3P1WA

Crystal structure of rab gdi from plasmodium falciparum, pfl2060c
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
444
structure length
442
Chain Sequence
QGEHYDVIILGTGLKECILSGLLSHYGKKILVLDRNPYYGGETASLNLTNLYNTFKPKENIPSKYGENRHWNVDLIPKFILVGGNLVKILKKTRVTNYLEWLVVEGSYVYQHQKKGFLTSEKFIHKVPATDMEALVSPLLSLMEKNRCKNFYQYVSEWDANKRNTWDNLDPYKLTMLEIYKHFNLCQLTIDFLGHAVALYLNDDYLKQPAYLTLERIKLYMQSISAFGKSPFIYPLYGLGGIPEGFSRMCAINTFMLNKNVVDFVFDDDNKVCGIKSSDGEIAYCDKVICDPSYVMHLKNKIKKIGQVIRCICILSNPIPETNQTNSCQIIIPQNQLNRKSDIYINLVSFQHGVTLKGKYIAIVSATVETNNPIKEIEKPLELLGTIEEKFVKISDLYVSTSKKPADNIFVTSSYDATSHFETATNDLLQIWENLWGQKLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RabGDI protein
publication title Crystal Structure of RAB GDI from Plasmodium Falciparum, PFL2060c
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein transport
total genus 138
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2010-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3p1wA03
3.30.519.10 Alpha Beta 2-Layer Sandwich Guanine Nucleotide Dissociation Inhibitor; domain 2 Guanine Nucleotide Dissociation Inhibitor, domain 2 3p1wA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3p1wA01
3I3LA 3AYLA 3P1WA 3NTAA 2YLSA 4H4UA 3NK0X 3CGEA 1NEKA 5BRTA 1ZX9A 2X3NA 4ZCCA 3BI5A 1GT8A 3OC4A 4H4WA 1VDCA 1ELIA 2C73A 4J33A 4OPDA 3LADA 2WPEA 4NTDA 1E1LA 1NHRA 2WQYA 3QVPA 4AP3A 1QJDA 3K7MX 4RG4A 1BZLA 5KWFA 3B6DA 4H2NA 3G5SA 4J2WA 2WBAA 2YM2A 2YR6A 3AEDA 3NLCA 1H86A 3V3OA 2BXSA 2BC0A 4Z26A 3UP4A 1L9EA 3ATRA 1GRAA 2OAMA 3M0OA 4PABA 4B63A 2XLTA 2DKIA 3EAOA 2C65A 4U8MA 1OJ9A 2EQ7A 1KF6A 2GAHB 5JCIA 1IUTA 4I59A 1CC6A 1H7XA 2XVHA 1EL9A 3DJDA 3QSMA 3G5QA 3ALLA 2WP9A 2ZZ0A 3QFAA 4CY8A 4Z2RA 1D7YA 1D7LA 4E0VA 2Z5YA 4GCMA 2X8HA 2JB2A 4CNJA 2B76A 2WDVA 3RP7A 3H8LA 1MOKA 5C3JA 3M12A 1IUXA 1IUVA 2TMDA 5BUKA 4CCQA 3IC9A 4Z43A 3CNTA 1BWCA 3CNJA 2X50A 1NHQA 3QFBA 3FBSA 2FJBA 1K0JA 1PBBA 4Z25A 3QSEA 4YSHA 3NK2X 3S61A 3NYCA 4Z2UA 2VRLA 3DJEA 1B4VA 1E7PA 1VRQB 3VR9A 1LPFA 4UDQA 4WX1A 5J7XA 3UKHA 5IQ1A 3LOVA 3REDA 4Z44A 2RGOA 1H81A 3CNSA 1RSGA 2YVGA 4D04A 2OALA 3AD7B 1ZKQA 1L9DA 3D8XA 4WCTA 1FEAA 3LJPA 4JN9A 1BKWA 2GMHA 2B9WA 1TDFA 3NHOX 3KD9A 1RYIA 4LA1A 3ALJA 3FPZA 3CGDA 3NN0X 3CNDA 3DK8A 4I58A 4X9MA 2C67A 3P4RA 4RG3A 5JCNA 4USRA 5FS9A 4H50A 2O9ZA 4ECHA 1JNRA 3AECA 3PVCA 5BULA 1LVLA 4A5LA 2AQJA 2EQ8A 1O95A 3CN8A 3SGLA 4EQWA 3AE8A 5KOXA 3C96A 4X9NA 3AE5A 1W4XA 1TYPA 3BNMA 3S5WA 2OA1A 2B7SA 3RNMA 1NDAA 4C77A 1YKJA 3AE2A 1PS9A 1DJQA 4PAAA 3KA7A 1S3EA 2WOWA 2WP5A 1DOBA 3KKJA 2FBWA 1DNCA 1EL7A 1NG4A 4TM1A 4N9XA 3CIRA 3UKQA 1YQ3A 2R4JA 3NK1X 5U63A 2GVCA 3DK4A 4LU6A 2YVJA 5L46A 1KDGA 3BHKA 3SFDA 2FJAA 2WHDA 4YSYA 2YAUA 2YM1A 5JCKA 1E1NA 3UCLA 1FOHA 3ALMA 1Z6LA 4GR1A 1S2QA 1VG0A 4YWOA 2IVDA 4BK2A 1FECA 1DODA 1KSUA 4YT0A 1TDOA 3GDNA 4NZHA 1JNZA 5HY5A 1LQTA 3ICTA 5FS6A 1FCDA 4O5UA 2VQBA 1K0IA 1M6IA 2GQWA 4YTMA 2GEWA 1TYTA 2BC1A 2PHHA 2WU5A 3D1CA 2C66A 3UKFA 4YTPA 4C5OA 4YTNA 2RGJA 1XANA 1Q1RA 3DK9A 2XFNA 3CPJG 5FMHA 3SFEA 2YQUA 1PBDA 4BK1A 2J3NA 3L8KA 1MXTA 2IVEA 4KPRA 1H83A 1DOCA 1GESA 2FJDA 1UKVG 3BHFA 3FMWA 2C64A 3CGBA 2XFQA 2WESA 4D03A 5U25A 2A87A 4H7UA 2W0HA 3QSSA 1H7WA 4J56A 2BXRA 5EBKA 3SM8A 3T37A 2GQFA 3GD3A 1COYA 1E6EA 1Y56B 1PXAA 1S3BA 1ZMDA 4CY6A 2XLPA 2Z5XA 4YXDA 1OJTA 2RABA 5IPYA 3AE4A 4H4ZA 3VRBA 1GETA 4AT0A 1N4VA 2C7GA 2JAEA 3ABVA 1CHUA 3AYIA 3HZLA 5KVIA 4B64A 1N1PA 1REOA 2BACA 4ICYA 4Y4MA 2HQMA 1GREA 2C72A 2YG5A 2A8XA 2GAGB 2R4EA 2XYOA 2EQ6A 1NHPA 4EM3A 2YLXA 3EF6A 1GRHA 3AYJA 4U8JA 2BS3A 2Y6QA 2JB3A 3GRTA 3KPFA 3NYEA 2BA9A 4U8LA 3NIXA 3URHA 1O94A 3KLJA 4GDPA 4OCGA 3VRDB 3FG2P 5EOWA 1H6VA 1E1MA 3H8IA 4OPCA 4JQ9A 3RHAA 3ZDNA 3AEFA 2XVJA 1FL2A 3DJGX 3KU9A 5FS7A 3AE6A 4K7ZA 4OPTA 4YKFA 4B1BA 1Y56A 1VQWA 2WPFA 1CJ3A 2WP6A 4JY2A 4B66A 4FDCB 4ADWA 3E1TA 4H4QA 4H2QA 2XDOA 1CF3A 1GTEA 3C4NA 4YKGA 1DXLA 4LIIA 1FEBA 4K5SA 4H4VA 1Q9IA 4J31A 2GR0A 1BGNA 1M64A 4IV9A 3K7TA 4A7AA 4M52A 1TDEA 3AEAA 1ZOYA 2GH5A 1SEZA 2X8CA 2R0GA 5HHFA 4P9SA 4IA6A 1XHCA 1YY5A 1XDIA 2NVKX 2X8GA 2OLNA 4TLXA 3NT6A 1EL5A 3G5RA 3P4QA 3PO7A 2A89A 1B37A 4EM4A 1GXFA 2BABA 4CCRA 1ZMCA 1K0LA 3BNUA 2C75A 2Y6RA 1GRTA 3B3RA 3AE7A 2R46A 1EBDA 4HB9A 4Y4LA 2XLUA 3P9UA 4A6NB 1F8WA 2XLSA 4U8OA 1RP0A 1JEHA 4DNAA 3UOVA 4EMIA 3K30A 4GUVA 2GR2A 3EPTA 5DBJA 3NYFA 2XCGA 3NG7X 4O5QA 2H88A 1F3PA 2WOVA 2ACZA 3Q6JA 1ZK7A 2ZZCA 5GSNA 1EL8A 1PBCA 2B9YA 2GR3A 3AEEA 4K8DA 1GV4A 2BK3A 4U8PA 4H4XA 1GERA 4H4TA 2JBVA 1PXCA 1ONFA 4UDRA 4AOXA 2QCUA 4NEVA 4BJZA 3DA1A 2XVFA 3AEBA 2CULA 5LV9A 2BYBA 3ITJA 5EB4A 2Q6UA 2NPXA 4OPUA 4Y4NA 3NN6X 2GRTA 3AEGA 1D4EA 4TM4A 2OLOA 4FK1C 5M10A 1X31B 4Z2TA 1ZOVA 4NTEA 2Q7VA 4A99A 3GMCA 1B5QA 5C2TA 1MO9A 3AXBA 1GRGA 3GYJA 4YSXA 2WU2A 3UTEA 2QA1A 2R0CA 1KNRA 3UOXA 3DGZA 3L1RA 1F6MA 4UP3A 3IHGA 1NAAA 1NPXA 2B9XA 2XLRA 4U2LA 2DKHA 2VRMA 2VVMA 4ZN0A 5HYMA 2IIDA 3NGCX 2XFPA 1L9CA 3AE9A 4K2XA 3CTYA 2YLRA 1F8RA 3LZWA 2E1MA 4U8NA 3BI4A 2TPRA 1JRXA 3F8PA 1JU2A 4K5RA 3VQRA 1DOEA 2GMJA 2V3AA 4B65A 2YG7A 2EQ9A 3NTDA 3NKSA 2BK5A 1TRBA 3V3NA 1CC2A 3II4A 1YQ4A 3RP6A 4H4SA 3GDPA 1CL0A 1QLBA 1CJ2A 2BS4A 3AD9B 5BVAA 3OZ2A 5JCMA 4IVMB 3V76A 1D4CA 3VR8A 4JNQA 1ZDLA 5EB5A 3O0HA 2WETA 3WE0A 2BS2A 4U8IA 2CFYA 2BK4A 1S2YA 1KNPA 2E4GA 2WPCA 3F8DA 2JKCA 1PBFA 1E1KA 1PXBA 2WS3A 5FS8A 4H4RA 4BK3A 4GRTA 4CRTA 1IUWA 1Y0PA 1B8SA 4K22A 2JB1A 4C3XA 2BCPA 2R9ZA 3UTHA 3ICSA 2R0PA 1OJCA 4H4YA 3UOYA 2YG3A 1PHHA 4H2PA 1N4WA 2YR5A 2QA2A 1H82A 1N4UA 4UDPA 1LJ1A 2QAEA 1D5TA 1PJ7A 2AR8A 3IWAA 3LZXA 2V60A 2C3CA 2BCGG 2ARDA 3BI2A 4U2TA 4C3YA 4FK1A 1HYUA 3FIMB 4MJWA 4GDEA 4AT2A 2XFOA 5KXJA 4OPGA 2FJEA 4RSLA 1JRYA 1BF3A 2R45A 1D4DA 4CNKA 4DSGA 5HXIA 1GRFA 3UTGA 2VOUA 2V6OA 4OPLA 4EQRA 4U2SA 1GNDA 3GSIA 4A9WA 2PYXA 3ICRA 4OPIA 2YG6A 3AWIA 1IJHA 3COXA 1XPQA 3EANA 1QO8A 2GV8A 2YLTA 1ZP0A 2GB0A 2Q0LA 1GALA 4TLZA 4Z24A 1CBOA 2F5ZA 2JK6A 3DJJA 4IVOB 3KVEA 4J34A 1P2EA 3GD4A 3IF9A 1NENA 3NNEA 3GWDA 5KRQA 1CJCA 1F8SA 3CPHG 3P4SA 2WDQA 2CVJA 4HA6A 3DH9A 5U1OA 3UKLA 3UP5A 3AE3A 3DGHA 3ISHA 2APGA 2CDUA 3NRNA 4NEWA 5CKUA 4EIPA 3LXDA 4EIQA 2V3BA 2XVIA 3AD8B 3CGCA 2Q0KA 3GYIA 3P4PA 1GTHA 4AOSA 1TDNA 1IUUA 1CC4A 4J36A 1LQUA 3UTFA 2H89A 4EQXA 1VG9A 2YG4A 1K4QA 3AE1A 4XXGA 1OJDA 2ZZBA 1OJAA 4EMWA 4ZCDA 3K7QX 2YWLA 2WDRA 4XWRA 3JSKA 4BJYA 4REKA 2ZBWA 5TR3A 2GR1A 1LTXR 3RP8A 4B67A 2WEUA 4KX6A 3CPIG 4X4JA 1V59A 2I0ZA 2XVEA 3M13A 1PJ6A 3H4KA 3ADAB 1DJNA 2C76A 4NTCA 4H2RA 5KVHA 1KSSA 3LB8A 3ZYXA 3GMBA 2C70A 4C74A 4A79A 4B68A 1KFYA 2YLZA 4A6NA 1GSNA 2V61A 5M0ZA 3IHMA 4IA5A 1NHSA 1IUSA 3UKPA 1BGJA 3VRAA 4DGKA 4EMJA 1TDKA 4JNAA 1GRBA 3DMEA 4J57A 3PS9A 1JOAA 4TM3A 4A65A 1PN0A 4CBQA 5KOWA 4BURA 3SQPA 2RGHA 1E39A 2C3DA 4JDRA 3QVRA 1GOSA 2YR4A 3NH3X 5CQFA 1GPEA 1JRZA 4H4PA 4BV6A 1P2HA 4APNA 2AAQA 2YLWA 2V5ZA 1GEUA 4XWZA 2YVFA 3Q9TA 2E5VA 2UZZA 3CNPA 4TM0A 4GF7A 5J60A 3I6DA 4JY3A 3ATQA 4YSZA 3AB1A 3R9UA 1PDHA 4AP1A 1YQZA 3GWFA 3UOZA 1H84A 1ZY8A 2VQ7A 3C4AA 1NG3A 2B7RA 3UKKA 1CJ4A 5ER0A 4OVIA 5JCLA 4U8KA 3QJ4A 1PBEA 2VVLG 5IQ4A 1L0VA 1LV0A 2VZ2A 2WOIA 2VVLA 4USQA 4B69A 2XFUA 4DSHA 1Q1WA 5GRTA 1PJ5A 3F8RA 2GF3A 3UKAA 4EQSA 1AOGA 2X99A 4FX9A 1O5WA 3GRSA
chains in the Genus database with same CATH superfamily
3I3LA 3AYLA 3P1WA 3NTAA 2YLSA 4H4UA 3NK0X 3CGEA 1NEKA 5BRTA 2BRAA 4G6HA 1ZX9A 2X3NA 3CMMA 4ZCCA 3BI5A 1GT8A 3OC4A 4H4WA 1VDCA 1ELIA 2C73A 4J33A 4OPDA 3LADA 2WPEA 4NTDA 1E1LA 1NHRA 2WQYA 3QVPA 4AP3A 1QJDA 3K7MX 4RG4A 1BZLA 5KWFA 3B6DA 4H2NA 3G5SA 4J2WA 2WBAA 2YM2A 2YR6A 3AEDA 3NLCA 1H86A 3V3OA 2BXSA 3SY4A 2BC0A 4Z26A 3UP4A 1L9EA 3ATRA 1GRAA 2OAMA 3M0OA 4PABA 4B63A 2XLTA 2DKIA 3EAOA 2C65A 4U8MA 1OJ9A 2EQ7A 1KF6A 2GAHB 5JCIA 1IUTA 4I59A 1CC6A 1H7XA 2XVHA 1EL9A 3DJDA 3QSMA 3G5QA 3ALLA 2WP9A 2ZZ0A 3QFAA 4CY8A 4Z2RA 1D7YA 1D7LA 4E0VA 2Z5YA 4GCMA 2X8HA 2JB2A 4CNJA 2B76A 2WDVA 3RP7A 3H8LA 1MOKA 5C3JA 3M12A 1IUXA 1IUVA 2TMDA 5BUKA 4CCQA 3IC9A 4Z43A 3CNTA 1BWCA 3CNJA 2X50A 1NHQA 3QFBA 3FBSA 2FJBA 1K0JA 1PBBA 4Z25A 3QSEA 4YSHA 3NK2X 3S61A 3NYCA 4Z2UA 2VRLA 3DJEA 1B4VA 1E7PA 1VRQB 3VR9A 1LPFA 4UDQA 4WX1A 5J7XA 3UKHA 5IQ1A 3LOVA 3REDA 4Z44A 2RGOA 1H81A 3CNSA 1RSGA 2YVGA 4D04A 2OALA 3AD7B 1ZKQA 1L9DA 3D8XA 4WCTA 1FEAA 3LJPA 4JN9A 1BKWA 2GMHA 2B9WA 1TDFA 3NHOX 4G73A 3KD9A 1RYIA 4LA1A 3ALJA 3FPZA 3CGDA 3NN0X 3CNDA 3T0KA 3DK8A 4I58A 4X9MA 2C67A 3P4RA 4RG3A 5JCNA 4USRA 5FS9A 4H50A 2O9ZA 3T2KA 4ECHA 1JNRA 3AECA 3PVCA 5BULA 1LVLA 4A5LA 2AQJA 2EQ8A 1O95A 3CN8A 3HYXA 3SGLA 4EQWA 3AE8A 5KOXA 3C96A 4X9NA 3AE5A 1W4XA 1TYPA 3BNMA 3S5WA 2OA1A 2B7SA 3RNMA 1NDAA 4C77A 1YKJA 3AE2A 1PS9A 1DJQA 4PAAA 5KMQA 3KA7A 1S3EA 2WOWA 2WP5A 1DOBA 3KKJA 2FBWA 1DNCA 1EL7A 1NG4A 4TM1A 4N9XA 3CIRA 3UKQA 1YQ3A 2R4JA 3T31A 3NK1X 5U63A 2GVCA 3DK4A 4LU6A 2YVJA 5L46A 1KDGA 3BHKA 3SFDA 2FJAA 2WHDA 4YSYA 2YAUA 2YM1A 5JCKA 1E1NA 3UCLA 1FOHA 3ALMA 1Z6LA 4GR1A 1S2QA 1VG0A 4YWOA 2IVDA 4BK2A 1FECA 1DODA 1KSUA 3SZ0A 1TDOA 3GDNA 4NZHA 1JNZA 4YT0A 1LQTA 5HY5A 5KMPA 3ICTA 5FS6A 1FCDA 4O5UA 4II2A 2VQBA 1K0IA 1M6IA 2GQWA 4YTMA 2GEWA 1TYTA 2BC1A 2PHHA 2WU5A 3D1CA 2C66A 3UKFA 4YTPA 4C5OA 4YTNA 2RGJA 1XANA 1Q1RA 3DK9A 2XFNA 3CPJG 5FMHA 3SFEA 2YQUA 1PBDA 4BK1A 2J3NA 3L8KA 1MXTA 2IVEA 4KPRA 1H83A 1DOCA 1GESA 2FJDA 1UKVG 3BHFA 3FMWA 2C64A 3CGBA 3SZWA 2XFQA 2WESA 4D03A 5U25A 2A87A 4H7UA 2W0HA 3QSSA 1H7WA 4J56A 2BXRA 5EBKA 3SM8A 3T37A 2GQFA 3GD3A 1COYA 1E6EA 1Y56B 1PXAA 1S3BA 1ZMDA 4CY6A 2XLPA 2Z5XA 4YXDA 3KPKA 1OJTA 2RABA 4G6GA 3AE4A 4H4ZA 5IPYA 3VRBA 1GETA 4AT0A 1N4VA 2C7GA 2JAEA 3ABVA 1CHUA 3AYIA 3HZLA 5KVIA 4B64A 5KNLA 1N1PA 1REOA 2BACA 4ICYA 4Y4MA 2HQMA 1GREA 2C72A 2YG5A 2A8XA 2GAGB 2R4EA 2XYOA 2EQ6A 1NHPA 4EM3A 2YLXA 3EF6A 1GRHA 3AYJA 4U8JA 2BS3A 2Y6QA 2JB3A 3GRTA 3KPFA 3NYEA 2BA9A 4U8LA 3NIXA 3URHA 1O94A 3KLJA 4GDPA 4OCGA 3VRDB 3FG2P 5EOWA 1H6VA 3T2YA 1E1MA 3H8IA 4OPCA 4JQ9A 3RHAA 3ZDNA 3AEFA 2XVJA 1FL2A 3DJGX 3KU9A 5FS7A 3AE6A 4K7ZA 4OPTA 4YKFA 4B1BA 1Y56A 1VQWA 2WPFA 1CJ3A 2WP6A 4JY2A 4B66A 4FDCB 4ADWA 3E1TA 4H4QA 4GAPA 4H2QA 2XDOA 1CF3A 1GTEA 3C4NA 4YKGA 1DXLA 4LIIA 1FEBA 4K5SA 4H4VA 1Q9IA 4J31A 2GR0A 1BGNA 1M64A 4IV9A 4G9KA 3K7TA 4A7AA 4M52A 1TDEA 2BRYA 3AEAA 1ZOYA 2GH5A 1SEZA 2X8CA 2R0GA 5HHFA 4P9SA 4IA6A 1XHCA 1YY5A 1XDIA 2NVKX 2X8GA 2OLNA 4TLXA 3NT6A 1EL5A 3G5RA 3P4QA 3PO7A 2A89A 1B37A 4EM4A 1GXFA 2BABA 3SX6A 4CCRA 1ZMCA 3GYXA 1K0LA 3BNUA 2C75A 2Y6RA 1GRTA 2C4CA 3B3RA 3AE7A 2R46A 1EBDA 4HB9A 4Y4LA 2XLUA 3P9UA 4A6NB 1F8WA 2XLSA 4U8OA 1RP0A 1JEHA 4DNAA 3UOVA 4EMIA 5KMRA 3K30A 4GUVA 2GR2A 3EPTA 5DBJA 3NYFA 2XCGA 3NG7X 4O5QA 2H88A 1F3PA 2WOVA 2ACZA 3Q6JA 1ZK7A 2ZZCA 5GSNA 1EL8A 2B9YA 1PBCA 2GR3A 3AEEA 4K8DA 1GV4A 2BK3A 3SXIA 4U8PA 4H4XA 1GERA 4H4TA 2JBVA 1PXCA 1ONFA 4UDRA 4AOXA 2QCUA 4NEVA 4BJZA 3DA1A 2XVFA 3AEBA 2CULA 5LV9A 2BYBA 3HYVA 3ITJA 2Q6UA 2NPXA 5EB4A 4OPUA 4Y4NA 3SYIA 3NN6X 2GRTA 3T14A 3HYWA 3AEGA 1D4EA 4TM4A 2OLOA 4FK1C 5M10A 1X31B 4Z2TA 1ZOVA 4NTEA 2Q7VA 4A99A 3GMCA 1B5QA 5C2TA 1MO9A 3AXBA 1GRGA 3GYJA 4YSXA 2WU2A 3UTEA 2QA1A 2R0CA 1KNRA 3UOXA 3DGZA 3L1RA 1F6MA 4UP3A 3IHGA 1NAAA 1NPXA 2B9XA 2XLRA 4U2LA 2DKHA 2VRMA 2VVMA 4ZN0A 5HYMA 2IIDA 3NGCX 2XFPA 1L9CA 3AE9A 4K2XA 3CTYA 2YLRA 1F8RA 3LZWA 2E1MA 4U8NA 3BI4A 2TPRA 1JRXA 3F8PA 1JU2A 4K5RA 3VQRA 1DOEA 2GMJA 2V3AA 4B65A 2YG7A 2EQ9A 3NTDA 3NKSA 2BK5A 1TRBA 3V3NA 1CC2A 3II4A 1YQ4A 3RP6A 4H4SA 3GDPA 1CL0A 1QLBA 1CJ2A 2BS4A 3AD9B 5BVAA 3OZ2A 5JCMA 4IVMB 3V76A 1D4CA 3VR8A 4JNQA 1ZDLA 5EB5A 3WE0A 2WETA 3O0HA 2BS2A 4U8IA 2BK4A 2CFYA 1S2YA 1KNPA 2E4GA 2WPCA 3F8DA 2JKCA 1PBFA 1E1KA 1PXBA 2WS3A 5FS8A 4H4RA 4BK3A 4GRTA 4CRTA 1IUWA 1Y0PA 1B8SA 4K22A 2JB1A 4C3XA 2BCPA 2R9ZA 3UTHA 3ICSA 2R0PA 1OJCA 4H4YA 3UOYA 3SZCA 2YG3A 1PHHA 4H2PA 1N4WA 2YR5A 2QA2A 1H82A 1N4UA 4UDPA 1LJ1A 2QAEA 1D5TA 1PJ7A 2AR8A 3IWAA 3LZXA 2V60A 2C3CA 2BCGG 2ARDA 3BI2A 4U2TA 4C3YA 4FK1A 1HYUA 3FIMB 4MJWA 4GDEA 4NWZA 4AT2A 2XFOA 5KXJA 4OPGA 2FJEA 4RSLA 1JRYA 1BF3A 2R45A 1D4DA 4CNKA 4DSGA 5HXIA 5KMSA 1GRFA 3UTGA 2VOUA 2V6OA 4OPLA 4EQRA 4U2SA 1GNDA 3GSIA 4A9WA 2PYXA 3ICRA 4OPIA 2YG6A 3AWIA 1IJHA 4GAVA 3COXA 1XPQA 3EANA 1QO8A 2GV8A 2YLTA 1ZP0A 2GB0A 2Q0LA 1GALA 4TLZA 4Z24A 1CBOA 2F5ZA 2JK6A 3DJJA 4IVOB 3KVEA 4J34A 1P2EA 3GD4A 3IF9A 1NENA 3NNEA 3GWDA 5KRQA 1CJCA 1F8SA 3CPHG 3P4SA 2WDQA 2CVJA 4HA6A 3DH9A 5U1OA 3UKLA 3UP5A 3AE3A 3DGHA 3ISHA 2APGA 2CDUA 3NRNA 4NEWA 5CKUA 4EIPA 3LXDA 4EIQA 2V3BA 2XVIA 3AD8B 3CGCA 2Q0KA 3GYIA 3P4PA 1GTHA 4AOSA 1TDNA 1IUUA 1CC4A 4J36A 1LQUA 3UTFA 2H89A 4EQXA 1VG9A 2YG4A 1K4QA 3AE1A 4XXGA 1OJDA 2ZZBA 3T2ZA 1OJAA 4EMWA 4ZCDA 3K7QX 2YWLA 2WDRA 4XWRA 3JSKA 4BJYA 4REKA 2ZBWA 5TR3A 2GR1A 1LTXR 3RP8A 4B67A 2WEUA 4KX6A 3CPIG 4X4JA 1V59A 2I0ZA 2XVEA 3M13A 1PJ6A 3H4KA 3ADAB 1DJNA 2C76A 4NTCA 4H2RA 5KVHA 1KSSA 4NNJA 3LB8A 3ZYXA 3GMBA 2C70A 4C74A 4A79A 4B68A 1KFYA 2YLZA 4A6NA 1GSNA 2V61A 5M0ZA 3IHMA 4IA5A 1NHSA 1IUSA 3UKPA 1BGJA 3VRAA 4DGKA 4EMJA 1TDKA 4JNAA 1GRBA 3DMEA 4J57A 3PS9A 1JOAA 4TM3A 4A65A 1PN0A 4CBQA 5KOWA 4BURA 3SQPA 2RGHA 1E39A 2C3DA 4JDRA 3QVRA 1GOSA 2YR4A 3NH3X 5CQFA 1GPEA 1JRZA 4H4PA 4BV6A 1P2HA 4II3A 4APNA 2AAQA 2YLWA 2V5ZA 1GEUA 4XWZA 2YVFA 3Q9TA 2E5VA 2UZZA 3CNPA 4TM0A 4GF7A 5J60A 3I6DA 4JY3A 3ATQA 4YSZA 3AB1A 3R9UA 1PDHA 4AP1A 1YQZA 3GWFA 3UOZA 1H84A 1ZY8A 2VQ7A 3C4AA 1NG3A 2B7RA 3UKKA 1CJ4A 5ER0A 4OVIA 4G74A 5JCLA 4U8KA 3QJ4A 1PBEA 2VVLG 5IQ4A 1L0VA 1LV0A 2VZ2A 2WOIA 2VVLA 4USQA 4B69A 2XFUA 4DSHA 3SZFA 1Q1WA 5GRTA 1PJ5A 3F8RA 2GF3A 3UKAA 4EQSA 1AOGA 2X99A 4FX9A 1O5WA 3GRSA
chains in the Genus database with same CATH topology
3I3LA 3AYLA 3P1WA 3NTAA 2YLSA 4H4UA 3NK0X 3CGEA 1NEKA 5BRTA 2BRAA 4G6HA 1ZX9A 2X3NA 3CMMA 4ZCCA 3BI5A 1GT8A 3OC4A 4H4WA 1VDCA 1ELIA 2C73A 4J33A 4OPDA 3LADA 2WPEA 4NTDA 1E1LA 1NHRA 2WQYA 3QVPA 4AP3A 1QJDA 3K7MX 4RG4A 1BZLA 5KWFA 3B6DA 4H2NA 3G5SA 4J2WA 2WBAA 2YM2A 2YR6A 3AEDA 3NLCA 1H86A 3V3OA 2BXSA 3SY4A 2BC0A 4Z26A 3UP4A 1L9EA 3ATRA 1GRAA 2OAMA 3M0OA 4PABA 4B63A 2XLTA 2DKIA 3EAOA 2C65A 4U8MA 1OJ9A 2EQ7A 1KF6A 2GAHB 5JCIA 1IUTA 4I59A 1CC6A 1H7XA 2XVHA 1EL9A 3DJDA 3QSMA 3G5QA 3ALLA 2WP9A 2ZZ0A 3QFAA 4CY8A 4Z2RA 1D7YA 1D7LA 4E0VA 2Z5YA 4GCMA 2X8HA 2JB2A 4CNJA 2B76A 2WDVA 3RP7A 3H8LA 1MOKA 5C3JA 3M12A 1IUXA 1IUVA 2TMDA 5BUKA 4CCQA 3IC9A 4Z43A 3CNTA 1BWCA 3CNJA 2X50A 1NHQA 3QFBA 3FBSA 2FJBA 1K0JA 1PBBA 4Z25A 3QSEA 4YSHA 3NK2X 3S61A 3NYCA 4Z2UA 2VRLA 3DJEA 1B4VA 1E7PA 1VRQB 3VR9A 1LPFA 4UDQA 4WX1A 5J7XA 3UKHA 5IQ1A 3LOVA 3REDA 4Z44A 2RGOA 1H81A 3CNSA 1RSGA 2YVGA 4D04A 2OALA 3AD7B 1ZKQA 1L9DA 3D8XA 4WCTA 1FEAA 3LJPA 4JN9A 1BKWA 2GMHA 2B9WA 1TDFA 3NHOX 4G73A 3KD9A 1RYIA 4LA1A 3ALJA 3FPZA 3CGDA 3NN0X 3CNDA 3T0KA 3DK8A 4I58A 4X9MA 2C67A 3P4RA 4RG3A 5JCNA 4USRA 5FS9A 4H50A 2O9ZA 3T2KA 4ECHA 1JNRA 3AECA 3PVCA 5BULA 1LVLA 4A5LA 2AQJA 2EQ8A 1O95A 3CN8A 3HYXA 3SGLA 4EQWA 3AE8A 5KOXA 3C96A 4X9NA 3AE5A 1W4XA 1TYPA 3BNMA 3S5WA 2OA1A 2B7SA 3RNMA 1NDAA 4C77A 1YKJA 3AE2A 1PS9A 1DJQA 4PAAA 5KMQA 3KA7A 1S3EA 2WOWA 2WP5A 1DOBA 3KKJA 2FBWA 1DNCA 1EL7A 1NG4A 4TM1A 4N9XA 3CIRA 3UKQA 1YQ3A 2R4JA 3T31A 3NK1X 5U63A 2GVCA 3DK4A 4LU6A 2YVJA 5L46A 1KDGA 3BHKA 3SFDA 2FJAA 2WHDA 4YSYA 2YAUA 2YM1A 5JCKA 1E1NA 3UCLA 1FOHA 3ALMA 1Z6LA 4GR1A 1S2QA 1VG0A 4YWOA 2IVDA 4BK2A 1FECA 1DODA 1KSUA 3SZ0A 1TDOA 3GDNA 4NZHA 1JNZA 4YT0A 1LQTA 5HY5A 5KMPA 3ICTA 5FS6A 1FCDA 4O5UA 4II2A 2VQBA 1K0IA 1M6IA 2GQWA 4YTMA 2GEWA 1TYTA 2BC1A 2PHHA 2WU5A 3D1CA 2C66A 3UKFA 4YTPA 4C5OA 4YTNA 2RGJA 1XANA 1Q1RA 3DK9A 2XFNA 3CPJG 5FMHA 3SFEA 2YQUA 1PBDA 4BK1A 2J3NA 3L8KA 1MXTA 2IVEA 4KPRA 1H83A 1DOCA 1GESA 2FJDA 1UKVG 3BHFA 3FMWA 2C64A 3CGBA 3SZWA 2XFQA 2WESA 4D03A 5U25A 2A87A 4H7UA 2W0HA 3QSSA 1H7WA 4J56A 2BXRA 5EBKA 3SM8A 3T37A 2GQFA 3GD3A 1COYA 1E6EA 1Y56B 1PXAA 1S3BA 1ZMDA 4CY6A 2XLPA 2Z5XA 4YXDA 3KPKA 1OJTA 2RABA 4G6GA 3AE4A 4H4ZA 5IPYA 3VRBA 1GETA 4AT0A 1N4VA 2C7GA 2JAEA 3ABVA 1CHUA 3AYIA 3HZLA 5KVIA 4B64A 5KNLA 1N1PA 1REOA 2BACA 4ICYA 4Y4MA 2HQMA 1GREA 2C72A 2YG5A 2A8XA 2GAGB 2R4EA 2XYOA 2EQ6A 1NHPA 4EM3A 2YLXA 3EF6A 1GRHA 3AYJA 4U8JA 2BS3A 2Y6QA 2JB3A 3GRTA 3KPFA 3NYEA 2BA9A 4U8LA 3NIXA 3URHA 1O94A 3KLJA 4GDPA 4OCGA 3VRDB 3FG2P 5EOWA 1H6VA 3T2YA 1E1MA 3H8IA 4OPCA 4JQ9A 3RHAA 3ZDNA 3AEFA 2XVJA 1FL2A 3DJGX 3KU9A 5FS7A 3AE6A 4K7ZA 4OPTA 4YKFA 4B1BA 1Y56A 1VQWA 2WPFA 1CJ3A 2WP6A 4JY2A 4B66A 4FDCB 4ADWA 3E1TA 4H4QA 4GAPA 4H2QA 2XDOA 1CF3A 1GTEA 3C4NA 4YKGA 1DXLA 4LIIA 1FEBA 4K5SA 4H4VA 1Q9IA 4J31A 2GR0A 1BGNA 1M64A 4IV9A 4G9KA 3K7TA 4A7AA 4M52A 1TDEA 2BRYA 3AEAA 1ZOYA 2GH5A 1SEZA 2X8CA 2R0GA 5HHFA 4P9SA 4IA6A 1XHCA 1YY5A 1XDIA 2NVKX 2X8GA 2OLNA 4TLXA 3NT6A 1EL5A 3G5RA 3P4QA 3PO7A 2A89A 1B37A 4EM4A 1GXFA 2BABA 3SX6A 4CCRA 1ZMCA 3GYXA 1K0LA 3BNUA 2C75A 2Y6RA 1GRTA 2C4CA 3B3RA 3AE7A 2R46A 1EBDA 4HB9A 4Y4LA 2XLUA 3P9UA 4A6NB 1F8WA 2XLSA 4U8OA 1RP0A 1JEHA 4DNAA 3UOVA 4EMIA 5KMRA 3K30A 4GUVA 2GR2A 3EPTA 5DBJA 3NYFA 2XCGA 3NG7X 4O5QA 2H88A 1F3PA 2WOVA 2ACZA 3Q6JA 1ZK7A 2ZZCA 5GSNA 1EL8A 1PBCA 2B9YA 2GR3A 3AEEA 4K8DA 1GV4A 2BK3A 3SXIA 4U8PA 4H4XA 1GERA 4H4TA 2JBVA 1PXCA 1ONFA 4UDRA 4AOXA 2QCUA 4NEVA 4BJZA 3DA1A 2XVFA 3AEBA 2CULA 5LV9A 2BYBA 3HYVA 3ITJA 2Q6UA 2NPXA 5EB4A 4OPUA 4Y4NA 3SYIA 3NN6X 2GRTA 3T14A 3HYWA 3AEGA 1D4EA 4TM4A 2OLOA 4FK1C 5M10A 1X31B 4Z2TA 1ZOVA 4NTEA 2Q7VA 4A99A 3GMCA 1B5QA 5C2TA 1MO9A 3AXBA 1GRGA 3GYJA 4YSXA 2WU2A 3UTEA 2QA1A 2R0CA 1KNRA 3UOXA 3DGZA 3L1RA 1F6MA 4UP3A 3IHGA 1NAAA 1NPXA 2B9XA 2XLRA 4U2LA 2DKHA 2VRMA 2VVMA 4ZN0A 5HYMA 2IIDA 3NGCX 2XFPA 1L9CA 3AE9A 4K2XA 3CTYA 2YLRA 1F8RA 3LZWA 2E1MA 4U8NA 3BI4A 2TPRA 1JRXA 3F8PA 1JU2A 4K5RA 3VQRA 1DOEA 2GMJA 2V3AA 4B65A 2YG7A 2EQ9A 3NTDA 3NKSA 2BK5A 1TRBA 3V3NA 1CC2A 3II4A 1YQ4A 3RP6A 4H4SA 3GDPA 1CL0A 1QLBA 1CJ2A 2BS4A 3AD9B 5BVAA 3OZ2A 5JCMA 4IVMB 3V76A 1D4CA 3VR8A 4JNQA 1ZDLA 5EB5A 3O0HA 2WETA 3WE0A 2BS2A 4U8IA 2CFYA 2BK4A 1S2YA 1KNPA 2E4GA 2WPCA 3F8DA 2JKCA 1PBFA 1E1KA 1PXBA 2WS3A 5FS8A 4H4RA 4BK3A 4GRTA 4CRTA 1IUWA 1Y0PA 1B8SA 4K22A 2JB1A 4C3XA 2BCPA 2R9ZA 3UTHA 3ICSA 2R0PA 1OJCA 4H4YA 3UOYA 3SZCA 2YG3A 1PHHA 4H2PA 1N4WA 2YR5A 2QA2A 1H82A 1N4UA 4UDPA 1LJ1A 2QAEA 1D5TA 1PJ7A 2AR8A 3IWAA 3LZXA 2V60A 2C3CA 2BCGG 2ARDA 3BI2A 4U2TA 4C3YA 4FK1A 1HYUA 3FIMB 4MJWA 4GDEA 4NWZA 4AT2A 2XFOA 5KXJA 4OPGA 2FJEA 4RSLA 1JRYA 1BF3A 2R45A 1D4DA 4CNKA 4DSGA 5HXIA 5KMSA 1GRFA 3UTGA 2VOUA 2V6OA 4OPLA 4EQRA 4U2SA 1GNDA 3GSIA 4A9WA 2PYXA 3ICRA 4OPIA 2YG6A 3AWIA 1IJHA 4GAVA 3COXA 1XPQA 3EANA 1QO8A 2GV8A 2YLTA 1ZP0A 2GB0A 2Q0LA 1GALA 4TLZA 4Z24A 1CBOA 2F5ZA 2JK6A 3DJJA 4IVOB 3KVEA 4J34A 1P2EA 3GD4A 3IF9A 1NENA 3NNEA 3GWDA 5KRQA 1CJCA 1F8SA 3CPHG 3P4SA 2WDQA 2CVJA 4HA6A 3DH9A 5U1OA 3UKLA 3UP5A 3AE3A 3DGHA 3ISHA 2APGA 2CDUA 3NRNA 4NEWA 5CKUA 4EIPA 3LXDA 4EIQA 2V3BA 2XVIA 3AD8B 3CGCA 2Q0KA 3GYIA 3P4PA 1GTHA 4AOSA 1TDNA 1IUUA 1CC4A 4J36A 1LQUA 3UTFA 2H89A 4EQXA 1VG9A 2YG4A 1K4QA 3AE1A 4XXGA 1OJDA 2ZZBA 3T2ZA 1OJAA 4EMWA 4ZCDA 3K7QX 2YWLA 2WDRA 4XWRA 3JSKA 4BJYA 4REKA 2ZBWA 5TR3A 2GR1A 1LTXR 3RP8A 4B67A 2WEUA 4KX6A 3CPIG 4X4JA 1V59A 2I0ZA 2XVEA 3M13A 1PJ6A 3H4KA 3ADAB 1DJNA 2C76A 4NTCA 4H2RA 5KVHA 1KSSA 4NNJA 3LB8A 3ZYXA 3GMBA 2C70A 4C74A 4A79A 4B68A 1KFYA 2YLZA 4A6NA 1GSNA 2V61A 5M0ZA 3IHMA 4IA5A 1NHSA 1IUSA 3UKPA 1BGJA 3VRAA 4DGKA 4EMJA 1TDKA 4JNAA 1GRBA 3DMEA 4J57A 3PS9A 1JOAA 4TM3A 4A65A 1PN0A 4CBQA 5KOWA 4BURA 3SQPA 2RGHA 1E39A 2C3DA 4JDRA 3QVRA 1GOSA 2YR4A 3NH3X 5CQFA 1GPEA 1JRZA 4H4PA 4BV6A 1P2HA 4II3A 4APNA 2AAQA 2YLWA 2V5ZA 1GEUA 4XWZA 2YVFA 3Q9TA 2E5VA 2UZZA 3CNPA 4TM0A 4GF7A 5J60A 3I6DA 4JY3A 3ATQA 4YSZA 3AB1A 3R9UA 1PDHA 4AP1A 1YQZA 3GWFA 3UOZA 1H84A 1ZY8A 2VQ7A 3C4AA 1NG3A 2B7RA 3UKKA 1CJ4A 5ER0A 4OVIA 4G74A 5JCLA 4U8KA 3QJ4A 1PBEA 2VVLG 5IQ4A 1L0VA 1LV0A 2VZ2A 2WOIA 2VVLA 4USQA 4B69A 2XFUA 4DSHA 3SZFA 1Q1WA 5GRTA 1PJ5A 3F8RA 2GF3A 3UKAA 4EQSA 1AOGA 2X99A 4FX9A 1O5WA 3GRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3L A;  3AYL A;  3P1W A;  3NTA A;  2YLS A;  4H4U A;  3NK0 X;  3CGE A;  1NEK A;  5BRT A;  1ZX9 A;  2X3N A;  4ZCC A;  3BI5 A;  1GT8 A;  3OC4 A;  4H4W A;  1VDC A;  1ELI A;  2C73 A;  4J33 A;  4OPD A;  3LAD A;  2WPE A;  4NTD A;  1E1L A;  1NHR A;  2WQY A;  3QVP A;  4AP3 A;  1QJD A;  3K7M X;  4RG4 A;  1BZL A;  5KWF A;  3B6D A;  4H2N A;  3G5S A;  4J2W A;  2WBA A;  2YM2 A;  2YR6 A;  3AED A;  3NLC A;  1H86 A;  3V3O A;  2BXS A;  2BC0 A;  4Z26 A;  3UP4 A;  1L9E A;  3ATR A;  1GRA A;  2OAM A;  3M0O A;  4PAB A;  4B63 A;  2XLT A;  2DKI A;  3EAO A;  2C65 A;  4U8M A;  1OJ9 A;  2EQ7 A;  1KF6 A;  2GAH B;  5JCI A;  1IUT A;  4I59 A;  1CC6 A;  1H7X A;  2XVH A;  1EL9 A;  3DJD A;  3QSM A;  3G5Q A;  3ALL A;  2WP9 A;  2ZZ0 A;  3QFA A;  4CY8 A;  4Z2R A;  1D7Y A;  1D7L A;  4E0V A;  2Z5Y A;  4GCM A;  2X8H A;  2JB2 A;  4CNJ A;  2B76 A;  2WDV A;  3RP7 A;  3H8L A;  1MOK A;  5C3J A;  3M12 A;  1IUX A;  1IUV A;  2TMD A;  5BUK A;  4CCQ A;  3IC9 A;  4Z43 A;  3CNT A;  1BWC A;  3CNJ A;  2X50 A;  1NHQ A;  3QFB A;  3FBS A;  2FJB A;  1K0J A;  1PBB A;  4Z25 A;  3QSE A;  4YSH A;  3NK2 X;  3S61 A;  3NYC A;  4Z2U A;  2VRL A;  3DJE A;  1B4V A;  1E7P A;  1VRQ B;  3VR9 A;  1LPF A;  4UDQ A;  4WX1 A;  5J7X A;  3UKH A;  5IQ1 A;  3LOV A;  3RED A;  4Z44 A;  2RGO A;  1H81 A;  3CNS A;  1RSG A;  2YVG A;  4D04 A;  2OAL A;  3AD7 B;  1ZKQ A;  1L9D A;  3D8X A;  4WCT A;  1FEA A;  3LJP A;  4JN9 A;  1BKW A;  2GMH A;  2B9W A;  1TDF A;  3NHO X;  3KD9 A;  1RYI A;  4LA1 A;  3ALJ A;  3FPZ A;  3CGD A;  3NN0 X;  3CND A;  3DK8 A;  4I58 A;  4X9M A;  2C67 A;  3P4R A;  4RG3 A;  5JCN A;  4USR A;  5FS9 A;  4H50 A;  2O9Z A;  4ECH A;  1JNR A;  3AEC A;  3PVC A;  5BUL A;  1LVL A;  4A5L A;  2AQJ A;  2EQ8 A;  1O95 A;  3CN8 A;  3SGL A;  4EQW A;  3AE8 A;  5KOX A;  3C96 A;  4X9N A;  3AE5 A;  1W4X A;  1TYP A;  3BNM A;  3S5W A;  2OA1 A;  2B7S A;  3RNM A;  1NDA A;  4C77 A;  1YKJ A;  3AE2 A;  1PS9 A;  1DJQ A;  4PAA A;  3KA7 A;  1S3E A;  2WOW A;  2WP5 A;  1DOB A;  3KKJ A;  2FBW A;  1DNC A;  1EL7 A;  1NG4 A;  4TM1 A;  4N9X A;  3CIR A;  3UKQ A;  1YQ3 A;  2R4J A;  3NK1 X;  5U63 A;  2GVC A;  3DK4 A;  4LU6 A;  2YVJ A;  5L46 A;  1KDG A;  3BHK A;  3SFD A;  2FJA A;  2WHD A;  4YSY A;  2YAU A;  2YM1 A;  5JCK A;  1E1N A;  3UCL A;  1FOH A;  3ALM A;  1Z6L A;  4GR1 A;  1S2Q A;  1VG0 A;  4YWO A;  2IVD A;  4BK2 A;  1FEC A;  1DOD A;  1KSU A;  4YT0 A;  1TDO A;  3GDN A;  4NZH A;  1JNZ A;  5HY5 A;  1LQT A;  3ICT A;  5FS6 A;  1FCD A;  4O5U A;  2VQB A;  1K0I A;  1M6I A;  2GQW A;  4YTM A;  2GEW A;  1TYT A;  2BC1 A;  2PHH A;  2WU5 A;  3D1C A;  2C66 A;  3UKF A;  4YTP A;  4C5O A;  4YTN A;  2RGJ A;  1XAN A;  1Q1R A;  3DK9 A;  2XFN A;  3CPJ G;  5FMH A;  3SFE A;  2YQU A;  1PBD A;  4BK1 A;  2J3N A;  3L8K A;  1MXT A;  2IVE A;  4KPR A;  1H83 A;  1DOC A;  1GES A;  2FJD A;  1UKV G;  3BHF A;  3FMW A;  2C64 A;  3CGB A;  2XFQ A;  2WES A;  4D03 A;  5U25 A;  2A87 A;  4H7U A;  2W0H A;  3QSS A;  1H7W A;  4J56 A;  2BXR A;  5EBK A;  3SM8 A;  3T37 A;  2GQF A;  3GD3 A;  1COY A;  1E6E A;  1Y56 B;  1PXA A;  1S3B A;  1ZMD A;  4CY6 A;  2XLP A;  2Z5X A;  4YXD A;  1OJT A;  2RAB A;  5IPY A;  3AE4 A;  4H4Z A;  3VRB A;  1GET A;  4AT0 A;  1N4V A;  2C7G A;  2JAE A;  3ABV A;  1CHU A;  3AYI A;  3HZL A;  5KVI A;  4B64 A;  1N1P A;  1REO A;  2BAC A;  4ICY A;  4Y4M A;  2HQM A;  1GRE A;  2C72 A;  2YG5 A;  2A8X A;  2GAG B;  2R4E A;  2XYO A;  2EQ6 A;  1NHP A;  4EM3 A;  2YLX A;  3EF6 A;  1GRH A;  3AYJ A;  4U8J A;  2BS3 A;  2Y6Q A;  2JB3 A;  3GRT A;  3KPF A;  3NYE A;  2BA9 A;  4U8L A;  3NIX A;  3URH A;  1O94 A;  3KLJ A;  4GDP A;  4OCG A;  3VRD B;  3FG2 P;  5EOW A;  1H6V A;  1E1M A;  3H8I A;  4OPC A;  4JQ9 A;  3RHA A;  3ZDN A;  3AEF A;  2XVJ A;  1FL2 A;  3DJG X;  3KU9 A;  5FS7 A;  3AE6 A;  4K7Z A;  4OPT A;  4YKF A;  4B1B A;  1Y56 A;  1VQW A;  2WPF A;  1CJ3 A;  2WP6 A;  4JY2 A;  4B66 A;  4FDC B;  4ADW A;  3E1T A;  4H4Q A;  4H2Q A;  2XDO A;  1CF3 A;  1GTE A;  3C4N A;  4YKG A;  1DXL A;  4LII A;  1FEB A;  4K5S A;  4H4V A;  1Q9I A;  4J31 A;  2GR0 A;  1BGN A;  1M64 A;  4IV9 A;  3K7T A;  4A7A A;  4M52 A;  1TDE A;  3AEA A;  1ZOY A;  2GH5 A;  1SEZ A;  2X8C A;  2R0G A;  5HHF A;  4P9S A;  4IA6 A;  1XHC A;  1YY5 A;  1XDI A;  2NVK X;  2X8G A;  2OLN A;  4TLX A;  3NT6 A;  1EL5 A;  3G5R A;  3P4Q A;  3PO7 A;  2A89 A;  1B37 A;  4EM4 A;  1GXF A;  2BAB A;  4CCR A;  1ZMC A;  1K0L A;  3BNU A;  2C75 A;  2Y6R A;  1GRT A;  3B3R A;  3AE7 A;  2R46 A;  1EBD A;  4HB9 A;  4Y4L A;  2XLU A;  3P9U A;  4A6N B;  1F8W A;  2XLS A;  4U8O A;  1RP0 A;  1JEH A;  4DNA A;  3UOV A;  4EMI A;  3K30 A;  4GUV A;  2GR2 A;  3EPT A;  5DBJ A;  3NYF A;  2XCG A;  3NG7 X;  4O5Q A;  2H88 A;  1F3P A;  2WOV A;  2ACZ A;  3Q6J A;  1ZK7 A;  2ZZC A;  5GSN A;  1EL8 A;  1PBC A;  2B9Y A;  2GR3 A;  3AEE A;  4K8D A;  1GV4 A;  2BK3 A;  4U8P A;  4H4X A;  1GER A;  4H4T A;  2JBV A;  1PXC A;  1ONF A;  4UDR A;  4AOX A;  2QCU A;  4NEV A;  4BJZ A;  3DA1 A;  2XVF A;  3AEB A;  2CUL A;  5LV9 A;  2BYB A;  3ITJ A;  5EB4 A;  2Q6U A;  2NPX A;  4OPU A;  4Y4N A;  3NN6 X;  2GRT A;  3AEG A;  1D4E A;  4TM4 A;  2OLO A;  4FK1 C;  5M10 A;  1X31 B;  4Z2T A;  1ZOV A;  4NTE A;  2Q7V A;  4A99 A;  3GMC A;  1B5Q A;  5C2T A;  1MO9 A;  3AXB A;  1GRG A;  3GYJ A;  4YSX A;  2WU2 A;  3UTE A;  2QA1 A;  2R0C A;  1KNR A;  3UOX A;  3DGZ A;  3L1R A;  1F6M A;  4UP3 A;  3IHG A;  1NAA A;  1NPX A;  2B9X A;  2XLR A;  4U2L A;  2DKH A;  2VRM A;  2VVM A;  4ZN0 A;  5HYM A;  2IID A;  3NGC X;  2XFP A;  1L9C A;  3AE9 A;  4K2X A;  3CTY A;  2YLR A;  1F8R A;  3LZW A;  2E1M A;  4U8N A;  3BI4 A;  2TPR A;  1JRX A;  3F8P A;  1JU2 A;  4K5R A;  3VQR A;  1DOE A;  2GMJ A;  2V3A A;  4B65 A;  2YG7 A;  2EQ9 A;  3NTD A;  3NKS A;  2BK5 A;  1TRB A;  3V3N A;  1CC2 A;  3II4 A;  1YQ4 A;  3RP6 A;  4H4S A;  3GDP A;  1CL0 A;  1QLB A;  1CJ2 A;  2BS4 A;  3AD9 B;  5BVA A;  3OZ2 A;  5JCM A;  4IVM B;  3V76 A;  1D4C A;  3VR8 A;  4JNQ A;  1ZDL A;  5EB5 A;  3O0H A;  2WET A;  3WE0 A;  2BS2 A;  4U8I A;  2CFY A;  2BK4 A;  1S2Y A;  1KNP A;  2E4G A;  2WPC A;  3F8D A;  2JKC A;  1PBF A;  1E1K A;  1PXB A;  2WS3 A;  5FS8 A;  4H4R A;  4BK3 A;  4GRT A;  4CRT A;  1IUW A;  1Y0P A;  1B8S A;  4K22 A;  2JB1 A;  4C3X A;  2BCP A;  2R9Z A;  3UTH A;  3ICS A;  2R0P A;  1OJC A;  4H4Y A;  3UOY A;  2YG3 A;  1PHH A;  4H2P A;  1N4W A;  2YR5 A;  2QA2 A;  1H82 A;  1N4U A;  4UDP A;  1LJ1 A;  2QAE A;  1D5T A;  1PJ7 A;  2AR8 A;  3IWA A;  3LZX A;  2V60 A;  2C3C A;  2BCG G;  2ARD A;  3BI2 A;  4U2T A;  4C3Y A;  4FK1 A;  1HYU A;  3FIM B;  4MJW A;  4GDE A;  4AT2 A;  2XFO A;  5KXJ A;  4OPG A;  2FJE A;  4RSL A;  1JRY A;  1BF3 A;  2R45 A;  1D4D A;  4CNK A;  4DSG A;  5HXI A;  1GRF A;  3UTG A;  2VOU A;  2V6O A;  4OPL A;  4EQR A;  4U2S A;  1GND A;  3GSI A;  4A9W A;  2PYX A;  3ICR A;  4OPI A;  2YG6 A;  3AWI A;  1IJH A;  3COX A;  1XPQ A;  3EAN A;  1QO8 A;  2GV8 A;  2YLT A;  1ZP0 A;  2GB0 A;  2Q0L A;  1GAL A;  4TLZ A;  4Z24 A;  1CBO A;  2F5Z A;  2JK6 A;  3DJJ A;  4IVO B;  3KVE A;  4J34 A;  1P2E A;  3GD4 A;  3IF9 A;  1NEN A;  3NNE A;  3GWD A;  5KRQ A;  1CJC A;  1F8S A;  3CPH G;  3P4S A;  2WDQ A;  2CVJ A;  4HA6 A;  3DH9 A;  5U1O A;  3UKL A;  3UP5 A;  3AE3 A;  3DGH A;  3ISH A;  2APG A;  2CDU A;  3NRN A;  4NEW A;  5CKU A;  4EIP A;  3LXD A;  4EIQ A;  2V3B A;  2XVI A;  3AD8 B;  3CGC A;  2Q0K A;  3GYI A;  3P4P A;  1GTH A;  4AOS A;  1TDN A;  1IUU A;  1CC4 A;  4J36 A;  1LQU A;  3UTF A;  2H89 A;  4EQX A;  1VG9 A;  2YG4 A;  1K4Q A;  3AE1 A;  4XXG A;  1OJD A;  2ZZB A;  1OJA A;  4EMW A;  4ZCD A;  3K7Q X;  2YWL A;  2WDR A;  4XWR A;  3JSK A;  4BJY A;  4REK A;  2ZBW A;  5TR3 A;  2GR1 A;  1LTX R;  3RP8 A;  4B67 A;  2WEU A;  4KX6 A;  3CPI G;  4X4J A;  1V59 A;  2I0Z A;  2XVE A;  3M13 A;  1PJ6 A;  3H4K A;  3ADA B;  1DJN A;  2C76 A;  4NTC A;  4H2R A;  5KVH A;  1KSS A;  3LB8 A;  3ZYX A;  3GMB A;  2C70 A;  4C74 A;  4A79 A;  4B68 A;  1KFY A;  2YLZ A;  4A6N A;  1GSN A;  2V61 A;  5M0Z A;  3IHM A;  4IA5 A;  1NHS A;  1IUS A;  3UKP A;  1BGJ A;  3VRA A;  4DGK A;  4EMJ A;  1TDK A;  4JNA A;  1GRB A;  3DME A;  4J57 A;  3PS9 A;  1JOA A;  4TM3 A;  4A65 A;  1PN0 A;  4CBQ A;  5KOW A;  4BUR A;  3SQP A;  2RGH A;  1E39 A;  2C3D A;  4JDR A;  3QVR A;  1GOS A;  2YR4 A;  3NH3 X;  5CQF A;  1GPE A;  1JRZ A;  4H4P A;  4BV6 A;  1P2H A;  4APN A;  2AAQ A;  2YLW A;  2V5Z A;  1GEU A;  4XWZ A;  2YVF A;  3Q9T A;  2E5V A;  2UZZ A;  3CNP A;  4TM0 A;  4GF7 A;  5J60 A;  3I6D A;  4JY3 A;  3ATQ A;  4YSZ A;  3AB1 A;  3R9U A;  1PDH A;  4AP1 A;  1YQZ A;  3GWF A;  3UOZ A;  1H84 A;  1ZY8 A;  2VQ7 A;  3C4A A;  1NG3 A;  2B7R A;  3UKK A;  1CJ4 A;  5ER0 A;  4OVI A;  5JCL A;  4U8K A;  3QJ4 A;  1PBE A;  2VVL G;  5IQ4 A;  1L0V A;  1LV0 A;  2VZ2 A;  2WOI A;  2VVL A;  4USQ A;  4B69 A;  2XFU A;  4DSH A;  1Q1W A;  5GRT A;  1PJ5 A;  3F8R A;  2GF3 A;  3UKA A;  4EQS A;  1AOG A;  2X99 A;  4FX9 A;  1O5W A;  3GRS A; 
#chains in the Genus database with same CATH topology
 3I3L A;  3AYL A;  3P1W A;  3NTA A;  2YLS A;  4H4U A;  3NK0 X;  3CGE A;  1NEK A;  5BRT A;  2BRA A;  4G6H A;  1ZX9 A;  2X3N A;  3CMM A;  4ZCC A;  3BI5 A;  1GT8 A;  3OC4 A;  4H4W A;  1VDC A;  1ELI A;  2C73 A;  4J33 A;  4OPD A;  3LAD A;  2WPE A;  4NTD A;  1E1L A;  1NHR A;  2WQY A;  3QVP A;  4AP3 A;  1QJD A;  3K7M X;  4RG4 A;  1BZL A;  5KWF A;  3B6D A;  4H2N A;  3G5S A;  4J2W A;  2WBA A;  2YM2 A;  2YR6 A;  3AED A;  3NLC A;  1H86 A;  3V3O A;  2BXS A;  3SY4 A;  2BC0 A;  4Z26 A;  3UP4 A;  1L9E A;  3ATR A;  1GRA A;  2OAM A;  3M0O A;  4PAB A;  4B63 A;  2XLT A;  2DKI A;  3EAO A;  2C65 A;  4U8M A;  1OJ9 A;  2EQ7 A;  1KF6 A;  2GAH B;  5JCI A;  1IUT A;  4I59 A;  1CC6 A;  1H7X A;  2XVH A;  1EL9 A;  3DJD A;  3QSM A;  3G5Q A;  3ALL A;  2WP9 A;  2ZZ0 A;  3QFA A;  4CY8 A;  4Z2R A;  1D7Y A;  1D7L A;  4E0V A;  2Z5Y A;  4GCM A;  2X8H A;  2JB2 A;  4CNJ A;  2B76 A;  2WDV A;  3RP7 A;  3H8L A;  1MOK A;  5C3J A;  3M12 A;  1IUX A;  1IUV A;  2TMD A;  5BUK A;  4CCQ A;  3IC9 A;  4Z43 A;  3CNT A;  1BWC A;  3CNJ A;  2X50 A;  1NHQ A;  3QFB A;  3FBS A;  2FJB A;  1K0J A;  1PBB A;  4Z25 A;  3QSE A;  4YSH A;  3NK2 X;  3S61 A;  3NYC A;  4Z2U A;  2VRL A;  3DJE A;  1B4V A;  1E7P A;  1VRQ B;  3VR9 A;  1LPF A;  4UDQ A;  4WX1 A;  5J7X A;  3UKH A;  5IQ1 A;  3LOV A;  3RED A;  4Z44 A;  2RGO A;  1H81 A;  3CNS A;  1RSG A;  2YVG A;  4D04 A;  2OAL A;  3AD7 B;  1ZKQ A;  1L9D A;  3D8X A;  4WCT A;  1FEA A;  3LJP A;  4JN9 A;  1BKW A;  2GMH A;  2B9W A;  1TDF A;  3NHO X;  4G73 A;  3KD9 A;  1RYI A;  4LA1 A;  3ALJ A;  3FPZ A;  3CGD A;  3NN0 X;  3CND A;  3T0K A;  3DK8 A;  4I58 A;  4X9M A;  2C67 A;  3P4R A;  4RG3 A;  5JCN A;  4USR A;  5FS9 A;  4H50 A;  2O9Z A;  3T2K A;  4ECH A;  1JNR A;  3AEC A;  3PVC A;  5BUL A;  1LVL A;  4A5L A;  2AQJ A;  2EQ8 A;  1O95 A;  3CN8 A;  3HYX A;  3SGL A;  4EQW A;  3AE8 A;  5KOX A;  3C96 A;  4X9N A;  3AE5 A;  1W4X A;  1TYP A;  3BNM A;  3S5W A;  2OA1 A;  2B7S A;  3RNM A;  1NDA A;  4C77 A;  1YKJ A;  3AE2 A;  1PS9 A;  1DJQ A;  4PAA A;  5KMQ A;  3KA7 A;  1S3E A;  2WOW A;  2WP5 A;  1DOB A;  3KKJ A;  2FBW A;  1DNC A;  1EL7 A;  1NG4 A;  4TM1 A;  4N9X A;  3CIR A;  3UKQ A;  1YQ3 A;  2R4J A;  3T31 A;  3NK1 X;  5U63 A;  2GVC A;  3DK4 A;  4LU6 A;  2YVJ A;  5L46 A;  1KDG A;  3BHK A;  3SFD A;  2FJA A;  2WHD A;  4YSY A;  2YAU A;  2YM1 A;  5JCK A;  1E1N A;  3UCL A;  1FOH A;  3ALM A;  1Z6L A;  4GR1 A;  1S2Q A;  1VG0 A;  4YWO A;  2IVD A;  4BK2 A;  1FEC A;  1DOD A;  1KSU A;  3SZ0 A;  1TDO A;  3GDN A;  4NZH A;  1JNZ A;  4YT0 A;  1LQT A;  5HY5 A;  5KMP A;  3ICT A;  5FS6 A;  1FCD A;  4O5U A;  4II2 A;  2VQB A;  1K0I A;  1M6I A;  2GQW A;  4YTM A;  2GEW A;  1TYT A;  2BC1 A;  2PHH A;  2WU5 A;  3D1C A;  2C66 A;  3UKF A;  4YTP A;  4C5O A;  4YTN A;  2RGJ A;  1XAN A;  1Q1R A;  3DK9 A;  2XFN A;  3CPJ G;  5FMH A;  3SFE A;  2YQU A;  1PBD A;  4BK1 A;  2J3N A;  3L8K A;  1MXT A;  2IVE A;  4KPR A;  1H83 A;  1DOC A;  1GES A;  2FJD A;  1UKV G;  3BHF A;  3FMW A;  2C64 A;  3CGB A;  3SZW A;  2XFQ A;  2WES A;  4D03 A;  5U25 A;  2A87 A;  4H7U A;  2W0H A;  3QSS A;  1H7W A;  4J56 A;  2BXR A;  5EBK A;  3SM8 A;  3T37 A;  2GQF A;  3GD3 A;  1COY A;  1E6E A;  1Y56 B;  1PXA A;  1S3B A;  1ZMD A;  4CY6 A;  2XLP A;  2Z5X A;  4YXD A;  3KPK A;  1OJT A;  2RAB A;  4G6G A;  3AE4 A;  4H4Z A;  5IPY A;  3VRB A;  1GET A;  4AT0 A;  1N4V A;  2C7G A;  2JAE A;  3ABV A;  1CHU A;  3AYI A;  3HZL A;  5KVI A;  4B64 A;  5KNL A;  1N1P A;  1REO A;  2BAC A;  4ICY A;  4Y4M A;  2HQM A;  1GRE A;  2C72 A;  2YG5 A;  2A8X A;  2GAG B;  2R4E A;  2XYO A;  2EQ6 A;  1NHP A;  4EM3 A;  2YLX A;  3EF6 A;  1GRH A;  3AYJ A;  4U8J A;  2BS3 A;  2Y6Q A;  2JB3 A;  3GRT A;  3KPF A;  3NYE A;  2BA9 A;  4U8L A;  3NIX A;  3URH A;  1O94 A;  3KLJ A;  4GDP A;  4OCG A;  3VRD B;  3FG2 P;  5EOW A;  1H6V A;  3T2Y A;  1E1M A;  3H8I A;  4OPC A;  4JQ9 A;  3RHA A;  3ZDN A;  3AEF A;  2XVJ A;  1FL2 A;  3DJG X;  3KU9 A;  5FS7 A;  3AE6 A;  4K7Z A;  4OPT A;  4YKF A;  4B1B A;  1Y56 A;  1VQW A;  2WPF A;  1CJ3 A;  2WP6 A;  4JY2 A;  4B66 A;  4FDC B;  4ADW A;  3E1T A;  4H4Q A;  4GAP A;  4H2Q A;  2XDO A;  1CF3 A;  1GTE A;  3C4N A;  4YKG A;  1DXL A;  4LII A;  1FEB A;  4K5S A;  4H4V A;  1Q9I A;  4J31 A;  2GR0 A;  1BGN A;  1M64 A;  4IV9 A;  4G9K A;  3K7T A;  4A7A A;  4M52 A;  1TDE A;  2BRY A;  3AEA A;  1ZOY A;  2GH5 A;  1SEZ A;  2X8C A;  2R0G A;  5HHF A;  4P9S A;  4IA6 A;  1XHC A;  1YY5 A;  1XDI A;  2NVK X;  2X8G A;  2OLN A;  4TLX A;  3NT6 A;  1EL5 A;  3G5R A;  3P4Q A;  3PO7 A;  2A89 A;  1B37 A;  4EM4 A;  1GXF A;  2BAB A;  3SX6 A;  4CCR A;  1ZMC A;  3GYX A;  1K0L A;  3BNU A;  2C75 A;  2Y6R A;  1GRT A;  2C4C A;  3B3R A;  3AE7 A;  2R46 A;  1EBD A;  4HB9 A;  4Y4L A;  2XLU A;  3P9U A;  4A6N B;  1F8W A;  2XLS A;  4U8O A;  1RP0 A;  1JEH A;  4DNA A;  3UOV A;  4EMI A;  5KMR A;  3K30 A;  4GUV A;  2GR2 A;  3EPT A;  5DBJ A;  3NYF A;  2XCG A;  3NG7 X;  4O5Q A;  2H88 A;  1F3P A;  2WOV A;  2ACZ A;  3Q6J A;  1ZK7 A;  2ZZC A;  5GSN A;  1EL8 A;  2B9Y A;  1PBC A;  2GR3 A;  3AEE A;  4K8D A;  1GV4 A;  2BK3 A;  3SXI A;  4U8P A;  4H4X A;  1GER A;  4H4T A;  2JBV A;  1PXC A;  1ONF A;  4UDR A;  4AOX A;  2QCU A;  4NEV A;  4BJZ A;  3DA1 A;  2XVF A;  3AEB A;  2CUL A;  5LV9 A;  2BYB A;  3HYV A;  3ITJ A;  2Q6U A;  2NPX A;  5EB4 A;  4OPU A;  4Y4N A;  3SYI A;  3NN6 X;  2GRT A;  3T14 A;  3HYW A;  3AEG A;  1D4E A;  4TM4 A;  2OLO A;  4FK1 C;  5M10 A;  1X31 B;  4Z2T A;  1ZOV A;  4NTE A;  2Q7V A;  4A99 A;  3GMC A;  1B5Q A;  5C2T A;  1MO9 A;  3AXB A;  1GRG A;  3GYJ A;  4YSX A;  2WU2 A;  3UTE A;  2QA1 A;  2R0C A;  1KNR A;  3UOX A;  3DGZ A;  3L1R A;  1F6M A;  4UP3 A;  3IHG A;  1NAA A;  1NPX A;  2B9X A;  2XLR A;  4U2L A;  2DKH A;  2VRM A;  2VVM A;  4ZN0 A;  5HYM A;  2IID A;  3NGC X;  2XFP A;  1L9C A;  3AE9 A;  4K2X A;  3CTY A;  2YLR A;  1F8R A;  3LZW A;  2E1M A;  4U8N A;  3BI4 A;  2TPR A;  1JRX A;  3F8P A;  1JU2 A;  4K5R A;  3VQR A;  1DOE A;  2GMJ A;  2V3A A;  4B65 A;  2YG7 A;  2EQ9 A;  3NTD A;  3NKS A;  2BK5 A;  1TRB A;  3V3N A;  1CC2 A;  3II4 A;  1YQ4 A;  3RP6 A;  4H4S A;  3GDP A;  1CL0 A;  1QLB A;  1CJ2 A;  2BS4 A;  3AD9 B;  5BVA A;  3OZ2 A;  5JCM A;  4IVM B;  3V76 A;  1D4C A;  3VR8 A;  4JNQ A;  1ZDL A;  5EB5 A;  3WE0 A;  2WET A;  3O0H A;  2BS2 A;  4U8I A;  2BK4 A;  2CFY A;  1S2Y A;  1KNP A;  2E4G A;  2WPC A;  3F8D A;  2JKC A;  1PBF A;  1E1K A;  1PXB A;  2WS3 A;  5FS8 A;  4H4R A;  4BK3 A;  4GRT A;  4CRT A;  1IUW A;  1Y0P A;  1B8S A;  4K22 A;  2JB1 A;  4C3X A;  2BCP A;  2R9Z A;  3UTH A;  3ICS A;  2R0P A;  1OJC A;  4H4Y A;  3UOY A;  3SZC A;  2YG3 A;  1PHH A;  4H2P A;  1N4W A;  2YR5 A;  2QA2 A;  1H82 A;  1N4U A;  4UDP A;  1LJ1 A;  2QAE A;  1D5T A;  1PJ7 A;  2AR8 A;  3IWA A;  3LZX A;  2V60 A;  2C3C A;  2BCG G;  2ARD A;  3BI2 A;  4U2T A;  4C3Y A;  4FK1 A;  1HYU A;  3FIM B;  4MJW A;  4GDE A;  4NWZ A;  4AT2 A;  2XFO A;  5KXJ A;  4OPG A;  2FJE A;  4RSL A;  1JRY A;  1BF3 A;  2R45 A;  1D4D A;  4CNK A;  4DSG A;  5HXI A;  5KMS A;  1GRF A;  3UTG A;  2VOU A;  2V6O A;  4OPL A;  4EQR A;  4U2S A;  1GND A;  3GSI A;  4A9W A;  2PYX A;  3ICR A;  4OPI A;  2YG6 A;  3AWI A;  1IJH A;  4GAV A;  3COX A;  1XPQ A;  3EAN A;  1QO8 A;  2GV8 A;  2YLT A;  1ZP0 A;  2GB0 A;  2Q0L A;  1GAL A;  4TLZ A;  4Z24 A;  1CBO A;  2F5Z A;  2JK6 A;  3DJJ A;  4IVO B;  3KVE A;  4J34 A;  1P2E A;  3GD4 A;  3IF9 A;  1NEN A;  3NNE A;  3GWD A;  5KRQ A;  1CJC A;  1F8S A;  3CPH G;  3P4S A;  2WDQ A;  2CVJ A;  4HA6 A;  3DH9 A;  5U1O A;  3UKL A;  3UP5 A;  3AE3 A;  3DGH A;  3ISH A;  2APG A;  2CDU A;  3NRN A;  4NEW A;  5CKU A;  4EIP A;  3LXD A;  4EIQ A;  2V3B A;  2XVI A;  3AD8 B;  3CGC A;  2Q0K A;  3GYI A;  3P4P A;  1GTH A;  4AOS A;  1TDN A;  1IUU A;  1CC4 A;  4J36 A;  1LQU A;  3UTF A;  2H89 A;  4EQX A;  1VG9 A;  2YG4 A;  1K4Q A;  3AE1 A;  4XXG A;  1OJD A;  2ZZB A;  3T2Z A;  1OJA A;  4EMW A;  4ZCD A;  3K7Q X;  2YWL A;  2WDR A;  4XWR A;  3JSK A;  4BJY A;  4REK A;  2ZBW A;  5TR3 A;  2GR1 A;  1LTX R;  3RP8 A;  4B67 A;  2WEU A;  4KX6 A;  3CPI G;  4X4J A;  1V59 A;  2I0Z A;  2XVE A;  3M13 A;  1PJ6 A;  3H4K A;  3ADA B;  1DJN A;  2C76 A;  4NTC A;  4H2R A;  5KVH A;  1KSS A;  4NNJ A;  3LB8 A;  3ZYX A;  3GMB A;  2C70 A;  4C74 A;  4A79 A;  4B68 A;  1KFY A;  2YLZ A;  4A6N A;  1GSN A;  2V61 A;  5M0Z A;  3IHM A;  4IA5 A;  1NHS A;  1IUS A;  3UKP A;  1BGJ A;  3VRA A;  4DGK A;  4EMJ A;  1TDK A;  4JNA A;  1GRB A;  3DME A;  4J57 A;  3PS9 A;  1JOA A;  4TM3 A;  4A65 A;  1PN0 A;  4CBQ A;  5KOW A;  4BUR A;  3SQP A;  2RGH A;  1E39 A;  2C3D A;  4JDR A;  3QVR A;  1GOS A;  2YR4 A;  3NH3 X;  5CQF A;  1GPE A;  1JRZ A;  4H4P A;  4BV6 A;  1P2H A;  4II3 A;  4APN A;  2AAQ A;  2YLW A;  2V5Z A;  1GEU A;  4XWZ A;  2YVF A;  3Q9T A;  2E5V A;  2UZZ A;  3CNP A;  4TM0 A;  4GF7 A;  5J60 A;  3I6D A;  4JY3 A;  3ATQ A;  4YSZ A;  3AB1 A;  3R9U A;  1PDH A;  4AP1 A;  1YQZ A;  3GWF A;  3UOZ A;  1H84 A;  1ZY8 A;  2VQ7 A;  3C4A A;  1NG3 A;  2B7R A;  3UKK A;  1CJ4 A;  5ER0 A;  4OVI A;  4G74 A;  5JCL A;  4U8K A;  3QJ4 A;  1PBE A;  2VVL G;  5IQ4 A;  1L0V A;  1LV0 A;  2VZ2 A;  2WOI A;  2VVL A;  4USQ A;  4B69 A;  2XFU A;  4DSH A;  3SZF A;  1Q1W A;  5GRT A;  1PJ5 A;  3F8R A;  2GF3 A;  3UKA A;  4EQS A;  1AOG A;  2X99 A;  4FX9 A;  1O5W A;  3GRS A; 
#chains in the Genus database with same CATH homology
 3I3L A;  3AYL A;  3P1W A;  3NTA A;  2YLS A;  4H4U A;  3NK0 X;  3CGE A;  1NEK A;  5BRT A;  2BRA A;  4G6H A;  1ZX9 A;  2X3N A;  3CMM A;  4ZCC A;  3BI5 A;  1GT8 A;  3OC4 A;  4H4W A;  1VDC A;  1ELI A;  2C73 A;  4J33 A;  4OPD A;  3LAD A;  2WPE A;  4NTD A;  1E1L A;  1NHR A;  2WQY A;  3QVP A;  4AP3 A;  1QJD A;  3K7M X;  4RG4 A;  1BZL A;  5KWF A;  3B6D A;  4H2N A;  3G5S A;  4J2W A;  2WBA A;  2YM2 A;  2YR6 A;  3AED A;  3NLC A;  1H86 A;  3V3O A;  2BXS A;  3SY4 A;  2BC0 A;  4Z26 A;  3UP4 A;  1L9E A;  3ATR A;  1GRA A;  2OAM A;  3M0O A;  4PAB A;  4B63 A;  2XLT A;  2DKI A;  3EAO A;  2C65 A;  4U8M A;  1OJ9 A;  2EQ7 A;  1KF6 A;  2GAH B;  5JCI A;  1IUT A;  4I59 A;  1CC6 A;  1H7X A;  2XVH A;  1EL9 A;  3DJD A;  3QSM A;  3G5Q A;  3ALL A;  2WP9 A;  2ZZ0 A;  3QFA A;  4CY8 A;  4Z2R A;  1D7Y A;  1D7L A;  4E0V A;  2Z5Y A;  4GCM A;  2X8H A;  2JB2 A;  4CNJ A;  2B76 A;  2WDV A;  3RP7 A;  3H8L A;  1MOK A;  5C3J A;  3M12 A;  1IUX A;  1IUV A;  2TMD A;  5BUK A;  4CCQ A;  3IC9 A;  4Z43 A;  3CNT A;  1BWC A;  3CNJ A;  2X50 A;  1NHQ A;  3QFB A;  3FBS A;  2FJB A;  1K0J A;  1PBB A;  4Z25 A;  3QSE A;  4YSH A;  3NK2 X;  3S61 A;  3NYC A;  4Z2U A;  2VRL A;  3DJE A;  1B4V A;  1E7P A;  1VRQ B;  3VR9 A;  1LPF A;  4UDQ A;  4WX1 A;  5J7X A;  3UKH A;  5IQ1 A;  3LOV A;  3RED A;  4Z44 A;  2RGO A;  1H81 A;  3CNS A;  1RSG A;  2YVG A;  4D04 A;  2OAL A;  3AD7 B;  1ZKQ A;  1L9D A;  3D8X A;  4WCT A;  1FEA A;  3LJP A;  4JN9 A;  1BKW A;  2GMH A;  2B9W A;  1TDF A;  3NHO X;  4G73 A;  3KD9 A;  1RYI A;  4LA1 A;  3ALJ A;  3FPZ A;  3CGD A;  3NN0 X;  3CND A;  3T0K A;  3DK8 A;  4I58 A;  4X9M A;  2C67 A;  3P4R A;  4RG3 A;  5JCN A;  4USR A;  5FS9 A;  4H50 A;  2O9Z A;  3T2K A;  4ECH A;  1JNR A;  3AEC A;  3PVC A;  5BUL A;  1LVL A;  4A5L A;  2AQJ A;  2EQ8 A;  1O95 A;  3CN8 A;  3HYX A;  3SGL A;  4EQW A;  3AE8 A;  5KOX A;  3C96 A;  4X9N A;  3AE5 A;  1W4X A;  1TYP A;  3BNM A;  3S5W A;  2OA1 A;  2B7S A;  3RNM A;  1NDA A;  4C77 A;  1YKJ A;  3AE2 A;  1PS9 A;  1DJQ A;  4PAA A;  5KMQ A;  3KA7 A;  1S3E A;  2WOW A;  2WP5 A;  1DOB A;  3KKJ A;  2FBW A;  1DNC A;  1EL7 A;  1NG4 A;  4TM1 A;  4N9X A;  3CIR A;  3UKQ A;  1YQ3 A;  2R4J A;  3T31 A;  3NK1 X;  5U63 A;  2GVC A;  3DK4 A;  4LU6 A;  2YVJ A;  5L46 A;  1KDG A;  3BHK A;  3SFD A;  2FJA A;  2WHD A;  4YSY A;  2YAU A;  2YM1 A;  5JCK A;  1E1N A;  3UCL A;  1FOH A;  3ALM A;  1Z6L A;  4GR1 A;  1S2Q A;  1VG0 A;  4YWO A;  2IVD A;  4BK2 A;  1FEC A;  1DOD A;  1KSU A;  3SZ0 A;  1TDO A;  3GDN A;  4NZH A;  1JNZ A;  4YT0 A;  1LQT A;  5HY5 A;  5KMP A;  3ICT A;  5FS6 A;  1FCD A;  4O5U A;  4II2 A;  2VQB A;  1K0I A;  1M6I A;  2GQW A;  4YTM A;  2GEW A;  1TYT A;  2BC1 A;  2PHH A;  2WU5 A;  3D1C A;  2C66 A;  3UKF A;  4YTP A;  4C5O A;  4YTN A;  2RGJ A;  1XAN A;  1Q1R A;  3DK9 A;  2XFN A;  3CPJ G;  5FMH A;  3SFE A;  2YQU A;  1PBD A;  4BK1 A;  2J3N A;  3L8K A;  1MXT A;  2IVE A;  4KPR A;  1H83 A;  1DOC A;  1GES A;  2FJD A;  1UKV G;  3BHF A;  3FMW A;  2C64 A;  3CGB A;  3SZW A;  2XFQ A;  2WES A;  4D03 A;  5U25 A;  2A87 A;  4H7U A;  2W0H A;  3QSS A;  1H7W A;  4J56 A;  2BXR A;  5EBK A;  3SM8 A;  3T37 A;  2GQF A;  3GD3 A;  1COY A;  1E6E A;  1Y56 B;  1PXA A;  1S3B A;  1ZMD A;  4CY6 A;  2XLP A;  2Z5X A;  4YXD A;  3KPK A;  1OJT A;  2RAB A;  4G6G A;  3AE4 A;  4H4Z A;  5IPY A;  3VRB A;  1GET A;  4AT0 A;  1N4V A;  2C7G A;  2JAE A;  3ABV A;  1CHU A;  3AYI A;  3HZL A;  5KVI A;  4B64 A;  5KNL A;  1N1P A;  1REO A;  2BAC A;  4ICY A;  4Y4M A;  2HQM A;  1GRE A;  2C72 A;  2YG5 A;  2A8X A;  2GAG B;  2R4E A;  2XYO A;  2EQ6 A;  1NHP A;  4EM3 A;  2YLX A;  3EF6 A;  1GRH A;  3AYJ A;  4U8J A;  2BS3 A;  2Y6Q A;  2JB3 A;  3GRT A;  3KPF A;  3NYE A;  2BA9 A;  4U8L A;  3NIX A;  3URH A;  1O94 A;  3KLJ A;  4GDP A;  4OCG A;  3VRD B;  3FG2 P;  5EOW A;  1H6V A;  3T2Y A;  1E1M A;  3H8I A;  4OPC A;  4JQ9 A;  3RHA A;  3ZDN A;  3AEF A;  2XVJ A;  1FL2 A;  3DJG X;  3KU9 A;  5FS7 A;  3AE6 A;  4K7Z A;  4OPT A;  4YKF A;  4B1B A;  1Y56 A;  1VQW A;  2WPF A;  1CJ3 A;  2WP6 A;  4JY2 A;  4B66 A;  4FDC B;  4ADW A;  3E1T A;  4H4Q A;  4GAP A;  4H2Q A;  2XDO A;  1CF3 A;  1GTE A;  3C4N A;  4YKG A;  1DXL A;  4LII A;  1FEB A;  4K5S A;  4H4V A;  1Q9I A;  4J31 A;  2GR0 A;  1BGN A;  1M64 A;  4IV9 A;  4G9K A;  3K7T A;  4A7A A;  4M52 A;  1TDE A;  2BRY A;  3AEA A;  1ZOY A;  2GH5 A;  1SEZ A;  2X8C A;  2R0G A;  5HHF A;  4P9S A;  4IA6 A;  1XHC A;  1YY5 A;  1XDI A;  2NVK X;  2X8G A;  2OLN A;  4TLX A;  3NT6 A;  1EL5 A;  3G5R A;  3P4Q A;  3PO7 A;  2A89 A;  1B37 A;  4EM4 A;  1GXF A;  2BAB A;  3SX6 A;  4CCR A;  1ZMC A;  3GYX A;  1K0L A;  3BNU A;  2C75 A;  2Y6R A;  1GRT A;  2C4C A;  3B3R A;  3AE7 A;  2R46 A;  1EBD A;  4HB9 A;  4Y4L A;  2XLU A;  3P9U A;  4A6N B;  1F8W A;  2XLS A;  4U8O A;  1RP0 A;  1JEH A;  4DNA A;  3UOV A;  4EMI A;  5KMR A;  3K30 A;  4GUV A;  2GR2 A;  3EPT A;  5DBJ A;  3NYF A;  2XCG A;  3NG7 X;  4O5Q A;  2H88 A;  1F3P A;  2WOV A;  2ACZ A;  3Q6J A;  1ZK7 A;  2ZZC A;  5GSN A;  1EL8 A;  1PBC A;  2B9Y A;  2GR3 A;  3AEE A;  4K8D A;  1GV4 A;  2BK3 A;  3SXI A;  4U8P A;  4H4X A;  1GER A;  4H4T A;  2JBV A;  1PXC A;  1ONF A;  4UDR A;  4AOX A;  2QCU A;  4NEV A;  4BJZ A;  3DA1 A;  2XVF A;  3AEB A;  2CUL A;  5LV9 A;  2BYB A;  3HYV A;  3ITJ A;  2Q6U A;  2NPX A;  5EB4 A;  4OPU A;  4Y4N A;  3SYI A;  3NN6 X;  2GRT A;  3T14 A;  3HYW A;  3AEG A;  1D4E A;  4TM4 A;  2OLO A;  4FK1 C;  5M10 A;  1X31 B;  4Z2T A;  1ZOV A;  4NTE A;  2Q7V A;  4A99 A;  3GMC A;  1B5Q A;  5C2T A;  1MO9 A;  3AXB A;  1GRG A;  3GYJ A;  4YSX A;  2WU2 A;  3UTE A;  2QA1 A;  2R0C A;  1KNR A;  3UOX A;  3DGZ A;  3L1R A;  1F6M A;  4UP3 A;  3IHG A;  1NAA A;  1NPX A;  2B9X A;  2XLR A;  4U2L A;  2DKH A;  2VRM A;  2VVM A;  4ZN0 A;  5HYM A;  2IID A;  3NGC X;  2XFP A;  1L9C A;  3AE9 A;  4K2X A;  3CTY A;  2YLR A;  1F8R A;  3LZW A;  2E1M A;  4U8N A;  3BI4 A;  2TPR A;  1JRX A;  3F8P A;  1JU2 A;  4K5R A;  3VQR A;  1DOE A;  2GMJ A;  2V3A A;  4B65 A;  2YG7 A;  2EQ9 A;  3NTD A;  3NKS A;  2BK5 A;  1TRB A;  3V3N A;  1CC2 A;  3II4 A;  1YQ4 A;  3RP6 A;  4H4S A;  3GDP A;  1CL0 A;  1QLB A;  1CJ2 A;  2BS4 A;  3AD9 B;  5BVA A;  3OZ2 A;  5JCM A;  4IVM B;  3V76 A;  1D4C A;  3VR8 A;  4JNQ A;  1ZDL A;  5EB5 A;  3O0H A;  2WET A;  3WE0 A;  2BS2 A;  4U8I A;  2CFY A;  2BK4 A;  1S2Y A;  1KNP A;  2E4G A;  2WPC A;  3F8D A;  2JKC A;  1PBF A;  1E1K A;  1PXB A;  2WS3 A;  5FS8 A;  4H4R A;  4BK3 A;  4GRT A;  4CRT A;  1IUW A;  1Y0P A;  1B8S A;  4K22 A;  2JB1 A;  4C3X A;  2BCP A;  2R9Z A;  3UTH A;  3ICS A;  2R0P A;  1OJC A;  4H4Y A;  3UOY A;  3SZC A;  2YG3 A;  1PHH A;  4H2P A;  1N4W A;  2YR5 A;  2QA2 A;  1H82 A;  1N4U A;  4UDP A;  1LJ1 A;  2QAE A;  1D5T A;  1PJ7 A;  2AR8 A;  3IWA A;  3LZX A;  2V60 A;  2C3C A;  2BCG G;  2ARD A;  3BI2 A;  4U2T A;  4C3Y A;  4FK1 A;  1HYU A;  3FIM B;  4MJW A;  4GDE A;  4NWZ A;  4AT2 A;  2XFO A;  5KXJ A;  4OPG A;  2FJE A;  4RSL A;  1JRY A;  1BF3 A;  2R45 A;  1D4D A;  4CNK A;  4DSG A;  5HXI A;  5KMS A;  1GRF A;  3UTG A;  2VOU A;  2V6O A;  4OPL A;  4EQR A;  4U2S A;  1GND A;  3GSI A;  4A9W A;  2PYX A;  3ICR A;  4OPI A;  2YG6 A;  3AWI A;  1IJH A;  4GAV A;  3COX A;  1XPQ A;  3EAN A;  1QO8 A;  2GV8 A;  2YLT A;  1ZP0 A;  2GB0 A;  2Q0L A;  1GAL A;  4TLZ A;  4Z24 A;  1CBO A;  2F5Z A;  2JK6 A;  3DJJ A;  4IVO B;  3KVE A;  4J34 A;  1P2E A;  3GD4 A;  3IF9 A;  1NEN A;  3NNE A;  3GWD A;  5KRQ A;  1CJC A;  1F8S A;  3CPH G;  3P4S A;  2WDQ A;  2CVJ A;  4HA6 A;  3DH9 A;  5U1O A;  3UKL A;  3UP5 A;  3AE3 A;  3DGH A;  3ISH A;  2APG A;  2CDU A;  3NRN A;  4NEW A;  5CKU A;  4EIP A;  3LXD A;  4EIQ A;  2V3B A;  2XVI A;  3AD8 B;  3CGC A;  2Q0K A;  3GYI A;  3P4P A;  1GTH A;  4AOS A;  1TDN A;  1IUU A;  1CC4 A;  4J36 A;  1LQU A;  3UTF A;  2H89 A;  4EQX A;  1VG9 A;  2YG4 A;  1K4Q A;  3AE1 A;  4XXG A;  1OJD A;  2ZZB A;  3T2Z A;  1OJA A;  4EMW A;  4ZCD A;  3K7Q X;  2YWL A;  2WDR A;  4XWR A;  3JSK A;  4BJY A;  4REK A;  2ZBW A;  5TR3 A;  2GR1 A;  1LTX R;  3RP8 A;  4B67 A;  2WEU A;  4KX6 A;  3CPI G;  4X4J A;  1V59 A;  2I0Z A;  2XVE A;  3M13 A;  1PJ6 A;  3H4K A;  3ADA B;  1DJN A;  2C76 A;  4NTC A;  4H2R A;  5KVH A;  1KSS A;  4NNJ A;  3LB8 A;  3ZYX A;  3GMB A;  2C70 A;  4C74 A;  4A79 A;  4B68 A;  1KFY A;  2YLZ A;  4A6N A;  1GSN A;  2V61 A;  5M0Z A;  3IHM A;  4IA5 A;  1NHS A;  1IUS A;  3UKP A;  1BGJ A;  3VRA A;  4DGK A;  4EMJ A;  1TDK A;  4JNA A;  1GRB A;  3DME A;  4J57 A;  3PS9 A;  1JOA A;  4TM3 A;  4A65 A;  1PN0 A;  4CBQ A;  5KOW A;  4BUR A;  3SQP A;  2RGH A;  1E39 A;  2C3D A;  4JDR A;  3QVR A;  1GOS A;  2YR4 A;  3NH3 X;  5CQF A;  1GPE A;  1JRZ A;  4H4P A;  4BV6 A;  1P2H A;  4II3 A;  4APN A;  2AAQ A;  2YLW A;  2V5Z A;  1GEU A;  4XWZ A;  2YVF A;  3Q9T A;  2E5V A;  2UZZ A;  3CNP A;  4TM0 A;  4GF7 A;  5J60 A;  3I6D A;  4JY3 A;  3ATQ A;  4YSZ A;  3AB1 A;  3R9U A;  1PDH A;  4AP1 A;  1YQZ A;  3GWF A;  3UOZ A;  1H84 A;  1ZY8 A;  2VQ7 A;  3C4A A;  1NG3 A;  2B7R A;  3UKK A;  1CJ4 A;  5ER0 A;  4OVI A;  4G74 A;  5JCL A;  4U8K A;  3QJ4 A;  1PBE A;  2VVL G;  5IQ4 A;  1L0V A;  1LV0 A;  2VZ2 A;  2WOI A;  2VVL A;  4USQ A;  4B69 A;  2XFU A;  4DSH A;  3SZF A;  1Q1W A;  5GRT A;  1PJ5 A;  3F8R A;  2GF3 A;  3UKA A;  4EQS A;  1AOG A;  2X99 A;  4FX9 A;  1O5W A;  3GRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...