1M4NA 1MLYA 1M0NA 3E6GA 4XJLA 2JGTA 5DB5A 5LHAA 1RV4A 2YKUA 3VK3A 3GJUA 3E2ZB 4OMAA 5EUEA 3I16A 1CJ0A 1AHYA 4R5ZA 2BHXA 1ARGA 1U08A 3D6KA 4RJYA 5AX8A 1AY8A 2PB0A 4JEVA 5EUDA 4ZSYA 4WB0B 4XQ2A 2W8VA 1DFOA 4ADCA 2O0RA 4A6UA 3QI6A 5TF5A 3FRKA 3BV0A 1YIZA 1X29A 2D64A 4R2NA 3II0A 4WBTA 2VMZA 4WP0A 2FYFA 1ASBA 5DJ1A
chains in the Genus database with same CATH topology
1DJEA 1I41A 2JJEA 2V1PA 4F5LA 3BCAA 2HOZA 4IX8A 3TATA 2JISA 2BIEA 2GMSA 3R9AA 1YIYA 2BI9A 4W1XA 1YJZA 5BJ3A 1G7WA 1C0NA 1B4XA 1XI9A 4E3QA 1WKHA 1AIAA 2ZUKA 4ADBA 2G7JA 4MKKA 3LVKA 1S06A 2AY6A 2TPLA 1BS0A 2VMYA 2C44A 4GE7A 4BA4A 2BWNA 2R2NA 3EI8A 3R4TA 2YOBA 1E5FA 4Q31A 5JAYA 5KTBA 4CVQA 3N5MA 2EO5A 3CAIA 1D7SA 2BI3A 4ZWMA 4EFFA 1O69A 1TOIA 2O7CA 1WSTA 2EH6A 1OXPA 2CH2A 2EPJA 3EIAA 4IXSA 3W1IA 3HVYA 2JJHA 4H51A 4BQ0A 1IX7A 2AY2A 4RKDA 1WYUB 1Y4IA 2Z9VA 1W7MA 3E2FA 3AEPA 2RFVA 4CBSA 1KMJA 4U1TA 3CBFA 3AEMC 1DJUA 1MDZA 3HBXA 5M4DA 1B5PA 1PMMA 5G2PA 4ZDPA 2W8WA 2W8UA 3AOWA 3ELEA 1JG8A 1SZUA 5FT4A 2W7HA 2Z9UA 1B9IA 1J32A 4EB5A 4RAEA 3A9ZA 3LVMA 3VAXA 3ZRQA 1DGDA 1CL2A 4HF8A 5G4IA 1DTYA 1AX4A 4F5KA 1ASNA 4WYGA 3GSBA 1ECXA 2OKJA 3GBXA 1WYTB 3PDXA 1YJYA 3NRAA 4W5KA 4ZASA 3FQAA 3FDBA 4F5GA 4PFNA 5BJ4A 3OP7A 4LW2A 1AMRA 1UKJA 4ZAHA 3AEJC 3W1JA 1UU2A 1ASCA 2Q7WA 3NYTA 4OBUA 4K2IA 4BMKA 3N4SA 4RLGA 1KKJA 4H63Q 1S08A 3GETA 4AZJA 2CY8A 3FD0A 3I5TA 4FFCA 2CFBA 3CQ4A 2A1VA 2YHKA 1KMKA 1BQAA 1BKGA 3BWNC 2Z1YA 4B9BA 1QIRA 2AY7A 2VMWA 3QN6A 5C6UA 9AATA 1X0MA 2E7UA 1B8GA 5M4BA 2VLFA 3KE3A 4LC3A 4MQPA 4AO4A 2JJFA 3NTJA 3F9TA 4Q76A 3DODA 4FL0A 4RJ0A 2AEUA 2BI2A 2BI1A 1ASGA 3F6TA 4CBRA 3AOVA 3FTBA 1O62A 1V2EA 3T32A 3DC1A 3GZCA 1E5EA 1TASA 3LG0A 4IW7A 4O6ZA 4PVFA 2EZ2A 2VGUA 2R5CB 1IUGA 2AEVA 4AZKA 2BI5A 4GSAA 2HUUA 2VMOA 2FQ6A 1LW4A 3BCXA 3PGYA 4I8AA 3B8XA 5EFSA 3UAKA 3KKIA 1IAXA 2VMUA 1LK9A 2BIAA 5F8VA 2ORDA 2X8UA 3TFTA 2GB3A 4MQQA 2Z9WA 2BIGA 4WB0A 3FKDA 4ATPA 4KAMA 4RM1A 4W1VA 4ADDA 1V2DA 4M2JA 2W8JA 2X3LA 1M0OA 1ZOBA 3DU4A 1J04A 2D61A 1AHFA 3HT4A 2DGMA 3A9YA 3TFUA 4ZDOA 4ZM4A 3EZ1A 3PA9A 3WKSA 1PMOA 2ZSMA 3TQXA 2OKKA 4P7YA 1S0AA 1D7RA 2YRRA 3NUIA 4WYDA 3ZZJA 1ARSA 3RQ1A 4DBCA 4IY7A 1CL1A 4ITXA 4OT8A 1AHXA 4UHMA 4LNMA 3AELA 2QBTA 3BB8A 3EI6A 1W23A 4P3MA 1AJSB 4UHNA 1TOEA 2HZPA 3RCHB 5DX5A 2CINA 1TOKA 1BQDA 2AY9A 2VIBA 3BC8A 2VIAA 2KFPA 1WYVA 3FVUA 5K8BA 3GR9A 4XJPA 1KL2A 4DQ6A 1C7OA 2BYLA 1H1CA 2CH1A 3JWAA 3QGUA 4WXBA 4ZM3A 2JG2A 4K05A 3FZ6A 2ZYJA 3UWCA 3WGBA 3ACZA 2Z61A 1H0CA 3QHXA 1O61A 2HP2A 1TOGA 2PB2A 3FQ8A 2QLRA 2CB1A 4PIWA 4JEWA 5HDMA 3L8AA 1B9HA 4LNLA 1ZC9A 2VGVA 2FM1A 1P3WA 1XEYA 3GZDA 1BJNA 3K28A 1W7NA 1GEWA 4OYTA 4ZWVA 5G09A 2CJHA 1IX8A 1WYUA 1G7XA 1GD9A 4M2MA 2W7LA 1GCKA 2HOYA 2VMRA 4ATQA 3MADA 4E77A 3DZZA 4AO9A 4MKJA 3F0HA 4K2BA 1RVUA 3NYSA 5E3KA 3UE8A 2W7JA 4JE5A 4Y0HA 3LWSA 3JW9A 1M32A 2AY1A 1GC2A 4OCAA 2QB2A 1YJSA 2ZJGA 1QJ3A 2YKYA 1LS3A 1KKPA 1T3IA 3FZ7A 2D7YA 1FG7A 1QITA 1Z3ZA 3WZFA 1G4XA 2ZY4A 2W8TA 3PD6B 4A00A 2VGTA 2VGZA 3G0TA 1IX6A 2VMVA 4EMYA 1ARIA 3NNKA 2X5FA 1PFFA 1MLZA 1ARTA 3FFRA 4R8DA 4TV7A 1WYTA 3N4XA 5G2QA 5E5IA 4W8IA 1CS1A 3MEBA 1BJWA 2WB6A 1BT4A 1SFFA 3AENA 4JF0A 2VI9A 4F5IA 1AJRA 4JF1A 3PDBB 2E7JA 2BWOA 1LKCA 1IJIA 3P6KA 4GRXA 4MSOA 4AOAA 2F8JA 2QSRA 2DGLA 2AY8A 1V72A 3E77A 3GWPA 4TN4A 2DR1A 1AMAA 2ZY3A 3PIUA 3VOMA 4N0BA 5EIGB 1S07A 5D95A 3N4RA 2VMSA 1VP4A 1CZCA 2W7KA 1CQ6A 4JEZA 1X2AA 3AEMA 4GE9A 1DGEA 3CQ6A 3RUYA 1C4KA 2BWPA 2E54A 5EUNA 3L44A 1IBJA 5LH9A 5G4JA 2WK8A 1MDXA 5FT5A 4OC9A 2D7ZA 1RVYA 1OHYA 4UOYA 4B98A 4N0WA 4RKCA 1D7VA 2NMPA 2E7IA 1TOJA 2C81A 1TARA 1QJ5A 4KYOA 1KL1A 3WCOA 1SF2A 1YOOA 2OQXA 4BHDA 5E4ZA 5M46A 5M49A 3HL2A 2PO3A 2ZP7A 4L0OA 3MC6C 2FKIA 3K40A 1B5OA 1D7UA 1BJOB 2W7GA 3BN1A 4E1OA 1TPLA 3DXVA 2W7DA 3MKJA 3EZSA 2G6WA 2GQNA 2W7IA 2C7TA 3FVSA 3E2ZA 3I4JA 2VGWA 3HLMA 4CXQA 1M0QA 3W1HA 2GSAA 5IWQA 2Z1ZA 1EQBA 2Z9XA 2CANA 3DR7A 3NDNA 4MQRA 1LW5A 1ASMA 1MAQA 1W7LA 1AAWA 3BWNA 3B1DA 1SVVA 4OBVA 3ZRPA 2AY4A 1N31A 3JU7A 3B46A 1AMSA 3VP6A 1AAMA 3COGA 4NOGA 4K2MA 1JF9A 1QISA 3JZLA 4WYCA 3ASAA 1I43A 2C0RA 1ARHA 4GEBA 4PFFA 3LY1A 2DGKA 4A6TA 3JWBA 1I48A 3WKRA 4F5JA 1OHVA 4UHOA 1GC4A 1ORDA 4WXFA 3B1CA 4MY5A 3LV2A 3IHJA 5EQCA 3MAFB 3PPLA 4J5UA 1AJSA 4KXKA 1N8PA 3FQ7A 3MBBA 4XAUA 1EJIA 3RI6A 3N7NA 5DJ9A 5F9SA 2CTZA 3OKSA 2XBNA 4XEWA 2HUIA 1GDEA 1FG3A 4DGTA 4IYOB 1ZODA 3QBOA 3IF2A 2AY3A 4UQVA 4A6RA 2ZSLA 2CSTA 1N2TA 4WLJA 5G0AA 2QA3A 2GMUA 4JE5D 3A8UX 3AEOA 2DKJA 4ZDLA 1VEFA 1BJ4A 1BW0A 1C7GA 4EU1A 2O1BA 3ISLA 1QZ9A 2EYQA 1SZKA 1GC0A 2WK7A 3MAUA 2Z20A 3EUCA 2JJGA 2YKXA 3DYDA 3ECDA 2OGAA 2EGYA 2VLHA 2HORA 4ZLVA 1ELQA 1UU1A 4WYAA 4LW4A 4E3RA 1C9CA 4W1WA 1AKBA 4A0RA 4RIZA 1UU0A 3BWOA 3GZDC 1SPAA 4GDYA 4WD2A 5FT6A 3WLXA 1MGVA 3RBFA 8AATA 2FN6A 4JEXA 1YAAA 4TMRA 2ZC0A 5D5SA 3DXWA 3PD6A 4A0HA 3KGWA 1DJ9A 3PAAA 1O4SA 4XJOA 3A2BA 1GC3A 3EIBA 1OHWA 4WLHA 4ITGA 4R5FA 2WKAA 1AKCA 3EI5A 4RITA 4WYEA 3EI7A 3PJ0A 3ZRRA 4WXGA 1IAYA 3KGXA 1YNUA 4WYFA 1C7NA 3PDBA 2QMAA 3Q8NA 5FT8A 2CJGA 3AV7A 4EB7A 3ELPA 4Q6RA 3LVLB 3H9XA 2HOXA 3QM2A 3H7FA 4QGRA 4A0FA 2VI8A 1WYVB 2D5YA 5EIGA 1LC8A 4W91A 3ATHA 4A72A 1OXOA 2VMPA 1QGNA 3LVJA 4ADEA 4GE4A 3NUBA 5HXXA 1JS6A 3ASBA 3WCNA 2YCPA 3ZZKA 2ZY5A 1AHGA 2OGEA 3HQTA 2W7FA 4U2HA 2DKBA 1M0PA 3TCMA 1ASLA 3FDDA 2R0TA 2BYJA 3DRDA 4BA5A 4IXOA 4XJMA 1IVRA 2YCNA 4IXZA 2ZY2A 2OATA 4F5HA 3B1EA 1LC7A 2VYCA 1DKAA 3E2YA 2WK9A 1BJOA 1AKAA 1WKGA 3N75A 3BCBA 2HP1A 5I92A 3NYUA 2D66A 2FNUA 2W7MA 2X5DA 2YCTA 3RBLA 4J8LA 4LNJA 1SZSA 2V0YA 3HDOA 3M5UA 2W7EA 3NX3A 3USFA 5HHYA 2AATA 4Y0IA 1GEXA 4MGRA 4AH3A 2YKVA 1CQ8A 4JEYA 4CXRA 2R5CA 1LC5A 2VMQA 3EI9A 1ASDA 2VGSA 1FC4A 1PG8A 4HVKA 2YRIA 3A9XA 5EAAA 3N0LA 1AICA 2QB3A 3G8MA 3AENB 3AATA 2EZ1A 3WX9A 3FCRA 3WY7A 1TATA 2DOUA 3AEJA 1V2FA 2FNIA 1M6SA 3VK4A 1CZEA 1RV3A 1AY5A 2Z67A 1D2FA 3FVXA 3DR4A 1ASEA 2D63A 4OTLA 1MDOA 3BS8A 2VMXA 3NU8A 2HUFA 2AY5A 4ZSWA 3JTXA 3WGCA 1VJOA 2R5EA 1AY4A 1AIBA 1EG5A 3MAFA 4F5FA 1M7YA 1GBNA 4XK1A 3FFHA 1ASFA 3NU7A 1W3UA 5EAVA 1AHEA 1ASAA 4ISYA 3MC6A 1MAPA 2VMTA 3QPGA 5J8QA 2BKWA 3H14A 4F5MA 3HMUA 1AMQA 4IYOA 1JS3A 3P1TA 3CQ5A 1OATA 2XH1A 3K7YA 7AATA 3VK2A 4F4EA 1I29A 1G4VA 4A0GA 2VMNA 3G7QA 1GEYA 1ELUA 1S09A 4Q75A 3RCHA 1Z7DA 2CJDA 1CQ7A 2D65A 1X28A 4Y0DA 4M2KA 3FSLA 3FZ8A 3E9KA 1M4NA 1MLYA 1M0NA 3E6GA 4XJLA 2JGTA 5DB5A 5LHAA 1RV4A 2YKUA 3VK3A 3GJUA 3E2ZB 4OMAA 5EUEA 3I16A 1CJ0A 1AHYA 4R5ZA 2BHXA 1ARGA 1U08A 3D6KA 4RJYA 5AX8A 1AY8A 2PB0A 4JEVA 5EUDA 4ZSYA 4WB0B 4XQ2A 2W8VA 1DFOA 4ADCA 2O0RA 4A6UA 3QI6A 5TF5A 3FRKA 3BV0A 1YIZA 1X29A 2D64A 4R2NA 3II0A 4WBTA 2VMZA 4WP0A 2FYFA 1ASBA 5DJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJE A;  1I41 A;  2JJE A;  2V1P A;  4F5L A;  3BCA A;  2HOZ A;  4IX8 A;  3TAT A;  2JIS A;  2BIE A;  2GMS A;  3R9A A;  1YIY A;  2BI9 A;  4W1X A;  1YJZ A;  5BJ3 A;  1G7W A;  1C0N A;  1B4X A;  1XI9 A;  4E3Q A;  1WKH A;  1AIA A;  2ZUK A;  4ADB A;  4MKK A;  3LVK A;  1S06 A;  2AY6 A;  2TPL A;  1BS0 A;  2VMY A;  2C44 A;  4GE7 A;  4BA4 A;  2BWN A;  2R2N A;  3EI8 A;  3R4T A;  2YOB A;  1E5F A;  4Q31 A;  5JAY A;  4CVQ A;  3N5M A;  2EO5 A;  3CAI A;  1D7S A;  2BI3 A;  4ZWM A;  4EFF A;  1O69 A;  1TOI A;  2O7C A;  1WST A;  2EH6 A;  1OXP A;  2CH2 A;  2EPJ A;  3EIA A;  4IXS A;  3W1I A;  3HVY A;  2JJH A;  4H51 A;  4BQ0 A;  1IX7 A;  2AY2 A;  4RKD A;  1WYU B;  1Y4I A;  2Z9V A;  1W7M A;  3E2F A;  3AEP A;  2RFV A;  4CBS A;  1KMJ A;  4U1T A;  3CBF A;  3AEM C;  1DJU A;  1MDZ A;  3HBX A;  5M4D A;  1B5P A;  1PMM A;  5G2P A;  4ZDP A;  2W8W A;  2W8U A;  3AOW A;  3ELE A;  1JG8 A;  1SZU A;  5FT4 A;  2W7H A;  2Z9U A;  1B9I A;  1J32 A;  4EB5 A;  4RAE A;  3A9Z A;  3LVM A;  3VAX A;  3ZRQ A;  1DGD A;  1CL2 A;  4HF8 A;  5G4I A;  1DTY A;  1AX4 A;  4F5K A;  1ASN A;  4WYG A;  3GSB A;  1ECX A;  2OKJ A;  3GBX A;  1WYT B;  3PDX A;  1YJY A;  3NRA A;  4W5K A;  4ZAS A;  3FQA A;  3FDB A;  4F5G A;  4PFN A;  5BJ4 A;  3OP7 A;  4LW2 A;  1AMR A;  1UKJ A;  4ZAH A;  3AEJ C;  3W1J A;  1UU2 A;  1ASC A;  2Q7W A;  3NYT A;  4OBU A;  4K2I A;  4BMK A;  4RLG A;  1KKJ A;  1S08 A;  3GET A;  4AZJ A;  2CY8 A;  3FD0 A;  3I5T A;  4FFC A;  2CFB A;  3CQ4 A;  2YHK A;  1KMK A;  1BQA A;  1BKG A;  3BWN C;  2Z1Y A;  4B9B A;  1QIR A;  2AY7 A;  2VMW A;  3QN6 A;  5C6U A;  9AAT A;  1X0M A;  2E7U A;  1B8G A;  5M4B A;  2VLF A;  3KE3 A;  4LC3 A;  4MQP A;  4AO4 A;  2JJF A;  3NTJ A;  3F9T A;  4Q76 A;  3DOD A;  4FL0 A;  4RJ0 A;  2AEU A;  2BI2 A;  2BI1 A;  1ASG A;  3F6T A;  4CBR A;  3AOV A;  3FTB A;  1O62 A;  1V2E A;  3T32 A;  3DC1 A;  3GZC A;  1E5E A;  1TAS A;  3LG0 A;  4IW7 A;  4O6Z A;  4PVF A;  2EZ2 A;  2VGU A;  2R5C B;  1IUG A;  2AEV A;  4AZK A;  2BI5 A;  4GSA A;  2HUU A;  2VMO A;  2FQ6 A;  1LW4 A;  3BCX A;  3PGY A;  4I8A A;  3B8X A;  5EFS A;  3UAK A;  3KKI A;  1IAX A;  2VMU A;  1LK9 A;  2BIA A;  5F8V A;  2ORD A;  2X8U A;  3TFT A;  2GB3 A;  4MQQ A;  2Z9W A;  2BIG A;  4WB0 A;  3FKD A;  4ATP A;  4KAM A;  4RM1 A;  4W1V A;  4ADD A;  1V2D A;  4M2J A;  2W8J A;  2X3L A;  1M0O A;  1ZOB A;  3DU4 A;  1J04 A;  2D61 A;  1AHF A;  3HT4 A;  2DGM A;  3A9Y A;  3TFU A;  4ZDO A;  4ZM4 A;  3EZ1 A;  3PA9 A;  3WKS A;  1PMO A;  2ZSM A;  3TQX A;  2OKK A;  4P7Y A;  1S0A A;  1D7R A;  2YRR A;  3NUI A;  4WYD A;  3ZZJ A;  1ARS A;  3RQ1 A;  4DBC A;  4IY7 A;  1CL1 A;  4ITX A;  4OT8 A;  1AHX A;  4UHM A;  4LNM A;  3AEL A;  2QBT A;  3BB8 A;  3EI6 A;  1W23 A;  4P3M A;  1AJS B;  4UHN A;  1TOE A;  2HZP A;  3RCH B;  5DX5 A;  2CIN A;  1TOK A;  1BQD A;  2AY9 A;  2VIB A;  3BC8 A;  2VIA A;  1WYV A;  3FVU A;  5K8B A;  3GR9 A;  4XJP A;  1KL2 A;  4DQ6 A;  1C7O A;  2BYL A;  1H1C A;  2CH1 A;  3JWA A;  3QGU A;  4WXB A;  4ZM3 A;  2JG2 A;  3FZ6 A;  2ZYJ A;  3UWC A;  3WGB A;  3ACZ A;  2Z61 A;  1H0C A;  3QHX A;  1O61 A;  2HP2 A;  1TOG A;  2PB2 A;  3FQ8 A;  2QLR A;  2CB1 A;  4PIW A;  4JEW A;  5HDM A;  3L8A A;  1B9H A;  4LNL A;  1ZC9 A;  2VGV A;  2FM1 A;  1P3W A;  1XEY A;  3GZD A;  1BJN A;  3K28 A;  1W7N A;  1GEW A;  4OYT A;  4ZWV A;  5G09 A;  2CJH A;  1IX8 A;  1WYU A;  1G7X A;  1GD9 A;  4M2M A;  2W7L A;  1GCK A;  2HOY A;  2VMR A;  4ATQ A;  3MAD A;  4E77 A;  3DZZ A;  4AO9 A;  4MKJ A;  3F0H A;  4K2B A;  1RVU A;  3NYS A;  5E3K A;  3UE8 A;  2W7J A;  4JE5 A;  4Y0H A;  3LWS A;  3JW9 A;  1M32 A;  2AY1 A;  1GC2 A;  4OCA A;  2QB2 A;  1YJS A;  2ZJG A;  1QJ3 A;  2YKY A;  1LS3 A;  1KKP A;  1T3I A;  3FZ7 A;  2D7Y A;  1FG7 A;  1QIT A;  1Z3Z A;  3WZF A;  1G4X A;  2ZY4 A;  2W8T A;  3PD6 B;  4A00 A;  2VGT A;  2VGZ A;  3G0T A;  1IX6 A;  2VMV A;  4EMY A;  1ARI A;  3NNK A;  2X5F A;  1PFF A;  1MLZ A;  1ART A;  3FFR A;  4R8D A;  4TV7 A;  1WYT A;  5G2Q A;  5E5I A;  4W8I A;  1CS1 A;  3MEB A;  1BJW A;  1BT4 A;  1SFF A;  3AEN A;  4JF0 A;  2VI9 A;  4F5I A;  1AJR A;  4JF1 A;  3PDB B;  2E7J A;  2BWO A;  1LKC A;  1IJI A;  3P6K A;  4GRX A;  4MSO A;  4AOA A;  2F8J A;  2DGL A;  2AY8 A;  1V72 A;  3E77 A;  3GWP A;  4TN4 A;  2DR1 A;  1AMA A;  2ZY3 A;  3PIU A;  3VOM A;  4N0B A;  5EIG B;  1S07 A;  5D95 A;  2VMS A;  1VP4 A;  1CZC A;  2W7K A;  1CQ6 A;  4JEZ A;  1X2A A;  3AEM A;  4GE9 A;  1DGE A;  3CQ6 A;  3RUY A;  1C4K A;  2BWP A;  2E54 A;  5EUN A;  3L44 A;  1IBJ A;  5LH9 A;  5G4J A;  2WK8 A;  1MDX A;  5FT5 A;  4OC9 A;  2D7Z A;  1RVY A;  1OHY A;  4UOY A;  4B98 A;  4N0W A;  4RKC A;  1D7V A;  2NMP A;  2E7I A;  1TOJ A;  2C81 A;  1TAR A;  1QJ5 A;  4KYO A;  1KL1 A;  3WCO A;  1SF2 A;  1YOO A;  2OQX A;  4BHD A;  5E4Z A;  5M46 A;  5M49 A;  3HL2 A;  2PO3 A;  2ZP7 A;  4L0O A;  3MC6 C;  3K40 A;  1B5O A;  1D7U A;  1BJO B;  2W7G A;  3BN1 A;  4E1O A;  1TPL A;  3DXV A;  2W7D A;  3MKJ A;  3EZS A;  2G6W A;  2GQN A;  2W7I A;  2C7T A;  3FVS A;  3E2Z A;  3I4J A;  2VGW A;  3HLM A;  4CXQ A;  1M0Q A;  3W1H A;  2GSA A;  5IWQ A;  2Z1Z A;  1EQB A;  2Z9X A;  2CAN A;  3DR7 A;  3NDN A;  4MQR A;  1LW5 A;  1ASM A;  1MAQ A;  1W7L A;  1AAW A;  3BWN A;  3B1D A;  1SVV A;  4OBV A;  3ZRP A;  2AY4 A;  1N31 A;  3JU7 A;  3B46 A;  1AMS A;  3VP6 A;  1AAM A;  3COG A;  4NOG A;  4K2M A;  1JF9 A;  1QIS A;  3JZL A;  4WYC A;  3ASA A;  1I43 A;  2C0R A;  1ARH A;  4GEB A;  4PFF A;  3LY1 A;  2DGK A;  4A6T A;  3JWB A;  1I48 A;  3WKR A;  4F5J A;  1OHV A;  4UHO A;  1GC4 A;  1ORD A;  4WXF A;  3B1C A;  4MY5 A;  3LV2 A;  3IHJ A;  5EQC A;  3MAF B;  3PPL A;  4J5U A;  1AJS A;  4KXK A;  1N8P A;  3FQ7 A;  3MBB A;  4XAU A;  1EJI A;  3RI6 A;  5DJ9 A;  5F9S A;  2CTZ A;  3OKS A;  2XBN A;  4XEW A;  2HUI A;  1GDE A;  1FG3 A;  4DGT A;  4IYO B;  1ZOD A;  3QBO A;  3IF2 A;  2AY3 A;  4UQV A;  4A6R A;  2ZSL A;  2CST A;  1N2T A;  4WLJ A;  5G0A A;  2QA3 A;  2GMU A;  4JE5 D;  3A8U X;  3AEO A;  2DKJ A;  4ZDL A;  1VEF A;  1BJ4 A;  1BW0 A;  1C7G A;  4EU1 A;  2O1B A;  3ISL A;  1QZ9 A;  1SZK A;  1GC0 A;  2WK7 A;  3MAU A;  2Z20 A;  3EUC A;  2JJG A;  2YKX A;  3DYD A;  3ECD A;  2OGA A;  2EGY A;  2VLH A;  2HOR A;  4ZLV A;  1ELQ A;  1UU1 A;  4WYA A;  4LW4 A;  4E3R A;  1C9C A;  4W1W A;  1AKB A;  4A0R A;  4RIZ A;  1UU0 A;  3BWO A;  3GZD C;  1SPA A;  4GDY A;  4WD2 A;  5FT6 A;  3WLX A;  1MGV A;  3RBF A;  8AAT A;  2FN6 A;  4JEX A;  1YAA A;  4TMR A;  2ZC0 A;  5D5S A;  3DXW A;  3PD6 A;  4A0H A;  3KGW A;  1DJ9 A;  3PAA A;  1O4S A;  4XJO A;  3A2B A;  1GC3 A;  3EIB A;  1OHW A;  4WLH A;  4ITG A;  4R5F A;  2WKA A;  1AKC A;  3EI5 A;  4RIT A;  4WYE A;  3EI7 A;  3PJ0 A;  3ZRR A;  4WXG A;  1IAY A;  3KGX A;  1YNU A;  4WYF A;  1C7N A;  3PDB A;  2QMA A;  3Q8N A;  5FT8 A;  2CJG A;  3AV7 A;  4EB7 A;  3ELP A;  4Q6R A;  3LVL B;  2HOX A;  3QM2 A;  3H7F A;  4QGR A;  4A0F A;  2VI8 A;  1WYV B;  2D5Y A;  5EIG A;  1LC8 A;  4W91 A;  3ATH A;  4A72 A;  1OXO A;  2VMP A;  1QGN A;  3LVJ A;  4ADE A;  4GE4 A;  3NUB A;  5HXX A;  1JS6 A;  3ASB A;  3WCN A;  2YCP A;  3ZZK A;  2ZY5 A;  1AHG A;  2OGE A;  3HQT A;  2W7F A;  4U2H A;  2DKB A;  1M0P A;  3TCM A;  1ASL A;  3FDD A;  2R0T A;  2BYJ A;  3DRD A;  4BA5 A;  4IXO A;  4XJM A;  1IVR A;  2YCN A;  4IXZ A;  2ZY2 A;  2OAT A;  4F5H A;  3B1E A;  1LC7 A;  2VYC A;  1DKA A;  3E2Y A;  2WK9 A;  1BJO A;  1AKA A;  1WKG A;  3N75 A;  3BCB A;  2HP1 A;  5I92 A;  3NYU A;  2D66 A;  2FNU A;  2W7M A;  2X5D A;  2YCT A;  3RBL A;  4J8L A;  4LNJ A;  1SZS A;  2V0Y A;  3HDO A;  3M5U A;  2W7E A;  3NX3 A;  3USF A;  5HHY A;  2AAT A;  4Y0I A;  1GEX A;  4MGR A;  4AH3 A;  2YKV A;  1CQ8 A;  4JEY A;  4CXR A;  2R5C A;  1LC5 A;  2VMQ A;  3EI9 A;  1ASD A;  2VGS A;  1FC4 A;  1PG8 A;  4HVK A;  2YRI A;  3A9X A;  5EAA A;  3N0L A;  1AIC A;  2QB3 A;  3G8M A;  3AEN B;  3AAT A;  2EZ1 A;  3WX9 A;  3FCR A;  3WY7 A;  1TAT A;  2DOU A;  3AEJ A;  1V2F A;  2FNI A;  1M6S A;  3VK4 A;  1CZE A;  1RV3 A;  1AY5 A;  2Z67 A;  1D2F A;  3FVX A;  3DR4 A;  1ASE A;  2D63 A;  4OTL A;  1MDO A;  3BS8 A;  2VMX A;  3NU8 A;  2HUF A;  2AY5 A;  4ZSW A;  3JTX A;  3WGC A;  1VJO A;  2R5E A;  1AY4 A;  1AIB A;  1EG5 A;  3MAF A;  4F5F A;  1M7Y A;  1GBN A;  4XK1 A;  3FFH A;  1ASF A;  3NU7 A;  1W3U A;  5EAV A;  1AHE A;  1ASA A;  4ISY A;  3MC6 A;  1MAP A;  2VMT A;  3QPG A;  5J8Q A;  2BKW A;  3H14 A;  4F5M A;  3HMU A;  1AMQ A;  4IYO A;  1JS3 A;  3P1T A;  3CQ5 A;  1OAT A;  2XH1 A;  3K7Y A;  7AAT A;  3VK2 A;  4F4E A;  1I29 A;  1G4V A;  4A0G A;  2VMN A;  3G7Q A;  1GEY A;  1ELU A;  1S09 A;  4Q75 A;  3RCH A;  1Z7D A;  2CJD A;  1CQ7 A;  2D65 A;  1X28 A;  4Y0D A;  4M2K A;  3FSL A;  3FZ8 A;  3E9K A;  1M4N A;  1MLY A;  1M0N A;  3E6G A;  4XJL A;  2JGT A;  5DB5 A;  5LHA A;  1RV4 A;  2YKU A;  3VK3 A;  3GJU A;  3E2Z B;  4OMA A;  5EUE A;  3I16 A;  1CJ0 A;  1AHY A;  4R5Z A;  2BHX A;  1ARG A;  1U08 A;  3D6K A;  4RJY A;  5AX8 A;  1AY8 A;  2PB0 A;  4JEV A;  5EUD A;  4ZSY A;  4WB0 B;  4XQ2 A;  2W8V A;  1DFO A;  4ADC A;  2O0R A;  4A6U A;  3QI6 A;  5TF5 A;  3FRK A;  3BV0 A;  1YIZ A;  1X29 A;  2D64 A;  4R2N A;  3II0 A;  4WBT A;  2VMZ A;  4WP0 A;  2FYF A;  1ASB A;  5DJ1 A; 
#chains in the Genus database with same CATH topology
 1DJE A;  1I41 A;  2JJE A;  2V1P A;  4F5L A;  3BCA A;  2HOZ A;  4IX8 A;  3TAT A;  2JIS A;  2BIE A;  2GMS A;  3R9A A;  1YIY A;  2BI9 A;  4W1X A;  1YJZ A;  5BJ3 A;  1G7W A;  1C0N A;  1B4X A;  1XI9 A;  4E3Q A;  1WKH A;  1AIA A;  2ZUK A;  4ADB A;  2G7J A;  4MKK A;  3LVK A;  1S06 A;  2AY6 A;  2TPL A;  1BS0 A;  2VMY A;  2C44 A;  4GE7 A;  4BA4 A;  2BWN A;  2R2N A;  3EI8 A;  3R4T A;  2YOB A;  1E5F A;  4Q31 A;  5JAY A;  5KTB A;  4CVQ A;  3N5M A;  2EO5 A;  3CAI A;  1D7S A;  2BI3 A;  4ZWM A;  4EFF A;  1O69 A;  1TOI A;  2O7C A;  1WST A;  2EH6 A;  1OXP A;  2CH2 A;  2EPJ A;  3EIA A;  4IXS A;  3W1I A;  3HVY A;  2JJH A;  4H51 A;  4BQ0 A;  1IX7 A;  2AY2 A;  4RKD A;  1WYU B;  1Y4I A;  2Z9V A;  1W7M A;  3E2F A;  3AEP A;  2RFV A;  4CBS A;  1KMJ A;  4U1T A;  3CBF A;  3AEM C;  1DJU A;  1MDZ A;  3HBX A;  5M4D A;  1B5P A;  1PMM A;  5G2P A;  4ZDP A;  2W8W A;  2W8U A;  3AOW A;  3ELE A;  1JG8 A;  1SZU A;  5FT4 A;  2W7H A;  2Z9U A;  1B9I A;  1J32 A;  4EB5 A;  4RAE A;  3A9Z A;  3LVM A;  3VAX A;  3ZRQ A;  1DGD A;  1CL2 A;  4HF8 A;  5G4I A;  1DTY A;  1AX4 A;  4F5K A;  1ASN A;  4WYG A;  3GSB A;  1ECX A;  2OKJ A;  3GBX A;  1WYT B;  3PDX A;  1YJY A;  3NRA A;  4W5K A;  4ZAS A;  3FQA A;  3FDB A;  4F5G A;  4PFN A;  5BJ4 A;  3OP7 A;  4LW2 A;  1AMR A;  1UKJ A;  4ZAH A;  3AEJ C;  3W1J A;  1UU2 A;  1ASC A;  2Q7W A;  3NYT A;  4OBU A;  4K2I A;  4BMK A;  3N4S A;  4RLG A;  1KKJ A;  4H63 Q;  1S08 A;  3GET A;  4AZJ A;  2CY8 A;  3FD0 A;  3I5T A;  4FFC A;  2CFB A;  3CQ4 A;  2A1V A;  2YHK A;  1KMK A;  1BQA A;  1BKG A;  3BWN C;  2Z1Y A;  4B9B A;  1QIR A;  2AY7 A;  2VMW A;  3QN6 A;  5C6U A;  9AAT A;  1X0M A;  2E7U A;  1B8G A;  5M4B A;  2VLF A;  3KE3 A;  4LC3 A;  4MQP A;  4AO4 A;  2JJF A;  3NTJ A;  3F9T A;  4Q76 A;  3DOD A;  4FL0 A;  4RJ0 A;  2AEU A;  2BI2 A;  2BI1 A;  1ASG A;  3F6T A;  4CBR A;  3AOV A;  3FTB A;  1O62 A;  1V2E A;  3T32 A;  3DC1 A;  3GZC A;  1E5E A;  1TAS A;  3LG0 A;  4IW7 A;  4O6Z A;  4PVF A;  2EZ2 A;  2VGU A;  2R5C B;  1IUG A;  2AEV A;  4AZK A;  2BI5 A;  4GSA A;  2HUU A;  2VMO A;  2FQ6 A;  1LW4 A;  3BCX A;  3PGY A;  4I8A A;  3B8X A;  5EFS A;  3UAK A;  3KKI A;  1IAX A;  2VMU A;  1LK9 A;  2BIA A;  5F8V A;  2ORD A;  2X8U A;  3TFT A;  2GB3 A;  4MQQ A;  2Z9W A;  2BIG A;  4WB0 A;  3FKD A;  4ATP A;  4KAM A;  4RM1 A;  4W1V A;  4ADD A;  1V2D A;  4M2J A;  2W8J A;  2X3L A;  1M0O A;  1ZOB A;  3DU4 A;  1J04 A;  2D61 A;  1AHF A;  3HT4 A;  2DGM A;  3A9Y A;  3TFU A;  4ZDO A;  4ZM4 A;  3EZ1 A;  3PA9 A;  3WKS A;  1PMO A;  2ZSM A;  3TQX A;  2OKK A;  4P7Y A;  1S0A A;  1D7R A;  2YRR A;  3NUI A;  4WYD A;  3ZZJ A;  1ARS A;  3RQ1 A;  4DBC A;  4IY7 A;  1CL1 A;  4ITX A;  4OT8 A;  1AHX A;  4UHM A;  4LNM A;  3AEL A;  2QBT A;  3BB8 A;  3EI6 A;  1W23 A;  4P3M A;  1AJS B;  4UHN A;  1TOE A;  2HZP A;  3RCH B;  5DX5 A;  2CIN A;  1TOK A;  1BQD A;  2AY9 A;  2VIB A;  3BC8 A;  2VIA A;  2KFP A;  1WYV A;  3FVU A;  5K8B A;  3GR9 A;  4XJP A;  1KL2 A;  4DQ6 A;  1C7O A;  2BYL A;  1H1C A;  2CH1 A;  3JWA A;  3QGU A;  4WXB A;  4ZM3 A;  2JG2 A;  4K05 A;  3FZ6 A;  2ZYJ A;  3UWC A;  3WGB A;  3ACZ A;  2Z61 A;  1H0C A;  3QHX A;  1O61 A;  2HP2 A;  1TOG A;  2PB2 A;  3FQ8 A;  2QLR A;  2CB1 A;  4PIW A;  4JEW A;  5HDM A;  3L8A A;  1B9H A;  4LNL A;  1ZC9 A;  2VGV A;  2FM1 A;  1P3W A;  1XEY A;  3GZD A;  1BJN A;  3K28 A;  1W7N A;  1GEW A;  4OYT A;  4ZWV A;  5G09 A;  2CJH A;  1IX8 A;  1WYU A;  1G7X A;  1GD9 A;  4M2M A;  2W7L A;  1GCK A;  2HOY A;  2VMR A;  4ATQ A;  3MAD A;  4E77 A;  3DZZ A;  4AO9 A;  4MKJ A;  3F0H A;  4K2B A;  1RVU A;  3NYS A;  5E3K A;  3UE8 A;  2W7J A;  4JE5 A;  4Y0H A;  3LWS A;  3JW9 A;  1M32 A;  2AY1 A;  1GC2 A;  4OCA A;  2QB2 A;  1YJS A;  2ZJG A;  1QJ3 A;  2YKY A;  1LS3 A;  1KKP A;  1T3I A;  3FZ7 A;  2D7Y A;  1FG7 A;  1QIT A;  1Z3Z A;  3WZF A;  1G4X A;  2ZY4 A;  2W8T A;  3PD6 B;  4A00 A;  2VGT A;  2VGZ A;  3G0T A;  1IX6 A;  2VMV A;  4EMY A;  1ARI A;  3NNK A;  2X5F A;  1PFF A;  1MLZ A;  1ART A;  3FFR A;  4R8D A;  4TV7 A;  1WYT A;  3N4X A;  5G2Q A;  5E5I A;  4W8I A;  1CS1 A;  3MEB A;  1BJW A;  2WB6 A;  1BT4 A;  1SFF A;  3AEN A;  4JF0 A;  2VI9 A;  4F5I A;  1AJR A;  4JF1 A;  3PDB B;  2E7J A;  2BWO A;  1LKC A;  1IJI A;  3P6K A;  4GRX A;  4MSO A;  4AOA A;  2F8J A;  2QSR A;  2DGL A;  2AY8 A;  1V72 A;  3E77 A;  3GWP A;  4TN4 A;  2DR1 A;  1AMA A;  2ZY3 A;  3PIU A;  3VOM A;  4N0B A;  5EIG B;  1S07 A;  5D95 A;  3N4R A;  2VMS A;  1VP4 A;  1CZC A;  2W7K A;  1CQ6 A;  4JEZ A;  1X2A A;  3AEM A;  4GE9 A;  1DGE A;  3CQ6 A;  3RUY A;  1C4K A;  2BWP A;  2E54 A;  5EUN A;  3L44 A;  1IBJ A;  5LH9 A;  5G4J A;  2WK8 A;  1MDX A;  5FT5 A;  4OC9 A;  2D7Z A;  1RVY A;  1OHY A;  4UOY A;  4B98 A;  4N0W A;  4RKC A;  1D7V A;  2NMP A;  2E7I A;  1TOJ A;  2C81 A;  1TAR A;  1QJ5 A;  4KYO A;  1KL1 A;  3WCO A;  1SF2 A;  1YOO A;  2OQX A;  4BHD A;  5E4Z A;  5M46 A;  5M49 A;  3HL2 A;  2PO3 A;  2ZP7 A;  4L0O A;  3MC6 C;  2FKI A;  3K40 A;  1B5O A;  1D7U A;  1BJO B;  2W7G A;  3BN1 A;  4E1O A;  1TPL A;  3DXV A;  2W7D A;  3MKJ A;  3EZS A;  2G6W A;  2GQN A;  2W7I A;  2C7T A;  3FVS A;  3E2Z A;  3I4J A;  2VGW A;  3HLM A;  4CXQ A;  1M0Q A;  3W1H A;  2GSA A;  5IWQ A;  2Z1Z A;  1EQB A;  2Z9X A;  2CAN A;  3DR7 A;  3NDN A;  4MQR A;  1LW5 A;  1ASM A;  1MAQ A;  1W7L A;  1AAW A;  3BWN A;  3B1D A;  1SVV A;  4OBV A;  3ZRP A;  2AY4 A;  1N31 A;  3JU7 A;  3B46 A;  1AMS A;  3VP6 A;  1AAM A;  3COG A;  4NOG A;  4K2M A;  1JF9 A;  1QIS A;  3JZL A;  4WYC A;  3ASA A;  1I43 A;  2C0R A;  1ARH A;  4GEB A;  4PFF A;  3LY1 A;  2DGK A;  4A6T A;  3JWB A;  1I48 A;  3WKR A;  4F5J A;  1OHV A;  4UHO A;  1GC4 A;  1ORD A;  4WXF A;  3B1C A;  4MY5 A;  3LV2 A;  3IHJ A;  5EQC A;  3MAF B;  3PPL A;  4J5U A;  1AJS A;  4KXK A;  1N8P A;  3FQ7 A;  3MBB A;  4XAU A;  1EJI A;  3RI6 A;  3N7N A;  5DJ9 A;  5F9S A;  2CTZ A;  3OKS A;  2XBN A;  4XEW A;  2HUI A;  1GDE A;  1FG3 A;  4DGT A;  4IYO B;  1ZOD A;  3QBO A;  3IF2 A;  2AY3 A;  4UQV A;  4A6R A;  2ZSL A;  2CST A;  1N2T A;  4WLJ A;  5G0A A;  2QA3 A;  2GMU A;  4JE5 D;  3A8U X;  3AEO A;  2DKJ A;  4ZDL A;  1VEF A;  1BJ4 A;  1BW0 A;  1C7G A;  4EU1 A;  2O1B A;  3ISL A;  1QZ9 A;  2EYQ A;  1SZK A;  1GC0 A;  2WK7 A;  3MAU A;  2Z20 A;  3EUC A;  2JJG A;  2YKX A;  3DYD A;  3ECD A;  2OGA A;  2EGY A;  2VLH A;  2HOR A;  4ZLV A;  1ELQ A;  1UU1 A;  4WYA A;  4LW4 A;  4E3R A;  1C9C A;  4W1W A;  1AKB A;  4A0R A;  4RIZ A;  1UU0 A;  3BWO A;  3GZD C;  1SPA A;  4GDY A;  4WD2 A;  5FT6 A;  3WLX A;  1MGV A;  3RBF A;  8AAT A;  2FN6 A;  4JEX A;  1YAA A;  4TMR A;  2ZC0 A;  5D5S A;  3DXW A;  3PD6 A;  4A0H A;  3KGW A;  1DJ9 A;  3PAA A;  1O4S A;  4XJO A;  3A2B A;  1GC3 A;  3EIB A;  1OHW A;  4WLH A;  4ITG A;  4R5F A;  2WKA A;  1AKC A;  3EI5 A;  4RIT A;  4WYE A;  3EI7 A;  3PJ0 A;  3ZRR A;  4WXG A;  1IAY A;  3KGX A;  1YNU A;  4WYF A;  1C7N A;  3PDB A;  2QMA A;  3Q8N A;  5FT8 A;  2CJG A;  3AV7 A;  4EB7 A;  3ELP A;  4Q6R A;  3LVL B;  3H9X A;  2HOX A;  3QM2 A;  3H7F A;  4QGR A;  4A0F A;  2VI8 A;  1WYV B;  2D5Y A;  5EIG A;  1LC8 A;  4W91 A;  3ATH A;  4A72 A;  1OXO A;  2VMP A;  1QGN A;  3LVJ A;  4ADE A;  4GE4 A;  3NUB A;  5HXX A;  1JS6 A;  3ASB A;  3WCN A;  2YCP A;  3ZZK A;  2ZY5 A;  1AHG A;  2OGE A;  3HQT A;  2W7F A;  4U2H A;  2DKB A;  1M0P A;  3TCM A;  1ASL A;  3FDD A;  2R0T A;  2BYJ A;  3DRD A;  4BA5 A;  4IXO A;  4XJM A;  1IVR A;  2YCN A;  4IXZ A;  2ZY2 A;  2OAT A;  4F5H A;  3B1E A;  1LC7 A;  2VYC A;  1DKA A;  3E2Y A;  2WK9 A;  1BJO A;  1AKA A;  1WKG A;  3N75 A;  3BCB A;  2HP1 A;  5I92 A;  3NYU A;  2D66 A;  2FNU A;  2W7M A;  2X5D A;  2YCT A;  3RBL A;  4J8L A;  4LNJ A;  1SZS A;  2V0Y A;  3HDO A;  3M5U A;  2W7E A;  3NX3 A;  3USF A;  5HHY A;  2AAT A;  4Y0I A;  1GEX A;  4MGR A;  4AH3 A;  2YKV A;  1CQ8 A;  4JEY A;  4CXR A;  2R5C A;  1LC5 A;  2VMQ A;  3EI9 A;  1ASD A;  2VGS A;  1FC4 A;  1PG8 A;  4HVK A;  2YRI A;  3A9X A;  5EAA A;  3N0L A;  1AIC A;  2QB3 A;  3G8M A;  3AEN B;  3AAT A;  2EZ1 A;  3WX9 A;  3FCR A;  3WY7 A;  1TAT A;  2DOU A;  3AEJ A;  1V2F A;  2FNI A;  1M6S A;  3VK4 A;  1CZE A;  1RV3 A;  1AY5 A;  2Z67 A;  1D2F A;  3FVX A;  3DR4 A;  1ASE A;  2D63 A;  4OTL A;  1MDO A;  3BS8 A;  2VMX A;  3NU8 A;  2HUF A;  2AY5 A;  1KAF A;  4ZSW A;  3JTX A;  3WGC A;  1VJO A;  2R5E A;  1AY4 A;  1AIB A;  1EG5 A;  3MAF A;  4F5F A;  1M7Y A;  1GBN A;  4XK1 A;  3FFH A;  1ASF A;  3NU7 A;  1W3U A;  5EAV A;  1AHE A;  1ASA A;  4ISY A;  3MC6 A;  1MAP A;  2VMT A;  3QPG A;  5J8Q A;  2BKW A;  3H14 A;  4F5M A;  3HMU A;  1AMQ A;  4IYO A;  1JS3 A;  3P1T A;  3CQ5 A;  1OAT A;  2XH1 A;  3K7Y A;  7AAT A;  3VK2 A;  4F4E A;  1I29 A;  1G4V A;  4A0G A;  2VMN A;  3G7Q A;  1GEY A;  1ELU A;  1S09 A;  4Q75 A;  3RCH A;  1Z7D A;  2CJD A;  1CQ7 A;  2D65 A;  1X28 A;  4Y0D A;  4M2K A;  3FSL A;  3FZ8 A;  3E9K A;  1M4N A;  1MLY A;  1M0N A;  3E6G A;  4XJL A;  2JGT A;  5DB5 A;  5LHA A;  1RV4 A;  2YKU A;  3VK3 A;  3GJU A;  3E2Z B;  4OMA A;  5EUE A;  3I16 A;  1CJ0 A;  1AHY A;  4R5Z A;  2BHX A;  1ARG A;  1U08 A;  3D6K A;  4RJY A;  5AX8 A;  1AY8 A;  2PB0 A;  4JEV A;  5EUD A;  4ZSY A;  4WB0 B;  4XQ2 A;  2W8V A;  1DFO A;  4ADC A;  2O0R A;  4A6U A;  3QI6 A;  5TF5 A;  3FRK A;  3BV0 A;  1YIZ A;  1X29 A;  2D64 A;  4R2N A;  3II0 A;  4WBT A;  2VMZ A;  4WP0 A;  2FYF A;  1ASB A;  5DJ1 A; 
#chains in the Genus database with same CATH homology
 1DJE A;  1I41 A;  2JJE A;  2V1P A;  4F5L A;  3BCA A;  2HOZ A;  4IX8 A;  3TAT A;  2JIS A;  2BIE A;  2GMS A;  3R9A A;  1YIY A;  2BI9 A;  4W1X A;  1YJZ A;  5BJ3 A;  1G7W A;  1C0N A;  1B4X A;  1XI9 A;  4E3Q A;  1WKH A;  1AIA A;  2ZUK A;  4ADB A;  2G7J A;  4MKK A;  3LVK A;  1S06 A;  2AY6 A;  2TPL A;  1BS0 A;  2VMY A;  2C44 A;  4GE7 A;  4BA4 A;  2BWN A;  2R2N A;  3EI8 A;  3R4T A;  2YOB A;  1E5F A;  4Q31 A;  5JAY A;  5KTB A;  4CVQ A;  3N5M A;  2EO5 A;  3CAI A;  1D7S A;  2BI3 A;  4ZWM A;  4EFF A;  1O69 A;  1TOI A;  2O7C A;  1WST A;  2EH6 A;  1OXP A;  2CH2 A;  2EPJ A;  3EIA A;  4IXS A;  3W1I A;  3HVY A;  2JJH A;  4H51 A;  4BQ0 A;  1IX7 A;  2AY2 A;  4RKD A;  1WYU B;  1Y4I A;  2Z9V A;  1W7M A;  3E2F A;  3AEP A;  2RFV A;  4CBS A;  1KMJ A;  4U1T A;  3CBF A;  3AEM C;  1DJU A;  1MDZ A;  3HBX A;  5M4D A;  1B5P A;  1PMM A;  5G2P A;  4ZDP A;  2W8W A;  2W8U A;  3AOW A;  3ELE A;  1JG8 A;  1SZU A;  5FT4 A;  2W7H A;  2Z9U A;  1B9I A;  1J32 A;  4EB5 A;  4RAE A;  3A9Z A;  3LVM A;  3VAX A;  3ZRQ A;  1DGD A;  1CL2 A;  4HF8 A;  5G4I A;  1DTY A;  1AX4 A;  4F5K A;  1ASN A;  4WYG A;  3GSB A;  1ECX A;  2OKJ A;  3GBX A;  1WYT B;  3PDX A;  1YJY A;  3NRA A;  4W5K A;  4ZAS A;  3FQA A;  3FDB A;  4F5G A;  4PFN A;  5BJ4 A;  3OP7 A;  4LW2 A;  1AMR A;  1UKJ A;  4ZAH A;  3AEJ C;  3W1J A;  1UU2 A;  1ASC A;  2Q7W A;  3NYT A;  4OBU A;  4K2I A;  4BMK A;  3N4S A;  4RLG A;  1KKJ A;  4H63 Q;  1S08 A;  3GET A;  4AZJ A;  2CY8 A;  3FD0 A;  3I5T A;  4FFC A;  2CFB A;  3CQ4 A;  2A1V A;  2YHK A;  1KMK A;  1BQA A;  1BKG A;  3BWN C;  2Z1Y A;  4B9B A;  1QIR A;  2AY7 A;  2VMW A;  3QN6 A;  5C6U A;  9AAT A;  1X0M A;  2E7U A;  1B8G A;  5M4B A;  2VLF A;  3KE3 A;  4LC3 A;  4MQP A;  4AO4 A;  2JJF A;  3NTJ A;  3F9T A;  4Q76 A;  3DOD A;  4FL0 A;  4RJ0 A;  2AEU A;  2BI2 A;  2BI1 A;  1ASG A;  3F6T A;  4CBR A;  3AOV A;  3FTB A;  1O62 A;  1V2E A;  3T32 A;  3DC1 A;  3GZC A;  1E5E A;  1TAS A;  3LG0 A;  4IW7 A;  4O6Z A;  4PVF A;  2EZ2 A;  2VGU A;  2R5C B;  1IUG A;  2AEV A;  4AZK A;  2BI5 A;  4GSA A;  2HUU A;  2VMO A;  2FQ6 A;  1LW4 A;  3BCX A;  3PGY A;  4I8A A;  3B8X A;  5EFS A;  3UAK A;  3KKI A;  1IAX A;  2VMU A;  1LK9 A;  2BIA A;  5F8V A;  2ORD A;  2X8U A;  3TFT A;  2GB3 A;  4MQQ A;  2Z9W A;  2BIG A;  4WB0 A;  3FKD A;  4ATP A;  4KAM A;  4RM1 A;  4W1V A;  4ADD A;  1V2D A;  4M2J A;  2W8J A;  2X3L A;  1M0O A;  1ZOB A;  3DU4 A;  1J04 A;  2D61 A;  1AHF A;  3HT4 A;  2DGM A;  3A9Y A;  3TFU A;  4ZDO A;  4ZM4 A;  3EZ1 A;  3PA9 A;  3WKS A;  1PMO A;  2ZSM A;  3TQX A;  2OKK A;  4P7Y A;  1S0A A;  1D7R A;  2YRR A;  3NUI A;  4WYD A;  3ZZJ A;  1ARS A;  3RQ1 A;  4DBC A;  4IY7 A;  1CL1 A;  4ITX A;  4OT8 A;  1AHX A;  4UHM A;  4LNM A;  3AEL A;  2QBT A;  3BB8 A;  3EI6 A;  1W23 A;  4P3M A;  1AJS B;  4UHN A;  1TOE A;  2HZP A;  3RCH B;  5DX5 A;  2CIN A;  1TOK A;  1BQD A;  2AY9 A;  2VIB A;  3BC8 A;  2VIA A;  2KFP A;  1WYV A;  3FVU A;  5K8B A;  3GR9 A;  4XJP A;  1KL2 A;  4DQ6 A;  1C7O A;  2BYL A;  1H1C A;  2CH1 A;  3JWA A;  3QGU A;  4WXB A;  4ZM3 A;  2JG2 A;  4K05 A;  3FZ6 A;  2ZYJ A;  3UWC A;  3WGB A;  3ACZ A;  2Z61 A;  1H0C A;  3QHX A;  1O61 A;  2HP2 A;  1TOG A;  2PB2 A;  3FQ8 A;  2QLR A;  2CB1 A;  4PIW A;  4JEW A;  5HDM A;  3L8A A;  1B9H A;  4LNL A;  1ZC9 A;  2VGV A;  2FM1 A;  1P3W A;  1XEY A;  3GZD A;  1BJN A;  3K28 A;  1W7N A;  1GEW A;  4OYT A;  4ZWV A;  5G09 A;  2CJH A;  1IX8 A;  1WYU A;  1G7X A;  1GD9 A;  4M2M A;  2W7L A;  1GCK A;  2HOY A;  2VMR A;  4ATQ A;  3MAD A;  4E77 A;  3DZZ A;  4AO9 A;  4MKJ A;  3F0H A;  4K2B A;  1RVU A;  3NYS A;  5E3K A;  3UE8 A;  2W7J A;  4JE5 A;  4Y0H A;  3LWS A;  3JW9 A;  1M32 A;  2AY1 A;  1GC2 A;  4OCA A;  2QB2 A;  1YJS A;  2ZJG A;  1QJ3 A;  2YKY A;  1LS3 A;  1KKP A;  1T3I A;  3FZ7 A;  2D7Y A;  1FG7 A;  1QIT A;  1Z3Z A;  3WZF A;  1G4X A;  2ZY4 A;  2W8T A;  3PD6 B;  4A00 A;  2VGT A;  2VGZ A;  3G0T A;  1IX6 A;  2VMV A;  4EMY A;  1ARI A;  3NNK A;  2X5F A;  1PFF A;  1MLZ A;  1ART A;  3FFR A;  4R8D A;  4TV7 A;  1WYT A;  3N4X A;  5G2Q A;  5E5I A;  4W8I A;  1CS1 A;  3MEB A;  1BJW A;  2WB6 A;  1BT4 A;  1SFF A;  3AEN A;  4JF0 A;  2VI9 A;  4F5I A;  1AJR A;  4JF1 A;  3PDB B;  2E7J A;  2BWO A;  1LKC A;  1IJI A;  3P6K A;  4GRX A;  4MSO A;  4AOA A;  2F8J A;  2QSR A;  2DGL A;  2AY8 A;  1V72 A;  3E77 A;  3GWP A;  4TN4 A;  2DR1 A;  1AMA A;  2ZY3 A;  3PIU A;  3VOM A;  4N0B A;  5EIG B;  1S07 A;  5D95 A;  3N4R A;  2VMS A;  1VP4 A;  1CZC A;  2W7K A;  1CQ6 A;  4JEZ A;  1X2A A;  3AEM A;  4GE9 A;  1DGE A;  3CQ6 A;  3RUY A;  1C4K A;  2BWP A;  2E54 A;  5EUN A;  3L44 A;  1IBJ A;  5LH9 A;  5G4J A;  2WK8 A;  1MDX A;  5FT5 A;  4OC9 A;  2D7Z A;  1RVY A;  1OHY A;  4UOY A;  4B98 A;  4N0W A;  4RKC A;  1D7V A;  2NMP A;  2E7I A;  1TOJ A;  2C81 A;  1TAR A;  1QJ5 A;  4KYO A;  1KL1 A;  3WCO A;  1SF2 A;  1YOO A;  2OQX A;  4BHD A;  5E4Z A;  5M46 A;  5M49 A;  3HL2 A;  2PO3 A;  2ZP7 A;  4L0O A;  3MC6 C;  2FKI A;  3K40 A;  1B5O A;  1D7U A;  1BJO B;  2W7G A;  3BN1 A;  4E1O A;  1TPL A;  3DXV A;  2W7D A;  3MKJ A;  3EZS A;  2G6W A;  2GQN A;  2W7I A;  2C7T A;  3FVS A;  3E2Z A;  3I4J A;  2VGW A;  3HLM A;  4CXQ A;  1M0Q A;  3W1H A;  2GSA A;  5IWQ A;  2Z1Z A;  1EQB A;  2Z9X A;  2CAN A;  3DR7 A;  3NDN A;  4MQR A;  1LW5 A;  1ASM A;  1MAQ A;  1W7L A;  1AAW A;  3BWN A;  3B1D A;  1SVV A;  4OBV A;  3ZRP A;  2AY4 A;  1N31 A;  3JU7 A;  3B46 A;  1AMS A;  3VP6 A;  1AAM A;  3COG A;  4NOG A;  4K2M A;  1JF9 A;  1QIS A;  3JZL A;  4WYC A;  3ASA A;  1I43 A;  2C0R A;  1ARH A;  4GEB A;  4PFF A;  3LY1 A;  2DGK A;  4A6T A;  3JWB A;  1I48 A;  3WKR A;  4F5J A;  1OHV A;  4UHO A;  1GC4 A;  1ORD A;  4WXF A;  3B1C A;  4MY5 A;  3LV2 A;  3IHJ A;  5EQC A;  3MAF B;  3PPL A;  4J5U A;  1AJS A;  4KXK A;  1N8P A;  3FQ7 A;  3MBB A;  4XAU A;  1EJI A;  3RI6 A;  3N7N A;  5DJ9 A;  5F9S A;  2CTZ A;  3OKS A;  2XBN A;  4XEW A;  2HUI A;  1GDE A;  1FG3 A;  4DGT A;  4IYO B;  1ZOD A;  3QBO A;  3IF2 A;  2AY3 A;  4UQV A;  4A6R A;  2ZSL A;  2CST A;  1N2T A;  4WLJ A;  5G0A A;  2QA3 A;  2GMU A;  4JE5 D;  3A8U X;  3AEO A;  2DKJ A;  4ZDL A;  1VEF A;  1BJ4 A;  1BW0 A;  1C7G A;  4EU1 A;  2O1B A;  3ISL A;  1QZ9 A;  2EYQ A;  1SZK A;  1GC0 A;  2WK7 A;  3MAU A;  2Z20 A;  3EUC A;  2JJG A;  2YKX A;  3DYD A;  3ECD A;  2OGA A;  2EGY A;  2VLH A;  2HOR A;  4ZLV A;  1ELQ A;  1UU1 A;  4WYA A;  4LW4 A;  4E3R A;  1C9C A;  4W1W A;  1AKB A;  4A0R A;  4RIZ A;  1UU0 A;  3BWO A;  3GZD C;  1SPA A;  4GDY A;  4WD2 A;  5FT6 A;  3WLX A;  1MGV A;  3RBF A;  8AAT A;  2FN6 A;  4JEX A;  1YAA A;  4TMR A;  2ZC0 A;  5D5S A;  3DXW A;  3PD6 A;  4A0H A;  3KGW A;  1DJ9 A;  3PAA A;  1O4S A;  4XJO A;  3A2B A;  1GC3 A;  3EIB A;  1OHW A;  4WLH A;  4ITG A;  4R5F A;  2WKA A;  1AKC A;  3EI5 A;  4RIT A;  4WYE A;  3EI7 A;  3PJ0 A;  3ZRR A;  4WXG A;  1IAY A;  3KGX A;  1YNU A;  4WYF A;  1C7N A;  3PDB A;  2QMA A;  3Q8N A;  5FT8 A;  2CJG A;  3AV7 A;  4EB7 A;  3ELP A;  4Q6R A;  3LVL B;  3H9X A;  2HOX A;  3QM2 A;  3H7F A;  4QGR A;  4A0F A;  2VI8 A;  1WYV B;  2D5Y A;  5EIG A;  1LC8 A;  4W91 A;  3ATH A;  4A72 A;  1OXO A;  2VMP A;  1QGN A;  3LVJ A;  4ADE A;  4GE4 A;  3NUB A;  5HXX A;  1JS6 A;  3ASB A;  3WCN A;  2YCP A;  3ZZK A;  2ZY5 A;  1AHG A;  2OGE A;  3HQT A;  2W7F A;  4U2H A;  2DKB A;  1M0P A;  3TCM A;  1ASL A;  3FDD A;  2R0T A;  2BYJ A;  3DRD A;  4BA5 A;  4IXO A;  4XJM A;  1IVR A;  2YCN A;  4IXZ A;  2ZY2 A;  2OAT A;  4F5H A;  3B1E A;  1LC7 A;  2VYC A;  1DKA A;  3E2Y A;  2WK9 A;  1BJO A;  1AKA A;  1WKG A;  3N75 A;  3BCB A;  2HP1 A;  5I92 A;  3NYU A;  2D66 A;  2FNU A;  2W7M A;  2X5D A;  2YCT A;  3RBL A;  4J8L A;  4LNJ A;  1SZS A;  2V0Y A;  3HDO A;  3M5U A;  2W7E A;  3NX3 A;  3USF A;  5HHY A;  2AAT A;  4Y0I A;  1GEX A;  4MGR A;  4AH3 A;  2YKV A;  1CQ8 A;  4JEY A;  4CXR A;  2R5C A;  1LC5 A;  2VMQ A;  3EI9 A;  1ASD A;  2VGS A;  1FC4 A;  1PG8 A;  4HVK A;  2YRI A;  3A9X A;  5EAA A;  3N0L A;  1AIC A;  2QB3 A;  3G8M A;  3AEN B;  3AAT A;  2EZ1 A;  3WX9 A;  3FCR A;  3WY7 A;  1TAT A;  2DOU A;  3AEJ A;  1V2F A;  2FNI A;  1M6S A;  3VK4 A;  1CZE A;  1RV3 A;  1AY5 A;  2Z67 A;  1D2F A;  3FVX A;  3DR4 A;  1ASE A;  2D63 A;  4OTL A;  1MDO A;  3BS8 A;  2VMX A;  3NU8 A;  2HUF A;  2AY5 A;  4ZSW A;  3JTX A;  3WGC A;  1VJO A;  2R5E A;  1AY4 A;  1AIB A;  1EG5 A;  3MAF A;  4F5F A;  1M7Y A;  1GBN A;  4XK1 A;  3FFH A;  1ASF A;  3NU7 A;  1W3U A;  5EAV A;  1AHE A;  1ASA A;  4ISY A;  3MC6 A;  1MAP A;  2VMT A;  3QPG A;  5J8Q A;  2BKW A;  3H14 A;  4F5M A;  3HMU A;  1AMQ A;  4IYO A;  1JS3 A;  3P1T A;  3CQ5 A;  1OAT A;  2XH1 A;  3K7Y A;  7AAT A;  3VK2 A;  4F4E A;  1I29 A;  1G4V A;  4A0G A;  2VMN A;  3G7Q A;  1GEY A;  1ELU A;  1S09 A;  4Q75 A;  3RCH A;  1Z7D A;  2CJD A;  1CQ7 A;  2D65 A;  1X28 A;  4Y0D A;  4M2K A;  3FSL A;  3FZ8 A;  3E9K A;  1M4N A;  1MLY A;  1M0N A;  3E6G A;  4XJL A;  2JGT A;  5DB5 A;  5LHA A;  1RV4 A;  2YKU A;  3VK3 A;  3GJU A;  3E2Z B;  4OMA A;  5EUE A;  3I16 A;  1CJ0 A;  1AHY A;  4R5Z A;  2BHX A;  1ARG A;  1U08 A;  3D6K A;  4RJY A;  5AX8 A;  1AY8 A;  2PB0 A;  4JEV A;  5EUD A;  4ZSY A;  4WB0 B;  4XQ2 A;  2W8V A;  1DFO A;  4ADC A;  2O0R A;  4A6U A;  3QI6 A;  5TF5 A;  3FRK A;  3BV0 A;  1YIZ A;  1X29 A;  2D64 A;  4R2N A;  3II0 A;  4WBT A;  2VMZ A;  4WP0 A;  2FYF A;  1ASB A;  5DJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...