3P1WA

Crystal structure of rab gdi from plasmodium falciparum, pfl2060c
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
444
structure length
442
Chain Sequence
QGEHYDVIILGTGLKECILSGLLSHYGKKILVLDRNPYYGGETASLNLTNLYNTFKPKENIPSKYGENRHWNVDLIPKFILVGGNLVKILKKTRVTNYLEWLVVEGSYVYQHQKKGFLTSEKFIHKVPATDMEALVSPLLSLMEKNRCKNFYQYVSEWDANKRNTWDNLDPYKLTMLEIYKHFNLCQLTIDFLGHAVALYLNDDYLKQPAYLTLERIKLYMQSISAFGKSPFIYPLYGLGGIPEGFSRMCAINTFMLNKNVVDFVFDDDNKVCGIKSSDGEIAYCDKVICDPSYVMHLKNKIKKIGQVIRCICILSNPIPETNQTNSCQIIIPQNQLNRKSDIYINLVSFQHGVTLKGKYIAIVSATVETNNPIKEIEKPLELLGTIEEKFVKISDLYVSTSKKPADNIFVTSSYDATSHFETATNDLLQIWENLWGQKLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RabGDI protein
publication title Crystal Structure of RAB GDI from Plasmodium Falciparum, PFL2060c
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein transport
total genus 138
structure length 442
sequence length 444
ec nomenclature
pdb deposition date 2010-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3p1wA03
3.30.519.10 Alpha Beta 2-Layer Sandwich Guanine Nucleotide Dissociation Inhibitor; domain 2 Guanine Nucleotide Dissociation Inhibitor, domain 2 3p1wA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3p1wA01
3GMCA 4NEWA 2R0PA 4Y4LA 4CBQA 1PN0A 4Z2TA 2XFNA 1XDIA 3G5RA 1OJDA 3VR8A 2TMDA 1VDCA 3GDNA 2NVKX 3AEEA 2V5ZA 1H6VA 2Q7VA 3ATQA 2YVGA 1GSNA 5CQFA 2BXRA 1B5QA 2WDQA 2BK3A 5C2TA 1D7YA 2Q0LA 1DOEA 1N4WA 4NZHA 1GOSA 3AE1A 2YG7A 4JQ9A 1GESA 4B66A 3CNJA 3ALJA 2CDUA 2BK4A 3JSKA 3LADA 1GRAA 2WETA 5BULA 4FX9A 2YVFA 1FOHA 1H82A 2JBVA 3LJPA 4REKA 4DSGA 3ADAB 1E1MA 2JK6A 4OVIA 2OALA 5JCIA 2WS3A 3NHOX 4IV9A 1GERA 4O5UA 1LTXR 4OPDA 1O94A 1EL7A 5KXJA 3FIMB 1B8SA 4BV6A 5KWFA 4Z26A 3GRSA 3OZ2A 4YSYA 1IUVA 3UOVA 1PDHA 3QFBA 5KRQA 1NHRA 3QSSA 4H4YA 5U25A 2R4JA 1DJQA 4BURA 2WESA 1YQ4A 3FG2P 3GWDA 5JCLA 2AAQA 3CNDA 2C75A 3DJDA 3P4SA 3GD4A 4LU6A 2YM2A 5J7XA 4E0VA 4I58A 4UDPA 1K0LA 4ZN0A 1CC4A 3KVEA 5HHFA 5M0ZA 2C70A 3UKAA 1YKJA 4B67A 3BNUA 4O5QA 5J60A 4JY2A 3IHMA 2FJAA 4JNQA 1XHCA 1FECA 2BYBA 1N4VA 4PAAA 2W0HA 1JNRA 4CNJA 2JB1A 2IIDA 1CHUA 4JDRA 1N4UA 2C3CA 3K7QX 5EBKA 3ICSA 1EL9A 2C72A 4GDPA 2WPFA 2VRLA 4AOXA 3ABVA 2RGJA 3RNMA 2WQYA 3C4NA 1CC6A 3AEBA 2XDOA 4J31A 3E1TA 1KF6A 1NHSA 5EOWA 3KA7A 3QVPA 4TM4A 3AD8B 4U8OA 5TR3A 1TRBA 4K22A 1PJ5A 3QSEA 4KPRA 2X8GA 1VQWA 1IUSA 1H81A 2VVMA 3H4KA 1LV0A 3GYIA 2YLWA 4H4WA 4B1BA 1FL2A 1VG0A 2C66A 2VRMA 2WDRA 1GV4A 5FMHA 4H4PA 1Z6LA 4A6NA 4U2SA 4TM0A 4Y4NA 2YLXA 1MOKA 2BA9A 1NENA 1S2YA 4OPUA 3NLCA 1QLBA 2GH5A 2V3AA 3EANA 1H7WA 3NKSA 4H2RA 1BZLA 1B4VA 4GUVA 4B65A 4K2XA 4P9SA 4J2WA 3AD7B 1PBFA 1GRGA 4B63A 3RP6A 4APNA 4K8DA 2YG3A 2NPXA 5EB4A 3QJ4A 4H2NA 2GQFA 2YG6A 1EL5A 1Y56A 5LV9A 2DKIA 2YR5A 3LZWA 1D4DA 1K0JA 4LIIA 3F8DA 1Q1WA 3HZLA 2A89A 2WP9A 3DJJA 2EQ6A 1IJHA 2WP5A 3NK0X 3VRAA 4H4QA 2E1MA 3DK9A 1IUTA 3M13A 2QA2A 3OC4A 1PHHA 3AE5A 4ECHA 2Z5YA 4BK1A 1F6MA 2YLRA 4B69A 2B76A 4EIPA 2Q6UA 3ZYXA 1JRYA 2WU5A 3BI2A 2XVIA 1D4EA 1NHPA 3Q6JA 4D03A 1F8SA 2BS2A 4GR1A 2JAEA 1ZX9A 1VG9A 1QO8A 2XFUA 2BACA 3NK2X 1CJCA 1CF3A 2QCUA 3EAOA 1ZOYA 2XLSA 2ZZ0A 1X31B 3AD9B 4AOSA 5GRTA 1GTEA 2BCPA 2XYOA 4EMJA 4AP3A 5BRTA 3LXDA 1RYIA 1LPFA 2WEUA 2Y6QA 2ZBWA 4MJWA 2X50A 4DGKA 5JCKA 2PHHA 4Z2RA 4OPIA 1KFYA 3AYLA 4N9XA 1PXAA 2GQWA 3UKPA 3KD9A 1O95A 1E7PA 2OLNA 1TDNA 2F5ZA 2ZZBA 3D1CA 1L0VA 1CJ2A 1EBDA 1QJDA 2VVLA 3BHFA 3FMWA 3NGCX 3NYFA 4A6NB 3BHKA 2C67A 2IVEA 3KKJA 3DGHA 4HA6A 2GF3A 4YSZA 4XXGA 4X9NA 3UP5A 2GAGB 4AP1A 4NTEA 1NHQA 3NTDA 3K30A 2QAEA 2C73A 1DOBA 2R4EA 3DGZA 3SM8A 4BJZA 2OA1A 3F8RA 4YKFA 5KOXA 1Y56B 3ITJA 5EB5A 1GRHA 5M10A 3O0HA 2WOIA 4ZCDA 3AECA 3B3RA 3CPHG 4OPLA 2B9XA 1TYTA 1E39A 2Q0KA 3KLJA 3P4PA 1H83A 4EQWA 1DNCA 2BS3A 2OLOA 4H2PA 2FBWA 3S5WA 3S61A 1UKVG 4A99A 2FJBA 2JKCA 4U8JA 3M0OA 4USRA 4YXDA 3RP8A 4GRTA 4IA5A 1YQ3A 2RGOA 1ZKQA 3CIRA 1KSSA 1GREA 1JEHA 2DKHA 2YQUA 3P4QA 4CCQA 2XLUA 3UOXA 2B7SA 4YWOA 4ADWA 1NAAA 1DOCA 1PBEA 2WBAA 1JNZA 4OPGA 3GD3A 3UTGA 2GMJA 1Q9IA 2WDVA 3NK1X 3UOZA 3VQRA 1KDGA 4Z43A 3DH9A 2X8CA 1PS9A 2VQ7A 2I0ZA 1GRFA 1ZOVA 3ALLA 4CY8A 3RP7A 4NEVA 1CL0A 2J3NA 2X3NA 3QSMA 3CPJG 4BK2A 3CTYA 4TM3A 1FCDA 3AEFA 1H7XA 1IUWA 2XLPA 3UKKA 1LVLA 3ISHA 1COYA 5HXIA 2GB0A 5GSNA 2X99A 4CY6A 1M64A 3AYJA 1JU2A 3D8XA 3AYIA 2VQBA 3FPZA 2PYXA 4H4SA 4RG3A 2C65A 4C3YA 1PBCA 2AQJA 3BNMA 3AE9A 2C64A 2WPEA 2GR2A 2UZZA 2GVCA 4J36A 1KNRA 2BXSA 3F8PA 3ZDNA 1ZY8A 1ZMCA 4K7ZA 4EIQA 3CGDA 3I3LA 3II4A 3IWAA 4U8MA 1L9EA 3UTHA 5IPYA 3DK4A 1IUXA 4Z44A 4EMIA 1OJ9A 2C76A 3LB8A 3AE3A 5IQ1A 3IF9A 2ZZCA 3AEAA 2CULA 3KPFA 1F3PA 4H4XA 3QFAA 1E1NA 1OJAA 2JB3A 3UP4A 4J34A 4UDQA 3P9UA 4IA6A 4PABA 4TM1A 2YM1A 2EQ9A 2APGA 2YR6A 1W4XA 1GRTA 3H8LA 2YR4A 2WOVA 1DODA 2GMHA 4U8LA 1S2QA 2WPCA 5BUKA 1FEBA 4ZCCA 1NPXA 1NG3A 2VZ2A 3LOVA 4FK1C 2WU2A 3B6DA 3NYEA 3DJEA 1N1PA 3AE8A 4RG4A 2E4GA 1XANA 5L46A 4X9MA 3DK8A 4WX1A 3CGEA 1JOAA 1NG4A 1DJNA 3AE2A 4CCRA 3GYJA 4Z25A 2XLTA 1LQUA 1CBOA 4A79A 2H88A 2XFPA 2IVDA 4C74A 3UTFA 3BI4A 3NN6X 5FS6A 3UKLA 2BABA 1D4CA 4HB9A 3UCLA 4H4VA 1PXCA 4C3XA 2YWLA 4C77A 4NTDA 4AT0A 1REOA 3V76A 1PJ7A 5U63A 1PXBA 2YG4A 2BCGG 2R45A 2H89A 1V59A 2R0CA 3AE4A 4B64A 4KX6A 3GMBA 1E6EA 1ZMDA 3UTEA 4YT0A 3GDPA 4H7UA 1K0IA 5KVIA 4YTPA 4U2LA 1GALA 5FS9A 4NTCA 1ZK7A 3DA1A 4H4RA 1BGJA 3PS9A 4USQA 4YSXA 5HY5A 3CGBA 2GR0A 4U2TA 3CNSA 3PO7A 3VR9A 2GV8A 2YG5A 3COXA 1MO9A 5HYMA 4C5OA 1S3EA 4EM4A 5KOWA 3NIXA 3AXBA 1AOGA 3SGLA 4A5LA 2B9WA 3AE6A 3CNTA 1H84A 2R46A 1D7LA 3P4RA 4FK1A 2AR8A 3UKQA 2Y6RA 4YTMA 3VRDB 2GR3A 1BGNA 3REDA 3CGCA 1TDKA 3AB1A 2E5VA 1VRQB 5JCMA 1P2HA 5DBJA 1ZP0A 3EF6A 3IC9A 4U8NA 4A9WA 4A7AA 3UOYA 4J33A 2B9YA 2BC1A 4DSHA 4FDCB 4XWRA 1L9CA 4EQRA 3NTAA 2BK5A 2V60A 2XVJA 2R9ZA 2WP6A 3DMEA 4TLXA 2EQ8A 3AEDA 4EQSA 3BI5A 3RHAA 2WOWA 2XVFA 4GDEA 2X8HA 3L8KA 4Y4MA 3GWFA 4YKGA 2RABA 1CJ3A 3I6DA 1RSGA 3LZXA 4H2QA 4GCMA 4Z2UA 2YLSA 4OPTA 1GRBA 4IVOB 4GF7A 1F8RA 2A87A 2XFOA 4K5SA 2RGHA 3C4AA 2GRTA 5U1OA 1KSUA 1P2EA 4RSLA 2EQ7A 5FS8A 3VRBA 1E1KA 5CKUA 2R0GA 3NG7X 1LJ1A 5JCNA 4OPCA 1E1LA 3SFEA 3G5QA 3NT6A 2FJDA 3UKHA 1TDOA 1ZDLA 3NRNA 1MXTA 3AEGA 2QA1A 3AWIA 3SQPA 1Q1RA 2ACZA 1BWCA 1GEUA 3CN8A 3NNEA 4A65A 3KU9A 3SFDA 3V3OA 3V3NA 1CC2A 4CRTA 2O9ZA 2WHDA 2CVJA 3NH3X 1ELIA 4H4UA 4EMWA 2XFQA 1HYUA 1GNDA 2Z5XA 3NN0X 1BF3A 4UP3A 3L1RA 5BVAA 4DNAA 1JRZA 2C7GA 2BC0A 2YAUA 2VVLG 3ICRA 3H8IA 2GR1A 1L9DA 3NYCA 3WE0A 3GRTA 3K7TA 4WCTA 1NDAA 3ICTA 4AT2A 1DXLA 1GPEA 1TYPA 3EPTA 2GAHB 4UDRA 2V3BA 2V61A 4OCGA 1TDEA 1BKWA 1SEZA 2CFYA 1OJTA 1CJ4A 4U8KA 1KNPA 1LQTA 2YVJA 4LA1A 5ER0A 4BK3A 1PBDA 1NEKA 1EL8A 1OJCA 1ONFA 1O5WA 4Z24A 1S3BA 2BS4A 5C3JA 4XWZA 4J57A 1YQZA 3UKFA 1YY5A 4YTNA 1FEAA 1D5TA 2C3DA 4H4ZA 2ARDA 1PJ6A 2XLRA 3Q9TA 3QVRA 4U8PA 3R9UA 3DJGX 2TPRA 4K5RA 1IUUA 4B68A 4CNKA 1B37A 1PBBA 4BJYA 1JRXA 1K4QA 3P1WA 2YLZA 1F8WA 3G5SA 4H4TA 4TLZA 1TDFA 4JN9A 4JNAA 1H86A 2FJEA 1Y0PA 2A8XA 3IHGA 3AE7A 4H50A 4X4JA 2B7RA 1GTHA 4I59A 4ICYA 4JY3A 4EQXA 2XCGA 3C96A 2YLTA 1GXFA 4YSHA 3PVCA 1M6IA 2GEWA 1GETA 2VOUA 4U8IA 3GSIA 2JB2A 5IQ4A 3M12A 4EM3A 5KVHA 3CNPA 3FBSA 3ALMA 1GT8A 3ATRA 2OAMA 3K7MX 4J56A 5FS7A 1RP0A 3CPIG 2HQMA 2XVEA 2XVHA 4IVMB 4M52A 4D04A 1XPQA 2V6OA 3T37A 3URHA
chains in the Genus database with same CATH superfamily
3GMCA 4NEWA 2R0PA 4Y4LA 4CBQA 1PN0A 4Z2TA 2XFNA 1XDIA 3G5RA 1OJDA 4G9KA 2TMDA 1VDCA 3GDNA 3VR8A 2NVKX 3AEEA 2V5ZA 1H6VA 2Q7VA 3ATQA 2YVGA 1GSNA 5CQFA 2BXRA 1B5QA 2WDQA 2BK3A 5C2TA 1D7YA 2Q0LA 1DOEA 1N4WA 4NZHA 4NNJA 1GOSA 3AE1A 2YG7A 4JQ9A 1GESA 4B66A 3CNJA 3ALJA 2CDUA 2BK4A 3JSKA 3LADA 1GRAA 2WETA 5BULA 4FX9A 2YVFA 1FOHA 1H82A 2JBVA 3HYXA 3LJPA 4REKA 4DSGA 3ADAB 1E1MA 2JK6A 4OVIA 2OALA 5JCIA 4IV9A 2WS3A 3NHOX 1GERA 4O5UA 1LTXR 4OPDA 2C4CA 1O94A 1EL7A 5KXJA 3FIMB 1B8SA 4BV6A 5KWFA 4Z26A 3GRSA 3OZ2A 4YSYA 1IUVA 3SXIA 1PDHA 3QFBA 3UOVA 5KRQA 3GYXA 1NHRA 3QSSA 4H4YA 5U25A 2R4JA 1DJQA 4BURA 2WESA 1YQ4A 3SZWA 3FG2P 3GWDA 5JCLA 2AAQA 3CNDA 2C75A 4YXDA 3DJDA 3P4SA 3GD4A 4LU6A 2YM2A 5J7XA 4E0VA 4G6GA 4I58A 4UDPA 1K0LA 4ZN0A 4GAVA 4G6HA 1CC4A 3KVEA 5HHFA 5M0ZA 2C70A 3UKAA 1YKJA 4B67A 3BNUA 4O5QA 5J60A 4JY2A 3IHMA 2FJAA 4JNQA 1XHCA 1FECA 2BYBA 1N4VA 4PAAA 2W0HA 1JNRA 4CNJA 2JB1A 2IIDA 1CHUA 4JDRA 1N4UA 2C3CA 3K7QX 5EBKA 3ICSA 1EL9A 2C72A 4GDPA 2WPFA 2VRLA 4AOXA 3ABVA 2RGJA 3RNMA 2WQYA 3C4NA 1CC6A 3AEBA 2XDOA 4J31A 3E1TA 1KF6A 1NHSA 5EOWA 3KA7A 3QVPA 4TM4A 3AD8B 4U8OA 5TR3A 1TRBA 4K22A 1PJ5A 3QSEA 4KPRA 2X8GA 1VQWA 1IUSA 1H81A 2VVMA 3H4KA 1LV0A 3GYIA 2YLWA 4H4WA 4B1BA 1FL2A 1VG0A 2C66A 2VRMA 2WDRA 1GV4A 5FMHA 4H4PA 3SYIA 1Z6LA 4A6NA 4U2SA 4TM0A 4Y4NA 2YLXA 1MOKA 2BA9A 1S2YA 1NENA 4OPUA 3NLCA 1QLBA 2GH5A 2V3AA 3EANA 1H7WA 3NKSA 4H2RA 1BZLA 3SX6A 1B4VA 4GUVA 4B65A 4K2XA 4P9SA 4G74A 4J2WA 3AD7B 1PBFA 1GRGA 4B63A 3RP6A 4APNA 4K8DA 2YG3A 2NPXA 4G73A 5EB4A 3QJ4A 4H2NA 2GQFA 2YG6A 1EL5A 1Y56A 5LV9A 2DKIA 2YR5A 3LZWA 1D4DA 1K0JA 4LIIA 3F8DA 1Q1WA 3HZLA 2A89A 2WP9A 3DJJA 5KMQA 2EQ6A 1IJHA 2WP5A 3NK0X 3VRAA 4H4QA 2E1MA 3DK9A 1IUTA 3M13A 2QA2A 3OC4A 1PHHA 3AE5A 4ECHA 2Z5YA 4BK1A 1F6MA 2YLRA 4B69A 2B76A 4EIPA 2Q6UA 3ZYXA 1JRYA 2WU5A 3BI2A 2XVIA 1D4EA 1NHPA 3Q6JA 4D03A 1F8SA 2BS2A 4GR1A 2JAEA 2BRYA 1ZX9A 1VG9A 2BACA 2XFUA 1QO8A 3NK2X 1CJCA 1CF3A 2QCUA 3EAOA 1ZOYA 2XLSA 2ZZ0A 1X31B 3AD9B 4AOSA 5GRTA 1GTEA 2BCPA 2XYOA 4EMJA 4AP3A 5BRTA 3LXDA 1RYIA 1LPFA 2WEUA 2Y6QA 2ZBWA 4MJWA 2X50A 4DGKA 5JCKA 2PHHA 4Z2RA 4OPIA 1KFYA 3AYLA 4N9XA 1PXAA 2GQWA 3UKPA 3KD9A 1O95A 1E7PA 2OLNA 1TDNA 2F5ZA 2ZZBA 3D1CA 1L0VA 1CJ2A 1EBDA 1QJDA 2VVLA 3BHFA 3FMWA 3NGCX 3NYFA 4A6NB 3BHKA 2C67A 2IVEA 3KKJA 3DGHA 4HA6A 2GF3A 4YSZA 4XXGA 4X9NA 3UP5A 2GAGB 4AP1A 4NTEA 1NHQA 3NTDA 3K30A 2QAEA 2C73A 1DOBA 2R4EA 3DGZA 3SM8A 4BJZA 2OA1A 3F8RA 4YKFA 5KOXA 1Y56B 3ITJA 5EB5A 1GRHA 5M10A 3O0HA 2WOIA 4ZCDA 3AECA 3T14A 3B3RA 3CPHG 4OPLA 2B9XA 1TYTA 1E39A 2Q0KA 3KLJA 3P4PA 1H83A 4EQWA 1DNCA 2BS3A 2OLOA 4H2PA 2FBWA 3S5WA 3S61A 1UKVG 4A99A 2FJBA 2JKCA 4U8JA 3M0OA 4USRA 3SZCA 3RP8A 4GRTA 4IA5A 1YQ3A 2RGOA 1ZKQA 3CIRA 1KSSA 1GREA 1JEHA 2DKHA 2YQUA 3P4QA 4CCQA 2XLUA 3UOXA 2B7SA 4YWOA 4ADWA 1NAAA 1DOCA 1PBEA 2WBAA 1JNZA 4OPGA 3GD3A 3UTGA 2GMJA 1Q9IA 2WDVA 3NK1X 3UOZA 3VQRA 1KDGA 4Z43A 3DH9A 2X8CA 1PS9A 4GAPA 2VQ7A 2I0ZA 1GRFA 1ZOVA 3ALLA 4CY8A 3RP7A 4NEVA 1CL0A 2J3NA 2X3NA 3QSMA 3CPJG 4BK2A 3CTYA 4TM3A 1FCDA 3AEFA 3HYWA 1H7XA 1IUWA 2XLPA 3UKKA 1LVLA 3ISHA 1COYA 3CMMA 2GB0A 5GSNA 2X99A 4CY6A 5HXIA 1M64A 3AYJA 1JU2A 3D8XA 3AYIA 2VQBA 3FPZA 2PYXA 4H4SA 4RG3A 2C65A 4C3YA 1PBCA 2AQJA 3BNMA 3AE9A 2C64A 2WPEA 2GR2A 2UZZA 2GVCA 4J36A 1KNRA 2BXSA 3F8PA 3ZDNA 1ZY8A 1ZMCA 4K7ZA 4EIQA 3CGDA 3I3LA 3II4A 3IWAA 4U8MA 1L9EA 3UTHA 5IPYA 5KMRA 3DK4A 1IUXA 4Z44A 4EMIA 1OJ9A 2C76A 3LB8A 3AE3A 5IQ1A 3IF9A 2ZZCA 3AEAA 2CULA 3KPFA 1F3PA 4H4XA 3QFAA 1E1NA 1OJAA 2JB3A 3UP4A 4J34A 4UDQA 3P9UA 4IA6A 4PABA 4TM1A 2YM1A 2EQ9A 2APGA 2YR6A 1W4XA 1GRTA 3H8LA 2YR4A 2WOVA 1DODA 2GMHA 4U8LA 1S2QA 2WPCA 5BUKA 1FEBA 4ZCCA 1NPXA 1NG3A 2VZ2A 3LOVA 4FK1C 2WU2A 3B6DA 3NYEA 3DJEA 1N1PA 3AE8A 4RG4A 2E4GA 1XANA 5L46A 4X9MA 3DK8A 4WX1A 3CGEA 1JOAA 1NG4A 1DJNA 3AE2A 4CCRA 3GYJA 4Z25A 2XLTA 1LQUA 1CBOA 4A79A 2H88A 2XFPA 2IVDA 5KMSA 4C74A 3UTFA 3BI4A 3NN6X 5FS6A 3UKLA 2BABA 1D4CA 4II3A 4HB9A 3UCLA 4H4VA 1PXCA 4C3XA 2YWLA 4C77A 4NTDA 4AT0A 1REOA 3V76A 1PJ7A 5U63A 1PXBA 2YG4A 2BCGG 2R45A 2H89A 1V59A 2R0CA 3AE4A 4B64A 4KX6A 5KMPA 3GMBA 1E6EA 1ZMDA 3HYVA 3UTEA 4YT0A 5KNLA 3GDPA 4H7UA 1K0IA 5KVIA 4YTPA 4U2LA 1GALA 5FS9A 4NTCA 1ZK7A 3DA1A 4H4RA 1BGJA 3PS9A 4USQA 4YSXA 5HY5A 3CGBA 2GR0A 4U2TA 3CNSA 3PO7A 3VR9A 2GV8A 2YG5A 3COXA 1MO9A 5HYMA 4C5OA 1S3EA 4EM4A 5KOWA 3NIXA 3AXBA 1AOGA 3SGLA 4A5LA 2B9WA 3AE6A 3CNTA 1H84A 2R46A 1D7LA 3P4RA 4FK1A 2AR8A 3UKQA 2Y6RA 4YTMA 3VRDB 2GR3A 1BGNA 3REDA 3CGCA 2BRAA 1TDKA 3AB1A 2E5VA 1VRQB 5JCMA 1P2HA 5DBJA 1ZP0A 3EF6A 3IC9A 4U8NA 4A9WA 4A7AA 3UOYA 4J33A 2B9YA 2BC1A 4DSHA 4FDCB 4XWRA 1L9CA 4EQRA 3NTAA 2BK5A 2V60A 2XVJA 2R9ZA 2WP6A 3DMEA 4TLXA 2EQ8A 3AEDA 4EQSA 3BI5A 3RHAA 2WOWA 2XVFA 4GDEA 2X8HA 3L8KA 4Y4MA 3GWFA 4YKGA 2RABA 1CJ3A 3I6DA 1RSGA 3LZXA 4H2QA 4GCMA 4Z2UA 2YLSA 4OPTA 1GRBA 4IVOB 4GF7A 1F8RA 2A87A 2XFOA 4K5SA 2RGHA 3C4AA 2GRTA 5U1OA 1KSUA 1P2EA 4RSLA 2EQ7A 5FS8A 3VRBA 1E1KA 5CKUA 2R0GA 3NG7X 1LJ1A 5JCNA 4OPCA 1E1LA 3T31A 3SFEA 3G5QA 3NT6A 2FJDA 3UKHA 1TDOA 1ZDLA 3NRNA 1MXTA 3AEGA 2QA1A 3AWIA 3SQPA 1Q1RA 2ACZA 1BWCA 1GEUA 3CN8A 3NNEA 4A65A 3KU9A 3SFDA 3V3OA 3V3NA 1CC2A 4CRTA 2O9ZA 2WHDA 2CVJA 3NH3X 1ELIA 4H4UA 3T2YA 4EMWA 2XFQA 1HYUA 1GNDA 2Z5XA 3NN0X 1BF3A 3KPKA 4UP3A 3L1RA 5BVAA 4DNAA 1JRZA 3SZ0A 2C7GA 2BC0A 2YAUA 2VVLG 3ICRA 4NWZA 3H8IA 2GR1A 3WE0A 1L9DA 3NYCA 3GRTA 3K7TA 4WCTA 1NDAA 3ICTA 4AT2A 1DXLA 1GPEA 1TYPA 3EPTA 2GAHB 4UDRA 2V3BA 2V61A 4OCGA 1TDEA 1BKWA 1SEZA 2CFYA 1OJTA 1CJ4A 4U8KA 1KNPA 1LQTA 2YVJA 4LA1A 5ER0A 4II2A 4BK3A 1PBDA 3T0KA 1NEKA 1EL8A 3T2ZA 1OJCA 1ONFA 1O5WA 4Z24A 1S3BA 2BS4A 5C3JA 4XWZA 4J57A 1YQZA 3UKFA 1YY5A 4YTNA 1FEAA 1D5TA 2C3DA 4H4ZA 2ARDA 1PJ6A 2XLRA 3Q9TA 3QVRA 4U8PA 3R9UA 3DJGX 2TPRA 4K5RA 1IUUA 4B68A 4CNKA 1B37A 1PBBA 4BJYA 1JRXA 1K4QA 3P1WA 2YLZA 1F8WA 3G5SA 4H4TA 4TLZA 1TDFA 4JN9A 4JNAA 1H86A 2FJEA 1Y0PA 2A8XA 3IHGA 3AE7A 4H50A 4X4JA 2B7RA 1GTHA 4I59A 4ICYA 4JY3A 4EQXA 2XCGA 3C96A 2YLTA 3SY4A 1GXFA 4YSHA 3PVCA 1M6IA 2GEWA 1GETA 2VOUA 4U8IA 3T2KA 3GSIA 2JB2A 5IQ4A 3M12A 4EM3A 5KVHA 3CNPA 3FBSA 3ALMA 3SZFA 1GT8A 3ATRA 2OAMA 3K7MX 4J56A 5FS7A 1RP0A 3CPIG 2HQMA 2XVEA 2XVHA 4IVMB 4M52A 4D04A 1XPQA 2V6OA 3T37A 3URHA
chains in the Genus database with same CATH topology
3GMCA 4NEWA 2R0PA 4Y4LA 4CBQA 1PN0A 4Z2TA 2XFNA 1XDIA 3G5RA 1OJDA 4G9KA 2TMDA 1VDCA 3GDNA 3VR8A 2NVKX 3AEEA 2V5ZA 1H6VA 2Q7VA 3ATQA 2YVGA 1GSNA 5CQFA 2BXRA 1B5QA 2WDQA 2BK3A 5C2TA 1D7YA 2Q0LA 1DOEA 1N4WA 4NZHA 4NNJA 1GOSA 3AE1A 2YG7A 4JQ9A 1GESA 4B66A 3CNJA 3ALJA 2CDUA 2BK4A 3JSKA 3LADA 1GRAA 2WETA 5BULA 4FX9A 2YVFA 1FOHA 1H82A 2JBVA 3HYXA 3LJPA 4REKA 4DSGA 3ADAB 1E1MA 2JK6A 4OVIA 2OALA 5JCIA 2WS3A 3NHOX 4IV9A 1GERA 4O5UA 1LTXR 4OPDA 2C4CA 1O94A 1EL7A 5KXJA 3FIMB 1B8SA 4BV6A 5KWFA 4Z26A 3GRSA 3OZ2A 4YSYA 1IUVA 3SXIA 1PDHA 3QFBA 3UOVA 5KRQA 3GYXA 1NHRA 3QSSA 4H4YA 5U25A 2R4JA 1DJQA 4BURA 2WESA 1YQ4A 3SZWA 3FG2P 3GWDA 5JCLA 2AAQA 3CNDA 2C75A 4YXDA 3DJDA 3P4SA 3GD4A 4LU6A 2YM2A 5J7XA 4E0VA 4G6GA 4I58A 4UDPA 1K0LA 4ZN0A 4GAVA 4G6HA 1CC4A 3KVEA 5HHFA 5M0ZA 2C70A 3UKAA 1YKJA 4B67A 3BNUA 4O5QA 5J60A 4JY2A 3IHMA 2FJAA 4JNQA 1XHCA 1FECA 2BYBA 1N4VA 4PAAA 2W0HA 1JNRA 4CNJA 2JB1A 2IIDA 1CHUA 4JDRA 1N4UA 2C3CA 3K7QX 5EBKA 3ICSA 1EL9A 2C72A 4GDPA 2WPFA 2VRLA 4AOXA 3ABVA 2RGJA 3RNMA 2WQYA 3C4NA 1CC6A 3AEBA 2XDOA 4J31A 3E1TA 1KF6A 1NHSA 5EOWA 3KA7A 3QVPA 4TM4A 3AD8B 4U8OA 5TR3A 1TRBA 4K22A 1PJ5A 3QSEA 4KPRA 2X8GA 1VQWA 1IUSA 1H81A 2VVMA 3H4KA 1LV0A 3GYIA 2YLWA 4H4WA 4B1BA 1FL2A 1VG0A 2C66A 2VRMA 2WDRA 1GV4A 5FMHA 4H4PA 3SYIA 1Z6LA 4A6NA 4U2SA 4TM0A 4Y4NA 2YLXA 1MOKA 2BA9A 1NENA 1S2YA 4OPUA 3NLCA 1QLBA 2GH5A 2V3AA 3EANA 1H7WA 3NKSA 4H2RA 1BZLA 3SX6A 1B4VA 4GUVA 4B65A 4K2XA 4P9SA 4G74A 4J2WA 3AD7B 1PBFA 1GRGA 4B63A 3RP6A 4APNA 4K8DA 2YG3A 2NPXA 4G73A 5EB4A 3QJ4A 4H2NA 2GQFA 2YG6A 1EL5A 1Y56A 5LV9A 2DKIA 2YR5A 3LZWA 1D4DA 1K0JA 4LIIA 3F8DA 1Q1WA 3HZLA 2A89A 2WP9A 3DJJA 5KMQA 2EQ6A 1IJHA 2WP5A 3NK0X 3VRAA 4H4QA 2E1MA 3DK9A 1IUTA 3M13A 2QA2A 3OC4A 1PHHA 3AE5A 4ECHA 2Z5YA 4BK1A 1F6MA 2YLRA 4B69A 2B76A 4EIPA 2Q6UA 3ZYXA 1JRYA 2WU5A 3BI2A 2XVIA 1D4EA 1NHPA 3Q6JA 4D03A 1F8SA 2BS2A 4GR1A 2JAEA 2BRYA 1ZX9A 1VG9A 1QO8A 2XFUA 2BACA 3NK2X 1CJCA 1CF3A 2QCUA 3EAOA 1ZOYA 2XLSA 2ZZ0A 1X31B 3AD9B 4AOSA 5GRTA 1GTEA 2BCPA 2XYOA 4EMJA 4AP3A 5BRTA 3LXDA 1RYIA 1LPFA 2WEUA 2Y6QA 2ZBWA 4MJWA 2X50A 4DGKA 5JCKA 2PHHA 4Z2RA 4OPIA 1KFYA 3AYLA 4N9XA 1PXAA 2GQWA 3UKPA 3KD9A 1O95A 1E7PA 2OLNA 1TDNA 2F5ZA 2ZZBA 3D1CA 1L0VA 1CJ2A 1EBDA 1QJDA 2VVLA 3BHFA 3FMWA 3NGCX 3NYFA 4A6NB 3BHKA 2C67A 2IVEA 3KKJA 3DGHA 4HA6A 2GF3A 4YSZA 4XXGA 4X9NA 3UP5A 2GAGB 4AP1A 4NTEA 1NHQA 3NTDA 3K30A 2QAEA 2C73A 1DOBA 2R4EA 3DGZA 3SM8A 4BJZA 2OA1A 3F8RA 4YKFA 5KOXA 1Y56B 3ITJA 5EB5A 1GRHA 5M10A 3O0HA 2WOIA 4ZCDA 3AECA 3T14A 3B3RA 3CPHG 4OPLA 2B9XA 1TYTA 1E39A 2Q0KA 3KLJA 3P4PA 1H83A 4EQWA 1DNCA 2BS3A 2OLOA 4H2PA 2FBWA 3S5WA 3S61A 1UKVG 4A99A 2FJBA 2JKCA 4U8JA 3M0OA 4USRA 3SZCA 3RP8A 4GRTA 4IA5A 1YQ3A 2RGOA 1ZKQA 3CIRA 1KSSA 1GREA 1JEHA 2DKHA 2YQUA 3P4QA 4CCQA 2XLUA 3UOXA 2B7SA 4YWOA 4ADWA 1NAAA 1DOCA 1PBEA 2WBAA 1JNZA 4OPGA 3GD3A 3UTGA 2GMJA 1Q9IA 2WDVA 3NK1X 3UOZA 3VQRA 1KDGA 4Z43A 3DH9A 2X8CA 1PS9A 4GAPA 2VQ7A 2I0ZA 1GRFA 1ZOVA 3ALLA 4CY8A 3RP7A 4NEVA 1CL0A 2J3NA 2X3NA 3QSMA 3CPJG 4BK2A 3CTYA 4TM3A 1FCDA 3AEFA 3HYWA 1H7XA 1IUWA 2XLPA 3UKKA 1LVLA 3ISHA 1COYA 3CMMA 2GB0A 5GSNA 2X99A 4CY6A 5HXIA 1M64A 3AYJA 1JU2A 3D8XA 3AYIA 2VQBA 3FPZA 2PYXA 4H4SA 4RG3A 2C65A 4C3YA 1PBCA 2AQJA 3BNMA 3AE9A 2C64A 2WPEA 2GR2A 2UZZA 2GVCA 4J36A 1KNRA 2BXSA 3F8PA 3ZDNA 1ZY8A 1ZMCA 4K7ZA 4EIQA 3CGDA 3I3LA 3II4A 3IWAA 4U8MA 1L9EA 3UTHA 5IPYA 5KMRA 3DK4A 1IUXA 4Z44A 4EMIA 1OJ9A 2C76A 3LB8A 3AE3A 5IQ1A 3IF9A 2ZZCA 3AEAA 2CULA 3KPFA 1F3PA 4H4XA 3QFAA 1E1NA 1OJAA 2JB3A 3UP4A 4J34A 4UDQA 3P9UA 4IA6A 4PABA 4TM1A 2YM1A 2EQ9A 2APGA 2YR6A 1W4XA 1GRTA 3H8LA 2YR4A 2WOVA 1DODA 2GMHA 4U8LA 1S2QA 2WPCA 5BUKA 1FEBA 4ZCCA 1NPXA 1NG3A 2VZ2A 3LOVA 4FK1C 2WU2A 3B6DA 3NYEA 3DJEA 1N1PA 3AE8A 4RG4A 2E4GA 1XANA 5L46A 4X9MA 3DK8A 4WX1A 3CGEA 1JOAA 1NG4A 1DJNA 3AE2A 4CCRA 3GYJA 4Z25A 2XLTA 1LQUA 1CBOA 4A79A 2H88A 2XFPA 2IVDA 5KMSA 4C74A 3UTFA 3BI4A 3NN6X 5FS6A 3UKLA 2BABA 1D4CA 4II3A 4HB9A 3UCLA 4H4VA 1PXCA 4C3XA 2YWLA 4C77A 4NTDA 4AT0A 1REOA 3V76A 1PJ7A 5U63A 1PXBA 2YG4A 2BCGG 2R45A 2H89A 1V59A 2R0CA 3AE4A 4B64A 4KX6A 5KMPA 3GMBA 1E6EA 1ZMDA 3HYVA 3UTEA 4YT0A 5KNLA 3GDPA 4H7UA 1K0IA 5KVIA 4YTPA 4U2LA 1GALA 5FS9A 4NTCA 1ZK7A 3DA1A 4H4RA 1BGJA 3PS9A 4USQA 4YSXA 5HY5A 3CGBA 2GR0A 4U2TA 3CNSA 3PO7A 3VR9A 2GV8A 2YG5A 3COXA 1MO9A 5HYMA 4C5OA 1S3EA 4EM4A 5KOWA 3NIXA 3AXBA 1AOGA 3SGLA 4A5LA 2B9WA 3AE6A 3CNTA 1H84A 2R46A 1D7LA 3P4RA 4FK1A 2AR8A 3UKQA 2Y6RA 4YTMA 3VRDB 2GR3A 1BGNA 3REDA 3CGCA 2BRAA 1TDKA 3AB1A 2E5VA 1VRQB 5JCMA 1P2HA 5DBJA 1ZP0A 3EF6A 3IC9A 4U8NA 4A9WA 4A7AA 3UOYA 4J33A 2B9YA 2BC1A 4DSHA 4FDCB 4XWRA 1L9CA 4EQRA 3NTAA 2BK5A 2V60A 2XVJA 2R9ZA 2WP6A 3DMEA 4TLXA 2EQ8A 3AEDA 4EQSA 3BI5A 3RHAA 2WOWA 2XVFA 4GDEA 2X8HA 3L8KA 4Y4MA 3GWFA 4YKGA 2RABA 1CJ3A 3I6DA 1RSGA 3LZXA 4H2QA 4GCMA 4Z2UA 2YLSA 4OPTA 1GRBA 4IVOB 4GF7A 1F8RA 2A87A 2XFOA 4K5SA 2RGHA 3C4AA 2GRTA 5U1OA 1KSUA 1P2EA 4RSLA 2EQ7A 5FS8A 3VRBA 1E1KA 5CKUA 2R0GA 3NG7X 1LJ1A 5JCNA 4OPCA 1E1LA 3T31A 3SFEA 3G5QA 3NT6A 2FJDA 3UKHA 1TDOA 1ZDLA 3NRNA 1MXTA 3AEGA 2QA1A 3AWIA 3SQPA 1Q1RA 2ACZA 1BWCA 1GEUA 3CN8A 3NNEA 4A65A 3KU9A 3SFDA 3V3OA 3V3NA 1CC2A 4CRTA 2O9ZA 2WHDA 2CVJA 3NH3X 1ELIA 4H4UA 3T2YA 4EMWA 2XFQA 1HYUA 1GNDA 2Z5XA 3NN0X 1BF3A 3KPKA 4UP3A 3L1RA 5BVAA 4DNAA 1JRZA 3SZ0A 2C7GA 2BC0A 2YAUA 2VVLG 3ICRA 4NWZA 3H8IA 2GR1A 1L9DA 3NYCA 3WE0A 3GRTA 3K7TA 4WCTA 1NDAA 3ICTA 4AT2A 1DXLA 1GPEA 1TYPA 3EPTA 2GAHB 4UDRA 2V3BA 2V61A 4OCGA 1TDEA 1BKWA 1SEZA 2CFYA 1OJTA 1CJ4A 4U8KA 1KNPA 1LQTA 2YVJA 4LA1A 5ER0A 4II2A 4BK3A 1PBDA 3T0KA 1NEKA 1EL8A 3T2ZA 1OJCA 1ONFA 1O5WA 4Z24A 1S3BA 2BS4A 5C3JA 4XWZA 4J57A 1YQZA 3UKFA 1YY5A 4YTNA 1FEAA 1D5TA 2C3DA 4H4ZA 2ARDA 1PJ6A 2XLRA 3Q9TA 3QVRA 4U8PA 3R9UA 3DJGX 2TPRA 4K5RA 1IUUA 4B68A 4CNKA 1B37A 1PBBA 4BJYA 1JRXA 1K4QA 3P1WA 2YLZA 1F8WA 3G5SA 4H4TA 4TLZA 1TDFA 4JN9A 4JNAA 1H86A 2FJEA 1Y0PA 2A8XA 3IHGA 3AE7A 4H50A 4X4JA 2B7RA 1GTHA 4I59A 4ICYA 4JY3A 4EQXA 2XCGA 3C96A 2YLTA 3SY4A 1GXFA 4YSHA 3PVCA 1M6IA 2GEWA 1GETA 2VOUA 4U8IA 3T2KA 3GSIA 2JB2A 5IQ4A 3M12A 4EM3A 5KVHA 3CNPA 3FBSA 3ALMA 3SZFA 1GT8A 3ATRA 2OAMA 3K7MX 4J56A 5FS7A 1RP0A 3CPIG 2HQMA 2XVEA 2XVHA 4IVMB 4M52A 4D04A 1XPQA 2V6OA 3T37A 3URHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMC A;  4NEW A;  2R0P A;  4Y4L A;  4CBQ A;  1PN0 A;  4Z2T A;  2XFN A;  1XDI A;  3G5R A;  1OJD A;  3VR8 A;  2TMD A;  1VDC A;  3GDN A;  2NVK X;  3AEE A;  2V5Z A;  1H6V A;  2Q7V A;  3ATQ A;  2YVG A;  1GSN A;  5CQF A;  2BXR A;  1B5Q A;  2WDQ A;  2BK3 A;  5C2T A;  1D7Y A;  2Q0L A;  1DOE A;  1N4W A;  4NZH A;  1GOS A;  3AE1 A;  2YG7 A;  4JQ9 A;  1GES A;  4B66 A;  3CNJ A;  3ALJ A;  2CDU A;  2BK4 A;  3JSK A;  3LAD A;  1GRA A;  2WET A;  5BUL A;  4FX9 A;  2YVF A;  1FOH A;  1H82 A;  2JBV A;  3LJP A;  4REK A;  4DSG A;  3ADA B;  1E1M A;  2JK6 A;  4OVI A;  2OAL A;  5JCI A;  2WS3 A;  3NHO X;  4IV9 A;  1GER A;  4O5U A;  1LTX R;  4OPD A;  1O94 A;  1EL7 A;  5KXJ A;  3FIM B;  1B8S A;  4BV6 A;  5KWF A;  4Z26 A;  3GRS A;  3OZ2 A;  4YSY A;  1IUV A;  3UOV A;  1PDH A;  3QFB A;  5KRQ A;  1NHR A;  3QSS A;  4H4Y A;  5U25 A;  2R4J A;  1DJQ A;  4BUR A;  2WES A;  1YQ4 A;  3FG2 P;  3GWD A;  5JCL A;  2AAQ A;  3CND A;  2C75 A;  3DJD A;  3P4S A;  3GD4 A;  4LU6 A;  2YM2 A;  5J7X A;  4E0V A;  4I58 A;  4UDP A;  1K0L A;  4ZN0 A;  1CC4 A;  3KVE A;  5HHF A;  5M0Z A;  2C70 A;  3UKA A;  1YKJ A;  4B67 A;  3BNU A;  4O5Q A;  5J60 A;  4JY2 A;  3IHM A;  2FJA A;  4JNQ A;  1XHC A;  1FEC A;  2BYB A;  1N4V A;  4PAA A;  2W0H A;  1JNR A;  4CNJ A;  2JB1 A;  2IID A;  1CHU A;  4JDR A;  1N4U A;  2C3C A;  3K7Q X;  5EBK A;  3ICS A;  1EL9 A;  2C72 A;  4GDP A;  2WPF A;  2VRL A;  4AOX A;  3ABV A;  2RGJ A;  3RNM A;  2WQY A;  3C4N A;  1CC6 A;  3AEB A;  2XDO A;  4J31 A;  3E1T A;  1KF6 A;  1NHS A;  5EOW A;  3KA7 A;  3QVP A;  4TM4 A;  3AD8 B;  4U8O A;  5TR3 A;  1TRB A;  4K22 A;  1PJ5 A;  3QSE A;  4KPR A;  2X8G A;  1VQW A;  1IUS A;  1H81 A;  2VVM A;  3H4K A;  1LV0 A;  3GYI A;  2YLW A;  4H4W A;  4B1B A;  1FL2 A;  1VG0 A;  2C66 A;  2VRM A;  2WDR A;  1GV4 A;  5FMH A;  4H4P A;  1Z6L A;  4A6N A;  4U2S A;  4TM0 A;  4Y4N A;  2YLX A;  1MOK A;  2BA9 A;  1NEN A;  1S2Y A;  4OPU A;  3NLC A;  1QLB A;  2GH5 A;  2V3A A;  3EAN A;  1H7W A;  3NKS A;  4H2R A;  1BZL A;  1B4V A;  4GUV A;  4B65 A;  4K2X A;  4P9S A;  4J2W A;  3AD7 B;  1PBF A;  1GRG A;  4B63 A;  3RP6 A;  4APN A;  4K8D A;  2YG3 A;  2NPX A;  5EB4 A;  3QJ4 A;  4H2N A;  2GQF A;  2YG6 A;  1EL5 A;  1Y56 A;  5LV9 A;  2DKI A;  2YR5 A;  3LZW A;  1D4D A;  1K0J A;  4LII A;  3F8D A;  1Q1W A;  3HZL A;  2A89 A;  2WP9 A;  3DJJ A;  2EQ6 A;  1IJH A;  2WP5 A;  3NK0 X;  3VRA A;  4H4Q A;  2E1M A;  3DK9 A;  1IUT A;  3M13 A;  2QA2 A;  3OC4 A;  1PHH A;  3AE5 A;  4ECH A;  2Z5Y A;  4BK1 A;  1F6M A;  2YLR A;  4B69 A;  2B76 A;  4EIP A;  2Q6U A;  3ZYX A;  1JRY A;  2WU5 A;  3BI2 A;  2XVI A;  1D4E A;  1NHP A;  3Q6J A;  4D03 A;  1F8S A;  2BS2 A;  4GR1 A;  2JAE A;  1ZX9 A;  1VG9 A;  1QO8 A;  2XFU A;  2BAC A;  3NK2 X;  1CJC A;  1CF3 A;  2QCU A;  3EAO A;  1ZOY A;  2XLS A;  2ZZ0 A;  1X31 B;  3AD9 B;  4AOS A;  5GRT A;  1GTE A;  2BCP A;  2XYO A;  4EMJ A;  4AP3 A;  5BRT A;  3LXD A;  1RYI A;  1LPF A;  2WEU A;  2Y6Q A;  2ZBW A;  4MJW A;  2X50 A;  4DGK A;  5JCK A;  2PHH A;  4Z2R A;  4OPI A;  1KFY A;  3AYL A;  4N9X A;  1PXA A;  2GQW A;  3UKP A;  3KD9 A;  1O95 A;  1E7P A;  2OLN A;  1TDN A;  2F5Z A;  2ZZB A;  3D1C A;  1L0V A;  1CJ2 A;  1EBD A;  1QJD A;  2VVL A;  3BHF A;  3FMW A;  3NGC X;  3NYF A;  4A6N B;  3BHK A;  2C67 A;  2IVE A;  3KKJ A;  3DGH A;  4HA6 A;  2GF3 A;  4YSZ A;  4XXG A;  4X9N A;  3UP5 A;  2GAG B;  4AP1 A;  4NTE A;  1NHQ A;  3NTD A;  3K30 A;  2QAE A;  2C73 A;  1DOB A;  2R4E A;  3DGZ A;  3SM8 A;  4BJZ A;  2OA1 A;  3F8R A;  4YKF A;  5KOX A;  1Y56 B;  3ITJ A;  5EB5 A;  1GRH A;  5M10 A;  3O0H A;  2WOI A;  4ZCD A;  3AEC A;  3B3R A;  3CPH G;  4OPL A;  2B9X A;  1TYT A;  1E39 A;  2Q0K A;  3KLJ A;  3P4P A;  1H83 A;  4EQW A;  1DNC A;  2BS3 A;  2OLO A;  4H2P A;  2FBW A;  3S5W A;  3S61 A;  1UKV G;  4A99 A;  2FJB A;  2JKC A;  4U8J A;  3M0O A;  4USR A;  4YXD A;  3RP8 A;  4GRT A;  4IA5 A;  1YQ3 A;  2RGO A;  1ZKQ A;  3CIR A;  1KSS A;  1GRE A;  1JEH A;  2DKH A;  2YQU A;  3P4Q A;  4CCQ A;  2XLU A;  3UOX A;  2B7S A;  4YWO A;  4ADW A;  1NAA A;  1DOC A;  1PBE A;  2WBA A;  1JNZ A;  4OPG A;  3GD3 A;  3UTG A;  2GMJ A;  1Q9I A;  2WDV A;  3NK1 X;  3UOZ A;  3VQR A;  1KDG A;  4Z43 A;  3DH9 A;  2X8C A;  1PS9 A;  2VQ7 A;  2I0Z A;  1GRF A;  1ZOV A;  3ALL A;  4CY8 A;  3RP7 A;  4NEV A;  1CL0 A;  2J3N A;  2X3N A;  3QSM A;  3CPJ G;  4BK2 A;  3CTY A;  4TM3 A;  1FCD A;  3AEF A;  1H7X A;  1IUW A;  2XLP A;  3UKK A;  1LVL A;  3ISH A;  1COY A;  5HXI A;  2GB0 A;  5GSN A;  2X99 A;  4CY6 A;  1M64 A;  3AYJ A;  1JU2 A;  3D8X A;  3AYI A;  2VQB A;  3FPZ A;  2PYX A;  4H4S A;  4RG3 A;  2C65 A;  4C3Y A;  1PBC A;  2AQJ A;  3BNM A;  3AE9 A;  2C64 A;  2WPE A;  2GR2 A;  2UZZ A;  2GVC A;  4J36 A;  1KNR A;  2BXS A;  3F8P A;  3ZDN A;  1ZY8 A;  1ZMC A;  4K7Z A;  4EIQ A;  3CGD A;  3I3L A;  3II4 A;  3IWA A;  4U8M A;  1L9E A;  3UTH A;  5IPY A;  3DK4 A;  1IUX A;  4Z44 A;  4EMI A;  1OJ9 A;  2C76 A;  3LB8 A;  3AE3 A;  5IQ1 A;  3IF9 A;  2ZZC A;  3AEA A;  2CUL A;  3KPF A;  1F3P A;  4H4X A;  3QFA A;  1E1N A;  1OJA A;  2JB3 A;  3UP4 A;  4J34 A;  4UDQ A;  3P9U A;  4IA6 A;  4PAB A;  4TM1 A;  2YM1 A;  2EQ9 A;  2APG A;  2YR6 A;  1W4X A;  1GRT A;  3H8L A;  2YR4 A;  2WOV A;  1DOD A;  2GMH A;  4U8L A;  1S2Q A;  2WPC A;  5BUK A;  1FEB A;  4ZCC A;  1NPX A;  1NG3 A;  2VZ2 A;  3LOV A;  4FK1 C;  2WU2 A;  3B6D A;  3NYE A;  3DJE A;  1N1P A;  3AE8 A;  4RG4 A;  2E4G A;  1XAN A;  5L46 A;  4X9M A;  3DK8 A;  4WX1 A;  3CGE A;  1JOA A;  1NG4 A;  1DJN A;  3AE2 A;  4CCR A;  3GYJ A;  4Z25 A;  2XLT A;  1LQU A;  1CBO A;  4A79 A;  2H88 A;  2XFP A;  2IVD A;  4C74 A;  3UTF A;  3BI4 A;  3NN6 X;  5FS6 A;  3UKL A;  2BAB A;  1D4C A;  4HB9 A;  3UCL A;  4H4V A;  1PXC A;  4C3X A;  2YWL A;  4C77 A;  4NTD A;  4AT0 A;  1REO A;  3V76 A;  1PJ7 A;  5U63 A;  1PXB A;  2YG4 A;  2BCG G;  2R45 A;  2H89 A;  1V59 A;  2R0C A;  3AE4 A;  4B64 A;  4KX6 A;  3GMB A;  1E6E A;  1ZMD A;  3UTE A;  4YT0 A;  3GDP A;  4H7U A;  1K0I A;  5KVI A;  4YTP A;  4U2L A;  1GAL A;  5FS9 A;  4NTC A;  1ZK7 A;  3DA1 A;  4H4R A;  1BGJ A;  3PS9 A;  4USQ A;  4YSX A;  5HY5 A;  3CGB A;  2GR0 A;  4U2T A;  3CNS A;  3PO7 A;  3VR9 A;  2GV8 A;  2YG5 A;  3COX A;  1MO9 A;  5HYM A;  4C5O A;  1S3E A;  4EM4 A;  5KOW A;  3NIX A;  3AXB A;  1AOG A;  3SGL A;  4A5L A;  2B9W A;  3AE6 A;  3CNT A;  1H84 A;  2R46 A;  1D7L A;  3P4R A;  4FK1 A;  2AR8 A;  3UKQ A;  2Y6R A;  4YTM A;  3VRD B;  2GR3 A;  1BGN A;  3RED A;  3CGC A;  1TDK A;  3AB1 A;  2E5V A;  1VRQ B;  5JCM A;  1P2H A;  5DBJ A;  1ZP0 A;  3EF6 A;  3IC9 A;  4U8N A;  4A9W A;  4A7A A;  3UOY A;  4J33 A;  2B9Y A;  2BC1 A;  4DSH A;  4FDC B;  4XWR A;  1L9C A;  4EQR A;  3NTA A;  2BK5 A;  2V60 A;  2XVJ A;  2R9Z A;  2WP6 A;  3DME A;  4TLX A;  2EQ8 A;  3AED A;  4EQS A;  3BI5 A;  3RHA A;  2WOW A;  2XVF A;  4GDE A;  2X8H A;  3L8K A;  4Y4M A;  3GWF A;  4YKG A;  2RAB A;  1CJ3 A;  3I6D A;  1RSG A;  3LZX A;  4H2Q A;  4GCM A;  4Z2U A;  2YLS A;  4OPT A;  1GRB A;  4IVO B;  4GF7 A;  1F8R A;  2A87 A;  2XFO A;  4K5S A;  2RGH A;  3C4A A;  2GRT A;  5U1O A;  1KSU A;  1P2E A;  4RSL A;  2EQ7 A;  5FS8 A;  3VRB A;  1E1K A;  5CKU A;  2R0G A;  3NG7 X;  1LJ1 A;  5JCN A;  4OPC A;  1E1L A;  3SFE A;  3G5Q A;  3NT6 A;  2FJD A;  3UKH A;  1TDO A;  1ZDL A;  3NRN A;  1MXT A;  3AEG A;  2QA1 A;  3AWI A;  3SQP A;  1Q1R A;  2ACZ A;  1BWC A;  1GEU A;  3CN8 A;  3NNE A;  4A65 A;  3KU9 A;  3SFD A;  3V3O A;  3V3N A;  1CC2 A;  4CRT A;  2O9Z A;  2WHD A;  2CVJ A;  3NH3 X;  1ELI A;  4H4U A;  4EMW A;  2XFQ A;  1HYU A;  1GND A;  2Z5X A;  3NN0 X;  1BF3 A;  4UP3 A;  3L1R A;  5BVA A;  4DNA A;  1JRZ A;  2C7G A;  2BC0 A;  2YAU A;  2VVL G;  3ICR A;  3H8I A;  2GR1 A;  1L9D A;  3NYC A;  3WE0 A;  3GRT A;  3K7T A;  4WCT A;  1NDA A;  3ICT A;  4AT2 A;  1DXL A;  1GPE A;  1TYP A;  3EPT A;  2GAH B;  4UDR A;  2V3B A;  2V61 A;  4OCG A;  1TDE A;  1BKW A;  1SEZ A;  2CFY A;  1OJT A;  1CJ4 A;  4U8K A;  1KNP A;  1LQT A;  2YVJ A;  4LA1 A;  5ER0 A;  4BK3 A;  1PBD A;  1NEK A;  1EL8 A;  1OJC A;  1ONF A;  1O5W A;  4Z24 A;  1S3B A;  2BS4 A;  5C3J A;  4XWZ A;  4J57 A;  1YQZ A;  3UKF A;  1YY5 A;  4YTN A;  1FEA A;  1D5T A;  2C3D A;  4H4Z A;  2ARD A;  1PJ6 A;  2XLR A;  3Q9T A;  3QVR A;  4U8P A;  3R9U A;  3DJG X;  2TPR A;  4K5R A;  1IUU A;  4B68 A;  4CNK A;  1B37 A;  1PBB A;  4BJY A;  1JRX A;  1K4Q A;  3P1W A;  2YLZ A;  1F8W A;  3G5S A;  4H4T A;  4TLZ A;  1TDF A;  4JN9 A;  4JNA A;  1H86 A;  2FJE A;  1Y0P A;  2A8X A;  3IHG A;  3AE7 A;  4H50 A;  4X4J A;  2B7R A;  1GTH A;  4I59 A;  4ICY A;  4JY3 A;  4EQX A;  2XCG A;  3C96 A;  2YLT A;  1GXF A;  4YSH A;  3PVC A;  1M6I A;  2GEW A;  1GET A;  2VOU A;  4U8I A;  3GSI A;  2JB2 A;  5IQ4 A;  3M12 A;  4EM3 A;  5KVH A;  3CNP A;  3FBS A;  3ALM A;  1GT8 A;  3ATR A;  2OAM A;  3K7M X;  4J56 A;  5FS7 A;  1RP0 A;  3CPI G;  2HQM A;  2XVE A;  2XVH A;  4IVM B;  4M52 A;  4D04 A;  1XPQ A;  2V6O A;  3T37 A;  3URH A; 
#chains in the Genus database with same CATH topology
 3GMC A;  4NEW A;  2R0P A;  4Y4L A;  4CBQ A;  1PN0 A;  4Z2T A;  2XFN A;  1XDI A;  3G5R A;  1OJD A;  4G9K A;  2TMD A;  1VDC A;  3GDN A;  3VR8 A;  2NVK X;  3AEE A;  2V5Z A;  1H6V A;  2Q7V A;  3ATQ A;  2YVG A;  1GSN A;  5CQF A;  2BXR A;  1B5Q A;  2WDQ A;  2BK3 A;  5C2T A;  1D7Y A;  2Q0L A;  1DOE A;  1N4W A;  4NZH A;  4NNJ A;  1GOS A;  3AE1 A;  2YG7 A;  4JQ9 A;  1GES A;  4B66 A;  3CNJ A;  3ALJ A;  2CDU A;  2BK4 A;  3JSK A;  3LAD A;  1GRA A;  2WET A;  5BUL A;  4FX9 A;  2YVF A;  1FOH A;  1H82 A;  2JBV A;  3HYX A;  3LJP A;  4REK A;  4DSG A;  3ADA B;  1E1M A;  2JK6 A;  4OVI A;  2OAL A;  5JCI A;  4IV9 A;  2WS3 A;  3NHO X;  1GER A;  4O5U A;  1LTX R;  4OPD A;  2C4C A;  1O94 A;  1EL7 A;  5KXJ A;  3FIM B;  1B8S A;  4BV6 A;  5KWF A;  4Z26 A;  3GRS A;  3OZ2 A;  4YSY A;  1IUV A;  3SXI A;  1PDH A;  3QFB A;  3UOV A;  5KRQ A;  3GYX A;  1NHR A;  3QSS A;  4H4Y A;  5U25 A;  2R4J A;  1DJQ A;  4BUR A;  2WES A;  1YQ4 A;  3SZW A;  3FG2 P;  3GWD A;  5JCL A;  2AAQ A;  3CND A;  2C75 A;  4YXD A;  3DJD A;  3P4S A;  3GD4 A;  4LU6 A;  2YM2 A;  5J7X A;  4E0V A;  4G6G A;  4I58 A;  4UDP A;  1K0L A;  4ZN0 A;  4GAV A;  4G6H A;  1CC4 A;  3KVE A;  5HHF A;  5M0Z A;  2C70 A;  3UKA A;  1YKJ A;  4B67 A;  3BNU A;  4O5Q A;  5J60 A;  4JY2 A;  3IHM A;  2FJA A;  4JNQ A;  1XHC A;  1FEC A;  2BYB A;  1N4V A;  4PAA A;  2W0H A;  1JNR A;  4CNJ A;  2JB1 A;  2IID A;  1CHU A;  4JDR A;  1N4U A;  2C3C A;  3K7Q X;  5EBK A;  3ICS A;  1EL9 A;  2C72 A;  4GDP A;  2WPF A;  2VRL A;  4AOX A;  3ABV A;  2RGJ A;  3RNM A;  2WQY A;  3C4N A;  1CC6 A;  3AEB A;  2XDO A;  4J31 A;  3E1T A;  1KF6 A;  1NHS A;  5EOW A;  3KA7 A;  3QVP A;  4TM4 A;  3AD8 B;  4U8O A;  5TR3 A;  1TRB A;  4K22 A;  1PJ5 A;  3QSE A;  4KPR A;  2X8G A;  1VQW A;  1IUS A;  1H81 A;  2VVM A;  3H4K A;  1LV0 A;  3GYI A;  2YLW A;  4H4W A;  4B1B A;  1FL2 A;  1VG0 A;  2C66 A;  2VRM A;  2WDR A;  1GV4 A;  5FMH A;  4H4P A;  3SYI A;  1Z6L A;  4A6N A;  4U2S A;  4TM0 A;  4Y4N A;  2YLX A;  1MOK A;  2BA9 A;  1S2Y A;  1NEN A;  4OPU A;  3NLC A;  1QLB A;  2GH5 A;  2V3A A;  3EAN A;  1H7W A;  3NKS A;  4H2R A;  1BZL A;  3SX6 A;  1B4V A;  4GUV A;  4B65 A;  4K2X A;  4P9S A;  4G74 A;  4J2W A;  3AD7 B;  1PBF A;  1GRG A;  4B63 A;  3RP6 A;  4APN A;  4K8D A;  2YG3 A;  2NPX A;  4G73 A;  5EB4 A;  3QJ4 A;  4H2N A;  2GQF A;  2YG6 A;  1EL5 A;  1Y56 A;  5LV9 A;  2DKI A;  2YR5 A;  3LZW A;  1D4D A;  1K0J A;  4LII A;  3F8D A;  1Q1W A;  3HZL A;  2A89 A;  2WP9 A;  3DJJ A;  5KMQ A;  2EQ6 A;  1IJH A;  2WP5 A;  3NK0 X;  3VRA A;  4H4Q A;  2E1M A;  3DK9 A;  1IUT A;  3M13 A;  2QA2 A;  3OC4 A;  1PHH A;  3AE5 A;  4ECH A;  2Z5Y A;  4BK1 A;  1F6M A;  2YLR A;  4B69 A;  2B76 A;  4EIP A;  2Q6U A;  3ZYX A;  1JRY A;  2WU5 A;  3BI2 A;  2XVI A;  1D4E A;  1NHP A;  3Q6J A;  4D03 A;  1F8S A;  2BS2 A;  4GR1 A;  2JAE A;  2BRY A;  1ZX9 A;  1VG9 A;  2BAC A;  2XFU A;  1QO8 A;  3NK2 X;  1CJC A;  1CF3 A;  2QCU A;  3EAO A;  1ZOY A;  2XLS A;  2ZZ0 A;  1X31 B;  3AD9 B;  4AOS A;  5GRT A;  1GTE A;  2BCP A;  2XYO A;  4EMJ A;  4AP3 A;  5BRT A;  3LXD A;  1RYI A;  1LPF A;  2WEU A;  2Y6Q A;  2ZBW A;  4MJW A;  2X50 A;  4DGK A;  5JCK A;  2PHH A;  4Z2R A;  4OPI A;  1KFY A;  3AYL A;  4N9X A;  1PXA A;  2GQW A;  3UKP A;  3KD9 A;  1O95 A;  1E7P A;  2OLN A;  1TDN A;  2F5Z A;  2ZZB A;  3D1C A;  1L0V A;  1CJ2 A;  1EBD A;  1QJD A;  2VVL A;  3BHF A;  3FMW A;  3NGC X;  3NYF A;  4A6N B;  3BHK A;  2C67 A;  2IVE A;  3KKJ A;  3DGH A;  4HA6 A;  2GF3 A;  4YSZ A;  4XXG A;  4X9N A;  3UP5 A;  2GAG B;  4AP1 A;  4NTE A;  1NHQ A;  3NTD A;  3K30 A;  2QAE A;  2C73 A;  1DOB A;  2R4E A;  3DGZ A;  3SM8 A;  4BJZ A;  2OA1 A;  3F8R A;  4YKF A;  5KOX A;  1Y56 B;  3ITJ A;  5EB5 A;  1GRH A;  5M10 A;  3O0H A;  2WOI A;  4ZCD A;  3AEC A;  3T14 A;  3B3R A;  3CPH G;  4OPL A;  2B9X A;  1TYT A;  1E39 A;  2Q0K A;  3KLJ A;  3P4P A;  1H83 A;  4EQW A;  1DNC A;  2BS3 A;  2OLO A;  4H2P A;  2FBW A;  3S5W A;  3S61 A;  1UKV G;  4A99 A;  2FJB A;  2JKC A;  4U8J A;  3M0O A;  4USR A;  3SZC A;  3RP8 A;  4GRT A;  4IA5 A;  1YQ3 A;  2RGO A;  1ZKQ A;  3CIR A;  1KSS A;  1GRE A;  1JEH A;  2DKH A;  2YQU A;  3P4Q A;  4CCQ A;  2XLU A;  3UOX A;  2B7S A;  4YWO A;  4ADW A;  1NAA A;  1DOC A;  1PBE A;  2WBA A;  1JNZ A;  4OPG A;  3GD3 A;  3UTG A;  2GMJ A;  1Q9I A;  2WDV A;  3NK1 X;  3UOZ A;  3VQR A;  1KDG A;  4Z43 A;  3DH9 A;  2X8C A;  1PS9 A;  4GAP A;  2VQ7 A;  2I0Z A;  1GRF A;  1ZOV A;  3ALL A;  4CY8 A;  3RP7 A;  4NEV A;  1CL0 A;  2J3N A;  2X3N A;  3QSM A;  3CPJ G;  4BK2 A;  3CTY A;  4TM3 A;  1FCD A;  3AEF A;  3HYW A;  1H7X A;  1IUW A;  2XLP A;  3UKK A;  1LVL A;  3ISH A;  1COY A;  3CMM A;  2GB0 A;  5GSN A;  2X99 A;  4CY6 A;  5HXI A;  1M64 A;  3AYJ A;  1JU2 A;  3D8X A;  3AYI A;  2VQB A;  3FPZ A;  2PYX A;  4H4S A;  4RG3 A;  2C65 A;  4C3Y A;  1PBC A;  2AQJ A;  3BNM A;  3AE9 A;  2C64 A;  2WPE A;  2GR2 A;  2UZZ A;  2GVC A;  4J36 A;  1KNR A;  2BXS A;  3F8P A;  3ZDN A;  1ZY8 A;  1ZMC A;  4K7Z A;  4EIQ A;  3CGD A;  3I3L A;  3II4 A;  3IWA A;  4U8M A;  1L9E A;  3UTH A;  5IPY A;  5KMR A;  3DK4 A;  1IUX A;  4Z44 A;  4EMI A;  1OJ9 A;  2C76 A;  3LB8 A;  3AE3 A;  5IQ1 A;  3IF9 A;  2ZZC A;  3AEA A;  2CUL A;  3KPF A;  1F3P A;  4H4X A;  3QFA A;  1E1N A;  1OJA A;  2JB3 A;  3UP4 A;  4J34 A;  4UDQ A;  3P9U A;  4IA6 A;  4PAB A;  4TM1 A;  2YM1 A;  2EQ9 A;  2APG A;  2YR6 A;  1W4X A;  1GRT A;  3H8L A;  2YR4 A;  2WOV A;  1DOD A;  2GMH A;  4U8L A;  1S2Q A;  2WPC A;  5BUK A;  1FEB A;  4ZCC A;  1NPX A;  1NG3 A;  2VZ2 A;  3LOV A;  4FK1 C;  2WU2 A;  3B6D A;  3NYE A;  3DJE A;  1N1P A;  3AE8 A;  4RG4 A;  2E4G A;  1XAN A;  5L46 A;  4X9M A;  3DK8 A;  4WX1 A;  3CGE A;  1JOA A;  1NG4 A;  1DJN A;  3AE2 A;  4CCR A;  3GYJ A;  4Z25 A;  2XLT A;  1LQU A;  1CBO A;  4A79 A;  2H88 A;  2XFP A;  2IVD A;  5KMS A;  4C74 A;  3UTF A;  3BI4 A;  3NN6 X;  5FS6 A;  3UKL A;  2BAB A;  1D4C A;  4II3 A;  4HB9 A;  3UCL A;  4H4V A;  1PXC A;  4C3X A;  2YWL A;  4C77 A;  4NTD A;  4AT0 A;  1REO A;  3V76 A;  1PJ7 A;  5U63 A;  1PXB A;  2YG4 A;  2BCG G;  2R45 A;  2H89 A;  1V59 A;  2R0C A;  3AE4 A;  4B64 A;  4KX6 A;  5KMP A;  3GMB A;  1E6E A;  1ZMD A;  3HYV A;  3UTE A;  4YT0 A;  5KNL A;  3GDP A;  4H7U A;  1K0I A;  5KVI A;  4YTP A;  4U2L A;  1GAL A;  5FS9 A;  4NTC A;  1ZK7 A;  3DA1 A;  4H4R A;  1BGJ A;  3PS9 A;  4USQ A;  4YSX A;  5HY5 A;  3CGB A;  2GR0 A;  4U2T A;  3CNS A;  3PO7 A;  3VR9 A;  2GV8 A;  2YG5 A;  3COX A;  1MO9 A;  5HYM A;  4C5O A;  1S3E A;  4EM4 A;  5KOW A;  3NIX A;  3AXB A;  1AOG A;  3SGL A;  4A5L A;  2B9W A;  3AE6 A;  3CNT A;  1H84 A;  2R46 A;  1D7L A;  3P4R A;  4FK1 A;  2AR8 A;  3UKQ A;  2Y6R A;  4YTM A;  3VRD B;  2GR3 A;  1BGN A;  3RED A;  3CGC A;  2BRA A;  1TDK A;  3AB1 A;  2E5V A;  1VRQ B;  5JCM A;  1P2H A;  5DBJ A;  1ZP0 A;  3EF6 A;  3IC9 A;  4U8N A;  4A9W A;  4A7A A;  3UOY A;  4J33 A;  2B9Y A;  2BC1 A;  4DSH A;  4FDC B;  4XWR A;  1L9C A;  4EQR A;  3NTA A;  2BK5 A;  2V60 A;  2XVJ A;  2R9Z A;  2WP6 A;  3DME A;  4TLX A;  2EQ8 A;  3AED A;  4EQS A;  3BI5 A;  3RHA A;  2WOW A;  2XVF A;  4GDE A;  2X8H A;  3L8K A;  4Y4M A;  3GWF A;  4YKG A;  2RAB A;  1CJ3 A;  3I6D A;  1RSG A;  3LZX A;  4H2Q A;  4GCM A;  4Z2U A;  2YLS A;  4OPT A;  1GRB A;  4IVO B;  4GF7 A;  1F8R A;  2A87 A;  2XFO A;  4K5S A;  2RGH A;  3C4A A;  2GRT A;  5U1O A;  1KSU A;  1P2E A;  4RSL A;  2EQ7 A;  5FS8 A;  3VRB A;  1E1K A;  5CKU A;  2R0G A;  3NG7 X;  1LJ1 A;  5JCN A;  4OPC A;  1E1L A;  3T31 A;  3SFE A;  3G5Q A;  3NT6 A;  2FJD A;  3UKH A;  1TDO A;  1ZDL A;  3NRN A;  1MXT A;  3AEG A;  2QA1 A;  3AWI A;  3SQP A;  1Q1R A;  2ACZ A;  1BWC A;  1GEU A;  3CN8 A;  3NNE A;  4A65 A;  3KU9 A;  3SFD A;  3V3O A;  3V3N A;  1CC2 A;  4CRT A;  2O9Z A;  2WHD A;  2CVJ A;  3NH3 X;  1ELI A;  4H4U A;  3T2Y A;  4EMW A;  2XFQ A;  1HYU A;  1GND A;  2Z5X A;  3NN0 X;  1BF3 A;  3KPK A;  4UP3 A;  3L1R A;  5BVA A;  4DNA A;  1JRZ A;  3SZ0 A;  2C7G A;  2BC0 A;  2YAU A;  2VVL G;  3ICR A;  4NWZ A;  3H8I A;  2GR1 A;  3WE0 A;  1L9D A;  3NYC A;  3GRT A;  3K7T A;  4WCT A;  1NDA A;  3ICT A;  4AT2 A;  1DXL A;  1GPE A;  1TYP A;  3EPT A;  2GAH B;  4UDR A;  2V3B A;  2V61 A;  4OCG A;  1TDE A;  1BKW A;  1SEZ A;  2CFY A;  1OJT A;  1CJ4 A;  4U8K A;  1KNP A;  1LQT A;  2YVJ A;  4LA1 A;  5ER0 A;  4II2 A;  4BK3 A;  1PBD A;  3T0K A;  1NEK A;  1EL8 A;  3T2Z A;  1OJC A;  1ONF A;  1O5W A;  4Z24 A;  1S3B A;  2BS4 A;  5C3J A;  4XWZ A;  4J57 A;  1YQZ A;  3UKF A;  1YY5 A;  4YTN A;  1FEA A;  1D5T A;  2C3D A;  4H4Z A;  2ARD A;  1PJ6 A;  2XLR A;  3Q9T A;  3QVR A;  4U8P A;  3R9U A;  3DJG X;  2TPR A;  4K5R A;  1IUU A;  4B68 A;  4CNK A;  1B37 A;  1PBB A;  4BJY A;  1JRX A;  1K4Q A;  3P1W A;  2YLZ A;  1F8W A;  3G5S A;  4H4T A;  4TLZ A;  1TDF A;  4JN9 A;  4JNA A;  1H86 A;  2FJE A;  1Y0P A;  2A8X A;  3IHG A;  3AE7 A;  4H50 A;  4X4J A;  2B7R A;  1GTH A;  4I59 A;  4ICY A;  4JY3 A;  4EQX A;  2XCG A;  3C96 A;  2YLT A;  3SY4 A;  1GXF A;  4YSH A;  3PVC A;  1M6I A;  2GEW A;  1GET A;  2VOU A;  4U8I A;  3T2K A;  3GSI A;  2JB2 A;  5IQ4 A;  3M12 A;  4EM3 A;  5KVH A;  3CNP A;  3FBS A;  3ALM A;  3SZF A;  1GT8 A;  3ATR A;  2OAM A;  3K7M X;  4J56 A;  5FS7 A;  1RP0 A;  3CPI G;  2HQM A;  2XVE A;  2XVH A;  4IVM B;  4M52 A;  4D04 A;  1XPQ A;  2V6O A;  3T37 A;  3URH A; 
#chains in the Genus database with same CATH homology
 3GMC A;  4NEW A;  2R0P A;  4Y4L A;  4CBQ A;  1PN0 A;  4Z2T A;  2XFN A;  1XDI A;  3G5R A;  1OJD A;  4G9K A;  2TMD A;  1VDC A;  3GDN A;  3VR8 A;  2NVK X;  3AEE A;  2V5Z A;  1H6V A;  2Q7V A;  3ATQ A;  2YVG A;  1GSN A;  5CQF A;  2BXR A;  1B5Q A;  2WDQ A;  2BK3 A;  5C2T A;  1D7Y A;  2Q0L A;  1DOE A;  1N4W A;  4NZH A;  4NNJ A;  1GOS A;  3AE1 A;  2YG7 A;  4JQ9 A;  1GES A;  4B66 A;  3CNJ A;  3ALJ A;  2CDU A;  2BK4 A;  3JSK A;  3LAD A;  1GRA A;  2WET A;  5BUL A;  4FX9 A;  2YVF A;  1FOH A;  1H82 A;  2JBV A;  3HYX A;  3LJP A;  4REK A;  4DSG A;  3ADA B;  1E1M A;  2JK6 A;  4OVI A;  2OAL A;  5JCI A;  2WS3 A;  3NHO X;  4IV9 A;  1GER A;  4O5U A;  1LTX R;  4OPD A;  2C4C A;  1O94 A;  1EL7 A;  5KXJ A;  3FIM B;  1B8S A;  4BV6 A;  5KWF A;  4Z26 A;  3GRS A;  3OZ2 A;  4YSY A;  1IUV A;  3SXI A;  1PDH A;  3QFB A;  3UOV A;  5KRQ A;  3GYX A;  1NHR A;  3QSS A;  4H4Y A;  5U25 A;  2R4J A;  1DJQ A;  4BUR A;  2WES A;  1YQ4 A;  3SZW A;  3FG2 P;  3GWD A;  5JCL A;  2AAQ A;  3CND A;  2C75 A;  4YXD A;  3DJD A;  3P4S A;  3GD4 A;  4LU6 A;  2YM2 A;  5J7X A;  4E0V A;  4G6G A;  4I58 A;  4UDP A;  1K0L A;  4ZN0 A;  4GAV A;  4G6H A;  1CC4 A;  3KVE A;  5HHF A;  5M0Z A;  2C70 A;  3UKA A;  1YKJ A;  4B67 A;  3BNU A;  4O5Q A;  5J60 A;  4JY2 A;  3IHM A;  2FJA A;  4JNQ A;  1XHC A;  1FEC A;  2BYB A;  1N4V A;  4PAA A;  2W0H A;  1JNR A;  4CNJ A;  2JB1 A;  2IID A;  1CHU A;  4JDR A;  1N4U A;  2C3C A;  3K7Q X;  5EBK A;  3ICS A;  1EL9 A;  2C72 A;  4GDP A;  2WPF A;  2VRL A;  4AOX A;  3ABV A;  2RGJ A;  3RNM A;  2WQY A;  3C4N A;  1CC6 A;  3AEB A;  2XDO A;  4J31 A;  3E1T A;  1KF6 A;  1NHS A;  5EOW A;  3KA7 A;  3QVP A;  4TM4 A;  3AD8 B;  4U8O A;  5TR3 A;  1TRB A;  4K22 A;  1PJ5 A;  3QSE A;  4KPR A;  2X8G A;  1VQW A;  1IUS A;  1H81 A;  2VVM A;  3H4K A;  1LV0 A;  3GYI A;  2YLW A;  4H4W A;  4B1B A;  1FL2 A;  1VG0 A;  2C66 A;  2VRM A;  2WDR A;  1GV4 A;  5FMH A;  4H4P A;  3SYI A;  1Z6L A;  4A6N A;  4U2S A;  4TM0 A;  4Y4N A;  2YLX A;  1MOK A;  2BA9 A;  1NEN A;  1S2Y A;  4OPU A;  3NLC A;  1QLB A;  2GH5 A;  2V3A A;  3EAN A;  1H7W A;  3NKS A;  4H2R A;  1BZL A;  3SX6 A;  1B4V A;  4GUV A;  4B65 A;  4K2X A;  4P9S A;  4G74 A;  4J2W A;  3AD7 B;  1PBF A;  1GRG A;  4B63 A;  3RP6 A;  4APN A;  4K8D A;  2YG3 A;  2NPX A;  4G73 A;  5EB4 A;  3QJ4 A;  4H2N A;  2GQF A;  2YG6 A;  1EL5 A;  1Y56 A;  5LV9 A;  2DKI A;  2YR5 A;  3LZW A;  1D4D A;  1K0J A;  4LII A;  3F8D A;  1Q1W A;  3HZL A;  2A89 A;  2WP9 A;  3DJJ A;  5KMQ A;  2EQ6 A;  1IJH A;  2WP5 A;  3NK0 X;  3VRA A;  4H4Q A;  2E1M A;  3DK9 A;  1IUT A;  3M13 A;  2QA2 A;  3OC4 A;  1PHH A;  3AE5 A;  4ECH A;  2Z5Y A;  4BK1 A;  1F6M A;  2YLR A;  4B69 A;  2B76 A;  4EIP A;  2Q6U A;  3ZYX A;  1JRY A;  2WU5 A;  3BI2 A;  2XVI A;  1D4E A;  1NHP A;  3Q6J A;  4D03 A;  1F8S A;  2BS2 A;  4GR1 A;  2JAE A;  2BRY A;  1ZX9 A;  1VG9 A;  1QO8 A;  2XFU A;  2BAC A;  3NK2 X;  1CJC A;  1CF3 A;  2QCU A;  3EAO A;  1ZOY A;  2XLS A;  2ZZ0 A;  1X31 B;  3AD9 B;  4AOS A;  5GRT A;  1GTE A;  2BCP A;  2XYO A;  4EMJ A;  4AP3 A;  5BRT A;  3LXD A;  1RYI A;  1LPF A;  2WEU A;  2Y6Q A;  2ZBW A;  4MJW A;  2X50 A;  4DGK A;  5JCK A;  2PHH A;  4Z2R A;  4OPI A;  1KFY A;  3AYL A;  4N9X A;  1PXA A;  2GQW A;  3UKP A;  3KD9 A;  1O95 A;  1E7P A;  2OLN A;  1TDN A;  2F5Z A;  2ZZB A;  3D1C A;  1L0V A;  1CJ2 A;  1EBD A;  1QJD A;  2VVL A;  3BHF A;  3FMW A;  3NGC X;  3NYF A;  4A6N B;  3BHK A;  2C67 A;  2IVE A;  3KKJ A;  3DGH A;  4HA6 A;  2GF3 A;  4YSZ A;  4XXG A;  4X9N A;  3UP5 A;  2GAG B;  4AP1 A;  4NTE A;  1NHQ A;  3NTD A;  3K30 A;  2QAE A;  2C73 A;  1DOB A;  2R4E A;  3DGZ A;  3SM8 A;  4BJZ A;  2OA1 A;  3F8R A;  4YKF A;  5KOX A;  1Y56 B;  3ITJ A;  5EB5 A;  1GRH A;  5M10 A;  3O0H A;  2WOI A;  4ZCD A;  3AEC A;  3T14 A;  3B3R A;  3CPH G;  4OPL A;  2B9X A;  1TYT A;  1E39 A;  2Q0K A;  3KLJ A;  3P4P A;  1H83 A;  4EQW A;  1DNC A;  2BS3 A;  2OLO A;  4H2P A;  2FBW A;  3S5W A;  3S61 A;  1UKV G;  4A99 A;  2FJB A;  2JKC A;  4U8J A;  3M0O A;  4USR A;  3SZC A;  3RP8 A;  4GRT A;  4IA5 A;  1YQ3 A;  2RGO A;  1ZKQ A;  3CIR A;  1KSS A;  1GRE A;  1JEH A;  2DKH A;  2YQU A;  3P4Q A;  4CCQ A;  2XLU A;  3UOX A;  2B7S A;  4YWO A;  4ADW A;  1NAA A;  1DOC A;  1PBE A;  2WBA A;  1JNZ A;  4OPG A;  3GD3 A;  3UTG A;  2GMJ A;  1Q9I A;  2WDV A;  3NK1 X;  3UOZ A;  3VQR A;  1KDG A;  4Z43 A;  3DH9 A;  2X8C A;  1PS9 A;  4GAP A;  2VQ7 A;  2I0Z A;  1GRF A;  1ZOV A;  3ALL A;  4CY8 A;  3RP7 A;  4NEV A;  1CL0 A;  2J3N A;  2X3N A;  3QSM A;  3CPJ G;  4BK2 A;  3CTY A;  4TM3 A;  1FCD A;  3AEF A;  3HYW A;  1H7X A;  1IUW A;  2XLP A;  3UKK A;  1LVL A;  3ISH A;  1COY A;  3CMM A;  2GB0 A;  5GSN A;  2X99 A;  4CY6 A;  5HXI A;  1M64 A;  3AYJ A;  1JU2 A;  3D8X A;  3AYI A;  2VQB A;  3FPZ A;  2PYX A;  4H4S A;  4RG3 A;  2C65 A;  4C3Y A;  1PBC A;  2AQJ A;  3BNM A;  3AE9 A;  2C64 A;  2WPE A;  2GR2 A;  2UZZ A;  2GVC A;  4J36 A;  1KNR A;  2BXS A;  3F8P A;  3ZDN A;  1ZY8 A;  1ZMC A;  4K7Z A;  4EIQ A;  3CGD A;  3I3L A;  3II4 A;  3IWA A;  4U8M A;  1L9E A;  3UTH A;  5IPY A;  5KMR A;  3DK4 A;  1IUX A;  4Z44 A;  4EMI A;  1OJ9 A;  2C76 A;  3LB8 A;  3AE3 A;  5IQ1 A;  3IF9 A;  2ZZC A;  3AEA A;  2CUL A;  3KPF A;  1F3P A;  4H4X A;  3QFA A;  1E1N A;  1OJA A;  2JB3 A;  3UP4 A;  4J34 A;  4UDQ A;  3P9U A;  4IA6 A;  4PAB A;  4TM1 A;  2YM1 A;  2EQ9 A;  2APG A;  2YR6 A;  1W4X A;  1GRT A;  3H8L A;  2YR4 A;  2WOV A;  1DOD A;  2GMH A;  4U8L A;  1S2Q A;  2WPC A;  5BUK A;  1FEB A;  4ZCC A;  1NPX A;  1NG3 A;  2VZ2 A;  3LOV A;  4FK1 C;  2WU2 A;  3B6D A;  3NYE A;  3DJE A;  1N1P A;  3AE8 A;  4RG4 A;  2E4G A;  1XAN A;  5L46 A;  4X9M A;  3DK8 A;  4WX1 A;  3CGE A;  1JOA A;  1NG4 A;  1DJN A;  3AE2 A;  4CCR A;  3GYJ A;  4Z25 A;  2XLT A;  1LQU A;  1CBO A;  4A79 A;  2H88 A;  2XFP A;  2IVD A;  5KMS A;  4C74 A;  3UTF A;  3BI4 A;  3NN6 X;  5FS6 A;  3UKL A;  2BAB A;  1D4C A;  4II3 A;  4HB9 A;  3UCL A;  4H4V A;  1PXC A;  4C3X A;  2YWL A;  4C77 A;  4NTD A;  4AT0 A;  1REO A;  3V76 A;  1PJ7 A;  5U63 A;  1PXB A;  2YG4 A;  2BCG G;  2R45 A;  2H89 A;  1V59 A;  2R0C A;  3AE4 A;  4B64 A;  4KX6 A;  5KMP A;  3GMB A;  1E6E A;  1ZMD A;  3HYV A;  3UTE A;  4YT0 A;  5KNL A;  3GDP A;  4H7U A;  1K0I A;  5KVI A;  4YTP A;  4U2L A;  1GAL A;  5FS9 A;  4NTC A;  1ZK7 A;  3DA1 A;  4H4R A;  1BGJ A;  3PS9 A;  4USQ A;  4YSX A;  5HY5 A;  3CGB A;  2GR0 A;  4U2T A;  3CNS A;  3PO7 A;  3VR9 A;  2GV8 A;  2YG5 A;  3COX A;  1MO9 A;  5HYM A;  4C5O A;  1S3E A;  4EM4 A;  5KOW A;  3NIX A;  3AXB A;  1AOG A;  3SGL A;  4A5L A;  2B9W A;  3AE6 A;  3CNT A;  1H84 A;  2R46 A;  1D7L A;  3P4R A;  4FK1 A;  2AR8 A;  3UKQ A;  2Y6R A;  4YTM A;  3VRD B;  2GR3 A;  1BGN A;  3RED A;  3CGC A;  2BRA A;  1TDK A;  3AB1 A;  2E5V A;  1VRQ B;  5JCM A;  1P2H A;  5DBJ A;  1ZP0 A;  3EF6 A;  3IC9 A;  4U8N A;  4A9W A;  4A7A A;  3UOY A;  4J33 A;  2B9Y A;  2BC1 A;  4DSH A;  4FDC B;  4XWR A;  1L9C A;  4EQR A;  3NTA A;  2BK5 A;  2V60 A;  2XVJ A;  2R9Z A;  2WP6 A;  3DME A;  4TLX A;  2EQ8 A;  3AED A;  4EQS A;  3BI5 A;  3RHA A;  2WOW A;  2XVF A;  4GDE A;  2X8H A;  3L8K A;  4Y4M A;  3GWF A;  4YKG A;  2RAB A;  1CJ3 A;  3I6D A;  1RSG A;  3LZX A;  4H2Q A;  4GCM A;  4Z2U A;  2YLS A;  4OPT A;  1GRB A;  4IVO B;  4GF7 A;  1F8R A;  2A87 A;  2XFO A;  4K5S A;  2RGH A;  3C4A A;  2GRT A;  5U1O A;  1KSU A;  1P2E A;  4RSL A;  2EQ7 A;  5FS8 A;  3VRB A;  1E1K A;  5CKU A;  2R0G A;  3NG7 X;  1LJ1 A;  5JCN A;  4OPC A;  1E1L A;  3T31 A;  3SFE A;  3G5Q A;  3NT6 A;  2FJD A;  3UKH A;  1TDO A;  1ZDL A;  3NRN A;  1MXT A;  3AEG A;  2QA1 A;  3AWI A;  3SQP A;  1Q1R A;  2ACZ A;  1BWC A;  1GEU A;  3CN8 A;  3NNE A;  4A65 A;  3KU9 A;  3SFD A;  3V3O A;  3V3N A;  1CC2 A;  4CRT A;  2O9Z A;  2WHD A;  2CVJ A;  3NH3 X;  1ELI A;  4H4U A;  3T2Y A;  4EMW A;  2XFQ A;  1HYU A;  1GND A;  2Z5X A;  3NN0 X;  1BF3 A;  3KPK A;  4UP3 A;  3L1R A;  5BVA A;  4DNA A;  1JRZ A;  3SZ0 A;  2C7G A;  2BC0 A;  2YAU A;  2VVL G;  3ICR A;  4NWZ A;  3H8I A;  2GR1 A;  1L9D A;  3NYC A;  3WE0 A;  3GRT A;  3K7T A;  4WCT A;  1NDA A;  3ICT A;  4AT2 A;  1DXL A;  1GPE A;  1TYP A;  3EPT A;  2GAH B;  4UDR A;  2V3B A;  2V61 A;  4OCG A;  1TDE A;  1BKW A;  1SEZ A;  2CFY A;  1OJT A;  1CJ4 A;  4U8K A;  1KNP A;  1LQT A;  2YVJ A;  4LA1 A;  5ER0 A;  4II2 A;  4BK3 A;  1PBD A;  3T0K A;  1NEK A;  1EL8 A;  3T2Z A;  1OJC A;  1ONF A;  1O5W A;  4Z24 A;  1S3B A;  2BS4 A;  5C3J A;  4XWZ A;  4J57 A;  1YQZ A;  3UKF A;  1YY5 A;  4YTN A;  1FEA A;  1D5T A;  2C3D A;  4H4Z A;  2ARD A;  1PJ6 A;  2XLR A;  3Q9T A;  3QVR A;  4U8P A;  3R9U A;  3DJG X;  2TPR A;  4K5R A;  1IUU A;  4B68 A;  4CNK A;  1B37 A;  1PBB A;  4BJY A;  1JRX A;  1K4Q A;  3P1W A;  2YLZ A;  1F8W A;  3G5S A;  4H4T A;  4TLZ A;  1TDF A;  4JN9 A;  4JNA A;  1H86 A;  2FJE A;  1Y0P A;  2A8X A;  3IHG A;  3AE7 A;  4H50 A;  4X4J A;  2B7R A;  1GTH A;  4I59 A;  4ICY A;  4JY3 A;  4EQX A;  2XCG A;  3C96 A;  2YLT A;  3SY4 A;  1GXF A;  4YSH A;  3PVC A;  1M6I A;  2GEW A;  1GET A;  2VOU A;  4U8I A;  3T2K A;  3GSI A;  2JB2 A;  5IQ4 A;  3M12 A;  4EM3 A;  5KVH A;  3CNP A;  3FBS A;  3ALM A;  3SZF A;  1GT8 A;  3ATR A;  2OAM A;  3K7M X;  4J56 A;  5FS7 A;  1RP0 A;  3CPI G;  2HQM A;  2XVE A;  2XVH A;  4IVM B;  4M52 A;  4D04 A;  1XPQ A;  2V6O A;  3T37 A;  3URH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...