3P1WA

Crystal structure of rab gdi from plasmodium falciparum, pfl2060c
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
444
structure length
442
Chain Sequence
b'QGEHYDVIILGTGLKECILSGLLSHYGKKILVLDRNPYYGGETASLNLTNLYNTFKPKENIPSKYGENRHWNVDLIPKFILVGGNLVKILKKTRVTNYLEWLVVEGSYVYQHQKKGFLTSEKFIHKVPATDMEALVSPLLSLMEKNRCKNFYQYVSEWDANKRNTWDNLDPYKLTMLEIYKHFNLCQLTIDFLGHAVALYLNDDYLKQPAYLTLERIKLYMQSISAFGKSPFIYPLYGLGGIPEGFSRMCAINTFMLNKNVVDFVFDDDNKVCGIKSSDGEIAYCDKVICDPSYVMHLKNKIKKIGQVIRCICILSNPIPETNQTNSCQIIIPQNQLNRKSDIYINLVSFQHGVTLKGKYIAIVSATVETNNPIKEIEKPLELLGTIEEKFVKISDLYVSTSKKPADNIFVTSSYDATSHFETATNDLLQIWENLWGQKLNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RabGDI protein
molecule tags Protein transport
source organism Plasmodium falciparum 3d7
publication title Crystal Structure of RAB GDI from Plasmodium Falciparum, PFL2060c
rcsb
total genus 138
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2010-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3p1wA03
3.30.519.10 Alpha Beta 2-Layer Sandwich Guanine Nucleotide Dissociation Inhibitor; domain 2 Guanine Nucleotide Dissociation Inhibitor, domain 2 3p1wA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3p1wA01
1BGNA 1F6MA 3L1RA 2Z5XA 3GD3A 3NG7X 3FMWA 1N4VA 5KRQA 2BK5A 3PO7A 1FCDA 1K0IA 1ZY8A 5L46A 4H4XA 3EANA 2ZBWA 4J34A 1H7XA 2GR3A 2QA2A 2WETA 3SGLA 5FS6A 1H7WA 1CBOA 2R0GA 1NHSA 3UTHA 4YSHA 1KF6A 3VRBA 2WHDA 1GOSA 4A7AA 2WP9A 1L0VA 1YQ3A 4B69A 1V59A 4H4VA 1REOA 1CJCA 4A65A 2WS3A 4K7ZA 3DJEA 2Q6UA 1YY5A 2B9YA 3AXBA 3CNSA 2GAGB 4YSZA 1GNDA 3Q9TA 5U1OA 4J56A 4UDQA 2YR5A 2OLNA 4FK1C 4CRTA 4J2WA 3H4KA 1B8SA 3QJ4A 1Q1RA 4TM0A 1CJ4A 4TM4A 3B3RA 1YKJA 3CNDA 3II4A 2Q7VA 1E1LA 1QO8A 4JN9A 2A87A 3VR8A 3CPHG 4IV9A 1FEBA 2XVFA 1EL7A 3AYLA 3IWAA 3DA1A 3QSMA 1H83A 3M12A 3AEFA 1OJTA 4EM3A 2XLPA 3NH3X 4WCTA 1CC2A 1N4WA 2JK6A 1NHPA 1HYUA 3BHKA 1PBDA 1GESA 5FS7A 2B76A 1DOCA 3DGZA 3SQPA 1FEAA 1FOHA 3ICSA 4A5LA 2J3NA 5HYMA 2WU5A 5KOWA 1S2QA 1TYTA 5ER0A 1NENA 4RG3A 3SFEA 2GR1A 5BULA 3LADA 2WESA 5JCKA 3KVEA 2X8CA 3REDA 4U2SA 3CPIG 1GRBA 3AEAA 4BJZA 1JRXA 3UTGA 1GXFA 2XFPA 3CNTA 2VVLA 3I6DA 1MXTA 3HZLA 4H4ZA 2V3AA 3I3LA 4TLXA 1NHQA 3VRAA 2ZZBA 1PJ5A 1W4XA 1NPXA 2GR0A 3UP4A 4YTMA 2PHHA 3P4RA 3FG2P 4MJWA 4BK1A 2XLSA 4AP1A 2C65A 4OVIA 2W0HA 5C2TA 2AQJA 4X9NA 2XVIA 3ICRA 3E1TA 1LJ1A 2X8HA 1Y56A 3AE9A 3AEEA 2X50A 2YAUA 1TDEA 1Q9IA 2XLUA 4C74A 2VVMA 3UTEA 3T37A 2GMJA 4CCQA 4Z2RA 2IVDA 3P1WA 3EPTA 3AEDA 2VZ2A 4PAAA 3UKQA 4DSGA 4K5RA 3M13A 4NZHA 1DODA 5LV9A 4P9SA 3BHFA 4B63A 3KPFA 1KSUA 3GYIA 5TR3A 1RSGA 2BC0A 2JKCA 2BK4A 2YM1A 2RABA 3QVPA 4Z24A 4D04A 1TRBA 3ADAB 3NYEA 1EL8A 5M0ZA 5HY5A 3C4NA 3CGBA 3DMEA 4TM3A 5BUKA 5J60A 3AE3A 2VRMA 1H82A 2BS4A 2VVLG 2C64A 2Z5YA 2AR8A 3NK1X 1KSSA 2JB3A 1PXAA 4JDRA 4U8NA 3VQRA 1O95A 1LV0A 3AE2A 3GDPA 4A6NB 3DGHA 4OPCA 3KU9A 2TMDA 2CDUA 4U2LA 3DK9A 1KNRA 2QA1A 1GALA 2WPFA 2R0PA 1ZOYA 3NLCA 1CC6A 2BS2A 4C77A 2C67A 3K7MX 5FS9A 4GRTA 2TPRA 3LB8A 2V60A 2GMHA 2OA1A 4B64A 4X9MA 1KFYA 2YLXA 2XYOA 4UDRA 2YWLA 3K7TA 3KLJA 1EL5A 3NYCA 2EQ8A 4JQ9A 3JSKA 4IA6A 2GEWA 2CULA 3RNMA 1LQTA 1AOGA 4U8JA 3SFDA 2JBVA 1GTEA 3D1CA 3NGCX 2GAHB 4YSYA 3CN8A 5CQFA 1PN0A 1F3PA 1ZDLA 5HHFA 4B66A 1E7PA 3BI4A 3FPZA 1BKWA 4YSXA 1F8WA 2E5VA 5J7XA 3UCLA 1IUVA 5EOWA 4YT0A 1GETA 3F8RA 3NK0X 2R46A 1PXBA 4EIPA 3QSEA 1E1KA 2YLTA 3UOYA 1NEKA 4OPLA 4X4JA 2WP5A 4ZN0A 3UOZA 2FJAA 3UKFA 4H4RA 5KOXA 4J33A 1B5QA 3PVCA 5FMHA 3AD9B 4AOXA 2DKIA 1S2YA 4H2NA 4LU6A 4O5QA 5GRTA 1O5WA 5M10A 1MO9A 3UKLA 3G5SA 1KDGA 3V3NA 3CGEA 4YKGA 2NPXA 4EMWA 5IPYA 1OJCA 4YWOA 4BJYA 3CNJA 2VOUA 1E6EA 2XVHA 4KX6A 1Q1WA 3KA7A 4H4UA 4FX9A 4A9WA 2JAEA 3ALLA 1D4CA 3NK2X 2ZZCA 2EQ7A 3BI5A 2ZZ0A 3P9UA 2WDQA 3P4SA 3QSSA 3ICTA 3NN6X 1Y56B 2X8GA 3UOVA 3ATQA 4CCRA 4CBQA 4XWRA 3G5RA 2CFYA 4ZCCA 5GSNA 3AE1A 3Q6JA 3RP7A 4GCMA 4IVMB 3LOVA 4JNAA 5U63A 1LQUA 2C7GA 2XVEA 2FJBA 4NEWA 3OZ2A 4U8LA 4EQXA 3EAOA 1L9CA 2GB0A 3GWDA 4NEVA 3AE4A 2YG6A 3CPJG 4H4PA 1DXLA 3C4AA 3IC9A 1PHHA 3DJGX 2YLSA 1K0JA 2XFQA 1CJ3A 2Y6QA 1MOKA 3ISHA 2Q0KA 4GUVA 3GRSA 1E1NA 4LIIA 3ITJA 4OPUA 4Y4LA 3VRDB 3AE7A 4EM4A 4Z26A 3K30A 2YG7A 1IUUA 1GT8A 2BC1A 2NVKX 2YG5A 2UZZA 1PBBA 1P2EA 3UP5A 4DNAA 3F8PA 3QFBA 4Z2UA 1JOAA 5DBJA 4AT0A 1GRGA 1TDFA 3GRTA 4YTPA 1PXCA 3AWIA 3H8LA 3AE6A 2V6OA 2WOWA 3C96A 4A6NA 4BK2A 4H2QA 4H4QA 3DK4A 1N4UA 2PYXA 2WP6A 3ABVA 4ECHA 5JCLA 3DJDA 3AYJA 1K0LA 2Q0LA 3NTDA 3IHMA 2RGHA 4EIQA 3FIMB 3AE8A 3B6DA 3L8KA 2IVEA 4BK3A 4U2TA 2GQFA 3ALJA 1YQZA 2WDVA 4RG4A 4U8OA 1IUXA 2BCPA 1F8RA 1COYA 1LVLA 4OPGA 2WPCA 3V76A 2FBWA 1VG9A 4ICYA 4U8PA 2R0CA 3NYFA 2E1MA 4ADWA 2C3CA 3OC4A 1D7LA 4K5SA 2QAEA 2FJEA 2BS3A 1ELIA 1ZMCA 1X31B 1PS9A 3UKHA 4JY2A 2XLTA 1BGJA 1NG3A 4NTEA 3CTYA 4NTCA 4APNA 2BABA 4OPDA 1GPEA 2ARDA 1DOEA 1VDCA 4CY6A 1RYIA 4AOSA 3G5QA 3UKAA 4U8KA 3UKPA 3GMCA 3O0HA 2BCGG 1K4QA 2YVJA 3GSIA 3QVRA 2B7SA 3NIXA 4M52A 3V3OA 2BACA 4LA1A 2IIDA 1M64A 3GDNA 4H7UA 1H86A 4I59A 1XDIA 1Y0PA 3ALMA 4U8IA 5KVHA 3AYIA 3P4QA 4XXGA 1H81A 4C5OA 2FJDA 3NRNA 2GV8A 3NKSA 4IVOB 4GF7A 2GF3A 2XVJA 1Z6LA 3DJJA 2XFOA 1BZLA 1TDNA 1RP0A 3K7QX 1LPFA 1EL9A 4BURA 1S3EA 1GEUA 2WQYA 1PBFA 4H4SA 1PJ7A 2OAMA 4BV6A 2A8XA 2X3NA 4TLZA 1PDHA 2R9ZA 4A99A 1CJ2A 2YVGA 5JCNA 2YLRA 1IUWA 3S61A 3AD8B 4NTDA 4O5UA 5EBKA 1EBDA 2WBAA 3BNUA 1E39A 1OJAA 1JRYA 3DK8A 2V3BA 2WDRA 2JB2A 5KXJA 1BWCA 5IQ4A 4I58A 1DNCA 1D5TA 1ONFA 4GR1A 4USQA 2B7RA 1GRHA 2B9WA 1JNZA 4Z25A 5BRTA 1GREA 2R4EA 1DJQA 3D8XA 1YQ4A 2B9XA 3NN0X 3NNEA 3URHA 1LTXR 3CNPA 3S5WA 2F5ZA 4J36A 1S3BA 2BXRA 2WOIA 2C3DA 1N1PA 1JU2A 4YKFA 4H50A 4DGKA 4FDCB 4WX1A 2O9ZA 2C75A 3BNMA 4B68A 1O94A 4J57A 2WPEA 2V61A 1D4DA 3GYJA 4H2RA 3ZDNA 3CIRA 4C3YA 3PS9A 1PBCA 1TDOA 3LZXA 2CVJA 1GSNA 4H2PA 5EB4A 2WU2A 1VG0A 3VR9A 4DSHA 3AB1A 3SM8A 2YG3A 3GD4A 3NHOX 4JY3A 4FK1A 4A79A 4E0VA 1XHCA 3IF9A 2OLOA 3AD7B 4K22A 1JEHA 3UTFA 2R4JA 5U25A 2YQUA 1FL2A 2JB1A 2R45A 4K8DA 3COXA 3AECA 4C3XA 3F8DA 1GRTA 4EQSA 1B37A 1L9EA 3NTAA 4B65A 4REKA 4AP3A 3GMBA 3KD9A 4U8MA 1PBEA 3RP8A 4GDPA 4KPRA 1ZX9A 1H84A 2QCUA 3UKKA 1B4VA 2A89A 3LXDA 2Y6RA 4EMIA 1L9DA 1ZMDA 3P4PA 3ZYXA 3BI2A 3EF6A 2H89A 3R9UA 1GRAA 1CHUA 4EQRA 4USRA 4YXDA 2XFNA 4AT2A 5IQ1A 4RSLA 2VQ7A 2BK3A 2YR6A 3DH9A 3M0OA 1GV4A 2GH5A 4UDPA 1IUTA 3LZWA 3IHGA 2X99A 5KWFA 3RHAA 4Z43A 2XDOA 4J31A 2ACZA 2C72A 2C70A 2C66A 2OALA 3CGDA 4K2XA 4PABA 4XWZA 1QJDA 4H4WA 2E4GA 3AEBA 1OJDA 1E1MA 1UKVG 2YG4A 2XLRA 2RGOA 5HXIA 2YVFA 1ZP0A 2APGA 1TDKA 3CGCA 1PJ6A 4YTNA 2EQ6A 2WOVA 2YR4A 4TM1A 2HQMA 3QFAA 1IJHA 2BA9A 2RGJA 4EQWA 1OJ9A 4OCGA 4Z44A 2XFUA 1GRFA 5JCMA 5JCIA 2DKHA 1DOBA 2C76A 5CKUA 2EQ9A 4H4YA 3ATRA 1VRQB 1D7YA 4UP3A 4EMJA 1D4EA 4CNKA 1JNRA 1NHRA 1SEZA 5C3JA 3FBSA 4OPIA 2BYBA 1KNPA 4Y4MA 4Z2TA 2YLZA 2C73A 4B67A 1F8SA 2YM2A 1CF3A 1XPQA 2GVCA 5BVAA 1NAAA 4N9XA 3UOXA 2H88A 2XCGA 4CNJA 4OPTA 4D03A 4Y4NA 1P2HA 2BXSA 1XANA 1CC4A 4JNQA 1BF3A 2YLWA 4B1BA 3LJPA 3NT6A 5EB5A 3KKJA 1ZK7A 1TYPA 1DJNA 4GDEA 1QLBA 1IUSA 4HB9A 1VQWA 1JRZA 1ZOVA 4H4TA 5FS8A 3WE0A 2GR2A 3AE5A 1GERA 1NG4A 2V5ZA 1CL0A 2GRTA 3AEGA 3H8IA 2VRLA 5KVIA 2WEUA 1H6VA 1M6IA 4HA6A 4CY8A 2GQWA 1NDAA 1ZKQA 2I0ZA 2VQBA 4IA5A 3GWFA 2AAQA 1FECA 4ZCDA 1GTHA 3RP6A
chains in the Genus database with same CATH superfamily
1BGNA 1F6MA 3L1RA 2Z5XA 3GD3A 3NG7X 3FMWA 1N4VA 5KRQA 2BK5A 3PO7A 1FCDA 1K0IA 1ZY8A 5L46A 4H4XA 3EANA 2ZBWA 4J34A 1H7XA 2GR3A 2QA2A 2WETA 3SGLA 5FS6A 1H7WA 1CBOA 2R0GA 1NHSA 3UTHA 4YSHA 1KF6A 3VRBA 2WHDA 1GOSA 4A7AA 2WP9A 5KMQA 1L0VA 1YQ3A 4B69A 1V59A 4H4VA 1REOA 1CJCA 4A65A 2WS3A 4K7ZA 3DJEA 2Q6UA 1YY5A 2B9YA 3AXBA 3CNSA 2GAGB 4YSZA 1GNDA 3Q9TA 5U1OA 4J56A 4UDQA 2YR5A 2OLNA 4FK1C 4CRTA 4J2WA 3H4KA 1B8SA 3QJ4A 1Q1RA 4TM0A 1CJ4A 4TM4A 3B3RA 1YKJA 3CNDA 3II4A 2Q7VA 1E1LA 1QO8A 4JN9A 2A87A 3VR8A 3CPHG 4IV9A 1FEBA 2XVFA 1EL7A 3AYLA 3IWAA 3DA1A 3QSMA 1H83A 3M12A 3AEFA 1OJTA 4EM3A 2XLPA 3SYIA 3NH3X 4WCTA 1CC2A 1N4WA 2JK6A 1NHPA 1HYUA 3BHKA 1PBDA 1GESA 5FS7A 2B76A 1DOCA 3DGZA 3SQPA 1FEAA 1FOHA 3ICSA 4A5LA 2J3NA 5HYMA 2WU5A 5KOWA 3HYWA 1S2QA 1TYTA 5ER0A 1NENA 4RG3A 3T2YA 3SFEA 2GR1A 5BULA 3HYXA 3LADA 2WESA 5JCKA 3KVEA 2X8CA 3REDA 4U2SA 3CPIG 1GRBA 3AEAA 4BJZA 1JRXA 3UTGA 1GXFA 2XFPA 3CNTA 2VVLA 3I6DA 1MXTA 3HZLA 4H4ZA 2V3AA 3I3LA 4TLXA 1NHQA 3VRAA 2ZZBA 1PJ5A 1W4XA 1NPXA 2GR0A 3UP4A 4YTMA 2PHHA 3P4RA 3FG2P 4MJWA 4BK1A 2XLSA 4AP1A 2C65A 4OVIA 2W0HA 5C2TA 2AQJA 4X9NA 2XVIA 3ICRA 3E1TA 5KMRA 1LJ1A 2X8HA 1Y56A 3AE9A 3AEEA 4II3A 2X50A 2YAUA 1TDEA 1Q9IA 2XLUA 4C74A 2VVMA 3UTEA 3T37A 2GMJA 4CCQA 4Z2RA 2IVDA 3P1WA 3EPTA 3AEDA 2VZ2A 4PAAA 3UKQA 4DSGA 4K5RA 3M13A 4NZHA 1DODA 5LV9A 4P9SA 3BHFA 4B63A 3KPFA 1KSUA 3GYIA 5TR3A 1RSGA 2BC0A 2JKCA 2BK4A 2YM1A 2RABA 3QVPA 4Z24A 4D04A 1TRBA 3ADAB 4G73A 3NYEA 1EL8A 5M0ZA 5HY5A 3C4NA 3CGBA 3DMEA 4TM3A 5BUKA 5J60A 3AE3A 2VRMA 1H82A 2BS4A 2VVLG 2C64A 2Z5YA 2AR8A 3NK1X 1KSSA 2JB3A 1PXAA 4JDRA 4U8NA 3VQRA 1O95A 1LV0A 3AE2A 3GDPA 4A6NB 3DGHA 4OPCA 3KU9A 2TMDA 2CDUA 4U2LA 3DK9A 1KNRA 2QA1A 1GALA 2WPFA 2R0PA 1ZOYA 3NLCA 1CC6A 2BS2A 4C77A 2C67A 3K7MX 5FS9A 4GRTA 2TPRA 4GAVA 3LB8A 2V60A 2GMHA 2OA1A 4B64A 4X9MA 1KFYA 2YLXA 2XYOA 4UDRA 2YWLA 3K7TA 3KLJA 1EL5A 3NYCA 2EQ8A 4JQ9A 3JSKA 4GAPA 4IA6A 2GEWA 2CULA 3RNMA 1LQTA 1AOGA 4U8JA 3SFDA 2JBVA 1GTEA 3D1CA 3NGCX 2GAHB 4YSYA 3CN8A 5CQFA 1PN0A 1F3PA 1ZDLA 3GYXA 5HHFA 3T31A 4B66A 1E7PA 3BI4A 3FPZA 1BKWA 4G6HA 3SZ0A 4YSXA 1F8WA 2E5VA 5J7XA 3UCLA 1IUVA 5EOWA 4YT0A 1GETA 3F8RA 3NK0X 2R46A 1PXBA 4EIPA 3QSEA 1E1KA 2YLTA 3SXIA 3UOYA 1NEKA 4OPLA 4X4JA 4NNJA 2WP5A 4ZN0A 3UOZA 2FJAA 3UKFA 4H4RA 5KOXA 4J33A 1B5QA 3PVCA 5FMHA 3AD9B 4AOXA 2DKIA 1S2YA 4H2NA 4LU6A 4O5QA 5GRTA 1O5WA 5M10A 1MO9A 3UKLA 3G5SA 1KDGA 3V3NA 3CGEA 4YKGA 2NPXA 4EMWA 5IPYA 1OJCA 4YWOA 4G74A 4BJYA 3CNJA 2VOUA 1E6EA 2XVHA 4KX6A 1Q1WA 3KA7A 4H4UA 4FX9A 4A9WA 2JAEA 3ALLA 1D4CA 4EQSA 3NK2X 2ZZCA 2EQ7A 3BI5A 2ZZ0A 3P9UA 2WDQA 3P4SA 3QSSA 3ICTA 3NN6X 1Y56B 2X8GA 3UOVA 3ATQA 4CCRA 4CBQA 4XWRA 3G5RA 2CFYA 4ZCCA 5GSNA 3AE1A 3Q6JA 3RP7A 4GCMA 4IVMB 3LOVA 4JNAA 5U63A 1LQUA 2C7GA 2XVEA 2FJBA 4NEWA 3OZ2A 4U8LA 4EQXA 3EAOA 1L9CA 2GB0A 3GWDA 4NEVA 3AE4A 2YG6A 3CPJG 4H4PA 1DXLA 3C4AA 3IC9A 1PHHA 3DJGX 2YLSA 1K0JA 2XFQA 1CJ3A 2Y6QA 1MOKA 3ISHA 2Q0KA 4GUVA 3GRSA 1E1NA 4LIIA 3ITJA 4OPUA 4Y4LA 3VRDB 3AE7A 4EM4A 4Z26A 3K30A 2YG7A 1IUUA 1GT8A 2BC1A 2NVKX 2YG5A 2UZZA 1PBBA 1P2EA 3UP5A 4DNAA 3F8PA 3QFBA 4Z2UA 1JOAA 5DBJA 4AT0A 1GRGA 1TDFA 3GRTA 4YTPA 1PXCA 3AWIA 3H8LA 3AE6A 2V6OA 2WOWA 3C96A 4A6NA 4BK2A 4H2QA 4H4QA 3T0KA 3DK4A 1N4UA 2PYXA 2WP6A 3ABVA 4ECHA 5JCLA 3DJDA 3AYJA 1K0LA 2Q0LA 3NTDA 3IHMA 2RGHA 4EIQA 3FIMB 3AE8A 3B6DA 3L8KA 2IVEA 4BK3A 4U2TA 2GQFA 5KMSA 3ALJA 1YQZA 2WDVA 4RG4A 4U8OA 1IUXA 2BCPA 1F8RA 1COYA 1LVLA 4OPGA 2WPCA 3V76A 2FBWA 1VG9A 4ICYA 4U8PA 2R0CA 3NYFA 2E1MA 4ADWA 2C3CA 3OC4A 1D7LA 4K5SA 2QAEA 2FJEA 2BS3A 1ELIA 1ZMCA 1X31B 1PS9A 3UKHA 4JY2A 2XLTA 1BGJA 1NG3A 4NTEA 3CTYA 4NTCA 4APNA 2BABA 4OPDA 1GPEA 2ARDA 1DOEA 1VDCA 4CY6A 1RYIA 4AOSA 3G5QA 3UKAA 4U8KA 3UKPA 3GMCA 3O0HA 2BCGG 1K4QA 2YVJA 3GSIA 3QVRA 2B7SA 3NIXA 4M52A 4NWZA 3V3OA 2BACA 4LA1A 2IIDA 1M64A 3GDNA 4H7UA 1H86A 4I59A 1XDIA 1Y0PA 3ALMA 4U8IA 3SZWA 3AYIA 3P4QA 4XXGA 1H81A 5KMPA 5KVHA 4C5OA 2FJDA 3NRNA 2GV8A 3NKSA 4IVOB 4GF7A 2GF3A 3CMMA 2XVJA 1Z6LA 3DJJA 2XFOA 1BZLA 1TDNA 1RP0A 3K7QX 1LPFA 1EL9A 4BURA 1S3EA 1GEUA 2WQYA 1PBFA 4H4SA 1PJ7A 2OAMA 4BV6A 2A8XA 2X3NA 4TLZA 1PDHA 2R9ZA 4A99A 1CJ2A 2YVGA 5JCNA 2YLRA 1IUWA 3S61A 3AD8B 4NTDA 4O5UA 5EBKA 1EBDA 2WBAA 3BNUA 1E39A 1OJAA 1JRYA 3DK8A 2V3BA 2WDRA 3T2KA 3KPKA 2JB2A 5KXJA 1BWCA 5IQ4A 4I58A 1DNCA 1D5TA 1ONFA 4GR1A 4USQA 2B7RA 1GRHA 2B9WA 1JNZA 4Z25A 5BRTA 1GREA 2R4EA 1DJQA 3D8XA 1YQ4A 2B9XA 3NN0X 3NNEA 3URHA 1LTXR 3CNPA 3S5WA 2F5ZA 4J36A 1S3BA 2BXRA 2WOIA 2C3DA 1N1PA 1JU2A 4YKFA 4H50A 4DGKA 4FDCB 4WX1A 2O9ZA 2C75A 3BNMA 4B68A 1O94A 4J57A 2WPEA 2V61A 1D4DA 3GYJA 4H2RA 3ZDNA 3CIRA 4C3YA 3PS9A 1PBCA 1TDOA 3LZXA 2CVJA 1GSNA 4H2PA 5EB4A 2WU2A 1VG0A 3VR9A 4DSHA 5KNLA 3AB1A 3SM8A 2YG3A 3GD4A 3NHOX 2C4CA 4JY3A 4FK1A 3SY4A 4A79A 4E0VA 1XHCA 3IF9A 2OLOA 3AD7B 4K22A 1JEHA 3UTFA 2R4JA 5U25A 2YQUA 1FL2A 2JB1A 2R45A 3HYVA 3COXA 3AECA 4K8DA 3F8DA 1GRTA 4C3XA 1B37A 1L9EA 2BRYA 3NTAA 4B65A 4REKA 4AP3A 3GMBA 3KD9A 4U8MA 1PBEA 3RP8A 4GDPA 4KPRA 1ZX9A 1H84A 2QCUA 3UKKA 1B4VA 2A89A 3LXDA 2Y6RA 4EMIA 1L9DA 1ZMDA 3P4PA 3ZYXA 3BI2A 3EF6A 2H89A 3R9UA 1GRAA 1CHUA 4EQRA 4USRA 4YXDA 2XFNA 4AT2A 5IQ1A 4RSLA 2VQ7A 2BK3A 2YR6A 3DH9A 3M0OA 1GV4A 2GH5A 4UDPA 1IUTA 3LZWA 3IHGA 2X99A 5KWFA 3RHAA 3T14A 2XDOA 4J31A 4Z43A 2ACZA 2C72A 2C70A 2C66A 2OALA 3CGDA 4K2XA 4PABA 4XWZA 1QJDA 4H4WA 2E4GA 3AEBA 1OJDA 1E1MA 1UKVG 2YG4A 2XLRA 2RGOA 5HXIA 2YVFA 1ZP0A 2APGA 1TDKA 3CGCA 1PJ6A 4YTNA 2EQ6A 2WOVA 2YR4A 4TM1A 2HQMA 3QFAA 2BA9A 1IJHA 2RGJA 4G9KA 4EQWA 1OJ9A 4OCGA 4Z44A 2XFUA 1GRFA 5JCMA 5JCIA 2DKHA 1DOBA 2C76A 5CKUA 2EQ9A 4H4YA 3ATRA 1VRQB 1D7YA 4UP3A 4EMJA 4G6GA 1D4EA 4CNKA 1JNRA 1NHRA 1SEZA 5C3JA 3FBSA 4OPIA 2BYBA 1KNPA 4Y4MA 4Z2TA 2YLZA 2C73A 4B67A 1F8SA 2YM2A 1CF3A 1XPQA 2GVCA 5BVAA 1NAAA 4N9XA 3UOXA 3SZCA 2H88A 3SZFA 4II2A 2XCGA 3SX6A 4CNJA 4OPTA 4D03A 4Y4NA 1P2HA 2BXSA 1XANA 1CC4A 4JNQA 1BF3A 2YLWA 4B1BA 3LJPA 3NT6A 5EB5A 2BRAA 3KKJA 3T2ZA 1ZK7A 1TYPA 1DJNA 4GDEA 1QLBA 1IUSA 4HB9A 1VQWA 1JRZA 1ZOVA 4H4TA 3WE0A 5FS8A 2GR2A 3AE5A 1GERA 1NG4A 2V5ZA 1CL0A 2GRTA 3AEGA 3H8IA 2VRLA 5KVIA 2WEUA 1H6VA 1M6IA 4HA6A 4CY8A 2GQWA 1NDAA 1ZKQA 2I0ZA 2VQBA 4IA5A 3GWFA 2AAQA 1FECA 4ZCDA 1GTHA 3RP6A
chains in the Genus database with same CATH topology
1BGNA 1F6MA 3L1RA 2Z5XA 3GD3A 3NG7X 3FMWA 1N4VA 5KRQA 2BK5A 3PO7A 1FCDA 1K0IA 1ZY8A 5L46A 4H4XA 3EANA 2ZBWA 4J34A 1H7XA 2GR3A 2QA2A 2WETA 3SGLA 5FS6A 1H7WA 1CBOA 2R0GA 1NHSA 3UTHA 4YSHA 1KF6A 3VRBA 2WHDA 1GOSA 4A7AA 2WP9A 5KMQA 1L0VA 1YQ3A 4B69A 1V59A 4H4VA 1REOA 1CJCA 4A65A 2WS3A 4K7ZA 3DJEA 2Q6UA 1YY5A 2B9YA 3AXBA 3CNSA 2GAGB 4YSZA 1GNDA 3Q9TA 5U1OA 4J56A 4UDQA 2YR5A 2OLNA 4FK1C 4CRTA 4J2WA 3H4KA 1B8SA 3QJ4A 1Q1RA 4TM0A 1CJ4A 4TM4A 3B3RA 1YKJA 3CNDA 3II4A 2Q7VA 1E1LA 1QO8A 4JN9A 2A87A 3VR8A 3CPHG 4IV9A 1FEBA 2XVFA 1EL7A 3AYLA 3IWAA 3DA1A 3QSMA 1H83A 3M12A 3AEFA 1OJTA 4EM3A 2XLPA 3SYIA 3NH3X 4WCTA 1CC2A 1N4WA 2JK6A 1NHPA 1HYUA 3BHKA 1PBDA 1GESA 5FS7A 2B76A 1DOCA 3DGZA 3SQPA 1FEAA 1FOHA 3ICSA 4A5LA 2J3NA 5HYMA 2WU5A 5KOWA 3HYWA 1S2QA 1TYTA 5ER0A 1NENA 4RG3A 3T2YA 3SFEA 2GR1A 5BULA 3HYXA 3LADA 2WESA 5JCKA 3KVEA 2X8CA 3REDA 4U2SA 3CPIG 1GRBA 3AEAA 4BJZA 1JRXA 3UTGA 1GXFA 2XFPA 3CNTA 2VVLA 3I6DA 1MXTA 3HZLA 4H4ZA 2V3AA 3I3LA 4TLXA 1NHQA 3VRAA 2ZZBA 1PJ5A 1W4XA 1NPXA 2GR0A 3UP4A 4YTMA 2PHHA 3P4RA 3FG2P 4MJWA 4BK1A 2XLSA 4AP1A 2C65A 4OVIA 2W0HA 5C2TA 2AQJA 4X9NA 2XVIA 3ICRA 3E1TA 5KMRA 1LJ1A 2X8HA 1Y56A 3AE9A 3AEEA 4II3A 2X50A 2YAUA 1TDEA 1Q9IA 2XLUA 4C74A 2VVMA 3UTEA 3T37A 2GMJA 4CCQA 4Z2RA 2IVDA 3P1WA 3EPTA 3AEDA 2VZ2A 4PAAA 3UKQA 4DSGA 4K5RA 3M13A 4NZHA 1DODA 5LV9A 4P9SA 3BHFA 4B63A 3KPFA 1KSUA 3GYIA 5TR3A 1RSGA 2BC0A 2JKCA 2BK4A 2YM1A 2RABA 3QVPA 4Z24A 4D04A 1TRBA 3ADAB 4G73A 3NYEA 1EL8A 5M0ZA 5HY5A 3C4NA 3CGBA 3DMEA 4TM3A 5BUKA 5J60A 3AE3A 2VRMA 1H82A 2BS4A 2VVLG 2C64A 2Z5YA 2AR8A 3NK1X 1KSSA 2JB3A 1PXAA 4JDRA 4U8NA 3VQRA 1O95A 1LV0A 3AE2A 3GDPA 4A6NB 3DGHA 4OPCA 3KU9A 2TMDA 2CDUA 4U2LA 3DK9A 1KNRA 2QA1A 1GALA 2WPFA 2R0PA 1ZOYA 3NLCA 1CC6A 2BS2A 4C77A 2C67A 3K7MX 5FS9A 4GRTA 2TPRA 4GAVA 3LB8A 2V60A 2GMHA 2OA1A 4B64A 4X9MA 1KFYA 2YLXA 2XYOA 4UDRA 2YWLA 3K7TA 3KLJA 1EL5A 3NYCA 2EQ8A 4JQ9A 3JSKA 4GAPA 4IA6A 2GEWA 2CULA 3RNMA 1LQTA 1AOGA 4U8JA 3SFDA 2JBVA 1GTEA 3D1CA 3NGCX 2GAHB 4YSYA 3CN8A 5CQFA 1PN0A 1F3PA 1ZDLA 3GYXA 5HHFA 3T31A 4B66A 1E7PA 3BI4A 3FPZA 1BKWA 4G6HA 3SZ0A 4YSXA 1F8WA 2E5VA 5J7XA 3UCLA 1IUVA 5EOWA 4YT0A 1GETA 3F8RA 3NK0X 2R46A 1PXBA 4EIPA 3QSEA 1E1KA 2YLTA 3SXIA 3UOYA 1NEKA 4OPLA 4X4JA 4NNJA 2WP5A 4ZN0A 3UOZA 2FJAA 3UKFA 4H4RA 5KOXA 4J33A 1B5QA 3PVCA 5FMHA 3AD9B 4AOXA 2DKIA 1S2YA 4H2NA 4LU6A 4O5QA 5GRTA 1O5WA 5M10A 1MO9A 3UKLA 3G5SA 1KDGA 3V3NA 3CGEA 4YKGA 2NPXA 4EMWA 5IPYA 1OJCA 4YWOA 4G74A 4BJYA 3CNJA 2VOUA 1E6EA 2XVHA 4KX6A 1Q1WA 3KA7A 4H4UA 4FX9A 4A9WA 2JAEA 3ALLA 1D4CA 4EQSA 3NK2X 2ZZCA 2EQ7A 3BI5A 2ZZ0A 3P9UA 2WDQA 3P4SA 3QSSA 3ICTA 3NN6X 1Y56B 2X8GA 3UOVA 3ATQA 4CCRA 4CBQA 4XWRA 3G5RA 2CFYA 4ZCCA 5GSNA 3AE1A 3Q6JA 3RP7A 4GCMA 4IVMB 3LOVA 4JNAA 5U63A 1LQUA 2C7GA 2XVEA 2FJBA 4NEWA 3OZ2A 4U8LA 4EQXA 3EAOA 1L9CA 2GB0A 3GWDA 4NEVA 3AE4A 2YG6A 3CPJG 4H4PA 1DXLA 3C4AA 3IC9A 1PHHA 3DJGX 2YLSA 1K0JA 2XFQA 1CJ3A 2Y6QA 1MOKA 3ISHA 2Q0KA 4GUVA 3GRSA 1E1NA 4LIIA 3ITJA 4OPUA 4Y4LA 3VRDB 3AE7A 4EM4A 4Z26A 3K30A 2YG7A 1IUUA 1GT8A 2BC1A 2NVKX 2YG5A 2UZZA 1PBBA 1P2EA 3UP5A 4DNAA 3F8PA 3QFBA 4Z2UA 1JOAA 5DBJA 4AT0A 1GRGA 1TDFA 3GRTA 4YTPA 1PXCA 3AWIA 3H8LA 3AE6A 2V6OA 2WOWA 3C96A 4A6NA 4BK2A 4H2QA 4H4QA 3T0KA 3DK4A 1N4UA 2PYXA 2WP6A 3ABVA 4ECHA 5JCLA 3DJDA 3AYJA 1K0LA 2Q0LA 3NTDA 3IHMA 2RGHA 4EIQA 3FIMB 3AE8A 3B6DA 3L8KA 2IVEA 4BK3A 4U2TA 2GQFA 5KMSA 3ALJA 1YQZA 2WDVA 4RG4A 4U8OA 1IUXA 2BCPA 1F8RA 1COYA 1LVLA 4OPGA 2WPCA 3V76A 2FBWA 1VG9A 4ICYA 4U8PA 2R0CA 3NYFA 2E1MA 4ADWA 2C3CA 3OC4A 1D7LA 4K5SA 2QAEA 2FJEA 2BS3A 1ELIA 1ZMCA 1X31B 1PS9A 3UKHA 4JY2A 2XLTA 1BGJA 1NG3A 4NTEA 3CTYA 4NTCA 4APNA 2BABA 4OPDA 1GPEA 2ARDA 1DOEA 1VDCA 4CY6A 1RYIA 4AOSA 3G5QA 3UKAA 4U8KA 3UKPA 3GMCA 3O0HA 2BCGG 1K4QA 2YVJA 3GSIA 3QVRA 2B7SA 3NIXA 4M52A 4NWZA 3V3OA 2BACA 4LA1A 2IIDA 1M64A 3GDNA 4H7UA 1H86A 4I59A 1XDIA 1Y0PA 3ALMA 4U8IA 3SZWA 3AYIA 3P4QA 4XXGA 1H81A 5KMPA 5KVHA 4C5OA 2FJDA 3NRNA 2GV8A 3NKSA 4IVOB 4GF7A 2GF3A 3CMMA 2XVJA 1Z6LA 3DJJA 2XFOA 1BZLA 1TDNA 1RP0A 3K7QX 1LPFA 1EL9A 4BURA 1S3EA 1GEUA 2WQYA 1PBFA 4H4SA 1PJ7A 2OAMA 4BV6A 2A8XA 2X3NA 4TLZA 1PDHA 2R9ZA 4A99A 1CJ2A 2YVGA 5JCNA 2YLRA 1IUWA 3S61A 3AD8B 4NTDA 4O5UA 5EBKA 1EBDA 2WBAA 3BNUA 1E39A 1OJAA 1JRYA 3DK8A 2V3BA 2WDRA 3T2KA 3KPKA 2JB2A 5KXJA 1BWCA 5IQ4A 4I58A 1DNCA 1D5TA 1ONFA 4GR1A 4USQA 2B7RA 1GRHA 2B9WA 1JNZA 4Z25A 5BRTA 1GREA 2R4EA 1DJQA 3D8XA 1YQ4A 2B9XA 3NN0X 3NNEA 3URHA 1LTXR 3CNPA 3S5WA 2F5ZA 4J36A 1S3BA 2BXRA 2WOIA 2C3DA 1N1PA 1JU2A 4YKFA 4H50A 4DGKA 4FDCB 4WX1A 2O9ZA 2C75A 3BNMA 4B68A 1O94A 4J57A 2WPEA 2V61A 1D4DA 3GYJA 4H2RA 3ZDNA 3CIRA 4C3YA 3PS9A 1PBCA 1TDOA 3LZXA 2CVJA 1GSNA 4H2PA 5EB4A 2WU2A 1VG0A 3VR9A 4DSHA 5KNLA 3AB1A 3SM8A 2YG3A 3GD4A 3NHOX 2C4CA 4JY3A 4FK1A 3SY4A 4A79A 4E0VA 1XHCA 3IF9A 2OLOA 3AD7B 4K22A 1JEHA 3UTFA 2R4JA 5U25A 2YQUA 1FL2A 2JB1A 2R45A 3HYVA 3COXA 3AECA 4K8DA 3F8DA 1GRTA 4C3XA 1B37A 1L9EA 2BRYA 3NTAA 4B65A 4REKA 4AP3A 3GMBA 3KD9A 4U8MA 1PBEA 3RP8A 4GDPA 4KPRA 1ZX9A 1H84A 2QCUA 3UKKA 1B4VA 2A89A 3LXDA 2Y6RA 4EMIA 1L9DA 1ZMDA 3P4PA 3ZYXA 3BI2A 3EF6A 2H89A 3R9UA 1GRAA 1CHUA 4EQRA 4USRA 4YXDA 2XFNA 4AT2A 5IQ1A 4RSLA 2VQ7A 2BK3A 2YR6A 3DH9A 3M0OA 1GV4A 2GH5A 4UDPA 1IUTA 3LZWA 3IHGA 2X99A 5KWFA 3RHAA 3T14A 2XDOA 4J31A 4Z43A 2ACZA 2C72A 2C70A 2C66A 2OALA 3CGDA 4K2XA 4PABA 4XWZA 1QJDA 4H4WA 2E4GA 3AEBA 1OJDA 1E1MA 1UKVG 2YG4A 2XLRA 2RGOA 5HXIA 2YVFA 1ZP0A 2APGA 1TDKA 3CGCA 1PJ6A 4YTNA 2EQ6A 2WOVA 2YR4A 4TM1A 2HQMA 3QFAA 1IJHA 2BA9A 2RGJA 4G9KA 4EQWA 1OJ9A 4OCGA 4Z44A 2XFUA 1GRFA 5JCMA 5JCIA 2DKHA 1DOBA 2C76A 5CKUA 2EQ9A 4H4YA 3ATRA 1VRQB 1D7YA 4UP3A 4EMJA 4G6GA 1D4EA 4CNKA 1JNRA 1NHRA 1SEZA 5C3JA 3FBSA 4OPIA 2BYBA 1KNPA 4Y4MA 4Z2TA 2YLZA 2C73A 4B67A 1F8SA 2YM2A 1CF3A 1XPQA 2GVCA 5BVAA 1NAAA 4N9XA 3UOXA 3SZCA 2H88A 3SZFA 4II2A 2XCGA 3SX6A 4CNJA 4OPTA 4D03A 4Y4NA 1P2HA 2BXSA 1XANA 1CC4A 4JNQA 1BF3A 2YLWA 4B1BA 3LJPA 3NT6A 5EB5A 2BRAA 3KKJA 3T2ZA 1ZK7A 1TYPA 1DJNA 4GDEA 1QLBA 1IUSA 4HB9A 1VQWA 1JRZA 1ZOVA 4H4TA 5FS8A 3WE0A 2GR2A 3AE5A 1GERA 1NG4A 2V5ZA 1CL0A 2GRTA 3AEGA 3H8IA 2VRLA 5KVIA 2WEUA 1H6VA 1M6IA 4HA6A 4CY8A 2GQWA 1NDAA 1ZKQA 2I0ZA 2VQBA 4IA5A 3GWFA 2AAQA 1FECA 4ZCDA 1GTHA 3RP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGN A;  1F6M A;  3L1R A;  2Z5X A;  3GD3 A;  3NG7 X;  3FMW A;  1N4V A;  5KRQ A;  2BK5 A;  3PO7 A;  1FCD A;  1K0I A;  1ZY8 A;  5L46 A;  4H4X A;  3EAN A;  2ZBW A;  4J34 A;  1H7X A;  2GR3 A;  2QA2 A;  2WET A;  3SGL A;  5FS6 A;  1H7W A;  1CBO A;  2R0G A;  1NHS A;  3UTH A;  4YSH A;  1KF6 A;  3VRB A;  2WHD A;  1GOS A;  4A7A A;  2WP9 A;  1L0V A;  1YQ3 A;  4B69 A;  1V59 A;  4H4V A;  1REO A;  1CJC A;  4A65 A;  2WS3 A;  4K7Z A;  3DJE A;  2Q6U A;  1YY5 A;  2B9Y A;  3AXB A;  3CNS A;  2GAG B;  4YSZ A;  1GND A;  3Q9T A;  5U1O A;  4J56 A;  4UDQ A;  2YR5 A;  2OLN A;  4FK1 C;  4CRT A;  4J2W A;  3H4K A;  1B8S A;  3QJ4 A;  1Q1R A;  4TM0 A;  1CJ4 A;  4TM4 A;  3B3R A;  1YKJ A;  3CND A;  3II4 A;  2Q7V A;  1E1L A;  1QO8 A;  4JN9 A;  2A87 A;  3VR8 A;  3CPH G;  4IV9 A;  1FEB A;  2XVF A;  1EL7 A;  3AYL A;  3IWA A;  3DA1 A;  3QSM A;  1H83 A;  3M12 A;  3AEF A;  1OJT A;  4EM3 A;  2XLP A;  3NH3 X;  4WCT A;  1CC2 A;  1N4W A;  2JK6 A;  1NHP A;  1HYU A;  3BHK A;  1PBD A;  1GES A;  5FS7 A;  2B76 A;  1DOC A;  3DGZ A;  3SQP A;  1FEA A;  1FOH A;  3ICS A;  4A5L A;  2J3N A;  5HYM A;  2WU5 A;  5KOW A;  1S2Q A;  1TYT A;  5ER0 A;  1NEN A;  4RG3 A;  3SFE A;  2GR1 A;  5BUL A;  3LAD A;  2WES A;  5JCK A;  3KVE A;  2X8C A;  3RED A;  4U2S A;  3CPI G;  1GRB A;  3AEA A;  4BJZ A;  1JRX A;  3UTG A;  1GXF A;  2XFP A;  3CNT A;  2VVL A;  3I6D A;  1MXT A;  3HZL A;  4H4Z A;  2V3A A;  3I3L A;  4TLX A;  1NHQ A;  3VRA A;  2ZZB A;  1PJ5 A;  1W4X A;  1NPX A;  2GR0 A;  3UP4 A;  4YTM A;  2PHH A;  3P4R A;  3FG2 P;  4MJW A;  4BK1 A;  2XLS A;  4AP1 A;  2C65 A;  4OVI A;  2W0H A;  5C2T A;  2AQJ A;  4X9N A;  2XVI A;  3ICR A;  3E1T A;  1LJ1 A;  2X8H A;  1Y56 A;  3AE9 A;  3AEE A;  2X50 A;  2YAU A;  1TDE A;  1Q9I A;  2XLU A;  4C74 A;  2VVM A;  3UTE A;  3T37 A;  2GMJ A;  4CCQ A;  4Z2R A;  2IVD A;  3P1W A;  3EPT A;  3AED A;  2VZ2 A;  4PAA A;  3UKQ A;  4DSG A;  4K5R A;  3M13 A;  4NZH A;  1DOD A;  5LV9 A;  4P9S A;  3BHF A;  4B63 A;  3KPF A;  1KSU A;  3GYI A;  5TR3 A;  1RSG A;  2BC0 A;  2JKC A;  2BK4 A;  2YM1 A;  2RAB A;  3QVP A;  4Z24 A;  4D04 A;  1TRB A;  3ADA B;  3NYE A;  1EL8 A;  5M0Z A;  5HY5 A;  3C4N A;  3CGB A;  3DME A;  4TM3 A;  5BUK A;  5J60 A;  3AE3 A;  2VRM A;  1H82 A;  2BS4 A;  2VVL G;  2C64 A;  2Z5Y A;  2AR8 A;  3NK1 X;  1KSS A;  2JB3 A;  1PXA A;  4JDR A;  4U8N A;  3VQR A;  1O95 A;  1LV0 A;  3AE2 A;  3GDP A;  4A6N B;  3DGH A;  4OPC A;  3KU9 A;  2TMD A;  2CDU A;  4U2L A;  3DK9 A;  1KNR A;  2QA1 A;  1GAL A;  2WPF A;  2R0P A;  1ZOY A;  3NLC A;  1CC6 A;  2BS2 A;  4C77 A;  2C67 A;  3K7M X;  5FS9 A;  4GRT A;  2TPR A;  3LB8 A;  2V60 A;  2GMH A;  2OA1 A;  4B64 A;  4X9M A;  1KFY A;  2YLX A;  2XYO A;  4UDR A;  2YWL A;  3K7T A;  3KLJ A;  1EL5 A;  3NYC A;  2EQ8 A;  4JQ9 A;  3JSK A;  4IA6 A;  2GEW A;  2CUL A;  3RNM A;  1LQT A;  1AOG A;  4U8J A;  3SFD A;  2JBV A;  1GTE A;  3D1C A;  3NGC X;  2GAH B;  4YSY A;  3CN8 A;  5CQF A;  1PN0 A;  1F3P A;  1ZDL A;  5HHF A;  4B66 A;  1E7P A;  3BI4 A;  3FPZ A;  1BKW A;  4YSX A;  1F8W A;  2E5V A;  5J7X A;  3UCL A;  1IUV A;  5EOW A;  4YT0 A;  1GET A;  3F8R A;  3NK0 X;  2R46 A;  1PXB A;  4EIP A;  3QSE A;  1E1K A;  2YLT A;  3UOY A;  1NEK A;  4OPL A;  4X4J A;  2WP5 A;  4ZN0 A;  3UOZ A;  2FJA A;  3UKF A;  4H4R A;  5KOX A;  4J33 A;  1B5Q A;  3PVC A;  5FMH A;  3AD9 B;  4AOX A;  2DKI A;  1S2Y A;  4H2N A;  4LU6 A;  4O5Q A;  5GRT A;  1O5W A;  5M10 A;  1MO9 A;  3UKL A;  3G5S A;  1KDG A;  3V3N A;  3CGE A;  4YKG A;  2NPX A;  4EMW A;  5IPY A;  1OJC A;  4YWO A;  4BJY A;  3CNJ A;  2VOU A;  1E6E A;  2XVH A;  4KX6 A;  1Q1W A;  3KA7 A;  4H4U A;  4FX9 A;  4A9W A;  2JAE A;  3ALL A;  1D4C A;  3NK2 X;  2ZZC A;  2EQ7 A;  3BI5 A;  2ZZ0 A;  3P9U A;  2WDQ A;  3P4S A;  3QSS A;  3ICT A;  3NN6 X;  1Y56 B;  2X8G A;  3UOV A;  3ATQ A;  4CCR A;  4CBQ A;  4XWR A;  3G5R A;  2CFY A;  4ZCC A;  5GSN A;  3AE1 A;  3Q6J A;  3RP7 A;  4GCM A;  4IVM B;  3LOV A;  4JNA A;  5U63 A;  1LQU A;  2C7G A;  2XVE A;  2FJB A;  4NEW A;  3OZ2 A;  4U8L A;  4EQX A;  3EAO A;  1L9C A;  2GB0 A;  3GWD A;  4NEV A;  3AE4 A;  2YG6 A;  3CPJ G;  4H4P A;  1DXL A;  3C4A A;  3IC9 A;  1PHH A;  3DJG X;  2YLS A;  1K0J A;  2XFQ A;  1CJ3 A;  2Y6Q A;  1MOK A;  3ISH A;  2Q0K A;  4GUV A;  3GRS A;  1E1N A;  4LII A;  3ITJ A;  4OPU A;  4Y4L A;  3VRD B;  3AE7 A;  4EM4 A;  4Z26 A;  3K30 A;  2YG7 A;  1IUU A;  1GT8 A;  2BC1 A;  2NVK X;  2YG5 A;  2UZZ A;  1PBB A;  1P2E A;  3UP5 A;  4DNA A;  3F8P A;  3QFB A;  4Z2U A;  1JOA A;  5DBJ A;  4AT0 A;  1GRG A;  1TDF A;  3GRT A;  4YTP A;  1PXC A;  3AWI A;  3H8L A;  3AE6 A;  2V6O A;  2WOW A;  3C96 A;  4A6N A;  4BK2 A;  4H2Q A;  4H4Q A;  3DK4 A;  1N4U A;  2PYX A;  2WP6 A;  3ABV A;  4ECH A;  5JCL A;  3DJD A;  3AYJ A;  1K0L A;  2Q0L A;  3NTD A;  3IHM A;  2RGH A;  4EIQ A;  3FIM B;  3AE8 A;  3B6D A;  3L8K A;  2IVE A;  4BK3 A;  4U2T A;  2GQF A;  3ALJ A;  1YQZ A;  2WDV A;  4RG4 A;  4U8O A;  1IUX A;  2BCP A;  1F8R A;  1COY A;  1LVL A;  4OPG A;  2WPC A;  3V76 A;  2FBW A;  1VG9 A;  4ICY A;  4U8P A;  2R0C A;  3NYF A;  2E1M A;  4ADW A;  2C3C A;  3OC4 A;  1D7L A;  4K5S A;  2QAE A;  2FJE A;  2BS3 A;  1ELI A;  1ZMC A;  1X31 B;  1PS9 A;  3UKH A;  4JY2 A;  2XLT A;  1BGJ A;  1NG3 A;  4NTE A;  3CTY A;  4NTC A;  4APN A;  2BAB A;  4OPD A;  1GPE A;  2ARD A;  1DOE A;  1VDC A;  4CY6 A;  1RYI A;  4AOS A;  3G5Q A;  3UKA A;  4U8K A;  3UKP A;  3GMC A;  3O0H A;  2BCG G;  1K4Q A;  2YVJ A;  3GSI A;  3QVR A;  2B7S A;  3NIX A;  4M52 A;  3V3O A;  2BAC A;  4LA1 A;  2IID A;  1M64 A;  3GDN A;  4H7U A;  1H86 A;  4I59 A;  1XDI A;  1Y0P A;  3ALM A;  4U8I A;  5KVH A;  3AYI A;  3P4Q A;  4XXG A;  1H81 A;  4C5O A;  2FJD A;  3NRN A;  2GV8 A;  3NKS A;  4IVO B;  4GF7 A;  2GF3 A;  2XVJ A;  1Z6L A;  3DJJ A;  2XFO A;  1BZL A;  1TDN A;  1RP0 A;  3K7Q X;  1LPF A;  1EL9 A;  4BUR A;  1S3E A;  1GEU A;  2WQY A;  1PBF A;  4H4S A;  1PJ7 A;  2OAM A;  4BV6 A;  2A8X A;  2X3N A;  4TLZ A;  1PDH A;  2R9Z A;  4A99 A;  1CJ2 A;  2YVG A;  5JCN A;  2YLR A;  1IUW A;  3S61 A;  3AD8 B;  4NTD A;  4O5U A;  5EBK A;  1EBD A;  2WBA A;  3BNU A;  1E39 A;  1OJA A;  1JRY A;  3DK8 A;  2V3B A;  2WDR A;  2JB2 A;  5KXJ A;  1BWC A;  5IQ4 A;  4I58 A;  1DNC A;  1D5T A;  1ONF A;  4GR1 A;  4USQ A;  2B7R A;  1GRH A;  2B9W A;  1JNZ A;  4Z25 A;  5BRT A;  1GRE A;  2R4E A;  1DJQ A;  3D8X A;  1YQ4 A;  2B9X A;  3NN0 X;  3NNE A;  3URH A;  1LTX R;  3CNP A;  3S5W A;  2F5Z A;  4J36 A;  1S3B A;  2BXR A;  2WOI A;  2C3D A;  1N1P A;  1JU2 A;  4YKF A;  4H50 A;  4DGK A;  4FDC B;  4WX1 A;  2O9Z A;  2C75 A;  3BNM A;  4B68 A;  1O94 A;  4J57 A;  2WPE A;  2V61 A;  1D4D A;  3GYJ A;  4H2R A;  3ZDN A;  3CIR A;  4C3Y A;  3PS9 A;  1PBC A;  1TDO A;  3LZX A;  2CVJ A;  1GSN A;  4H2P A;  5EB4 A;  2WU2 A;  1VG0 A;  3VR9 A;  4DSH A;  3AB1 A;  3SM8 A;  2YG3 A;  3GD4 A;  3NHO X;  4JY3 A;  4FK1 A;  4A79 A;  4E0V A;  1XHC A;  3IF9 A;  2OLO A;  3AD7 B;  4K22 A;  1JEH A;  3UTF A;  2R4J A;  5U25 A;  2YQU A;  1FL2 A;  2JB1 A;  2R45 A;  4K8D A;  3COX A;  3AEC A;  4C3X A;  3F8D A;  1GRT A;  4EQS A;  1B37 A;  1L9E A;  3NTA A;  4B65 A;  4REK A;  4AP3 A;  3GMB A;  3KD9 A;  4U8M A;  1PBE A;  3RP8 A;  4GDP A;  4KPR A;  1ZX9 A;  1H84 A;  2QCU A;  3UKK A;  1B4V A;  2A89 A;  3LXD A;  2Y6R A;  4EMI A;  1L9D A;  1ZMD A;  3P4P A;  3ZYX A;  3BI2 A;  3EF6 A;  2H89 A;  3R9U A;  1GRA A;  1CHU A;  4EQR A;  4USR A;  4YXD A;  2XFN A;  4AT2 A;  5IQ1 A;  4RSL A;  2VQ7 A;  2BK3 A;  2YR6 A;  3DH9 A;  3M0O A;  1GV4 A;  2GH5 A;  4UDP A;  1IUT A;  3LZW A;  3IHG A;  2X99 A;  5KWF A;  3RHA A;  4Z43 A;  2XDO A;  4J31 A;  2ACZ A;  2C72 A;  2C70 A;  2C66 A;  2OAL A;  3CGD A;  4K2X A;  4PAB A;  4XWZ A;  1QJD A;  4H4W A;  2E4G A;  3AEB A;  1OJD A;  1E1M A;  1UKV G;  2YG4 A;  2XLR A;  2RGO A;  5HXI A;  2YVF A;  1ZP0 A;  2APG A;  1TDK A;  3CGC A;  1PJ6 A;  4YTN A;  2EQ6 A;  2WOV A;  2YR4 A;  4TM1 A;  2HQM A;  3QFA A;  1IJH A;  2BA9 A;  2RGJ A;  4EQW A;  1OJ9 A;  4OCG A;  4Z44 A;  2XFU A;  1GRF A;  5JCM A;  5JCI A;  2DKH A;  1DOB A;  2C76 A;  5CKU A;  2EQ9 A;  4H4Y A;  3ATR A;  1VRQ B;  1D7Y A;  4UP3 A;  4EMJ A;  1D4E A;  4CNK A;  1JNR A;  1NHR A;  1SEZ A;  5C3J A;  3FBS A;  4OPI A;  2BYB A;  1KNP A;  4Y4M A;  4Z2T A;  2YLZ A;  2C73 A;  4B67 A;  1F8S A;  2YM2 A;  1CF3 A;  1XPQ A;  2GVC A;  5BVA A;  1NAA A;  4N9X A;  3UOX A;  2H88 A;  2XCG A;  4CNJ A;  4OPT A;  4D03 A;  4Y4N A;  1P2H A;  2BXS A;  1XAN A;  1CC4 A;  4JNQ A;  1BF3 A;  2YLW A;  4B1B A;  3LJP A;  3NT6 A;  5EB5 A;  3KKJ A;  1ZK7 A;  1TYP A;  1DJN A;  4GDE A;  1QLB A;  1IUS A;  4HB9 A;  1VQW A;  1JRZ A;  1ZOV A;  4H4T A;  5FS8 A;  3WE0 A;  2GR2 A;  3AE5 A;  1GER A;  1NG4 A;  2V5Z A;  1CL0 A;  2GRT A;  3AEG A;  3H8I A;  2VRL A;  5KVI A;  2WEU A;  1H6V A;  1M6I A;  4HA6 A;  4CY8 A;  2GQW A;  1NDA A;  1ZKQ A;  2I0Z A;  2VQB A;  4IA5 A;  3GWF A;  2AAQ A;  1FEC A;  4ZCD A;  1GTH A;  3RP6 A; 
#chains in the Genus database with same CATH topology
 1BGN A;  1F6M A;  3L1R A;  2Z5X A;  3GD3 A;  3NG7 X;  3FMW A;  1N4V A;  5KRQ A;  2BK5 A;  3PO7 A;  1FCD A;  1K0I A;  1ZY8 A;  5L46 A;  4H4X A;  3EAN A;  2ZBW A;  4J34 A;  1H7X A;  2GR3 A;  2QA2 A;  2WET A;  3SGL A;  5FS6 A;  1H7W A;  1CBO A;  2R0G A;  1NHS A;  3UTH A;  4YSH A;  1KF6 A;  3VRB A;  2WHD A;  1GOS A;  4A7A A;  2WP9 A;  5KMQ A;  1L0V A;  1YQ3 A;  4B69 A;  1V59 A;  4H4V A;  1REO A;  1CJC A;  4A65 A;  2WS3 A;  4K7Z A;  3DJE A;  2Q6U A;  1YY5 A;  2B9Y A;  3AXB A;  3CNS A;  2GAG B;  4YSZ A;  1GND A;  3Q9T A;  5U1O A;  4J56 A;  4UDQ A;  2YR5 A;  2OLN A;  4FK1 C;  4CRT A;  4J2W A;  3H4K A;  1B8S A;  3QJ4 A;  1Q1R A;  4TM0 A;  1CJ4 A;  4TM4 A;  3B3R A;  1YKJ A;  3CND A;  3II4 A;  2Q7V A;  1E1L A;  1QO8 A;  4JN9 A;  2A87 A;  3VR8 A;  3CPH G;  4IV9 A;  1FEB A;  2XVF A;  1EL7 A;  3AYL A;  3IWA A;  3DA1 A;  3QSM A;  1H83 A;  3M12 A;  3AEF A;  1OJT A;  4EM3 A;  2XLP A;  3SYI A;  3NH3 X;  4WCT A;  1CC2 A;  1N4W A;  2JK6 A;  1NHP A;  1HYU A;  3BHK A;  1PBD A;  1GES A;  5FS7 A;  2B76 A;  1DOC A;  3DGZ A;  3SQP A;  1FEA A;  1FOH A;  3ICS A;  4A5L A;  2J3N A;  5HYM A;  2WU5 A;  5KOW A;  3HYW A;  1S2Q A;  1TYT A;  5ER0 A;  1NEN A;  4RG3 A;  3T2Y A;  3SFE A;  2GR1 A;  5BUL A;  3HYX A;  3LAD A;  2WES A;  5JCK A;  3KVE A;  2X8C A;  3RED A;  4U2S A;  3CPI G;  1GRB A;  3AEA A;  4BJZ A;  1JRX A;  3UTG A;  1GXF A;  2XFP A;  3CNT A;  2VVL A;  3I6D A;  1MXT A;  3HZL A;  4H4Z A;  2V3A A;  3I3L A;  4TLX A;  1NHQ A;  3VRA A;  2ZZB A;  1PJ5 A;  1W4X A;  1NPX A;  2GR0 A;  3UP4 A;  4YTM A;  2PHH A;  3P4R A;  3FG2 P;  4MJW A;  4BK1 A;  2XLS A;  4AP1 A;  2C65 A;  4OVI A;  2W0H A;  5C2T A;  2AQJ A;  4X9N A;  2XVI A;  3ICR A;  3E1T A;  5KMR A;  1LJ1 A;  2X8H A;  1Y56 A;  3AE9 A;  3AEE A;  4II3 A;  2X50 A;  2YAU A;  1TDE A;  1Q9I A;  2XLU A;  4C74 A;  2VVM A;  3UTE A;  3T37 A;  2GMJ A;  4CCQ A;  4Z2R A;  2IVD A;  3P1W A;  3EPT A;  3AED A;  2VZ2 A;  4PAA A;  3UKQ A;  4DSG A;  4K5R A;  3M13 A;  4NZH A;  1DOD A;  5LV9 A;  4P9S A;  3BHF A;  4B63 A;  3KPF A;  1KSU A;  3GYI A;  5TR3 A;  1RSG A;  2BC0 A;  2JKC A;  2BK4 A;  2YM1 A;  2RAB A;  3QVP A;  4Z24 A;  4D04 A;  1TRB A;  3ADA B;  4G73 A;  3NYE A;  1EL8 A;  5M0Z A;  5HY5 A;  3C4N A;  3CGB A;  3DME A;  4TM3 A;  5BUK A;  5J60 A;  3AE3 A;  2VRM A;  1H82 A;  2BS4 A;  2VVL G;  2C64 A;  2Z5Y A;  2AR8 A;  3NK1 X;  1KSS A;  2JB3 A;  1PXA A;  4JDR A;  4U8N A;  3VQR A;  1O95 A;  1LV0 A;  3AE2 A;  3GDP A;  4A6N B;  3DGH A;  4OPC A;  3KU9 A;  2TMD A;  2CDU A;  4U2L A;  3DK9 A;  1KNR A;  2QA1 A;  1GAL A;  2WPF A;  2R0P A;  1ZOY A;  3NLC A;  1CC6 A;  2BS2 A;  4C77 A;  2C67 A;  3K7M X;  5FS9 A;  4GRT A;  2TPR A;  4GAV A;  3LB8 A;  2V60 A;  2GMH A;  2OA1 A;  4B64 A;  4X9M A;  1KFY A;  2YLX A;  2XYO A;  4UDR A;  2YWL A;  3K7T A;  3KLJ A;  1EL5 A;  3NYC A;  2EQ8 A;  4JQ9 A;  3JSK A;  4GAP A;  4IA6 A;  2GEW A;  2CUL A;  3RNM A;  1LQT A;  1AOG A;  4U8J A;  3SFD A;  2JBV A;  1GTE A;  3D1C A;  3NGC X;  2GAH B;  4YSY A;  3CN8 A;  5CQF A;  1PN0 A;  1F3P A;  1ZDL A;  3GYX A;  5HHF A;  3T31 A;  4B66 A;  1E7P A;  3BI4 A;  3FPZ A;  1BKW A;  4G6H A;  3SZ0 A;  4YSX A;  1F8W A;  2E5V A;  5J7X A;  3UCL A;  1IUV A;  5EOW A;  4YT0 A;  1GET A;  3F8R A;  3NK0 X;  2R46 A;  1PXB A;  4EIP A;  3QSE A;  1E1K A;  2YLT A;  3SXI A;  3UOY A;  1NEK A;  4OPL A;  4X4J A;  4NNJ A;  2WP5 A;  4ZN0 A;  3UOZ A;  2FJA A;  3UKF A;  4H4R A;  5KOX A;  4J33 A;  1B5Q A;  3PVC A;  5FMH A;  3AD9 B;  4AOX A;  2DKI A;  1S2Y A;  4H2N A;  4LU6 A;  4O5Q A;  5GRT A;  1O5W A;  5M10 A;  1MO9 A;  3UKL A;  3G5S A;  1KDG A;  3V3N A;  3CGE A;  4YKG A;  2NPX A;  4EMW A;  5IPY A;  1OJC A;  4YWO A;  4G74 A;  4BJY A;  3CNJ A;  2VOU A;  1E6E A;  2XVH A;  4KX6 A;  1Q1W A;  3KA7 A;  4H4U A;  4FX9 A;  4A9W A;  2JAE A;  3ALL A;  1D4C A;  4EQS A;  3NK2 X;  2ZZC A;  2EQ7 A;  3BI5 A;  2ZZ0 A;  3P9U A;  2WDQ A;  3P4S A;  3QSS A;  3ICT A;  3NN6 X;  1Y56 B;  2X8G A;  3UOV A;  3ATQ A;  4CCR A;  4CBQ A;  4XWR A;  3G5R A;  2CFY A;  4ZCC A;  5GSN A;  3AE1 A;  3Q6J A;  3RP7 A;  4GCM A;  4IVM B;  3LOV A;  4JNA A;  5U63 A;  1LQU A;  2C7G A;  2XVE A;  2FJB A;  4NEW A;  3OZ2 A;  4U8L A;  4EQX A;  3EAO A;  1L9C A;  2GB0 A;  3GWD A;  4NEV A;  3AE4 A;  2YG6 A;  3CPJ G;  4H4P A;  1DXL A;  3C4A A;  3IC9 A;  1PHH A;  3DJG X;  2YLS A;  1K0J A;  2XFQ A;  1CJ3 A;  2Y6Q A;  1MOK A;  3ISH A;  2Q0K A;  4GUV A;  3GRS A;  1E1N A;  4LII A;  3ITJ A;  4OPU A;  4Y4L A;  3VRD B;  3AE7 A;  4EM4 A;  4Z26 A;  3K30 A;  2YG7 A;  1IUU A;  1GT8 A;  2BC1 A;  2NVK X;  2YG5 A;  2UZZ A;  1PBB A;  1P2E A;  3UP5 A;  4DNA A;  3F8P A;  3QFB A;  4Z2U A;  1JOA A;  5DBJ A;  4AT0 A;  1GRG A;  1TDF A;  3GRT A;  4YTP A;  1PXC A;  3AWI A;  3H8L A;  3AE6 A;  2V6O A;  2WOW A;  3C96 A;  4A6N A;  4BK2 A;  4H2Q A;  4H4Q A;  3T0K A;  3DK4 A;  1N4U A;  2PYX A;  2WP6 A;  3ABV A;  4ECH A;  5JCL A;  3DJD A;  3AYJ A;  1K0L A;  2Q0L A;  3NTD A;  3IHM A;  2RGH A;  4EIQ A;  3FIM B;  3AE8 A;  3B6D A;  3L8K A;  2IVE A;  4BK3 A;  4U2T A;  2GQF A;  5KMS A;  3ALJ A;  1YQZ A;  2WDV A;  4RG4 A;  4U8O A;  1IUX A;  2BCP A;  1F8R A;  1COY A;  1LVL A;  4OPG A;  2WPC A;  3V76 A;  2FBW A;  1VG9 A;  4ICY A;  4U8P A;  2R0C A;  3NYF A;  2E1M A;  4ADW A;  2C3C A;  3OC4 A;  1D7L A;  4K5S A;  2QAE A;  2FJE A;  2BS3 A;  1ELI A;  1ZMC A;  1X31 B;  1PS9 A;  3UKH A;  4JY2 A;  2XLT A;  1BGJ A;  1NG3 A;  4NTE A;  3CTY A;  4NTC A;  4APN A;  2BAB A;  4OPD A;  1GPE A;  2ARD A;  1DOE A;  1VDC A;  4CY6 A;  1RYI A;  4AOS A;  3G5Q A;  3UKA A;  4U8K A;  3UKP A;  3GMC A;  3O0H A;  2BCG G;  1K4Q A;  2YVJ A;  3GSI A;  3QVR A;  2B7S A;  3NIX A;  4M52 A;  4NWZ A;  3V3O A;  2BAC A;  4LA1 A;  2IID A;  1M64 A;  3GDN A;  4H7U A;  1H86 A;  4I59 A;  1XDI A;  1Y0P A;  3ALM A;  4U8I A;  3SZW A;  3AYI A;  3P4Q A;  4XXG A;  1H81 A;  5KMP A;  5KVH A;  4C5O A;  2FJD A;  3NRN A;  2GV8 A;  3NKS A;  4IVO B;  4GF7 A;  2GF3 A;  3CMM A;  2XVJ A;  1Z6L A;  3DJJ A;  2XFO A;  1BZL A;  1TDN A;  1RP0 A;  3K7Q X;  1LPF A;  1EL9 A;  4BUR A;  1S3E A;  1GEU A;  2WQY A;  1PBF A;  4H4S A;  1PJ7 A;  2OAM A;  4BV6 A;  2A8X A;  2X3N A;  4TLZ A;  1PDH A;  2R9Z A;  4A99 A;  1CJ2 A;  2YVG A;  5JCN A;  2YLR A;  1IUW A;  3S61 A;  3AD8 B;  4NTD A;  4O5U A;  5EBK A;  1EBD A;  2WBA A;  3BNU A;  1E39 A;  1OJA A;  1JRY A;  3DK8 A;  2V3B A;  2WDR A;  3T2K A;  3KPK A;  2JB2 A;  5KXJ A;  1BWC A;  5IQ4 A;  4I58 A;  1DNC A;  1D5T A;  1ONF A;  4GR1 A;  4USQ A;  2B7R A;  1GRH A;  2B9W A;  1JNZ A;  4Z25 A;  5BRT A;  1GRE A;  2R4E A;  1DJQ A;  3D8X A;  1YQ4 A;  2B9X A;  3NN0 X;  3NNE A;  3URH A;  1LTX R;  3CNP A;  3S5W A;  2F5Z A;  4J36 A;  1S3B A;  2BXR A;  2WOI A;  2C3D A;  1N1P A;  1JU2 A;  4YKF A;  4H50 A;  4DGK A;  4FDC B;  4WX1 A;  2O9Z A;  2C75 A;  3BNM A;  4B68 A;  1O94 A;  4J57 A;  2WPE A;  2V61 A;  1D4D A;  3GYJ A;  4H2R A;  3ZDN A;  3CIR A;  4C3Y A;  3PS9 A;  1PBC A;  1TDO A;  3LZX A;  2CVJ A;  1GSN A;  4H2P A;  5EB4 A;  2WU2 A;  1VG0 A;  3VR9 A;  4DSH A;  5KNL A;  3AB1 A;  3SM8 A;  2YG3 A;  3GD4 A;  3NHO X;  2C4C A;  4JY3 A;  4FK1 A;  3SY4 A;  4A79 A;  4E0V A;  1XHC A;  3IF9 A;  2OLO A;  3AD7 B;  4K22 A;  1JEH A;  3UTF A;  2R4J A;  5U25 A;  2YQU A;  1FL2 A;  2JB1 A;  2R45 A;  3HYV A;  3COX A;  3AEC A;  4K8D A;  3F8D A;  1GRT A;  4C3X A;  1B37 A;  1L9E A;  2BRY A;  3NTA A;  4B65 A;  4REK A;  4AP3 A;  3GMB A;  3KD9 A;  4U8M A;  1PBE A;  3RP8 A;  4GDP A;  4KPR A;  1ZX9 A;  1H84 A;  2QCU A;  3UKK A;  1B4V A;  2A89 A;  3LXD A;  2Y6R A;  4EMI A;  1L9D A;  1ZMD A;  3P4P A;  3ZYX A;  3BI2 A;  3EF6 A;  2H89 A;  3R9U A;  1GRA A;  1CHU A;  4EQR A;  4USR A;  4YXD A;  2XFN A;  4AT2 A;  5IQ1 A;  4RSL A;  2VQ7 A;  2BK3 A;  2YR6 A;  3DH9 A;  3M0O A;  1GV4 A;  2GH5 A;  4UDP A;  1IUT A;  3LZW A;  3IHG A;  2X99 A;  5KWF A;  3RHA A;  3T14 A;  2XDO A;  4J31 A;  4Z43 A;  2ACZ A;  2C72 A;  2C70 A;  2C66 A;  2OAL A;  3CGD A;  4K2X A;  4PAB A;  4XWZ A;  1QJD A;  4H4W A;  2E4G A;  3AEB A;  1OJD A;  1E1M A;  1UKV G;  2YG4 A;  2XLR A;  2RGO A;  5HXI A;  2YVF A;  1ZP0 A;  2APG A;  1TDK A;  3CGC A;  1PJ6 A;  4YTN A;  2EQ6 A;  2WOV A;  2YR4 A;  4TM1 A;  2HQM A;  3QFA A;  2BA9 A;  1IJH A;  2RGJ A;  4G9K A;  4EQW A;  1OJ9 A;  4OCG A;  4Z44 A;  2XFU A;  1GRF A;  5JCM A;  5JCI A;  2DKH A;  1DOB A;  2C76 A;  5CKU A;  2EQ9 A;  4H4Y A;  3ATR A;  1VRQ B;  1D7Y A;  4UP3 A;  4EMJ A;  4G6G A;  1D4E A;  4CNK A;  1JNR A;  1NHR A;  1SEZ A;  5C3J A;  3FBS A;  4OPI A;  2BYB A;  1KNP A;  4Y4M A;  4Z2T A;  2YLZ A;  2C73 A;  4B67 A;  1F8S A;  2YM2 A;  1CF3 A;  1XPQ A;  2GVC A;  5BVA A;  1NAA A;  4N9X A;  3UOX A;  3SZC A;  2H88 A;  3SZF A;  4II2 A;  2XCG A;  3SX6 A;  4CNJ A;  4OPT A;  4D03 A;  4Y4N A;  1P2H A;  2BXS A;  1XAN A;  1CC4 A;  4JNQ A;  1BF3 A;  2YLW A;  4B1B A;  3LJP A;  3NT6 A;  5EB5 A;  2BRA A;  3KKJ A;  3T2Z A;  1ZK7 A;  1TYP A;  1DJN A;  4GDE A;  1QLB A;  1IUS A;  4HB9 A;  1VQW A;  1JRZ A;  1ZOV A;  4H4T A;  3WE0 A;  5FS8 A;  2GR2 A;  3AE5 A;  1GER A;  1NG4 A;  2V5Z A;  1CL0 A;  2GRT A;  3AEG A;  3H8I A;  2VRL A;  5KVI A;  2WEU A;  1H6V A;  1M6I A;  4HA6 A;  4CY8 A;  2GQW A;  1NDA A;  1ZKQ A;  2I0Z A;  2VQB A;  4IA5 A;  3GWF A;  2AAQ A;  1FEC A;  4ZCD A;  1GTH A;  3RP6 A; 
#chains in the Genus database with same CATH homology
 1BGN A;  1F6M A;  3L1R A;  2Z5X A;  3GD3 A;  3NG7 X;  3FMW A;  1N4V A;  5KRQ A;  2BK5 A;  3PO7 A;  1FCD A;  1K0I A;  1ZY8 A;  5L46 A;  4H4X A;  3EAN A;  2ZBW A;  4J34 A;  1H7X A;  2GR3 A;  2QA2 A;  2WET A;  3SGL A;  5FS6 A;  1H7W A;  1CBO A;  2R0G A;  1NHS A;  3UTH A;  4YSH A;  1KF6 A;  3VRB A;  2WHD A;  1GOS A;  4A7A A;  2WP9 A;  5KMQ A;  1L0V A;  1YQ3 A;  4B69 A;  1V59 A;  4H4V A;  1REO A;  1CJC A;  4A65 A;  2WS3 A;  4K7Z A;  3DJE A;  2Q6U A;  1YY5 A;  2B9Y A;  3AXB A;  3CNS A;  2GAG B;  4YSZ A;  1GND A;  3Q9T A;  5U1O A;  4J56 A;  4UDQ A;  2YR5 A;  2OLN A;  4FK1 C;  4CRT A;  4J2W A;  3H4K A;  1B8S A;  3QJ4 A;  1Q1R A;  4TM0 A;  1CJ4 A;  4TM4 A;  3B3R A;  1YKJ A;  3CND A;  3II4 A;  2Q7V A;  1E1L A;  1QO8 A;  4JN9 A;  2A87 A;  3VR8 A;  3CPH G;  4IV9 A;  1FEB A;  2XVF A;  1EL7 A;  3AYL A;  3IWA A;  3DA1 A;  3QSM A;  1H83 A;  3M12 A;  3AEF A;  1OJT A;  4EM3 A;  2XLP A;  3SYI A;  3NH3 X;  4WCT A;  1CC2 A;  1N4W A;  2JK6 A;  1NHP A;  1HYU A;  3BHK A;  1PBD A;  1GES A;  5FS7 A;  2B76 A;  1DOC A;  3DGZ A;  3SQP A;  1FEA A;  1FOH A;  3ICS A;  4A5L A;  2J3N A;  5HYM A;  2WU5 A;  5KOW A;  3HYW A;  1S2Q A;  1TYT A;  5ER0 A;  1NEN A;  4RG3 A;  3T2Y A;  3SFE A;  2GR1 A;  5BUL A;  3HYX A;  3LAD A;  2WES A;  5JCK A;  3KVE A;  2X8C A;  3RED A;  4U2S A;  3CPI G;  1GRB A;  3AEA A;  4BJZ A;  1JRX A;  3UTG A;  1GXF A;  2XFP A;  3CNT A;  2VVL A;  3I6D A;  1MXT A;  3HZL A;  4H4Z A;  2V3A A;  3I3L A;  4TLX A;  1NHQ A;  3VRA A;  2ZZB A;  1PJ5 A;  1W4X A;  1NPX A;  2GR0 A;  3UP4 A;  4YTM A;  2PHH A;  3P4R A;  3FG2 P;  4MJW A;  4BK1 A;  2XLS A;  4AP1 A;  2C65 A;  4OVI A;  2W0H A;  5C2T A;  2AQJ A;  4X9N A;  2XVI A;  3ICR A;  3E1T A;  5KMR A;  1LJ1 A;  2X8H A;  1Y56 A;  3AE9 A;  3AEE A;  4II3 A;  2X50 A;  2YAU A;  1TDE A;  1Q9I A;  2XLU A;  4C74 A;  2VVM A;  3UTE A;  3T37 A;  2GMJ A;  4CCQ A;  4Z2R A;  2IVD A;  3P1W A;  3EPT A;  3AED A;  2VZ2 A;  4PAA A;  3UKQ A;  4DSG A;  4K5R A;  3M13 A;  4NZH A;  1DOD A;  5LV9 A;  4P9S A;  3BHF A;  4B63 A;  3KPF A;  1KSU A;  3GYI A;  5TR3 A;  1RSG A;  2BC0 A;  2JKC A;  2BK4 A;  2YM1 A;  2RAB A;  3QVP A;  4Z24 A;  4D04 A;  1TRB A;  3ADA B;  4G73 A;  3NYE A;  1EL8 A;  5M0Z A;  5HY5 A;  3C4N A;  3CGB A;  3DME A;  4TM3 A;  5BUK A;  5J60 A;  3AE3 A;  2VRM A;  1H82 A;  2BS4 A;  2VVL G;  2C64 A;  2Z5Y A;  2AR8 A;  3NK1 X;  1KSS A;  2JB3 A;  1PXA A;  4JDR A;  4U8N A;  3VQR A;  1O95 A;  1LV0 A;  3AE2 A;  3GDP A;  4A6N B;  3DGH A;  4OPC A;  3KU9 A;  2TMD A;  2CDU A;  4U2L A;  3DK9 A;  1KNR A;  2QA1 A;  1GAL A;  2WPF A;  2R0P A;  1ZOY A;  3NLC A;  1CC6 A;  2BS2 A;  4C77 A;  2C67 A;  3K7M X;  5FS9 A;  4GRT A;  2TPR A;  4GAV A;  3LB8 A;  2V60 A;  2GMH A;  2OA1 A;  4B64 A;  4X9M A;  1KFY A;  2YLX A;  2XYO A;  4UDR A;  2YWL A;  3K7T A;  3KLJ A;  1EL5 A;  3NYC A;  2EQ8 A;  4JQ9 A;  3JSK A;  4GAP A;  4IA6 A;  2GEW A;  2CUL A;  3RNM A;  1LQT A;  1AOG A;  4U8J A;  3SFD A;  2JBV A;  1GTE A;  3D1C A;  3NGC X;  2GAH B;  4YSY A;  3CN8 A;  5CQF A;  1PN0 A;  1F3P A;  1ZDL A;  3GYX A;  5HHF A;  3T31 A;  4B66 A;  1E7P A;  3BI4 A;  3FPZ A;  1BKW A;  4G6H A;  3SZ0 A;  4YSX A;  1F8W A;  2E5V A;  5J7X A;  3UCL A;  1IUV A;  5EOW A;  4YT0 A;  1GET A;  3F8R A;  3NK0 X;  2R46 A;  1PXB A;  4EIP A;  3QSE A;  1E1K A;  2YLT A;  3SXI A;  3UOY A;  1NEK A;  4OPL A;  4X4J A;  4NNJ A;  2WP5 A;  4ZN0 A;  3UOZ A;  2FJA A;  3UKF A;  4H4R A;  5KOX A;  4J33 A;  1B5Q A;  3PVC A;  5FMH A;  3AD9 B;  4AOX A;  2DKI A;  1S2Y A;  4H2N A;  4LU6 A;  4O5Q A;  5GRT A;  1O5W A;  5M10 A;  1MO9 A;  3UKL A;  3G5S A;  1KDG A;  3V3N A;  3CGE A;  4YKG A;  2NPX A;  4EMW A;  5IPY A;  1OJC A;  4YWO A;  4G74 A;  4BJY A;  3CNJ A;  2VOU A;  1E6E A;  2XVH A;  4KX6 A;  1Q1W A;  3KA7 A;  4H4U A;  4FX9 A;  4A9W A;  2JAE A;  3ALL A;  1D4C A;  4EQS A;  3NK2 X;  2ZZC A;  2EQ7 A;  3BI5 A;  2ZZ0 A;  3P9U A;  2WDQ A;  3P4S A;  3QSS A;  3ICT A;  3NN6 X;  1Y56 B;  2X8G A;  3UOV A;  3ATQ A;  4CCR A;  4CBQ A;  4XWR A;  3G5R A;  2CFY A;  4ZCC A;  5GSN A;  3AE1 A;  3Q6J A;  3RP7 A;  4GCM A;  4IVM B;  3LOV A;  4JNA A;  5U63 A;  1LQU A;  2C7G A;  2XVE A;  2FJB A;  4NEW A;  3OZ2 A;  4U8L A;  4EQX A;  3EAO A;  1L9C A;  2GB0 A;  3GWD A;  4NEV A;  3AE4 A;  2YG6 A;  3CPJ G;  4H4P A;  1DXL A;  3C4A A;  3IC9 A;  1PHH A;  3DJG X;  2YLS A;  1K0J A;  2XFQ A;  1CJ3 A;  2Y6Q A;  1MOK A;  3ISH A;  2Q0K A;  4GUV A;  3GRS A;  1E1N A;  4LII A;  3ITJ A;  4OPU A;  4Y4L A;  3VRD B;  3AE7 A;  4EM4 A;  4Z26 A;  3K30 A;  2YG7 A;  1IUU A;  1GT8 A;  2BC1 A;  2NVK X;  2YG5 A;  2UZZ A;  1PBB A;  1P2E A;  3UP5 A;  4DNA A;  3F8P A;  3QFB A;  4Z2U A;  1JOA A;  5DBJ A;  4AT0 A;  1GRG A;  1TDF A;  3GRT A;  4YTP A;  1PXC A;  3AWI A;  3H8L A;  3AE6 A;  2V6O A;  2WOW A;  3C96 A;  4A6N A;  4BK2 A;  4H2Q A;  4H4Q A;  3T0K A;  3DK4 A;  1N4U A;  2PYX A;  2WP6 A;  3ABV A;  4ECH A;  5JCL A;  3DJD A;  3AYJ A;  1K0L A;  2Q0L A;  3NTD A;  3IHM A;  2RGH A;  4EIQ A;  3FIM B;  3AE8 A;  3B6D A;  3L8K A;  2IVE A;  4BK3 A;  4U2T A;  2GQF A;  5KMS A;  3ALJ A;  1YQZ A;  2WDV A;  4RG4 A;  4U8O A;  1IUX A;  2BCP A;  1F8R A;  1COY A;  1LVL A;  4OPG A;  2WPC A;  3V76 A;  2FBW A;  1VG9 A;  4ICY A;  4U8P A;  2R0C A;  3NYF A;  2E1M A;  4ADW A;  2C3C A;  3OC4 A;  1D7L A;  4K5S A;  2QAE A;  2FJE A;  2BS3 A;  1ELI A;  1ZMC A;  1X31 B;  1PS9 A;  3UKH A;  4JY2 A;  2XLT A;  1BGJ A;  1NG3 A;  4NTE A;  3CTY A;  4NTC A;  4APN A;  2BAB A;  4OPD A;  1GPE A;  2ARD A;  1DOE A;  1VDC A;  4CY6 A;  1RYI A;  4AOS A;  3G5Q A;  3UKA A;  4U8K A;  3UKP A;  3GMC A;  3O0H A;  2BCG G;  1K4Q A;  2YVJ A;  3GSI A;  3QVR A;  2B7S A;  3NIX A;  4M52 A;  4NWZ A;  3V3O A;  2BAC A;  4LA1 A;  2IID A;  1M64 A;  3GDN A;  4H7U A;  1H86 A;  4I59 A;  1XDI A;  1Y0P A;  3ALM A;  4U8I A;  3SZW A;  3AYI A;  3P4Q A;  4XXG A;  1H81 A;  5KMP A;  5KVH A;  4C5O A;  2FJD A;  3NRN A;  2GV8 A;  3NKS A;  4IVO B;  4GF7 A;  2GF3 A;  3CMM A;  2XVJ A;  1Z6L A;  3DJJ A;  2XFO A;  1BZL A;  1TDN A;  1RP0 A;  3K7Q X;  1LPF A;  1EL9 A;  4BUR A;  1S3E A;  1GEU A;  2WQY A;  1PBF A;  4H4S A;  1PJ7 A;  2OAM A;  4BV6 A;  2A8X A;  2X3N A;  4TLZ A;  1PDH A;  2R9Z A;  4A99 A;  1CJ2 A;  2YVG A;  5JCN A;  2YLR A;  1IUW A;  3S61 A;  3AD8 B;  4NTD A;  4O5U A;  5EBK A;  1EBD A;  2WBA A;  3BNU A;  1E39 A;  1OJA A;  1JRY A;  3DK8 A;  2V3B A;  2WDR A;  3T2K A;  3KPK A;  2JB2 A;  5KXJ A;  1BWC A;  5IQ4 A;  4I58 A;  1DNC A;  1D5T A;  1ONF A;  4GR1 A;  4USQ A;  2B7R A;  1GRH A;  2B9W A;  1JNZ A;  4Z25 A;  5BRT A;  1GRE A;  2R4E A;  1DJQ A;  3D8X A;  1YQ4 A;  2B9X A;  3NN0 X;  3NNE A;  3URH A;  1LTX R;  3CNP A;  3S5W A;  2F5Z A;  4J36 A;  1S3B A;  2BXR A;  2WOI A;  2C3D A;  1N1P A;  1JU2 A;  4YKF A;  4H50 A;  4DGK A;  4FDC B;  4WX1 A;  2O9Z A;  2C75 A;  3BNM A;  4B68 A;  1O94 A;  4J57 A;  2WPE A;  2V61 A;  1D4D A;  3GYJ A;  4H2R A;  3ZDN A;  3CIR A;  4C3Y A;  3PS9 A;  1PBC A;  1TDO A;  3LZX A;  2CVJ A;  1GSN A;  4H2P A;  5EB4 A;  2WU2 A;  1VG0 A;  3VR9 A;  4DSH A;  5KNL A;  3AB1 A;  3SM8 A;  2YG3 A;  3GD4 A;  3NHO X;  2C4C A;  4JY3 A;  4FK1 A;  3SY4 A;  4A79 A;  4E0V A;  1XHC A;  3IF9 A;  2OLO A;  3AD7 B;  4K22 A;  1JEH A;  3UTF A;  2R4J A;  5U25 A;  2YQU A;  1FL2 A;  2JB1 A;  2R45 A;  3HYV A;  3COX A;  3AEC A;  4K8D A;  3F8D A;  1GRT A;  4C3X A;  1B37 A;  1L9E A;  2BRY A;  3NTA A;  4B65 A;  4REK A;  4AP3 A;  3GMB A;  3KD9 A;  4U8M A;  1PBE A;  3RP8 A;  4GDP A;  4KPR A;  1ZX9 A;  1H84 A;  2QCU A;  3UKK A;  1B4V A;  2A89 A;  3LXD A;  2Y6R A;  4EMI A;  1L9D A;  1ZMD A;  3P4P A;  3ZYX A;  3BI2 A;  3EF6 A;  2H89 A;  3R9U A;  1GRA A;  1CHU A;  4EQR A;  4USR A;  4YXD A;  2XFN A;  4AT2 A;  5IQ1 A;  4RSL A;  2VQ7 A;  2BK3 A;  2YR6 A;  3DH9 A;  3M0O A;  1GV4 A;  2GH5 A;  4UDP A;  1IUT A;  3LZW A;  3IHG A;  2X99 A;  5KWF A;  3RHA A;  3T14 A;  2XDO A;  4J31 A;  4Z43 A;  2ACZ A;  2C72 A;  2C70 A;  2C66 A;  2OAL A;  3CGD A;  4K2X A;  4PAB A;  4XWZ A;  1QJD A;  4H4W A;  2E4G A;  3AEB A;  1OJD A;  1E1M A;  1UKV G;  2YG4 A;  2XLR A;  2RGO A;  5HXI A;  2YVF A;  1ZP0 A;  2APG A;  1TDK A;  3CGC A;  1PJ6 A;  4YTN A;  2EQ6 A;  2WOV A;  2YR4 A;  4TM1 A;  2HQM A;  3QFA A;  1IJH A;  2BA9 A;  2RGJ A;  4G9K A;  4EQW A;  1OJ9 A;  4OCG A;  4Z44 A;  2XFU A;  1GRF A;  5JCM A;  5JCI A;  2DKH A;  1DOB A;  2C76 A;  5CKU A;  2EQ9 A;  4H4Y A;  3ATR A;  1VRQ B;  1D7Y A;  4UP3 A;  4EMJ A;  4G6G A;  1D4E A;  4CNK A;  1JNR A;  1NHR A;  1SEZ A;  5C3J A;  3FBS A;  4OPI A;  2BYB A;  1KNP A;  4Y4M A;  4Z2T A;  2YLZ A;  2C73 A;  4B67 A;  1F8S A;  2YM2 A;  1CF3 A;  1XPQ A;  2GVC A;  5BVA A;  1NAA A;  4N9X A;  3UOX A;  3SZC A;  2H88 A;  3SZF A;  4II2 A;  2XCG A;  3SX6 A;  4CNJ A;  4OPT A;  4D03 A;  4Y4N A;  1P2H A;  2BXS A;  1XAN A;  1CC4 A;  4JNQ A;  1BF3 A;  2YLW A;  4B1B A;  3LJP A;  3NT6 A;  5EB5 A;  2BRA A;  3KKJ A;  3T2Z A;  1ZK7 A;  1TYP A;  1DJN A;  4GDE A;  1QLB A;  1IUS A;  4HB9 A;  1VQW A;  1JRZ A;  1ZOV A;  4H4T A;  5FS8 A;  3WE0 A;  2GR2 A;  3AE5 A;  1GER A;  1NG4 A;  2V5Z A;  1CL0 A;  2GRT A;  3AEG A;  3H8I A;  2VRL A;  5KVI A;  2WEU A;  1H6V A;  1M6I A;  4HA6 A;  4CY8 A;  2GQW A;  1NDA A;  1ZKQ A;  2I0Z A;  2VQB A;  4IA5 A;  3GWF A;  2AAQ A;  1FEC A;  4ZCD A;  1GTH A;  3RP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...