3P1WA

Crystal structure of rab gdi from plasmodium falciparum, pfl2060c
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
444
structure length
442
Chain Sequence
QGEHYDVIILGTGLKECILSGLLSHYGKKILVLDRNPYYGGETASLNLTNLYNTFKPKENIPSKYGENRHWNVDLIPKFILVGGNLVKILKKTRVTNYLEWLVVEGSYVYQHQKKGFLTSEKFIHKVPATDMEALVSPLLSLMEKNRCKNFYQYVSEWDANKRNTWDNLDPYKLTMLEIYKHFNLCQLTIDFLGHAVALYLNDDYLKQPAYLTLERIKLYMQSISAFGKSPFIYPLYGLGGIPEGFSRMCAINTFMLNKNVVDFVFDDDNKVCGIKSSDGEIAYCDKVICDPSYVMHLKNKIKKIGQVIRCICILSNPIPETNQTNSCQIIIPQNQLNRKSDIYINLVSFQHGVTLKGKYIAIVSATVETNNPIKEIEKPLELLGTIEEKFVKISDLYVSTSKKPADNIFVTSSYDATSHFETATNDLLQIWENLWGQKLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RAB GDI from Plasmodium Falciparum, PFL2060c
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein transport
molecule keywords RabGDI protein
total genus 138
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2010-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3p1wA03
3.30.519.10 Alpha Beta 2-Layer Sandwich Guanine Nucleotide Dissociation Inhibitor; domain 2 Guanine Nucleotide Dissociation Inhibitor, domain 2 3p1wA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3p1wA01
4AP1A 2ARDA 2E5VA 2FJBA 3GDNA 4YTNA 1F8SA 3IHMA 3UOXA 5ER0A 3GMBA 4NEWA 3LOVA 3ZYXA 3BHKA 3CTYA 1N4UA 1Y0PA 3CNTA 2A89A 1VRQB 3NYFA 2VQBA 2YLRA 3UKHA 4B65A 2YG3A 1DODA 4Z2TA 3AECA 3CGDA 2XVJA 4IA6A 2ZZCA 2PHHA 3F8RA 3II4A 3NTAA 5HXIA 4IA5A 1PXAA 3KKJA 2E1MA 1L9DA 4CNJA 1FEBA 1B37A 4XXGA 1S2QA 1DNCA 1OJTA 2A87A 3AEFA 3CIRA 3F8DA 3T37A 4YKGA 1H7XA 3I6DA 2XFUA 1AOGA 4EIQA 3P4QA 1YQ3A 4USQA 4J57A 2OLNA 4FX9A 2XLSA 2XYOA 4B66A 1DOBA 1SEZA 4J36A 3P9UA 4Z24A 3UKFA 2GR1A 3AE4A 1PXBA 2GAHB 1MO9A 2YVGA 4NEVA 4BK3A 4USRA 3BHFA 4Y4LA 3UOVA 3E1TA 4JQ9A 2XLPA 2JK6A 4A65A 1NPXA 2A8XA 3FMWA 1ZOYA 3RP7A 3RHAA 4OPCA 1PBEA 4GRTA 2YQUA 4AOSA 1GRTA 3QVPA 2V3BA 1KSSA 4A6NB 1JRYA 1ZP0A 3IC9A 1GOSA 3SFDA 2C7GA 3DJDA 5JCKA 1CL0A 1XPQA 4I59A 2YR4A 1Q1RA 3KU9A 3P4RA 1CHUA 2V3AA 4H4RA 1F8WA 4CY8A 4BURA 1JNZA 3KD9A 4BK2A 2BS3A 5JCIA 2X99A 1MOKA 1PBCA 3URHA 4B1BA 3LZXA 1PXCA 2WDQA 1GESA 1XDIA 4IVOB 4EQWA 3O0HA 2C75A 3SM8A 2WP5A 1F8RA 5KXJA 3DA1A 1GERA 1LQTA 2IVEA 2AQJA 4B67A 3UTGA 5M10A 3P4SA 4AT0A 2B9XA 1H83A 3VR9A 4YSHA 2TMDA 4A79A 4XWRA 1S2YA 1PDHA 2BACA 1GV4A 2WOIA 3AE3A 1NHRA 4BJZA 4AOXA 4OPDA 1NG3A 2WP9A 3V3NA 5L46A 1CC2A 4DGKA 1TYPA 3LXDA 3VRAA 1PBDA 1K0JA 1FL2A 2F5ZA 1KSUA 4J34A 1KNPA 3KLJA 2GR3A 1CJCA 3L1RA 2C73A 3AE2A 1FEAA 2Y6QA 1F6MA 2GH5A 2DKHA 2FJAA 2JB1A 3SFEA 3LB8A 4H4UA 2R0CA 3ICRA 3G5RA 4C3YA 1BF3A 2YWLA 4U8MA 4H4TA 4B64A 3V76A 1JRXA 2X50A 4Y4NA 3CPJG 2CVJA 3CGCA 1B5QA 1ONFA 1IUVA 1YQ4A 1TYTA 3AWIA 4JNAA 1PJ5A 4PABA 2B9YA 4H2NA 1KNRA 2GAGB 3AEDA 3QSMA 3DK9A 4H4PA 3UKPA 1L9EA 1JRZA 2B76A 4EM4A 1NHPA 2QA2A 2WESA 4E0VA 4ADWA 3UTEA 5U25A 4CY6A 2C64A 1YKJA 3GRTA 5JCNA 3HZLA 3IWAA 4EMJA 1FECA 3JSKA 3SQPA 4Z2UA 1BGJA 3ICTA 2EQ7A 1KF6A 4EQXA 4H2PA 2ZZ0A 1IUWA 4A99A 2YM2A 2GF3A 1O94A 2ACZA 2Z5YA 3UTHA 4GUVA 1GRBA 3BNUA 1TDKA 5KOXA 1LVLA 2PYXA 3DGZA 3CNDA 4NTDA 1GRHA 1GRFA 2R45A 3AXBA 5EBKA 4AP3A 1ZK7A 2Q0LA 3NLCA 4NZHA 3ICSA 2BCGG 1Y56A 2WBAA 1NHSA 2YR5A 1Q9IA 1H84A 4APNA 3DJGX 3DGHA 5CKUA 5BRTA 2Z5XA 4U8IA 4X9MA 2VVLA 3Q6JA 1LV0A 1CBOA 1DOEA 1LQUA 3BI2A 5EOWA 4EIPA 2R0PA 4YXDA 4GR1A 1XHCA 2XFQA 3NHOX 3REDA 2Q6UA 2WPCA 2XVIA 5KVIA 1EL7A 1V59A 2QAEA 2V6OA 2WEUA 4CBQA 2RGJA 2R46A 4IVMB 3SGLA 3CNSA 3PO7A 3COXA 3M13A 1LPFA 1D4EA 5JCLA 1K4QA 2XLUA 3UKKA 2Y6RA 3BNMA 3ALJA 4U8KA 5FMHA 1DOCA 2WOWA 1D7LA 2C72A 1IUTA 3PS9A 2WS3A 4KX6A 1ELIA 3D8XA 3KA7A 4J33A 4UDPA 1FCDA 4Z2RA 1GT8A 1H6VA 5EB5A 5HYMA 2ZBWA 4C74A 3FIMB 3ABVA 3LJPA 1B8SA 4TM3A 2CULA 5JCMA 3C96A 2BABA 2FJEA 3DK8A 2WETA 1RP0A 5BVAA 2XVFA 4K2XA 5BULA 2YG5A 1M64A 3UP4A 2YLWA 4C3XA 3GYIA 3LZWA 1OJ9A 4H4QA 2YLZA 1QJDA 4FK1C 2C3DA 2VOUA 2VQ7A 1L9CA 3DJEA 4I58A 3FBSA 3P4PA 5C3JA 1PBBA 4U8LA 3CPIG 1IUXA 1F3PA 1GALA 3KPFA 5HHFA 2ZZBA 1GNDA 4H4XA 1GEUA 4JY3A 4CRTA 4OPLA 4TM4A 1PBFA 2XLRA 4HB9A 4LA1A 4K5RA 4RG4A 4JNQA 2WU2A 2XLTA 3M0OA 5BUKA 4GF7A 4PAAA 3G5SA 4P9SA 4U8OA 4U8PA 2R9ZA 5U1OA 3AYLA 1GXFA 1ZY8A 1DJQA 1NAAA 1UKVG 1EBDA 2UZZA 2JB3A 3ATQA 3RP6A 1EL8A 3DMEA 3NRNA 4GDEA 3IF9A 4YT0A 1E1LA 2C3CA 3UCLA 3BI4A 2I0ZA 2RGOA 3GDPA 1REOA 3K30A 4U2SA 1GREA 1E1KA 4M52A 4ZN0A 2BK5A 4BJYA 3AD9B 4D04A 2WP6A 1ZDLA 3GYJA 2RGHA 3AE8A 4YSZA 1BZLA 1PS9A 2XVEA 1KDGA 3B3RA 3GMCA 4DNAA 2WPFA 2EQ9A 4U2TA 1D7YA 1EL9A 1RSGA 4UDRA 2JKCA 3UOYA 4A7AA 2V61A 4LU6A 4X9NA 4B69A 1K0LA 3FPZA 4WX1A 3EANA 4D03A 3OC4A 3GWDA 4NTEA 4HA6A 2BS4A 4YSYA 2GV8A 2BA9A 2GQWA 3ADAB 4YWOA 5KWFA 2HQMA 4H50A 4B63A 3QSEA 2BXRA 1RYIA 4MJWA 3NK1X 4H4WA 2H88A 1S3EA 2GMHA 2APGA 2E4GA 4EQSA 3AD8B 4K8DA 4Z43A 4H7UA 2DKIA 4DSHA 2CFYA 3AEGA 2VRMA 3UTFA 1NEKA 1ZOVA 1HYUA 4TM0A 3GRSA 3GWFA 3ZDNA 1E39A 4X4JA 3NT6A 2IVDA 3CNPA 4J31A 5IQ1A 5CQFA 2C70A 2XFOA 1FOHA 3CN8A 3GSIA 4FDCB 4CCQA 2GEWA 2VVLG 2BK4A 1JOAA 1JU2A 2O9ZA 3AE9A 5TR3A 3ISHA 2NVKX 2IIDA 3ALMA 3BI5A 3UOZA 5J60A 3H4KA 1D4DA 2VVMA 1H81A 3QVRA 2GR2A 3QSSA 4OPTA 2XFPA 3AD7B 1S3BA 1GSNA 4H4ZA 1CJ3A 4JDRA 1TDEA 2Q7VA 3NNEA 1YQZA 2H89A 3NK2X 2GRTA 4EMWA 4O5UA 2R4JA 5FS7A 2X3NA 3QJ4A 2AAQA 4YTMA 1COYA 2BYBA 4N9XA 2YG6A 3ATRA 1TDFA 3K7TA 4Y4MA 3WE0A 3CPHG 1P2HA 4JN9A 4OVIA 1IUSA 1YY5A 3PVCA 4JY2A 2OALA 4UP3A 1CF3A 1DJNA 4O5QA 3QFAA 2YVFA 4UDQA 2WQYA 1PHHA 2BXSA 4ZCDA 3UKLA 1DXLA 3VRBA 4K7ZA 4H4VA 4GDPA 2YLXA 3Q9TA 3L8KA 1ZMCA 3C4AA 2C66A 4NTCA 2J3NA 2WHDA 1O95A 3VRDB 3DH9A 3OZ2A 1IJHA 2EQ6A 4KPRA 4U8JA 1NDAA 3NTDA 5J7XA 3CNJA 3AEEA 2C76A 1GRAA 1OJDA 2JAEA 3H8IA 3NN6X 4XWZA 4BK1A 4CCRA 3B6DA 1E7PA 1NG4A 1M6IA 4DSGA 3UKQA 3NYCA 2JBVA 3AEAA 1ZKQA 3AE6A 4C77A 4H2QA 2GB0A 4H2RA 2YVJA 3AYJA 1PJ7A 1NENA 1VDCA 3AB1A 4BV6A 3EAOA 1OJAA 1BWCA 1CJ2A 3QFBA 2TPRA 3GD3A 2X8GA 3M12A 2AR8A 4LIIA 1PN0A 1VG9A 5FS8A 2YG4A 1QLBA 3S61A 2VZ2A 1W4XA 1EL5A 2RABA 1KFYA 1B4VA 4TM1A 2XCGA 1H82A 5U63A 3CGBA 4YSXA 3KVEA 4CNKA 3RP8A 2EQ8A 2OA1A 4C5OA 3G5QA 2NPXA 5GSNA 3VQRA 1D5TA 1TDNA 3DJJA 3UP5A 2GQFA 1OJCA 3NIXA 3NKSA 4GCMA 1Y56B 3ITJA 2FJDA 1O5WA 1PJ6A 3NK0X 3CGEA 3V3OA 2FBWA 1NHQA 2WU5A 4TLXA 1E1MA 1XANA 5IQ4A 3DK4A 4ECHA 1H7WA 1IUUA 5KRQA 4IV9A 2XFNA 3C4NA 4WCTA 5M0ZA 2WDVA 4H4SA 1VG0A 3NYEA 1P2EA 3UKAA 4RSLA 1H86A 4ZCCA 3H8LA 2X8CA 2BC1A 2W0HA 3I3LA 5LV9A 1CC4A 5KVHA 1JNRA 3AE1A 1E6EA 1MXTA 2BC0A 1CC6A 2OAMA 1N1PA 2OLOA 5C2TA 4FK1A 2GR0A 4OPIA 4YKFA 4U8NA 3AYIA 3P1WA 3AE7A 3ALLA 1ZX9A 1N4VA 1K0IA 4TLZA 4AT2A 1GTHA 2R0GA 1N4WA 5FS6A 3D1CA 3EF6A 1LJ1A 3NN0X 2BK3A 5EB4A 4A9WA 4U2LA 4YTPA 2XVHA 3F8PA 5GRTA 1Q1WA 1Z6LA 3FG2P 2C65A 2V5ZA 1CJ4A 4REKA 2B7SA 2WPEA 2V60A 2YG7A 3IHGA 3NG7X 2YAUA 2WOVA 1ZMDA 2WDRA 4A6NA 4OPGA 2Q0KA 2GMJA 2B9WA 1VQWA 3AEBA 2BS2A 3NH3X 2VRLA 2C67A 1BKWA 1E1NA 4Z26A 3AE5A 4H4YA 3VR8A 1X31B 1BGNA 1JEHA 2YM1A 2QA1A 4K22A 4B68A 3K7MX 3RNMA 2XDOA 2B7RA 3GD4A 3K7QX 4J2WA 2QCUA 3S5WA 4K5SA 4Z44A 3R9UA 4Z25A 4RG3A 4EMIA 2R4EA 2JB2A 1LTXR 4A5LA 1D4CA 2CDUA 2YLTA 4J56A 4OPUA 2YLSA 5DBJA 1GETA 2YR6A 1GRGA 3EPTA 5KOWA 4ICYA 2X8HA 1QO8A 3LADA 5HY5A 3NGCX 1TDOA 2BCPA 4OCGA 1GTEA 5FS9A 1GPEA 4EM3A 4EQRA 1L0VA 1TRBA 5IPYA 2GVCA
chains in the Genus database with same CATH superfamily
4AP1A 2ARDA 2E5VA 2FJBA 3GDNA 4YTNA 1F8SA 3IHMA 3UOXA 5ER0A 3GMBA 4NEWA 3LOVA 3ZYXA 3BHKA 3CTYA 1N4UA 1Y0PA 3CNTA 2A89A 1VRQB 3NYFA 2VQBA 2YLRA 3UKHA 4B65A 2YG3A 1DODA 4Z2TA 3AECA 3CGDA 2XVJA 4IA6A 2ZZCA 2PHHA 3F8RA 3II4A 3NTAA 5HXIA 4IA5A 1PXAA 3KKJA 2E1MA 1L9DA 4CNJA 1FEBA 1B37A 4XXGA 1S2QA 1DNCA 1OJTA 2A87A 3AEFA 3CIRA 3F8DA 4G9KA 3T37A 4YKGA 1H7XA 3I6DA 2XFUA 1AOGA 4EIQA 3P4QA 1YQ3A 4USQA 4J57A 2OLNA 4FX9A 2XLSA 2XYOA 4B66A 1DOBA 1SEZA 4J36A 3P9UA 4Z24A 3UKFA 2GR1A 3AE4A 1PXBA 2GAHB 1MO9A 2YVGA 4NEVA 4BK3A 4USRA 3BHFA 4Y4LA 3UOVA 3E1TA 4JQ9A 2XLPA 2JK6A 4A65A 1NPXA 2A8XA 3FMWA 1ZOYA 3RP7A 3RHAA 4OPCA 1PBEA 4GRTA 2YQUA 4AOSA 1GRTA 3QVPA 2V3BA 1KSSA 4A6NB 1JRYA 1ZP0A 3IC9A 1GOSA 3SFDA 2C7GA 3DJDA 5JCKA 1CL0A 1XPQA 4I59A 2YR4A 1Q1RA 3KU9A 3P4RA 1CHUA 2V3AA 4H4RA 1F8WA 4CY8A 4BURA 1JNZA 3KD9A 4BK2A 2BS3A 5JCIA 2X99A 1MOKA 1PBCA 3URHA 4B1BA 3LZXA 1PXCA 2WDQA 1GESA 1XDIA 4IVOB 4NNJA 4EQWA 3O0HA 2C75A 3SM8A 2WP5A 3SXIA 1F8RA 5KXJA 3DA1A 1GERA 1LQTA 2IVEA 2AQJA 4B67A 3UTGA 5M10A 3T14A 3P4SA 3GYXA 4AT0A 2B9XA 1H83A 3VR9A 4YSHA 3SZ0A 2TMDA 4A79A 4XWRA 1S2YA 1PDHA 2BACA 1GV4A 3T31A 5KMRA 2WOIA 3AE3A 1NHRA 4BJZA 4AOXA 4OPDA 1NG3A 2WP9A 3V3NA 5L46A 1CC2A 4DGKA 1TYPA 3LXDA 3VRAA 1PBDA 1K0JA 3T2YA 1FL2A 2F5ZA 1KSUA 4J34A 1KNPA 3KLJA 2GR3A 1CJCA 3L1RA 2C73A 3AE2A 1FEAA 2Y6QA 1F6MA 2GH5A 2DKHA 3SY4A 2FJAA 2JB1A 3SFEA 3LB8A 4H4UA 2R0CA 3ICRA 3G5RA 4C3YA 1BF3A 2YWLA 4U8MA 4H4TA 4B64A 3V76A 1JRXA 2X50A 4Y4NA 3CPJG 2CVJA 3CGCA 2BRYA 1B5QA 1ONFA 1IUVA 1YQ4A 1TYTA 3AWIA 4JNAA 1PJ5A 4PABA 2B9YA 4H2NA 1KNRA 3T2KA 2GAGB 3AEDA 3QSMA 3DK9A 4H4PA 3UKPA 5KNLA 1L9EA 1JRZA 2B76A 4EM4A 1NHPA 2QA2A 2WESA 4E0VA 4ADWA 3UTEA 5U25A 4CY6A 2C64A 1YKJA 3GRTA 5JCNA 3HZLA 3IWAA 4EMJA 1FECA 3JSKA 3SQPA 4Z2UA 1BGJA 3ICTA 2EQ7A 1KF6A 4EQXA 4H2PA 2ZZ0A 1IUWA 4A99A 2YM2A 2GF3A 1O94A 3CMMA 2ACZA 2Z5YA 3UTHA 4GUVA 1GRBA 3BNUA 1TDKA 5KOXA 1LVLA 2PYXA 3DGZA 3CNDA 4NTDA 1GRHA 1GRFA 2R45A 3AXBA 5EBKA 4AP3A 1ZK7A 2Q0LA 3NLCA 4NZHA 3ICSA 2BCGG 1Y56A 2WBAA 1NHSA 2YR5A 1Q9IA 4G6GA 1H84A 4APNA 3DJGX 3DGHA 5CKUA 5BRTA 2Z5XA 4U8IA 4X9MA 2VVLA 3Q6JA 1LV0A 1CBOA 1DOEA 1LQUA 3BI2A 5EOWA 4EIPA 2R0PA 4YXDA 4GR1A 1XHCA 2XFQA 3T2ZA 3KPKA 3NHOX 3REDA 2Q6UA 2WPCA 2XVIA 5KVIA 1EL7A 1V59A 2QAEA 2V6OA 2WEUA 4CBQA 2RGJA 2R46A 4IVMB 3SGLA 3CNSA 3PO7A 3COXA 3M13A 1LPFA 1D4EA 3SZWA 5JCLA 1K4QA 2XLUA 3UKKA 2Y6RA 3BNMA 3ALJA 4U8KA 5FMHA 1DOCA 2WOWA 1D7LA 2C72A 1IUTA 3PS9A 2WS3A 4KX6A 1ELIA 3D8XA 3KA7A 4J33A 4UDPA 1FCDA 4Z2RA 4G6HA 1GT8A 1H6VA 5EB5A 5HYMA 2ZBWA 4C74A 3FIMB 3ABVA 3LJPA 1B8SA 4TM3A 2CULA 3HYWA 5JCMA 3C96A 2BABA 2FJEA 3DK8A 2WETA 1RP0A 5BVAA 2XVFA 4K2XA 5BULA 2YG5A 1M64A 3UP4A 2YLWA 4C3XA 3GYIA 3LZWA 1OJ9A 4H4QA 2YLZA 1QJDA 4FK1C 2C3DA 2VOUA 2VQ7A 1L9CA 2GVCA 4I58A 3DJEA 3FBSA 3P4PA 5C3JA 1PBBA 4U8LA 3CPIG 1IUXA 1F3PA 1GALA 3KPFA 5HHFA 3SZFA 2ZZBA 1GNDA 4H4XA 1GEUA 4JY3A 4CRTA 4OPLA 4TM4A 1PBFA 5KMQA 2XLRA 4HB9A 4LA1A 4K5RA 4RG4A 4JNQA 2WU2A 2XLTA 3M0OA 5BUKA 4GF7A 4PAAA 3G5SA 4P9SA 4U8OA 4U8PA 2R9ZA 5U1OA 3AYLA 1GXFA 1ZY8A 1DJQA 1NAAA 1UKVG 1EBDA 2UZZA 2JB3A 3ATQA 3RP6A 1EL8A 3DMEA 3NRNA 4GDEA 3IF9A 4YT0A 1E1LA 2C3CA 3UCLA 3BI4A 2I0ZA 2RGOA 3GDPA 1REOA 3K30A 4U2SA 1GREA 1E1KA 4M52A 3SZCA 4ZN0A 2BK5A 4BJYA 3AD9B 4D04A 2WP6A 1ZDLA 3GYJA 2RGHA 3AE8A 4YSZA 1BZLA 1PS9A 2XVEA 1KDGA 3B3RA 3GMCA 4DNAA 2WPFA 2EQ9A 4U2TA 1D7YA 1EL9A 1RSGA 2C4CA 4UDRA 2JKCA 3UOYA 4A7AA 2V61A 4LU6A 4X9NA 4B69A 1K0LA 3FPZA 4WX1A 3EANA 4D03A 3OC4A 3GWDA 4NTEA 4HA6A 2BS4A 4YSYA 2GV8A 2BA9A 2GQWA 3ADAB 4YWOA 5KWFA 2BRAA 2HQMA 4H50A 4B63A 3HYXA 3QSEA 2BXRA 1RYIA 4MJWA 3NK1X 4H4WA 2H88A 1S3EA 2GMHA 2APGA 2E4GA 4EQSA 3AD8B 4K8DA 4Z43A 4H7UA 2DKIA 4DSHA 2CFYA 3AEGA 2VRMA 3UTFA 1NEKA 1ZOVA 1HYUA 4TM0A 3GRSA 3GWFA 3ZDNA 1E39A 4X4JA 3NT6A 2IVDA 3SYIA 3CNPA 4J31A 5IQ1A 5CQFA 2C70A 2XFOA 1FOHA 3CN8A 3GSIA 4FDCB 4CCQA 2GEWA 2VVLG 2BK4A 1JOAA 1JU2A 2O9ZA 3AE9A 5TR3A 3ISHA 2NVKX 2IIDA 3ALMA 3BI5A 3UOZA 5J60A 3H4KA 1D4DA 2VVMA 1H81A 3QVRA 2GR2A 3QSSA 4OPTA 2XFPA 3AD7B 1S3BA 1GSNA 4H4ZA 1CJ3A 4JDRA 1TDEA 2Q7VA 3NNEA 1YQZA 2H89A 3NK2X 4GAPA 2GRTA 4EMWA 4O5UA 2R4JA 5FS7A 2X3NA 3QJ4A 2AAQA 4YTMA 1COYA 2BYBA 4N9XA 2YG6A 3ATRA 3WE0A 1TDFA 3K7TA 4Y4MA 3CPHG 1P2HA 4JN9A 4OVIA 1IUSA 1YY5A 3PVCA 4JY2A 2OALA 4UP3A 1CF3A 1DJNA 4O5QA 3QFAA 2YVFA 4UDQA 2WQYA 1PHHA 2BXSA 4ZCDA 3UKLA 1DXLA 3VRBA 4K7ZA 4H4VA 4GDPA 2YLXA 3Q9TA 3L8KA 1ZMCA 3C4AA 2C66A 4NTCA 2J3NA 2WHDA 1O95A 3VRDB 3DH9A 3OZ2A 1IJHA 2EQ6A 4KPRA 4U8JA 1NDAA 3NTDA 5J7XA 3CNJA 3AEEA 2C76A 1GRAA 3H8IA 2JAEA 3NN6X 4XWZA 3SX6A 4BK1A 4CCRA 3B6DA 1E7PA 1NG4A 1M6IA 4DSGA 3UKQA 3NYCA 2JBVA 3AEAA 1ZKQA 3AE6A 4C77A 4H2QA 2GB0A 4H2RA 2YVJA 3AYJA 1PJ7A 1NENA 1VDCA 3AB1A 4II3A 4BV6A 3EAOA 1OJAA 1BWCA 1CJ2A 3QFBA 2TPRA 3GD3A 2X8GA 3M12A 2AR8A 4LIIA 1PN0A 1VG9A 5FS8A 2YG4A 1QLBA 3S61A 2VZ2A 1W4XA 1EL5A 2RABA 1KFYA 1B4VA 4TM1A 2XCGA 1H82A 5U63A 3CGBA 4YSXA 3KVEA 4CNKA 3RP8A 2EQ8A 2OA1A 4C5OA 3G5QA 2NPXA 5GSNA 3VQRA 1D5TA 1TDNA 3DJJA 3UP5A 2GQFA 1OJCA 3NIXA 3NKSA 4GCMA 1Y56B 3ITJA 2FJDA 1O5WA 1PJ6A 3NK0X 3CGEA 3V3OA 2FBWA 1NHQA 2WU5A 4TLXA 1E1MA 1XANA 5IQ4A 4GAVA 3DK4A 4ECHA 1H7WA 1IUUA 5KRQA 4IV9A 2XFNA 3C4NA 4WCTA 5M0ZA 2WDVA 4H4SA 1VG0A 3NYEA 1P2EA 3UKAA 4RSLA 1H86A 4ZCCA 3H8LA 2X8CA 2BC1A 2W0HA 3I3LA 5LV9A 1CC4A 5KVHA 1JNRA 3AE1A 1E6EA 1MXTA 2BC0A 1CC6A 2OAMA 1N1PA 2OLOA 5C2TA 4FK1A 2GR0A 4G73A 4OPIA 4U8NA 4YKFA 3AYIA 3P1WA 3AE7A 3ALLA 1ZX9A 1N4VA 1K0IA 4TLZA 4AT2A 3T0KA 1GTHA 2R0GA 1N4WA 5FS6A 3D1CA 3EF6A 1LJ1A 3NN0X 2BK3A 5EB4A 4A9WA 4U2LA 4YTPA 2XVHA 3F8PA 5GRTA 1Q1WA 1Z6LA 3FG2P 2C65A 2V5ZA 1CJ4A 4REKA 2B7SA 2WPEA 2V60A 4II2A 2YG7A 3IHGA 3NG7X 2YAUA 2WOVA 1ZMDA 2WDRA 4A6NA 4OPGA 2Q0KA 2GMJA 2B9WA 1VQWA 3AEBA 2BS2A 3NH3X 2VRLA 2C67A 1BKWA 1E1NA 4Z26A 3AE5A 4H4YA 3VR8A 1X31B 5KMSA 1BGNA 1JEHA 2YM1A 2QA1A 4K22A 4B68A 3K7MX 3RNMA 2XDOA 2B7RA 3GD4A 3K7QX 4J2WA 2QCUA 3S5WA 4K5SA 4G74A 4Z44A 3R9UA 4Z25A 4RG3A 4EMIA 2R4EA 2JB2A 1LTXR 4NWZA 4A5LA 1D4CA 2CDUA 2YLTA 4J56A 4OPUA 2YLSA 5DBJA 1GETA 5KMPA 3HYVA 2YR6A 1GRGA 3EPTA 5KOWA 4ICYA 2X8HA 1QO8A 3LADA 5HY5A 3NGCX 1TDOA 2BCPA 4OCGA 1GTEA 5FS9A 1GPEA 4EM3A 4EQRA 1L0VA 1TRBA 5IPYA 1OJDA
chains in the Genus database with same CATH topology
4AP1A 2ARDA 2E5VA 2FJBA 3GDNA 4YTNA 1F8SA 3IHMA 3UOXA 5ER0A 3GMBA 4NEWA 3LOVA 3ZYXA 3BHKA 3CTYA 1N4UA 1Y0PA 3CNTA 2A89A 1VRQB 3NYFA 2VQBA 2YLRA 3UKHA 4B65A 2YG3A 1DODA 4Z2TA 3AECA 3CGDA 2XVJA 4IA6A 2ZZCA 2PHHA 3F8RA 3II4A 3NTAA 5HXIA 4IA5A 1PXAA 3KKJA 2E1MA 1L9DA 4CNJA 1FEBA 1B37A 4XXGA 1S2QA 1DNCA 1OJTA 2A87A 3AEFA 3CIRA 3F8DA 4G9KA 3T37A 4YKGA 1H7XA 3I6DA 2XFUA 1AOGA 4EIQA 3P4QA 1YQ3A 4USQA 4J57A 2OLNA 4FX9A 2XLSA 2XYOA 4B66A 1DOBA 1SEZA 4J36A 3P9UA 4Z24A 3UKFA 2GR1A 3AE4A 1PXBA 2GAHB 1MO9A 2YVGA 4NEVA 4BK3A 4USRA 3BHFA 4Y4LA 3UOVA 3E1TA 4JQ9A 2XLPA 2JK6A 4A65A 1NPXA 2A8XA 3FMWA 1ZOYA 3RP7A 3RHAA 4OPCA 1PBEA 4GRTA 2YQUA 4AOSA 1GRTA 3QVPA 2V3BA 1KSSA 4A6NB 1JRYA 1ZP0A 3IC9A 1GOSA 3SFDA 2C7GA 3DJDA 5JCKA 1CL0A 1XPQA 4I59A 2YR4A 1Q1RA 3KU9A 3P4RA 1CHUA 2V3AA 4H4RA 1F8WA 4CY8A 4BURA 1JNZA 3KD9A 4BK2A 2BS3A 5JCIA 2X99A 1MOKA 1PBCA 3URHA 4B1BA 3LZXA 1PXCA 2WDQA 1GESA 1XDIA 4IVOB 4NNJA 4EQWA 3O0HA 2C75A 3SM8A 2WP5A 3SXIA 1F8RA 5KXJA 3DA1A 1GERA 1LQTA 2IVEA 2AQJA 4B67A 3UTGA 5M10A 3T14A 3P4SA 3GYXA 4AT0A 2B9XA 1H83A 3VR9A 4YSHA 3SZ0A 2TMDA 4A79A 4XWRA 1S2YA 1PDHA 2BACA 1GV4A 3T31A 5KMRA 2WOIA 3AE3A 1NHRA 4BJZA 4AOXA 4OPDA 1NG3A 2WP9A 3V3NA 5L46A 1CC2A 4DGKA 1TYPA 3LXDA 3VRAA 1PBDA 1K0JA 3T2YA 1FL2A 2F5ZA 1KSUA 4J34A 1KNPA 3KLJA 2GR3A 1CJCA 3L1RA 2C73A 3AE2A 1FEAA 2Y6QA 1F6MA 2GH5A 2DKHA 3SY4A 2FJAA 2JB1A 3SFEA 3LB8A 4H4UA 2R0CA 3ICRA 3G5RA 4C3YA 1BF3A 2YWLA 4U8MA 4H4TA 4B64A 3V76A 1JRXA 2X50A 4Y4NA 3CPJG 2CVJA 3CGCA 2BRYA 1B5QA 1ONFA 1IUVA 1YQ4A 1TYTA 3AWIA 4JNAA 1PJ5A 4PABA 2B9YA 4H2NA 1KNRA 3T2KA 2GAGB 3AEDA 3QSMA 3DK9A 4H4PA 3UKPA 5KNLA 1L9EA 1JRZA 2B76A 4EM4A 1NHPA 2QA2A 2WESA 4E0VA 4ADWA 3UTEA 5U25A 4CY6A 2C64A 1YKJA 3GRTA 5JCNA 3HZLA 3IWAA 4EMJA 1FECA 3JSKA 3SQPA 4Z2UA 1BGJA 3ICTA 2EQ7A 1KF6A 4EQXA 4H2PA 2ZZ0A 1IUWA 4A99A 2YM2A 2GF3A 1O94A 3CMMA 2ACZA 2Z5YA 3UTHA 4GUVA 1GRBA 3BNUA 1TDKA 5KOXA 1LVLA 2PYXA 3DGZA 3CNDA 4NTDA 1GRHA 1GRFA 2R45A 3AXBA 5EBKA 4AP3A 1ZK7A 2Q0LA 3NLCA 4NZHA 3ICSA 2BCGG 1Y56A 2WBAA 1NHSA 2YR5A 1Q9IA 4G6GA 1H84A 4APNA 3DJGX 3DGHA 5CKUA 5BRTA 2Z5XA 4U8IA 4X9MA 2VVLA 3Q6JA 1LV0A 1CBOA 1DOEA 1LQUA 3BI2A 5EOWA 4EIPA 2R0PA 4YXDA 4GR1A 1XHCA 2XFQA 3T2ZA 3KPKA 3NHOX 3REDA 2Q6UA 2WPCA 2XVIA 5KVIA 1EL7A 1V59A 2QAEA 2V6OA 2WEUA 4CBQA 2RGJA 2R46A 4IVMB 3SGLA 3CNSA 3PO7A 3COXA 3M13A 1LPFA 1D4EA 3SZWA 5JCLA 1K4QA 2XLUA 3UKKA 2Y6RA 3BNMA 3ALJA 4U8KA 5FMHA 1DOCA 2WOWA 1D7LA 2C72A 1IUTA 3PS9A 2WS3A 4KX6A 1ELIA 3D8XA 3KA7A 4J33A 4UDPA 1FCDA 4Z2RA 4G6HA 1GT8A 1H6VA 5EB5A 5HYMA 2ZBWA 4C74A 3FIMB 3ABVA 3LJPA 1B8SA 4TM3A 2CULA 3HYWA 5JCMA 3C96A 2BABA 2FJEA 3DK8A 2WETA 1RP0A 5BVAA 2XVFA 4K2XA 5BULA 2YG5A 1M64A 3UP4A 2YLWA 4C3XA 3GYIA 3LZWA 1OJ9A 4H4QA 2YLZA 1QJDA 4FK1C 2C3DA 2VOUA 2VQ7A 1L9CA 3DJEA 4I58A 3FBSA 3P4PA 5C3JA 1PBBA 4U8LA 3CPIG 1IUXA 1F3PA 1GALA 3KPFA 5HHFA 3SZFA 2ZZBA 1GNDA 4H4XA 1GEUA 4JY3A 4CRTA 4OPLA 4TM4A 1PBFA 5KMQA 2XLRA 4HB9A 4LA1A 4K5RA 4RG4A 4JNQA 2WU2A 2XLTA 3M0OA 5BUKA 4GF7A 4PAAA 3G5SA 4P9SA 4U8OA 4U8PA 2R9ZA 5U1OA 3AYLA 1GXFA 1ZY8A 1DJQA 1NAAA 1UKVG 1EBDA 2UZZA 2JB3A 3ATQA 3RP6A 1EL8A 3DMEA 3NRNA 4GDEA 3IF9A 4YT0A 1E1LA 2C3CA 3UCLA 3BI4A 2I0ZA 2RGOA 3GDPA 1REOA 3K30A 4U2SA 1GREA 1E1KA 4M52A 3SZCA 4ZN0A 2BK5A 4BJYA 3AD9B 4D04A 2WP6A 1ZDLA 3GYJA 2RGHA 3AE8A 4YSZA 1BZLA 1PS9A 2XVEA 1KDGA 3B3RA 3GMCA 4DNAA 2WPFA 2EQ9A 4U2TA 1D7YA 1EL9A 1RSGA 2C4CA 4UDRA 2JKCA 3UOYA 4A7AA 2V61A 4LU6A 4X9NA 4B69A 1K0LA 3FPZA 4WX1A 3EANA 4D03A 3OC4A 3GWDA 4NTEA 4HA6A 2BS4A 4YSYA 2GV8A 2BA9A 2GQWA 3ADAB 4YWOA 5KWFA 2BRAA 2HQMA 4H50A 4B63A 4CCRA 3HYXA 3QSEA 2BXRA 1RYIA 4MJWA 3NK1X 4H4WA 2H88A 1S3EA 2GMHA 2APGA 2E4GA 4EQSA 3AD8B 4K8DA 4Z43A 4H7UA 2DKIA 4DSHA 2CFYA 3AEGA 2VRMA 3UTFA 1NEKA 1ZOVA 1HYUA 4TM0A 3GRSA 3GWFA 3ZDNA 1E39A 4X4JA 3NT6A 2IVDA 3SYIA 3CNPA 4J31A 5IQ1A 5CQFA 2C70A 2XFOA 1FOHA 3CN8A 3GSIA 4FDCB 4CCQA 2GEWA 2VVLG 2BK4A 1JOAA 1JU2A 2O9ZA 3AE9A 5TR3A 3ISHA 2NVKX 2IIDA 3ALMA 3BI5A 3UOZA 5J60A 3H4KA 1D4DA 2VVMA 1H81A 3QVRA 2GR2A 3QSSA 4OPTA 2XFPA 3AD7B 1S3BA 1GSNA 4H4ZA 1CJ3A 4JDRA 1TDEA 2Q7VA 3NNEA 1YQZA 2H89A 3NK2X 4GAPA 2GRTA 4EMWA 4O5UA 2R4JA 5FS7A 2X3NA 3QJ4A 2AAQA 4YTMA 1COYA 2BYBA 4N9XA 2YG6A 3ATRA 1TDFA 3K7TA 4Y4MA 3WE0A 3CPHG 1P2HA 4JN9A 4OVIA 1IUSA 1YY5A 3PVCA 4JY2A 2OALA 4UP3A 1CF3A 1DJNA 4O5QA 3QFAA 2YVFA 4UDQA 2WQYA 1PHHA 2BXSA 4ZCDA 3UKLA 1DXLA 3VRBA 4K7ZA 4H4VA 4GDPA 2YLXA 3Q9TA 3L8KA 1ZMCA 3C4AA 2C66A 4NTCA 2J3NA 2WHDA 1O95A 3VRDB 3DH9A 3OZ2A 1IJHA 2EQ6A 4KPRA 4U8JA 1NDAA 3NTDA 5J7XA 3CNJA 3AEEA 2C76A 1GRAA 1OJDA 2JAEA 3H8IA 3NN6X 4XWZA 3SX6A 4BK1A 3B6DA 1E7PA 1NG4A 1M6IA 4DSGA 3UKQA 3NYCA 2JBVA 3AEAA 1ZKQA 3AE6A 4C77A 4H2QA 2GB0A 4H2RA 2YVJA 3AYJA 1PJ7A 1NENA 1VDCA 3AB1A 4II3A 4BV6A 3EAOA 1OJAA 1BWCA 1CJ2A 3QFBA 2TPRA 3GD3A 2X8GA 3M12A 2AR8A 4LIIA 1PN0A 1VG9A 5FS8A 2YG4A 1QLBA 3S61A 2VZ2A 1W4XA 1EL5A 2RABA 1KFYA 1B4VA 4TM1A 2XCGA 1H82A 5U63A 3CGBA 4YSXA 3KVEA 4CNKA 3RP8A 2EQ8A 2OA1A 4C5OA 3G5QA 2NPXA 5GSNA 3VQRA 1D5TA 1TDNA 3DJJA 3UP5A 2GQFA 1OJCA 3NIXA 3NKSA 4GCMA 1Y56B 3ITJA 2FJDA 1O5WA 1PJ6A 3NK0X 3CGEA 3V3OA 2FBWA 1NHQA 2WU5A 4TLXA 1E1MA 1XANA 5IQ4A 4GAVA 3DK4A 4ECHA 1H7WA 1IUUA 5KRQA 4IV9A 2XFNA 3C4NA 4WCTA 5M0ZA 2WDVA 4H4SA 1VG0A 3NYEA 1P2EA 3UKAA 4RSLA 1H86A 4ZCCA 3H8LA 2X8CA 2BC1A 2W0HA 3I3LA 5LV9A 1CC4A 5KVHA 1JNRA 3AE1A 1E6EA 1MXTA 2BC0A 1CC6A 2OAMA 1N1PA 2OLOA 5C2TA 4FK1A 2GR0A 4G73A 4OPIA 4U8NA 4YKFA 3AYIA 3P1WA 3AE7A 3ALLA 1ZX9A 1N4VA 1K0IA 4TLZA 4AT2A 3T0KA 1GTHA 2R0GA 1N4WA 5FS6A 3D1CA 3EF6A 1LJ1A 3NN0X 2BK3A 5EB4A 4A9WA 4U2LA 4YTPA 2XVHA 3F8PA 5GRTA 1Q1WA 1Z6LA 3FG2P 2C65A 2V5ZA 1CJ4A 4REKA 2B7SA 2WPEA 2V60A 4II2A 2YG7A 3IHGA 3NG7X 2YAUA 2WOVA 1ZMDA 2WDRA 4A6NA 4OPGA 2Q0KA 2GMJA 2B9WA 1VQWA 3AEBA 2BS2A 3NH3X 2VRLA 2C67A 1BKWA 1E1NA 4Z26A 3AE5A 4H4YA 3VR8A 1X31B 5KMSA 1BGNA 1JEHA 2YM1A 2QA1A 4K22A 4B68A 3K7MX 3RNMA 2XDOA 2B7RA 3GD4A 3K7QX 4J2WA 2QCUA 3S5WA 4K5SA 4G74A 4Z44A 3R9UA 4Z25A 4RG3A 4EMIA 2R4EA 2JB2A 1LTXR 4NWZA 4A5LA 1D4CA 2CDUA 2YLTA 4J56A 4OPUA 2YLSA 5DBJA 1GETA 5KMPA 3HYVA 2YR6A 1GRGA 3EPTA 5KOWA 4ICYA 2X8HA 1QO8A 3LADA 5HY5A 3NGCX 1TDOA 2BCPA 4OCGA 1GTEA 5FS9A 1GPEA 4EM3A 4EQRA 1L0VA 1TRBA 5IPYA 2GVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP1 A;  2ARD A;  2E5V A;  2FJB A;  3GDN A;  4YTN A;  1F8S A;  3IHM A;  3UOX A;  5ER0 A;  3GMB A;  4NEW A;  3LOV A;  3ZYX A;  3BHK A;  3CTY A;  1N4U A;  1Y0P A;  3CNT A;  2A89 A;  1VRQ B;  3NYF A;  2VQB A;  2YLR A;  3UKH A;  4B65 A;  2YG3 A;  1DOD A;  4Z2T A;  3AEC A;  3CGD A;  2XVJ A;  4IA6 A;  2ZZC A;  2PHH A;  3F8R A;  3II4 A;  3NTA A;  5HXI A;  4IA5 A;  1PXA A;  3KKJ A;  2E1M A;  1L9D A;  4CNJ A;  1FEB A;  1B37 A;  4XXG A;  1S2Q A;  1DNC A;  1OJT A;  2A87 A;  3AEF A;  3CIR A;  3F8D A;  3T37 A;  4YKG A;  1H7X A;  3I6D A;  2XFU A;  1AOG A;  4EIQ A;  3P4Q A;  1YQ3 A;  4USQ A;  4J57 A;  2OLN A;  4FX9 A;  2XLS A;  2XYO A;  4B66 A;  1DOB A;  1SEZ A;  4J36 A;  3P9U A;  4Z24 A;  3UKF A;  2GR1 A;  3AE4 A;  1PXB A;  2GAH B;  1MO9 A;  2YVG A;  4NEV A;  4BK3 A;  4USR A;  3BHF A;  4Y4L A;  3UOV A;  3E1T A;  4JQ9 A;  2XLP A;  2JK6 A;  4A65 A;  1NPX A;  2A8X A;  3FMW A;  1ZOY A;  3RP7 A;  3RHA A;  4OPC A;  1PBE A;  4GRT A;  2YQU A;  4AOS A;  1GRT A;  3QVP A;  2V3B A;  1KSS A;  4A6N B;  1JRY A;  1ZP0 A;  3IC9 A;  1GOS A;  3SFD A;  2C7G A;  3DJD A;  5JCK A;  1CL0 A;  1XPQ A;  4I59 A;  2YR4 A;  1Q1R A;  3KU9 A;  3P4R A;  1CHU A;  2V3A A;  4H4R A;  1F8W A;  4CY8 A;  4BUR A;  1JNZ A;  3KD9 A;  4BK2 A;  2BS3 A;  5JCI A;  2X99 A;  1MOK A;  1PBC A;  3URH A;  4B1B A;  3LZX A;  1PXC A;  2WDQ A;  1GES A;  1XDI A;  4IVO B;  4EQW A;  3O0H A;  2C75 A;  3SM8 A;  2WP5 A;  1F8R A;  5KXJ A;  3DA1 A;  1GER A;  1LQT A;  2IVE A;  2AQJ A;  4B67 A;  3UTG A;  5M10 A;  3P4S A;  4AT0 A;  2B9X A;  1H83 A;  3VR9 A;  4YSH A;  2TMD A;  4A79 A;  4XWR A;  1S2Y A;  1PDH A;  2BAC A;  1GV4 A;  2WOI A;  3AE3 A;  1NHR A;  4BJZ A;  4AOX A;  4OPD A;  1NG3 A;  2WP9 A;  3V3N A;  5L46 A;  1CC2 A;  4DGK A;  1TYP A;  3LXD A;  3VRA A;  1PBD A;  1K0J A;  1FL2 A;  2F5Z A;  1KSU A;  4J34 A;  1KNP A;  3KLJ A;  2GR3 A;  1CJC A;  3L1R A;  2C73 A;  3AE2 A;  1FEA A;  2Y6Q A;  1F6M A;  2GH5 A;  2DKH A;  2FJA A;  2JB1 A;  3SFE A;  3LB8 A;  4H4U A;  2R0C A;  3ICR A;  3G5R A;  4C3Y A;  1BF3 A;  2YWL A;  4U8M A;  4H4T A;  4B64 A;  3V76 A;  1JRX A;  2X50 A;  4Y4N A;  3CPJ G;  2CVJ A;  3CGC A;  1B5Q A;  1ONF A;  1IUV A;  1YQ4 A;  1TYT A;  3AWI A;  4JNA A;  1PJ5 A;  4PAB A;  2B9Y A;  4H2N A;  1KNR A;  2GAG B;  3AED A;  3QSM A;  3DK9 A;  4H4P A;  3UKP A;  1L9E A;  1JRZ A;  2B76 A;  4EM4 A;  1NHP A;  2QA2 A;  2WES A;  4E0V A;  4ADW A;  3UTE A;  5U25 A;  4CY6 A;  2C64 A;  1YKJ A;  3GRT A;  5JCN A;  3HZL A;  3IWA A;  4EMJ A;  1FEC A;  3JSK A;  3SQP A;  4Z2U A;  1BGJ A;  3ICT A;  2EQ7 A;  1KF6 A;  4EQX A;  4H2P A;  2ZZ0 A;  1IUW A;  4A99 A;  2YM2 A;  2GF3 A;  1O94 A;  2ACZ A;  2Z5Y A;  3UTH A;  4GUV A;  1GRB A;  3BNU A;  1TDK A;  5KOX A;  1LVL A;  2PYX A;  3DGZ A;  3CND A;  4NTD A;  1GRH A;  1GRF A;  2R45 A;  3AXB A;  5EBK A;  4AP3 A;  1ZK7 A;  2Q0L A;  3NLC A;  4NZH A;  3ICS A;  2BCG G;  1Y56 A;  2WBA A;  1NHS A;  2YR5 A;  1Q9I A;  1H84 A;  4APN A;  3DJG X;  3DGH A;  5CKU A;  5BRT A;  2Z5X A;  4U8I A;  4X9M A;  2VVL A;  3Q6J A;  1LV0 A;  1CBO A;  1DOE A;  1LQU A;  3BI2 A;  5EOW A;  4EIP A;  2R0P A;  4YXD A;  4GR1 A;  1XHC A;  2XFQ A;  3NHO X;  3RED A;  2Q6U A;  2WPC A;  2XVI A;  5KVI A;  1EL7 A;  1V59 A;  2QAE A;  2V6O A;  2WEU A;  4CBQ A;  2RGJ A;  2R46 A;  4IVM B;  3SGL A;  3CNS A;  3PO7 A;  3COX A;  3M13 A;  1LPF A;  1D4E A;  5JCL A;  1K4Q A;  2XLU A;  3UKK A;  2Y6R A;  3BNM A;  3ALJ A;  4U8K A;  5FMH A;  1DOC A;  2WOW A;  1D7L A;  2C72 A;  1IUT A;  3PS9 A;  2WS3 A;  4KX6 A;  1ELI A;  3D8X A;  3KA7 A;  4J33 A;  4UDP A;  1FCD A;  4Z2R A;  1GT8 A;  1H6V A;  5EB5 A;  5HYM A;  2ZBW A;  4C74 A;  3FIM B;  3ABV A;  3LJP A;  1B8S A;  4TM3 A;  2CUL A;  5JCM A;  3C96 A;  2BAB A;  2FJE A;  3DK8 A;  2WET A;  1RP0 A;  5BVA A;  2XVF A;  4K2X A;  5BUL A;  2YG5 A;  1M64 A;  3UP4 A;  2YLW A;  4C3X A;  3GYI A;  3LZW A;  1OJ9 A;  4H4Q A;  2YLZ A;  1QJD A;  4FK1 C;  2C3D A;  2VOU A;  2VQ7 A;  1L9C A;  3DJE A;  4I58 A;  3FBS A;  3P4P A;  5C3J A;  1PBB A;  4U8L A;  3CPI G;  1IUX A;  1F3P A;  1GAL A;  3KPF A;  5HHF A;  2ZZB A;  1GND A;  4H4X A;  1GEU A;  4JY3 A;  4CRT A;  4OPL A;  4TM4 A;  1PBF A;  2XLR A;  4HB9 A;  4LA1 A;  4K5R A;  4RG4 A;  4JNQ A;  2WU2 A;  2XLT A;  3M0O A;  5BUK A;  4GF7 A;  4PAA A;  3G5S A;  4P9S A;  4U8O A;  4U8P A;  2R9Z A;  5U1O A;  3AYL A;  1GXF A;  1ZY8 A;  1DJQ A;  1NAA A;  1UKV G;  1EBD A;  2UZZ A;  2JB3 A;  3ATQ A;  3RP6 A;  1EL8 A;  3DME A;  3NRN A;  4GDE A;  3IF9 A;  4YT0 A;  1E1L A;  2C3C A;  3UCL A;  3BI4 A;  2I0Z A;  2RGO A;  3GDP A;  1REO A;  3K30 A;  4U2S A;  1GRE A;  1E1K A;  4M52 A;  4ZN0 A;  2BK5 A;  4BJY A;  3AD9 B;  4D04 A;  2WP6 A;  1ZDL A;  3GYJ A;  2RGH A;  3AE8 A;  4YSZ A;  1BZL A;  1PS9 A;  2XVE A;  1KDG A;  3B3R A;  3GMC A;  4DNA A;  2WPF A;  2EQ9 A;  4U2T A;  1D7Y A;  1EL9 A;  1RSG A;  4UDR A;  2JKC A;  3UOY A;  4A7A A;  2V61 A;  4LU6 A;  4X9N A;  4B69 A;  1K0L A;  3FPZ A;  4WX1 A;  3EAN A;  4D03 A;  3OC4 A;  3GWD A;  4NTE A;  4HA6 A;  2BS4 A;  4YSY A;  2GV8 A;  2BA9 A;  2GQW A;  3ADA B;  4YWO A;  5KWF A;  2HQM A;  4H50 A;  4B63 A;  3QSE A;  2BXR A;  1RYI A;  4MJW A;  3NK1 X;  4H4W A;  2H88 A;  1S3E A;  2GMH A;  2APG A;  2E4G A;  4EQS A;  3AD8 B;  4K8D A;  4Z43 A;  4H7U A;  2DKI A;  4DSH A;  2CFY A;  3AEG A;  2VRM A;  3UTF A;  1NEK A;  1ZOV A;  1HYU A;  4TM0 A;  3GRS A;  3GWF A;  3ZDN A;  1E39 A;  4X4J A;  3NT6 A;  2IVD A;  3CNP A;  4J31 A;  5IQ1 A;  5CQF A;  2C70 A;  2XFO A;  1FOH A;  3CN8 A;  3GSI A;  4FDC B;  4CCQ A;  2GEW A;  2VVL G;  2BK4 A;  1JOA A;  1JU2 A;  2O9Z A;  3AE9 A;  5TR3 A;  3ISH A;  2NVK X;  2IID A;  3ALM A;  3BI5 A;  3UOZ A;  5J60 A;  3H4K A;  1D4D A;  2VVM A;  1H81 A;  3QVR A;  2GR2 A;  3QSS A;  4OPT A;  2XFP A;  3AD7 B;  1S3B A;  1GSN A;  4H4Z A;  1CJ3 A;  4JDR A;  1TDE A;  2Q7V A;  3NNE A;  1YQZ A;  2H89 A;  3NK2 X;  2GRT A;  4EMW A;  4O5U A;  2R4J A;  5FS7 A;  2X3N A;  3QJ4 A;  2AAQ A;  4YTM A;  1COY A;  2BYB A;  4N9X A;  2YG6 A;  3ATR A;  1TDF A;  3K7T A;  4Y4M A;  3WE0 A;  3CPH G;  1P2H A;  4JN9 A;  4OVI A;  1IUS A;  1YY5 A;  3PVC A;  4JY2 A;  2OAL A;  4UP3 A;  1CF3 A;  1DJN A;  4O5Q A;  3QFA A;  2YVF A;  4UDQ A;  2WQY A;  1PHH A;  2BXS A;  4ZCD A;  3UKL A;  1DXL A;  3VRB A;  4K7Z A;  4H4V A;  4GDP A;  2YLX A;  3Q9T A;  3L8K A;  1ZMC A;  3C4A A;  2C66 A;  4NTC A;  2J3N A;  2WHD A;  1O95 A;  3VRD B;  3DH9 A;  3OZ2 A;  1IJH A;  2EQ6 A;  4KPR A;  4U8J A;  1NDA A;  3NTD A;  5J7X A;  3CNJ A;  3AEE A;  2C76 A;  1GRA A;  1OJD A;  2JAE A;  3H8I A;  3NN6 X;  4XWZ A;  4BK1 A;  4CCR A;  3B6D A;  1E7P A;  1NG4 A;  1M6I A;  4DSG A;  3UKQ A;  3NYC A;  2JBV A;  3AEA A;  1ZKQ A;  3AE6 A;  4C77 A;  4H2Q A;  2GB0 A;  4H2R A;  2YVJ A;  3AYJ A;  1PJ7 A;  1NEN A;  1VDC A;  3AB1 A;  4BV6 A;  3EAO A;  1OJA A;  1BWC A;  1CJ2 A;  3QFB A;  2TPR A;  3GD3 A;  2X8G A;  3M12 A;  2AR8 A;  4LII A;  1PN0 A;  1VG9 A;  5FS8 A;  2YG4 A;  1QLB A;  3S61 A;  2VZ2 A;  1W4X A;  1EL5 A;  2RAB A;  1KFY A;  1B4V A;  4TM1 A;  2XCG A;  1H82 A;  5U63 A;  3CGB A;  4YSX A;  3KVE A;  4CNK A;  3RP8 A;  2EQ8 A;  2OA1 A;  4C5O A;  3G5Q A;  2NPX A;  5GSN A;  3VQR A;  1D5T A;  1TDN A;  3DJJ A;  3UP5 A;  2GQF A;  1OJC A;  3NIX A;  3NKS A;  4GCM A;  1Y56 B;  3ITJ A;  2FJD A;  1O5W A;  1PJ6 A;  3NK0 X;  3CGE A;  3V3O A;  2FBW A;  1NHQ A;  2WU5 A;  4TLX A;  1E1M A;  1XAN A;  5IQ4 A;  3DK4 A;  4ECH A;  1H7W A;  1IUU A;  5KRQ A;  4IV9 A;  2XFN A;  3C4N A;  4WCT A;  5M0Z A;  2WDV A;  4H4S A;  1VG0 A;  3NYE A;  1P2E A;  3UKA A;  4RSL A;  1H86 A;  4ZCC A;  3H8L A;  2X8C A;  2BC1 A;  2W0H A;  3I3L A;  5LV9 A;  1CC4 A;  5KVH A;  1JNR A;  3AE1 A;  1E6E A;  1MXT A;  2BC0 A;  1CC6 A;  2OAM A;  1N1P A;  2OLO A;  5C2T A;  4FK1 A;  2GR0 A;  4OPI A;  4YKF A;  4U8N A;  3AYI A;  3P1W A;  3AE7 A;  3ALL A;  1ZX9 A;  1N4V A;  1K0I A;  4TLZ A;  4AT2 A;  1GTH A;  2R0G A;  1N4W A;  5FS6 A;  3D1C A;  3EF6 A;  1LJ1 A;  3NN0 X;  2BK3 A;  5EB4 A;  4A9W A;  4U2L A;  4YTP A;  2XVH A;  3F8P A;  5GRT A;  1Q1W A;  1Z6L A;  3FG2 P;  2C65 A;  2V5Z A;  1CJ4 A;  4REK A;  2B7S A;  2WPE A;  2V60 A;  2YG7 A;  3IHG A;  3NG7 X;  2YAU A;  2WOV A;  1ZMD A;  2WDR A;  4A6N A;  4OPG A;  2Q0K A;  2GMJ A;  2B9W A;  1VQW A;  3AEB A;  2BS2 A;  3NH3 X;  2VRL A;  2C67 A;  1BKW A;  1E1N A;  4Z26 A;  3AE5 A;  4H4Y A;  3VR8 A;  1X31 B;  1BGN A;  1JEH A;  2YM1 A;  2QA1 A;  4K22 A;  4B68 A;  3K7M X;  3RNM A;  2XDO A;  2B7R A;  3GD4 A;  3K7Q X;  4J2W A;  2QCU A;  3S5W A;  4K5S A;  4Z44 A;  3R9U A;  4Z25 A;  4RG3 A;  4EMI A;  2R4E A;  2JB2 A;  1LTX R;  4A5L A;  1D4C A;  2CDU A;  2YLT A;  4J56 A;  4OPU A;  2YLS A;  5DBJ A;  1GET A;  2YR6 A;  1GRG A;  3EPT A;  5KOW A;  4ICY A;  2X8H A;  1QO8 A;  3LAD A;  5HY5 A;  3NGC X;  1TDO A;  2BCP A;  4OCG A;  1GTE A;  5FS9 A;  1GPE A;  4EM3 A;  4EQR A;  1L0V A;  1TRB A;  5IPY A;  2GVC A; 
#chains in the Genus database with same CATH topology
 4AP1 A;  2ARD A;  2E5V A;  2FJB A;  3GDN A;  4YTN A;  1F8S A;  3IHM A;  3UOX A;  5ER0 A;  3GMB A;  4NEW A;  3LOV A;  3ZYX A;  3BHK A;  3CTY A;  1N4U A;  1Y0P A;  3CNT A;  2A89 A;  1VRQ B;  3NYF A;  2VQB A;  2YLR A;  3UKH A;  4B65 A;  2YG3 A;  1DOD A;  4Z2T A;  3AEC A;  3CGD A;  2XVJ A;  4IA6 A;  2ZZC A;  2PHH A;  3F8R A;  3II4 A;  3NTA A;  5HXI A;  4IA5 A;  1PXA A;  3KKJ A;  2E1M A;  1L9D A;  4CNJ A;  1FEB A;  1B37 A;  4XXG A;  1S2Q A;  1DNC A;  1OJT A;  2A87 A;  3AEF A;  3CIR A;  3F8D A;  4G9K A;  3T37 A;  4YKG A;  1H7X A;  3I6D A;  2XFU A;  1AOG A;  4EIQ A;  3P4Q A;  1YQ3 A;  4USQ A;  4J57 A;  2OLN A;  4FX9 A;  2XLS A;  2XYO A;  4B66 A;  1DOB A;  1SEZ A;  4J36 A;  3P9U A;  4Z24 A;  3UKF A;  2GR1 A;  3AE4 A;  1PXB A;  2GAH B;  1MO9 A;  2YVG A;  4NEV A;  4BK3 A;  4USR A;  3BHF A;  4Y4L A;  3UOV A;  3E1T A;  4JQ9 A;  2XLP A;  2JK6 A;  4A65 A;  1NPX A;  2A8X A;  3FMW A;  1ZOY A;  3RP7 A;  3RHA A;  4OPC A;  1PBE A;  4GRT A;  2YQU A;  4AOS A;  1GRT A;  3QVP A;  2V3B A;  1KSS A;  4A6N B;  1JRY A;  1ZP0 A;  3IC9 A;  1GOS A;  3SFD A;  2C7G A;  3DJD A;  5JCK A;  1CL0 A;  1XPQ A;  4I59 A;  2YR4 A;  1Q1R A;  3KU9 A;  3P4R A;  1CHU A;  2V3A A;  4H4R A;  1F8W A;  4CY8 A;  4BUR A;  1JNZ A;  3KD9 A;  4BK2 A;  2BS3 A;  5JCI A;  2X99 A;  1MOK A;  1PBC A;  3URH A;  4B1B A;  3LZX A;  1PXC A;  2WDQ A;  1GES A;  1XDI A;  4IVO B;  4NNJ A;  4EQW A;  3O0H A;  2C75 A;  3SM8 A;  2WP5 A;  3SXI A;  1F8R A;  5KXJ A;  3DA1 A;  1GER A;  1LQT A;  2IVE A;  2AQJ A;  4B67 A;  3UTG A;  5M10 A;  3T14 A;  3P4S A;  3GYX A;  4AT0 A;  2B9X A;  1H83 A;  3VR9 A;  4YSH A;  3SZ0 A;  2TMD A;  4A79 A;  4XWR A;  1S2Y A;  1PDH A;  2BAC A;  1GV4 A;  3T31 A;  5KMR A;  2WOI A;  3AE3 A;  1NHR A;  4BJZ A;  4AOX A;  4OPD A;  1NG3 A;  2WP9 A;  3V3N A;  5L46 A;  1CC2 A;  4DGK A;  1TYP A;  3LXD A;  3VRA A;  1PBD A;  1K0J A;  3T2Y A;  1FL2 A;  2F5Z A;  1KSU A;  4J34 A;  1KNP A;  3KLJ A;  2GR3 A;  1CJC A;  3L1R A;  2C73 A;  3AE2 A;  1FEA A;  2Y6Q A;  1F6M A;  2GH5 A;  2DKH A;  3SY4 A;  2FJA A;  2JB1 A;  3SFE A;  3LB8 A;  4H4U A;  2R0C A;  3ICR A;  3G5R A;  4C3Y A;  1BF3 A;  2YWL A;  4U8M A;  4H4T A;  4B64 A;  3V76 A;  1JRX A;  2X50 A;  4Y4N A;  3CPJ G;  2CVJ A;  3CGC A;  2BRY A;  1B5Q A;  1ONF A;  1IUV A;  1YQ4 A;  1TYT A;  3AWI A;  4JNA A;  1PJ5 A;  4PAB A;  2B9Y A;  4H2N A;  1KNR A;  3T2K A;  2GAG B;  3AED A;  3QSM A;  3DK9 A;  4H4P A;  3UKP A;  5KNL A;  1L9E A;  1JRZ A;  2B76 A;  4EM4 A;  1NHP A;  2QA2 A;  2WES A;  4E0V A;  4ADW A;  3UTE A;  5U25 A;  4CY6 A;  2C64 A;  1YKJ A;  3GRT A;  5JCN A;  3HZL A;  3IWA A;  4EMJ A;  1FEC A;  3JSK A;  3SQP A;  4Z2U A;  1BGJ A;  3ICT A;  2EQ7 A;  1KF6 A;  4EQX A;  4H2P A;  2ZZ0 A;  1IUW A;  4A99 A;  2YM2 A;  2GF3 A;  1O94 A;  3CMM A;  2ACZ A;  2Z5Y A;  3UTH A;  4GUV A;  1GRB A;  3BNU A;  1TDK A;  5KOX A;  1LVL A;  2PYX A;  3DGZ A;  3CND A;  4NTD A;  1GRH A;  1GRF A;  2R45 A;  3AXB A;  5EBK A;  4AP3 A;  1ZK7 A;  2Q0L A;  3NLC A;  4NZH A;  3ICS A;  2BCG G;  1Y56 A;  2WBA A;  1NHS A;  2YR5 A;  1Q9I A;  4G6G A;  1H84 A;  4APN A;  3DJG X;  3DGH A;  5CKU A;  5BRT A;  2Z5X A;  4U8I A;  4X9M A;  2VVL A;  3Q6J A;  1LV0 A;  1CBO A;  1DOE A;  1LQU A;  3BI2 A;  5EOW A;  4EIP A;  2R0P A;  4YXD A;  4GR1 A;  1XHC A;  2XFQ A;  3T2Z A;  3KPK A;  3NHO X;  3RED A;  2Q6U A;  2WPC A;  2XVI A;  5KVI A;  1EL7 A;  1V59 A;  2QAE A;  2V6O A;  2WEU A;  4CBQ A;  2RGJ A;  2R46 A;  4IVM B;  3SGL A;  3CNS A;  3PO7 A;  3COX A;  3M13 A;  1LPF A;  1D4E A;  3SZW A;  5JCL A;  1K4Q A;  2XLU A;  3UKK A;  2Y6R A;  3BNM A;  3ALJ A;  4U8K A;  5FMH A;  1DOC A;  2WOW A;  1D7L A;  2C72 A;  1IUT A;  3PS9 A;  2WS3 A;  4KX6 A;  1ELI A;  3D8X A;  3KA7 A;  4J33 A;  4UDP A;  1FCD A;  4Z2R A;  4G6H A;  1GT8 A;  1H6V A;  5EB5 A;  5HYM A;  2ZBW A;  4C74 A;  3FIM B;  3ABV A;  3LJP A;  1B8S A;  4TM3 A;  2CUL A;  3HYW A;  5JCM A;  3C96 A;  2BAB A;  2FJE A;  3DK8 A;  2WET A;  1RP0 A;  5BVA A;  2XVF A;  4K2X A;  5BUL A;  2YG5 A;  1M64 A;  3UP4 A;  2YLW A;  4C3X A;  3GYI A;  3LZW A;  1OJ9 A;  4H4Q A;  2YLZ A;  1QJD A;  4FK1 C;  2C3D A;  2VOU A;  2VQ7 A;  1L9C A;  2GVC A;  4I58 A;  3DJE A;  3FBS A;  3P4P A;  5C3J A;  1PBB A;  4U8L A;  3CPI G;  1IUX A;  1F3P A;  1GAL A;  3KPF A;  5HHF A;  3SZF A;  2ZZB A;  1GND A;  4H4X A;  1GEU A;  4JY3 A;  4CRT A;  4OPL A;  4TM4 A;  1PBF A;  5KMQ A;  2XLR A;  4HB9 A;  4LA1 A;  4K5R A;  4RG4 A;  4JNQ A;  2WU2 A;  2XLT A;  3M0O A;  5BUK A;  4GF7 A;  4PAA A;  3G5S A;  4P9S A;  4U8O A;  4U8P A;  2R9Z A;  5U1O A;  3AYL A;  1GXF A;  1ZY8 A;  1DJQ A;  1NAA A;  1UKV G;  1EBD A;  2UZZ A;  2JB3 A;  3ATQ A;  3RP6 A;  1EL8 A;  3DME A;  3NRN A;  4GDE A;  3IF9 A;  4YT0 A;  1E1L A;  2C3C A;  3UCL A;  3BI4 A;  2I0Z A;  2RGO A;  3GDP A;  1REO A;  3K30 A;  4U2S A;  1GRE A;  1E1K A;  4M52 A;  3SZC A;  4ZN0 A;  2BK5 A;  4BJY A;  3AD9 B;  4D04 A;  2WP6 A;  1ZDL A;  3GYJ A;  2RGH A;  3AE8 A;  4YSZ A;  1BZL A;  1PS9 A;  2XVE A;  1KDG A;  3B3R A;  3GMC A;  4DNA A;  2WPF A;  2EQ9 A;  4U2T A;  1D7Y A;  1EL9 A;  1RSG A;  2C4C A;  4UDR A;  2JKC A;  3UOY A;  4A7A A;  2V61 A;  4LU6 A;  4X9N A;  4B69 A;  1K0L A;  3FPZ A;  4WX1 A;  3EAN A;  4D03 A;  3OC4 A;  3GWD A;  4NTE A;  4HA6 A;  2BS4 A;  4YSY A;  2GV8 A;  2BA9 A;  2GQW A;  3ADA B;  4YWO A;  5KWF A;  2BRA A;  2HQM A;  4H50 A;  4B63 A;  3HYX A;  3QSE A;  2BXR A;  1RYI A;  4MJW A;  3NK1 X;  4H4W A;  2H88 A;  1S3E A;  2GMH A;  2APG A;  2E4G A;  4EQS A;  3AD8 B;  4K8D A;  4Z43 A;  4H7U A;  2DKI A;  4DSH A;  2CFY A;  3AEG A;  2VRM A;  3UTF A;  1NEK A;  1ZOV A;  1HYU A;  4TM0 A;  3GRS A;  3GWF A;  3ZDN A;  1E39 A;  4X4J A;  3NT6 A;  2IVD A;  3SYI A;  3CNP A;  4J31 A;  5IQ1 A;  5CQF A;  2C70 A;  2XFO A;  1FOH A;  3CN8 A;  3GSI A;  4FDC B;  4CCQ A;  2GEW A;  2VVL G;  2BK4 A;  1JOA A;  1JU2 A;  2O9Z A;  3AE9 A;  5TR3 A;  3ISH A;  2NVK X;  2IID A;  3ALM A;  3BI5 A;  3UOZ A;  5J60 A;  3H4K A;  1D4D A;  2VVM A;  1H81 A;  3QVR A;  2GR2 A;  3QSS A;  4OPT A;  2XFP A;  3AD7 B;  1S3B A;  1GSN A;  4H4Z A;  1CJ3 A;  4JDR A;  1TDE A;  2Q7V A;  3NNE A;  1YQZ A;  2H89 A;  3NK2 X;  4GAP A;  2GRT A;  4EMW A;  4O5U A;  2R4J A;  5FS7 A;  2X3N A;  3QJ4 A;  2AAQ A;  4YTM A;  1COY A;  2BYB A;  4N9X A;  2YG6 A;  3ATR A;  3WE0 A;  1TDF A;  3K7T A;  4Y4M A;  3CPH G;  1P2H A;  4JN9 A;  4OVI A;  1IUS A;  1YY5 A;  3PVC A;  4JY2 A;  2OAL A;  4UP3 A;  1CF3 A;  1DJN A;  4O5Q A;  3QFA A;  2YVF A;  4UDQ A;  2WQY A;  1PHH A;  2BXS A;  4ZCD A;  3UKL A;  1DXL A;  3VRB A;  4K7Z A;  4H4V A;  4GDP A;  2YLX A;  3Q9T A;  3L8K A;  1ZMC A;  3C4A A;  2C66 A;  4NTC A;  2J3N A;  2WHD A;  1O95 A;  3VRD B;  3DH9 A;  3OZ2 A;  1IJH A;  2EQ6 A;  4KPR A;  4U8J A;  1NDA A;  3NTD A;  5J7X A;  3CNJ A;  3AEE A;  2C76 A;  1GRA A;  3H8I A;  2JAE A;  3NN6 X;  4XWZ A;  3SX6 A;  4BK1 A;  4CCR A;  3B6D A;  1E7P A;  1NG4 A;  1M6I A;  4DSG A;  3UKQ A;  3NYC A;  2JBV A;  3AEA A;  1ZKQ A;  3AE6 A;  4C77 A;  4H2Q A;  2GB0 A;  4H2R A;  2YVJ A;  3AYJ A;  1PJ7 A;  1NEN A;  1VDC A;  3AB1 A;  4II3 A;  4BV6 A;  3EAO A;  1OJA A;  1BWC A;  1CJ2 A;  3QFB A;  2TPR A;  3GD3 A;  2X8G A;  3M12 A;  2AR8 A;  4LII A;  1PN0 A;  1VG9 A;  5FS8 A;  2YG4 A;  1QLB A;  3S61 A;  2VZ2 A;  1W4X A;  1EL5 A;  2RAB A;  1KFY A;  1B4V A;  4TM1 A;  2XCG A;  1H82 A;  5U63 A;  3CGB A;  4YSX A;  3KVE A;  4CNK A;  3RP8 A;  2EQ8 A;  2OA1 A;  4C5O A;  3G5Q A;  2NPX A;  5GSN A;  3VQR A;  1D5T A;  1TDN A;  3DJJ A;  3UP5 A;  2GQF A;  1OJC A;  3NIX A;  3NKS A;  4GCM A;  1Y56 B;  3ITJ A;  2FJD A;  1O5W A;  1PJ6 A;  3NK0 X;  3CGE A;  3V3O A;  2FBW A;  1NHQ A;  2WU5 A;  4TLX A;  1E1M A;  1XAN A;  5IQ4 A;  4GAV A;  3DK4 A;  4ECH A;  1H7W A;  1IUU A;  5KRQ A;  4IV9 A;  2XFN A;  3C4N A;  4WCT A;  5M0Z A;  2WDV A;  4H4S A;  1VG0 A;  3NYE A;  1P2E A;  3UKA A;  4RSL A;  1H86 A;  4ZCC A;  3H8L A;  2X8C A;  2BC1 A;  2W0H A;  3I3L A;  5LV9 A;  1CC4 A;  5KVH A;  1JNR A;  3AE1 A;  1E6E A;  1MXT A;  2BC0 A;  1CC6 A;  2OAM A;  1N1P A;  2OLO A;  5C2T A;  4FK1 A;  2GR0 A;  4G73 A;  4OPI A;  4U8N A;  4YKF A;  3AYI A;  3P1W A;  3AE7 A;  3ALL A;  1ZX9 A;  1N4V A;  1K0I A;  4TLZ A;  4AT2 A;  3T0K A;  1GTH A;  2R0G A;  1N4W A;  5FS6 A;  3D1C A;  3EF6 A;  1LJ1 A;  3NN0 X;  2BK3 A;  5EB4 A;  4A9W A;  4U2L A;  4YTP A;  2XVH A;  3F8P A;  5GRT A;  1Q1W A;  1Z6L A;  3FG2 P;  2C65 A;  2V5Z A;  1CJ4 A;  4REK A;  2B7S A;  2WPE A;  2V60 A;  4II2 A;  2YG7 A;  3IHG A;  3NG7 X;  2YAU A;  2WOV A;  1ZMD A;  2WDR A;  4A6N A;  4OPG A;  2Q0K A;  2GMJ A;  2B9W A;  1VQW A;  3AEB A;  2BS2 A;  3NH3 X;  2VRL A;  2C67 A;  1BKW A;  1E1N A;  4Z26 A;  3AE5 A;  4H4Y A;  3VR8 A;  1X31 B;  5KMS A;  1BGN A;  1JEH A;  2YM1 A;  2QA1 A;  4K22 A;  4B68 A;  3K7M X;  3RNM A;  2XDO A;  2B7R A;  3GD4 A;  3K7Q X;  4J2W A;  2QCU A;  3S5W A;  4K5S A;  4G74 A;  4Z44 A;  3R9U A;  4Z25 A;  4RG3 A;  4EMI A;  2R4E A;  2JB2 A;  1LTX R;  4NWZ A;  4A5L A;  1D4C A;  2CDU A;  2YLT A;  4J56 A;  4OPU A;  2YLS A;  5DBJ A;  1GET A;  5KMP A;  3HYV A;  2YR6 A;  1GRG A;  3EPT A;  5KOW A;  4ICY A;  2X8H A;  1QO8 A;  3LAD A;  5HY5 A;  3NGC X;  1TDO A;  2BCP A;  4OCG A;  1GTE A;  5FS9 A;  1GPE A;  4EM3 A;  4EQR A;  1L0V A;  1TRB A;  5IPY A;  1OJD A; 
#chains in the Genus database with same CATH homology
 4AP1 A;  2ARD A;  2E5V A;  2FJB A;  3GDN A;  4YTN A;  1F8S A;  3IHM A;  3UOX A;  5ER0 A;  3GMB A;  4NEW A;  3LOV A;  3ZYX A;  3BHK A;  3CTY A;  1N4U A;  1Y0P A;  3CNT A;  2A89 A;  1VRQ B;  3NYF A;  2VQB A;  2YLR A;  3UKH A;  4B65 A;  2YG3 A;  1DOD A;  4Z2T A;  3AEC A;  3CGD A;  2XVJ A;  4IA6 A;  2ZZC A;  2PHH A;  3F8R A;  3II4 A;  3NTA A;  5HXI A;  4IA5 A;  1PXA A;  3KKJ A;  2E1M A;  1L9D A;  4CNJ A;  1FEB A;  1B37 A;  4XXG A;  1S2Q A;  1DNC A;  1OJT A;  2A87 A;  3AEF A;  3CIR A;  3F8D A;  4G9K A;  3T37 A;  4YKG A;  1H7X A;  3I6D A;  2XFU A;  1AOG A;  4EIQ A;  3P4Q A;  1YQ3 A;  4USQ A;  4J57 A;  2OLN A;  4FX9 A;  2XLS A;  2XYO A;  4B66 A;  1DOB A;  1SEZ A;  4J36 A;  3P9U A;  4Z24 A;  3UKF A;  2GR1 A;  3AE4 A;  1PXB A;  2GAH B;  1MO9 A;  2YVG A;  4NEV A;  4BK3 A;  4USR A;  3BHF A;  4Y4L A;  3UOV A;  3E1T A;  4JQ9 A;  2XLP A;  2JK6 A;  4A65 A;  1NPX A;  2A8X A;  3FMW A;  1ZOY A;  3RP7 A;  3RHA A;  4OPC A;  1PBE A;  4GRT A;  2YQU A;  4AOS A;  1GRT A;  3QVP A;  2V3B A;  1KSS A;  4A6N B;  1JRY A;  1ZP0 A;  3IC9 A;  1GOS A;  3SFD A;  2C7G A;  3DJD A;  5JCK A;  1CL0 A;  1XPQ A;  4I59 A;  2YR4 A;  1Q1R A;  3KU9 A;  3P4R A;  1CHU A;  2V3A A;  4H4R A;  1F8W A;  4CY8 A;  4BUR A;  1JNZ A;  3KD9 A;  4BK2 A;  2BS3 A;  5JCI A;  2X99 A;  1MOK A;  1PBC A;  3URH A;  4B1B A;  3LZX A;  1PXC A;  2WDQ A;  1GES A;  1XDI A;  4IVO B;  4NNJ A;  4EQW A;  3O0H A;  2C75 A;  3SM8 A;  2WP5 A;  3SXI A;  1F8R A;  5KXJ A;  3DA1 A;  1GER A;  1LQT A;  2IVE A;  2AQJ A;  4B67 A;  3UTG A;  5M10 A;  3T14 A;  3P4S A;  3GYX A;  4AT0 A;  2B9X A;  1H83 A;  3VR9 A;  4YSH A;  3SZ0 A;  2TMD A;  4A79 A;  4XWR A;  1S2Y A;  1PDH A;  2BAC A;  1GV4 A;  3T31 A;  5KMR A;  2WOI A;  3AE3 A;  1NHR A;  4BJZ A;  4AOX A;  4OPD A;  1NG3 A;  2WP9 A;  3V3N A;  5L46 A;  1CC2 A;  4DGK A;  1TYP A;  3LXD A;  3VRA A;  1PBD A;  1K0J A;  3T2Y A;  1FL2 A;  2F5Z A;  1KSU A;  4J34 A;  1KNP A;  3KLJ A;  2GR3 A;  1CJC A;  3L1R A;  2C73 A;  3AE2 A;  1FEA A;  2Y6Q A;  1F6M A;  2GH5 A;  2DKH A;  3SY4 A;  2FJA A;  2JB1 A;  3SFE A;  3LB8 A;  4H4U A;  2R0C A;  3ICR A;  3G5R A;  4C3Y A;  1BF3 A;  2YWL A;  4U8M A;  4H4T A;  4B64 A;  3V76 A;  1JRX A;  2X50 A;  4Y4N A;  3CPJ G;  2CVJ A;  3CGC A;  2BRY A;  1B5Q A;  1ONF A;  1IUV A;  1YQ4 A;  1TYT A;  3AWI A;  4JNA A;  1PJ5 A;  4PAB A;  2B9Y A;  4H2N A;  1KNR A;  3T2K A;  2GAG B;  3AED A;  3QSM A;  3DK9 A;  4H4P A;  3UKP A;  5KNL A;  1L9E A;  1JRZ A;  2B76 A;  4EM4 A;  1NHP A;  2QA2 A;  2WES A;  4E0V A;  4ADW A;  3UTE A;  5U25 A;  4CY6 A;  2C64 A;  1YKJ A;  3GRT A;  5JCN A;  3HZL A;  3IWA A;  4EMJ A;  1FEC A;  3JSK A;  3SQP A;  4Z2U A;  1BGJ A;  3ICT A;  2EQ7 A;  1KF6 A;  4EQX A;  4H2P A;  2ZZ0 A;  1IUW A;  4A99 A;  2YM2 A;  2GF3 A;  1O94 A;  3CMM A;  2ACZ A;  2Z5Y A;  3UTH A;  4GUV A;  1GRB A;  3BNU A;  1TDK A;  5KOX A;  1LVL A;  2PYX A;  3DGZ A;  3CND A;  4NTD A;  1GRH A;  1GRF A;  2R45 A;  3AXB A;  5EBK A;  4AP3 A;  1ZK7 A;  2Q0L A;  3NLC A;  4NZH A;  3ICS A;  2BCG G;  1Y56 A;  2WBA A;  1NHS A;  2YR5 A;  1Q9I A;  4G6G A;  1H84 A;  4APN A;  3DJG X;  3DGH A;  5CKU A;  5BRT A;  2Z5X A;  4U8I A;  4X9M A;  2VVL A;  3Q6J A;  1LV0 A;  1CBO A;  1DOE A;  1LQU A;  3BI2 A;  5EOW A;  4EIP A;  2R0P A;  4YXD A;  4GR1 A;  1XHC A;  2XFQ A;  3T2Z A;  3KPK A;  3NHO X;  3RED A;  2Q6U A;  2WPC A;  2XVI A;  5KVI A;  1EL7 A;  1V59 A;  2QAE A;  2V6O A;  2WEU A;  4CBQ A;  2RGJ A;  2R46 A;  4IVM B;  3SGL A;  3CNS A;  3PO7 A;  3COX A;  3M13 A;  1LPF A;  1D4E A;  3SZW A;  5JCL A;  1K4Q A;  2XLU A;  3UKK A;  2Y6R A;  3BNM A;  3ALJ A;  4U8K A;  5FMH A;  1DOC A;  2WOW A;  1D7L A;  2C72 A;  1IUT A;  3PS9 A;  2WS3 A;  4KX6 A;  1ELI A;  3D8X A;  3KA7 A;  4J33 A;  4UDP A;  1FCD A;  4Z2R A;  4G6H A;  1GT8 A;  1H6V A;  5EB5 A;  5HYM A;  2ZBW A;  4C74 A;  3FIM B;  3ABV A;  3LJP A;  1B8S A;  4TM3 A;  2CUL A;  3HYW A;  5JCM A;  3C96 A;  2BAB A;  2FJE A;  3DK8 A;  2WET A;  1RP0 A;  5BVA A;  2XVF A;  4K2X A;  5BUL A;  2YG5 A;  1M64 A;  3UP4 A;  2YLW A;  4C3X A;  3GYI A;  3LZW A;  1OJ9 A;  4H4Q A;  2YLZ A;  1QJD A;  4FK1 C;  2C3D A;  2VOU A;  2VQ7 A;  1L9C A;  3DJE A;  4I58 A;  3FBS A;  3P4P A;  5C3J A;  1PBB A;  4U8L A;  3CPI G;  1IUX A;  1F3P A;  1GAL A;  3KPF A;  5HHF A;  3SZF A;  2ZZB A;  1GND A;  4H4X A;  1GEU A;  4JY3 A;  4CRT A;  4OPL A;  4TM4 A;  1PBF A;  5KMQ A;  2XLR A;  4HB9 A;  4LA1 A;  4K5R A;  4RG4 A;  4JNQ A;  2WU2 A;  2XLT A;  3M0O A;  5BUK A;  4GF7 A;  4PAA A;  3G5S A;  4P9S A;  4U8O A;  4U8P A;  2R9Z A;  5U1O A;  3AYL A;  1GXF A;  1ZY8 A;  1DJQ A;  1NAA A;  1UKV G;  1EBD A;  2UZZ A;  2JB3 A;  3ATQ A;  3RP6 A;  1EL8 A;  3DME A;  3NRN A;  4GDE A;  3IF9 A;  4YT0 A;  1E1L A;  2C3C A;  3UCL A;  3BI4 A;  2I0Z A;  2RGO A;  3GDP A;  1REO A;  3K30 A;  4U2S A;  1GRE A;  1E1K A;  4M52 A;  3SZC A;  4ZN0 A;  2BK5 A;  4BJY A;  3AD9 B;  4D04 A;  2WP6 A;  1ZDL A;  3GYJ A;  2RGH A;  3AE8 A;  4YSZ A;  1BZL A;  1PS9 A;  2XVE A;  1KDG A;  3B3R A;  3GMC A;  4DNA A;  2WPF A;  2EQ9 A;  4U2T A;  1D7Y A;  1EL9 A;  1RSG A;  2C4C A;  4UDR A;  2JKC A;  3UOY A;  4A7A A;  2V61 A;  4LU6 A;  4X9N A;  4B69 A;  1K0L A;  3FPZ A;  4WX1 A;  3EAN A;  4D03 A;  3OC4 A;  3GWD A;  4NTE A;  4HA6 A;  2BS4 A;  4YSY A;  2GV8 A;  2BA9 A;  2GQW A;  3ADA B;  4YWO A;  5KWF A;  2BRA A;  2HQM A;  4H50 A;  4B63 A;  4CCR A;  3HYX A;  3QSE A;  2BXR A;  1RYI A;  4MJW A;  3NK1 X;  4H4W A;  2H88 A;  1S3E A;  2GMH A;  2APG A;  2E4G A;  4EQS A;  3AD8 B;  4K8D A;  4Z43 A;  4H7U A;  2DKI A;  4DSH A;  2CFY A;  3AEG A;  2VRM A;  3UTF A;  1NEK A;  1ZOV A;  1HYU A;  4TM0 A;  3GRS A;  3GWF A;  3ZDN A;  1E39 A;  4X4J A;  3NT6 A;  2IVD A;  3SYI A;  3CNP A;  4J31 A;  5IQ1 A;  5CQF A;  2C70 A;  2XFO A;  1FOH A;  3CN8 A;  3GSI A;  4FDC B;  4CCQ A;  2GEW A;  2VVL G;  2BK4 A;  1JOA A;  1JU2 A;  2O9Z A;  3AE9 A;  5TR3 A;  3ISH A;  2NVK X;  2IID A;  3ALM A;  3BI5 A;  3UOZ A;  5J60 A;  3H4K A;  1D4D A;  2VVM A;  1H81 A;  3QVR A;  2GR2 A;  3QSS A;  4OPT A;  2XFP A;  3AD7 B;  1S3B A;  1GSN A;  4H4Z A;  1CJ3 A;  4JDR A;  1TDE A;  2Q7V A;  3NNE A;  1YQZ A;  2H89 A;  3NK2 X;  4GAP A;  2GRT A;  4EMW A;  4O5U A;  2R4J A;  5FS7 A;  2X3N A;  3QJ4 A;  2AAQ A;  4YTM A;  1COY A;  2BYB A;  4N9X A;  2YG6 A;  3ATR A;  1TDF A;  3K7T A;  4Y4M A;  3WE0 A;  3CPH G;  1P2H A;  4JN9 A;  4OVI A;  1IUS A;  1YY5 A;  3PVC A;  4JY2 A;  2OAL A;  4UP3 A;  1CF3 A;  1DJN A;  4O5Q A;  3QFA A;  2YVF A;  4UDQ A;  2WQY A;  1PHH A;  2BXS A;  4ZCD A;  3UKL A;  1DXL A;  3VRB A;  4K7Z A;  4H4V A;  4GDP A;  2YLX A;  3Q9T A;  3L8K A;  1ZMC A;  3C4A A;  2C66 A;  4NTC A;  2J3N A;  2WHD A;  1O95 A;  3VRD B;  3DH9 A;  3OZ2 A;  1IJH A;  2EQ6 A;  4KPR A;  4U8J A;  1NDA A;  3NTD A;  5J7X A;  3CNJ A;  3AEE A;  2C76 A;  1GRA A;  1OJD A;  2JAE A;  3H8I A;  3NN6 X;  4XWZ A;  3SX6 A;  4BK1 A;  3B6D A;  1E7P A;  1NG4 A;  1M6I A;  4DSG A;  3UKQ A;  3NYC A;  2JBV A;  3AEA A;  1ZKQ A;  3AE6 A;  4C77 A;  4H2Q A;  2GB0 A;  4H2R A;  2YVJ A;  3AYJ A;  1PJ7 A;  1NEN A;  1VDC A;  3AB1 A;  4II3 A;  4BV6 A;  3EAO A;  1OJA A;  1BWC A;  1CJ2 A;  3QFB A;  2TPR A;  3GD3 A;  2X8G A;  3M12 A;  2AR8 A;  4LII A;  1PN0 A;  1VG9 A;  5FS8 A;  2YG4 A;  1QLB A;  3S61 A;  2VZ2 A;  1W4X A;  1EL5 A;  2RAB A;  1KFY A;  1B4V A;  4TM1 A;  2XCG A;  1H82 A;  5U63 A;  3CGB A;  4YSX A;  3KVE A;  4CNK A;  3RP8 A;  2EQ8 A;  2OA1 A;  4C5O A;  3G5Q A;  2NPX A;  5GSN A;  3VQR A;  1D5T A;  1TDN A;  3DJJ A;  3UP5 A;  2GQF A;  1OJC A;  3NIX A;  3NKS A;  4GCM A;  1Y56 B;  3ITJ A;  2FJD A;  1O5W A;  1PJ6 A;  3NK0 X;  3CGE A;  3V3O A;  2FBW A;  1NHQ A;  2WU5 A;  4TLX A;  1E1M A;  1XAN A;  5IQ4 A;  4GAV A;  3DK4 A;  4ECH A;  1H7W A;  1IUU A;  5KRQ A;  4IV9 A;  2XFN A;  3C4N A;  4WCT A;  5M0Z A;  2WDV A;  4H4S A;  1VG0 A;  3NYE A;  1P2E A;  3UKA A;  4RSL A;  1H86 A;  4ZCC A;  3H8L A;  2X8C A;  2BC1 A;  2W0H A;  3I3L A;  5LV9 A;  1CC4 A;  5KVH A;  1JNR A;  3AE1 A;  1E6E A;  1MXT A;  2BC0 A;  1CC6 A;  2OAM A;  1N1P A;  2OLO A;  5C2T A;  4FK1 A;  2GR0 A;  4G73 A;  4OPI A;  4U8N A;  4YKF A;  3AYI A;  3P1W A;  3AE7 A;  3ALL A;  1ZX9 A;  1N4V A;  1K0I A;  4TLZ A;  4AT2 A;  3T0K A;  1GTH A;  2R0G A;  1N4W A;  5FS6 A;  3D1C A;  3EF6 A;  1LJ1 A;  3NN0 X;  2BK3 A;  5EB4 A;  4A9W A;  4U2L A;  4YTP A;  2XVH A;  3F8P A;  5GRT A;  1Q1W A;  1Z6L A;  3FG2 P;  2C65 A;  2V5Z A;  1CJ4 A;  4REK A;  2B7S A;  2WPE A;  2V60 A;  4II2 A;  2YG7 A;  3IHG A;  3NG7 X;  2YAU A;  2WOV A;  1ZMD A;  2WDR A;  4A6N A;  4OPG A;  2Q0K A;  2GMJ A;  2B9W A;  1VQW A;  3AEB A;  2BS2 A;  3NH3 X;  2VRL A;  2C67 A;  1BKW A;  1E1N A;  4Z26 A;  3AE5 A;  4H4Y A;  3VR8 A;  1X31 B;  5KMS A;  1BGN A;  1JEH A;  2YM1 A;  2QA1 A;  4K22 A;  4B68 A;  3K7M X;  3RNM A;  2XDO A;  2B7R A;  3GD4 A;  3K7Q X;  4J2W A;  2QCU A;  3S5W A;  4K5S A;  4G74 A;  4Z44 A;  3R9U A;  4Z25 A;  4RG3 A;  4EMI A;  2R4E A;  2JB2 A;  1LTX R;  4NWZ A;  4A5L A;  1D4C A;  2CDU A;  2YLT A;  4J56 A;  4OPU A;  2YLS A;  5DBJ A;  1GET A;  5KMP A;  3HYV A;  2YR6 A;  1GRG A;  3EPT A;  5KOW A;  4ICY A;  2X8H A;  1QO8 A;  3LAD A;  5HY5 A;  3NGC X;  1TDO A;  2BCP A;  4OCG A;  1GTE A;  5FS9 A;  1GPE A;  4EM3 A;  4EQR A;  1L0V A;  1TRB A;  5IPY A;  2GVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...