3P24A

Structure of profragilysin-3 from bacteroides fragilis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
365
structure length
357
Chain Sequence
PVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTNFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKYPVSVKINVDKAKKILNLPECDYINDYIKTPQVTRAVPSEPKTVYVICLRENGSTVYPNEVSAQMQDAANSVYAVHGLKRYVNLHFVLYTTEYACPSGNADEGLDGFTASLKANPKAEGYDDQIYFLIRWGTWDNNILGISWLNSYNVNTASDFKASGMSTTQLMYPGVMAHELGHILGANHADDPKDLMYSKYTGYLFHLSEKNMDIIAKNLGWEIADGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BFT-3
publication title Structure, function and latency regulation of a bacterial enterotoxin potentially derived from a mammalian adamalysin/ADAM xenolog.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Hydrolase
total genus 120
structure length 357
sequence length 365
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.74: Fragilysin.
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13583 Reprolysin_4 Metallo-peptidase family M12B Reprolysin-like
A PF16376 fragilysinNterm N-terminal domain of fragilysin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.470 Mainly Beta Beta Barrel Lipocalin Lipocalin 3p24A01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3p24A02
1ZXVA 1GKDA 2O3EA 2DW1A 4DD8A 2MZIA 1R1JA 3TSKA 1SU3A 1BKCE 1UMTA 4Q1LA 3LQ0A 2W0DA 4L63A 3HB2P 1RMZA 3DPEA 4PKUA 1HOVA 4GR3A 1ND1A 1CXVA 3LE9A 3B2ZA 5I4OA 1QJJA 3KHIA 5L7FA 1JKYA 2L0RA 3EWJA 1G05A 3TT4A 3VI1A 4H3XA 4A3WA 2Y6CA 4PKVA 4GWMA 1CQRA 3F15A 4A7BA 3OHOA 2OVZA 3AIGA 2QPJA 2OW1A 1CGEA 1QICA 2WOAA 4DF9A 1YCMA 3HBUP 3KMEA 1JIWP 1L6JA 3G42A 4GQLA 1PWVA 1HTDA 5CUHA 1XFYA 2K9CA 4J4MA 3RTSA 2W14A 1JAPA 1PWQA 2AYKA 3G5CA 2D1NA 1GKCA 5B5OA 2I47A 1MMBA 1AYKA 1O0QA 3USNA 2KRJA 4GR0A 4I03A 4L19A 3HY9A 1QUAA 2OW9A 5CZMA 2CKIA 1B8YA 3F16A 3HDBA 2K2GA 3DNGA 4HMAA 1H71P 2SRTA 2USNA 1PWPA 3B92A 2OZRA 1ZVXA 3EDHA 3K7LA 1JH1A 2OVXA 4H2EA 1KUHA 1QIAA 2MLSA 3WV3A 5H8XA 1FLSA 2D1OA 1KUKA 4XM6A 1K7GA 1I1IP 4FXQA 3NX7A 1JANA 3N2UA 1C3IA 2Y6DA 3LMCA 5I0LA 1KUFA 3KRYA 5D1TA 3I7GA 3EHYA 1R1HA 1B3DA 4EFSA 4PKQA 3ZUKA 1ROSA 5I43A 1AF0A 1K7QA 1GO7P 1SMPA 2O36A 1HY7A 3LJTA 3LUNA 3LEAA 2DW0A 3RTTA 3HBVP 2AIGP 3F19A 4CTHA 1Y8JA 3UVCA 3LIRA 2X3AA 3F1AA 4WF6A 3TS4A 2RJPA 3EDIA 1AKLA 1PWWA 1UTZA 2OXZA 1Z3JA 4XM8A 1MMQA 3ZVSA 1CAQA 1XFXA 4H76A 4HX3A 1BQOA 2JNPA 4ILWD 1IADA 3O64A 2OW2A 4XM7A 3LJZA 1YP1A 5I12A 1BUDA 2DDYA 3WV2A 1UEAA 1O0TA 1BZSA 1YOUA 1G9KA 1SLNA 1CGLA 2E2DA 2RJQA 1XFZA 2W12A 5L79A 1I76A 2XS4A 5D3CA 5BOYA 3Q2HA 1OMJA 1G4KA 4H82A 2OW0A 4AUOA 3L0VA 1D5JA 4WKIA 2JIHA 1I73A 4GUYA 3DPFA 1KUIA 3AYUA 2W13A 4DV8A 2OY4A 4PKTA 2FV5A 3ZXHA 3KEJA 5JMYA 3LUMA 2TCLA 4JA1A 4DPEA 5I3MA 4JPAA 3KEKA 4JP4A 1EAKA 3HDAP 1YQYA 4XCTA 1CGFA 2WO9A 1JJ9A 5D1SA 1BKCA 2YIGA 1A85A 966CA 1GE6A 2DW2A 3LGPA 2X3BA 2OXWA 2CLTA 3EHXA 1S4BP 3DWBA 4GWNA 2X7MA 4G9LA 5D2BA 1UTTA 1MMRA 1SLMA 2DDFA 3OHLA 3O2XA 1C8TA 1HFSA 2OY2A 4AIGA 1D8MA 1FM1A 1UMSA 1Q3AA 5BOTA 3LIKA 1KBCA 1JIZA 2POJA 2E3XA 1FBLA 1BSWA 1BIWA 3AYKA 4PKSA 2JT5A 1ZTQA 4QKZA 1ATLA 1D7XA 1DTHA 1IAGA 3SHIA 3K7NA 2J0TA 1R54A 3P1VA 2W15A 3F17A 4JIJA 3I7IA 1GXDA 1ASTA 1IAEA 1OM7A 1HFCA 4GR8A 830CA 2MZHA 2A8HA 1SATA 2MLRA 1J7NA 1JK3A 4FXYP 2MZEA 4G0DA 1JAOA 2X3CA 3DSLA 3ELMA 3WV1A 4XBHA 1IACA 3GBOA 2ERQA 1GE5A 3KECA 1ZP5A 3HY7A 2PJTA 1K7IA 1KAPP 4FVLA 4H1QA 1DMTA 3N2VA 1QJIA 1HV5A 1KUGA 2YB9A 4R3VA 1BUVM 1ZS0A 1A86A 1IAAA 4IN9A 3KMCA 5CXAA 2WO8A 1OS2A 3TVCA 5LABA 4I35A 4AXQA 4WZVA 3VTGA 3E8RA 1ZXCA 1G12A 2FV9A 3KWVC 1PWUA 2XS3A 1C7KA 3EDGA 2JSDA 1RM8A 4WKEA 1OM8A 2J83A 1G49A 1GE7A 1QIBA 2V4BA 3MA2A 4JQGA 456CA 3LILA 3L0TA 1EB6A 1R1IA 1OM6A 4AYKA 3LQBA 2N8RA 4GF1A 1XFVA 1CIZA 3LK8A 4PKRA 3HYGA 3B8ZA 3LKAA 5B5PA 4ZR5A 1USNA 2JT6A 4PKWA 1SRPA 2Z2DA 3V96B 4H84A 1OO9A 1BM6A 3LJGA 2HU6A 5BPAA 3DL1A 1MNCA 3Q2GA 1GO8P 4H30A 5D1UA 3F18A 1Y93A 5I2ZA 1EUBA 1XFUA 2OI0A 4IUWA 4L6TA 4FU4A 1XURA 1WNIA 1JAQA 1OS9A 3EDZA 1R55A 4ON1A 5D7WA 4WK7A 1BKCI 2ERPA 1IABA 1XUCA 4H49A 3CKIA 1BQQM 4IJOA 1XFWA 1XUDA 3BA0A 1MMPA 1Y0VA 2OXUA 1D8FA 2EROA 3P24A 3U1RA 1CK7A
chains in the Genus database with same CATH superfamily
2LB6A 5IXGA 1GKDA 5EDCA 2DW1A 5B3MO 1R1JA 1NC9A 1I04A 1VWEB 3WBGA 1MX7A 4ZHFA 3PP6A 1SRJA 2GTFX 4L63A 1VWMB 2K23A 2FR3A 4XMDA 2R73A 4YFRA 1NP4A 3CMPA 4Z2VA 1QJJA 3BX8A 1AB0A 1CBQA 2WSJA 4O3XB 2L0RA 3EWJA 1G05A 3TT4A 2L68A 3VI1A 4A3WA 3SOTA 4DCBA 4PKVA 1GKAA 2HYSA 3WJCA 3NQKA 2OVZA 2X46A 1SA8A 3FDCA 3P6GA 3AIGA 1X8UA 3FIQA 5D48A 3OE3A 4DF9A 1L6MA 3KMEA 2WR6A 3SLTA 1HTDA 1XFYA 4N7DA 4OS8A 3RZYA 2RTCB 1PWQA 3B2HA 2PY1A 2I47A 2I5VO 1H91A 4BOEA 3GAQA 4AZNA 4LZVA 1GXAA 4GR0A 3L4RA 3T6FA 4Z2PA 5CZMA 4AZRA 3F16A 1YWAA 2CZTA 3ZZVA 3DNGA 4HMAA 1CBIA 1H71P 2SRTA 2Q9SA 4ORSA 2WQAE 1EW3A 4ARHA 3WOVA 2OYBO 4NYQA 4XMCA 1KUHA 3PECA 4A8ZA 1KUKA 2YUFA 1JJJA 3NX7A 3N2UA 3LMCA 3BY0A 1GX8A 5D1TA 3RE6A 1NQMA 4EFSA 1SWGA 3OBLA 3T2WA 1GO7P 1SMPA 3VG3A 3LEAA 4CPFA 2NNEA 2AIGP 2JGSA 5HZ6A 2VFBA 4IAWA 1Y8JA 2FGSA 2E4JA 2X3AA 5F2BA 1TW4A 3OJYC 5F58A 2IZFB 3EYCA 3Q6LA 1VWOB 2QOSC 3VHHA 1MMQA 1SRHA 1DF8A 1OPBA 2X8TA 4H76A 1IFBA 4O3YA 3PQUA 3LJZA 1YP1A 5I12A 4ES7A 4FBRA 1O0TA 2FR2A 1G9KA 4JNJA 1E06A 2A3FX 4QNIA 2RJQA 2W12A 3ZW2A 5HCDC 3NR3A 2QM9A 4YKMA 3B2KA 3FR5A 1IJ8A 1D5JA 1VYGA 2JIHA 4EKVA 1LCWA 2FV5A 4TLJA 2ASNX 1TOUA 3ZXHA 1W4TA 2RTDB 5JMYA 3AEHA 3LUMA 1HXZA 4DQ3A 2FLJA 2XSTA 4PJ2A 4JPAA 5KICA 5H9LA 2FWVA 3H3IA 1YQYA 4XCTA 1STRB 4I60A 1CGFA 3RDQA 1JBHA 5IRUA 2CLTA 2FS6A 4BBOA 4GJSA 2DJFA 5D2BA 2RTOB 3KFGA 1GX3A 1VYOA 5FQ7E 4HFOA 1SLFB 3D9WA 1Y9LA 1VWNB 1YWCA 1AELA 4TNNA 4O3ZA 1MVGA 4WFVA 4DNEA 4MVIA 1HFSA 1ALBA 4O4SA 1LF7A 4A1YA 5BYPA 1SLEB 1N43A 1Q3AA 4GGRA 1DZPA 1JIZA 1GM6A 1MUPA 4GGTA 3G7XA 4Z2OA 3ZW0B 4ZR2A 2JT5A 3B2LA 2QO6A 4ORRA 1ZTQA 4QKZA 3HWEA 4BX6B 1ATLA 1D7XA 1IAGA 2OY7A 2YG2A 1VWFB 5EDBA 3F17A 2JMBA 2IZHB 1GGLA 2ACOA 1ASTA 1IFCA 2MM3A 1HFCA 5HZ9A 1N7YA 2MZHA 1SATA 2MLRA 1D3SA 2X3CA 3DSLA 4O4OA 1O1VA 2GJ5A 4XBHA 2IFBA 2BHVA 2NP1A 3RDOA 3HY7A 3FLLA 1LIBA 1RXHA 3TGBA 2CZUA 5EPQA 3WJBA 3ZUIA 1KUGA 5LJHA 4HWMA 4KT5A 2W2BA 3FMZA 2KW1A 4IN9A 5CXAA 1VWQB 1SRIA 2AT0X 2IZLB 5LABA 3FA9A 4M6SA 1SXYA 1G12A 3I0AA 1HBQA 2XS3A 5L8NA 2WEWA 4ZHGA 1P6PA 1C7KA 3EDGA 1BLRA 4U8UO 2V4BA 1LDOA 5EEDA 3MA2A 1A3YA 1T68X 4Y0SA 1TVQA 3CR6A 1OBUA 4YCEA 4CSBA 1SLGB 2AF5A 3RWXA 3P02A 3ZW1A 2MF6A 1O8VA 3WZQA 1RXKA 3O22A 1BSYA 3HYGA 1LELA 2CM4A 2QO5A 4LZUA 3UEUA 1JMZA 1FEMA 1QABE 1AVEA 4AZOA 1ERBA 4IB6A 2RTBB 1SWHA 4EDEA 5DPQA 1OO9A 1BM6A 3HOLA 5BPAA 3RDUA 5CHKA 3AKMA 1LFOA 4H30A 4A60A 5I2ZA 1OEKA 2RTHB 1XFUA 1E2TA 2RN4A 1ZNHA 1MX8A 1KOIA 2WWPA 4ON1A 5IRAA 2OVDA 5HA0A 2ERPA 3HOEA 2C4IA 1XUDA 4HPDA 1N4JA 2YMSA 4O49A 1KT4A 3P24A 4GK9A 4K19A 1CK7A 2MO5A 4Y0QA 4ZCBA 1KL4A 1BBPA 3BLGA 4DD8A 2MZIA 3TSKA 1BKCE 1BEBA 1LKEA 3LQ0A 4MEEA 1UREA 3T2XA 1UYNX 1OEJA 1RMZA 3DPEA 3LHNA 3TZSA 2EU7X 5FFHA 4U46A 5B5FA 1CXVA 4IMOA 1YWDA 3LE9A 4YGZA 2Q2MA 3B2ZA 3KHIA 3VU1A 1X8QA 5L7FA 5AJCA 2QO4A 4CDDA 1SWLA 3BU9A 1MDCA 1BRPA 1PM1X 4H3XA 2Y6CA 4A7BA 3D4RA 1NGLA 3EC5A 3NPOA 4RUNA 2WOAA 1YCMA 1OEEA 1VWPB 3HBUP 4GQLA 4COTA 4GUZA 3FENA 5CUHA 2FHLA 4J4MA 3RTSA 5B5GA 4OKAA 1D2UA 2A2UA 5B5OA 3SZJA 1AYKA 4ORUA 1O0QA 3X00A 3USNA 2KRJA 3FW5A 2AMMX 4L19A 1JYDA 2OVEA 2BSZA 4WBKA 3FEPA 1KT6A 2UZ2A 1B8YA 3NQ3A 3B92A 1ZVXA 3EDHA 2OVXA 4AZQA 1ADLA 1JIWI 3O19A 3RY2A 3VE2A 1KXOA 4YVBA 1SY2A 5I0LA 1KUFA 4YFPA 2GTLM 1OBPA 4PKQA 1ROSA 2MWHA 4ZHHA 5I43A 2X45A 1LUQA 2O36A 4QYNA 3LJTA 5B11O 3LUNA 4TJZA 1Y55X 4YDAA 3F19A 2OY1O 2W2AA 3JS1A 3F1AA 4ZFXA 1XCAA 2RJPA 3EDIA 1PWWA 4NV7A 1KT7A 3CQRA 1SY3A 1CAQA 1XFXA 1QY0A 1BJ7A 4HX3A 3CBSA 2JNPA 1SY0A 1EQDA 1SWDA 1IADA 1HXLA 1BSQA 3WYQA 1SWQA 1SRGA 1BUDA 5HTDA 1NBXA 5HBSA 4U8UN 4BX7B 3WZPA 4Y0PA 1XFZA 5L79A 1I76A 4N7CA 1G4KA 3HWFA 4YCHA 3HK1A 4WKIA 1LIDA 4GUYA 4NW4A 4HPCA 3ELXA 4ZGUA 3AYUA 3D97A 5AJBA 4UU2A 4JGLA 4PKTA 2IZEB 4GDZA 3WYPA 4CPHB 1KZXA 2TCLA 3NX1A 1IIUA 2RTPB 1VWAB 4JP4A 1EAKA 5H9NA 1KGLA 2LA7A 4FQBB 1JJ9A 1LPJA 2NNQA 4M7MA 4IB8A 5D1SA 4Y59A 1BKCA 2YIGA 1EPBA 3FW4A 1A85A 4IMNA 4ZH9A 2OXWA 5L8OA 3VGWA 3KQ0A 1WBIA 3CQNA 1SLDB 1Y9TA 2Z4IA 4TKBA 1CBSA 5HTEA 3WZNA 3UAQA 1SWOA 3MM0A 2MJIA 1MMRA 3P6HA 3O2XA 4AIGA 2CAMA 1FM1A 1SWSA 2GTLN 4ZJ0A 3P6FA 5BOTA 2POJA 5IO5A 1NP1A 3S5VA 1VWDB 1BSWA 4CDEA 4ML7B 3EBKA 4QZTA 3FA7A 1U18A 1DTHA 1DFVA 1VWCB 3K7NA 1SWUA 1FDQA 2HLVA 1IAEA 2ZAGA 1OZ9A 3KVNA 2A8HA 1SWEA 4YGHA 4QRLA 3SAOA 1GE5A 2KT4B 1SWAA 1PBOA 4YFQA 4PSQA 4ORWA 3N2VA 2OY5O 3HPEA 1SWBA 4R3VA 1RBPA 5KIDA 1A86A 4ALBA 3VE1A 1OS2A 1LIFA 2RTQB 1KL3A 4MVKA 2Q4NA 1X8NA 4WZVA 1SWNA 5EEEA 4IABA 3E8RA 4EXZA 1ZXCA 4IB7A 4D6AA 3KWVC 2AT6X 2KTDA 2DM5A 1DZJA 2G5LA 5L8IA 4BGFA 2F01A 3UEVA 1RM8A 4WKEA 1OM8A 1IW2A 2OY8A 5LKEA 3LILA 3LQBA 4GF1A 2IZJA 2G8CO 2ZSCA 5D8JA 1XFVA 1SY1A 1VWKB 3LK8A 5AQ6A 2X34A 5HZ5A 3STKA 4U9CA 1HN2A 3B8ZA 1SWJA 1HMRA 1SRPA 1PTSA 5H9KA 3ZUOA 4WFUA 2GH7A 2RTNB 3V96B 2WPUA 3GE2A 4H84A 3RDSA 2JU3A 2AKQA 4XMFA 3VPJE 5K67A 3DL1A 4MVLA 5D1UA 1Y93A 1EUBA 2C1QA 4UU3A 5DG4A 5BVSA 3FR2A 3FA6A 2OVSA 1CBRA 4ALOA 4FU4A 2IZAA 1XURA 1WNIA 1JAQA 1I06A 2AT5X 2F73A 3U0DA 2RCQA 3APVA 4C5PA 5D7WA 5HZQA 5JD2A 3QKGA 3IFBA 4FBVA 5D47A 3ZWEA 4L3RA 1KT5A 2G78A 3BA0A 1LICA 3WJEA 2OXUA 5LJGA 2JU8A 2OFRX 4B55A 4GE1A 2EROA 4I3DA 3QQ2A 1S2PA 3SZHA 5AEOA 4CV7A 2RA6A 1ZXVA 2HZQA 4OS0A 4BVMA 1UMTA 4Q1LA 1SWCA 4I95A 2Y32A 2W0DA 1I05A 3HB2P 1E02A 5CSEA 1VWRB 3N91A 5IO6A 1HOVA 3EW2A 1ND1A 2A5BA 5I4OA 5EZ2A 4BCSA 5F6BA 4IBAA 3EBWA 1VPRA 4OS3A 4GWMA 4ZGFA 3PEDA 4ODDA 3MVFA 1U0XA 1W6FA 3OHOA 5KHPA 2JU7A 1YP6A 2QPJA 3DTEA 1QICA 4EEJA 5H8TA 2AT8X 4CPEA 1ML7A 3PQSA 3G42A 3ELZA 3APUA 3RKGA 3AUMO 5LJCA 4GD9A 3UEWA 2K9CA 3ZW0A 1GT1A 2BC3A 2AYKA 1HMTA 4BX6A 4AZPA 1NDJA 3G5CA 1QFVA 2D1NA 2VFCA 2FT9A 5D4AA 2HZRA 3SLOA 3HTYA 4CK4A 4I03A 3TGAA 3HDBA 1EIIA 4GGZA 4NV8A 1B56A 1FENA 2USNA 4L1NA 1PWPA 3S26A 2OZRA 1XKIA 2R74A 4IRWA 1JH1A 4JHQA 1QIAA 3SLJA 5H8XA 2D1OA 1DZKA 1I1IP 4FXQA 2Y6DA 1HMSA 1Z24A 3KRYA 3BX7A 3D96A 3I7GA 3EHYA 1B3DA 3NADA 5D45A 1AF0A 3UEXA 1I78A 1K7QA 2RCTA 2RTJA 2XKLA 1Y53X 3RTTA 2X56A 5HAEA 2BS6A 2ACPX 1SWTA 4OMWA 1X71A 4QGWA 2RTFB 1B4MA 4EQAC 2UYWA 2FRSA 1UYOX 3NQ9A 2OZQA 1UTZA 2OXZA 4I3CA 4XM8A 3Q34A 3ZVSA 3JSQA 1BQOA 1DZMA 5FAZA 2OW2A 4U8UM 2DDYA 1UEAA 1BZSA 1YOUA 2RTAA 1CGLA 2E2DA 1XM5A 2IZGB 2AT3X 3TF6A 5D3CA 3WXQA 5BOYA 3RDMA 4H82A 2A8GA 2F09A 2OW0A 4INNA 4AUOA 3L0VA 4CPIA 2X8SA 4O3WA 1KUIA 1STSB 4CDFA 1WUBA 3BRNA 4DV8A 1RAVA 5K06A 2JOZA 4NLJA 1JZUA 1A2DA 2FKGA 1A18A 3CKFA 3VG2A 4BX5B 4L7AA 2OL7A 2X55A 5B10O 1SWRA 1NQNA 2AVIA 3MG5A 3KEKA 2POAA 2WO9A 5K68A 2OFBA 1I9HA 1QWDA 4XMHA 3C76X 966CA 2A0AA 2OF8A 2BT9A 3LGPA 1ICNA 2X3BA 1G7NA 1X8PA 3EHXA 3DWBA 4O4XA 5HA1A 1FJ1E 2X7MA 4G9LA 1EXSA 2RTEB 2C1SA 1UTTA 1GT5A 1SLMA 4A1HA 1GKAB 2DDFA 1AQBA 3WZOA 1VWHB 1C8TA 2OY2A 1FE3A 5F7GA 1VWLB 1SWPA 2DJGA 1X89A 3LIKA 1KBCA 3AYKA 3D95A 3B2JA 4ORXA 2W2FA 3SHIA 3ZQ3A 1G85A 3I7IA 1GXDA 3RBYA 1OM7A 3VG7A 4BX5A 1Y0GA 3CBCA 1UZ2X 1MOYA 830CA 4Z28A 1I4UA 1ZNLA 3JQOA 1J7NA 4FXYP 2MZEA 4G0DA 1JAOA 2OFMX 3ELMA 3WV1A 2A2GA 1IACA 2ERQA 1BWYA 4IAXA 3RY1A 3KECA 1ZP5A 2JW1A 1GT4A 2HKDA 4H1QA 1KAPP 4AW8A 5LKFA 3RSWA 4YBPA 1SMPI 3F8AA 2YB9A 2VDFA 2OVAA 1BUVM 1ZS0A 1IAAA 3KMCA 3RDXA 3VHIA 1QFTA 2Y3FA 3S60A 4ID2A 3ZI8A 2HNXA 1R0UA 3IA8A 1OSPO 2R56A 2X32A 5B29A 1YP7A 1PWUA 3CWKA 2BLGA 2J83A 1G49A 4YDBA 2HMBA 4R0BA 2G79A 1QIBA 2LFOA 4JQGA 4GKCA 456CA 1HQQA 1QQSA 1EB6A 1R1IA 2QOMA 1OM6A 1STPA 2Y3EA 5HCCC 1ZNDA 1FELA 4MVEA 1SREA 2IZKA 3SZIA 1CIZA 3I17A 1ACDA 1CRBA 4GETA 4OELA 3LKAA 3E3CA 4FBOA 5HZ8A 1USNA 5B5PA 1N9YA 2Z2DA 5JR8A 5LJEA 1E00A 4KCAA 5BVQA 4I6SA 1ERXA 4EFGA 3LJGA 2RTIB 2HU6A 4Y5DA 4BX7A 3Q2GA 1GO8P 4Y0RA 5BVTA 4BQUA 1RSUB 2OI0A 4IUWA 4KIIA 4L6TA 1R55A 3FELA 3P6EA 1EALA 1IABA 1PEEA 1XUCA 4H49A 3CKIA 1BQQM 4IJOA 1XFWA 2RQ0A 3BDRA 5F1EA 1D8FA 4IB9A 4CPHA 3U1RA 1XAXA 4WHIA 5HCEC 4GNWA 2WQ9A 3DTQA 1SXXA 1N0SA 2O3EA 1ZNEA 3HWGA 3MBTA 3DSZA 4I9RA 4QQ1A 4ZHDA 3PPTA 1SU3A 1TVIA 1KQWA 1W5RA 3VG6A 4I3BA 3TGCA 4PKUA 1DV9A 2OFAA 1LCZA 4GR3A 4NNSA 3PH6A 2CBRA 5B27A 3FYFA 1S44A 4GZVA 4D6BA 3DTIA 3EW1A 1GX9A 4NYRA 2ANSA 2FHNX 3KFHA 1JKYA 1RXJA 4MISA 1MM9A 1TXLA 2AL0X 1CQRA 3F15A 4AYHA 1O1UA 2OW1A 1CGEA 3WJDA 2RTGB 1QG5A 1JIWP 1L6JA 1PMPA 1PWVA 4O9SA 4I9SA 1A57A 2W14A 5C0NA 4XMEA 1JAPA 1JV4A 1VYFA 5LJBA 1GKCA 1MMBA 4JO6A 4KC8A 3RE5A 2JN3A 3PK2A 2LBAA 1JYJA 1K24A 2WUTA 1U17A 2Q39A 3VG5A 3O2YA 4HPAA 3HY9A 4HPBA 2LKKA 1DF3A 1QUAA 2OW9A 2CKIA 3PDFA 5FENA 2RTRB 4OMXA 2K2GA 3T6LA 1G74A 3NBXX 1SXWA 1EUOA 1JJUA 5HWZA 3K7LA 1N9MA 4GNYA 3WVMA 3DTKA 4ZHCA 4H2EA 3F9DA 3WV3A 2MLSA 1FLSA 3STNA 4XM6A 5L3YA 4KC7A 3FA8A 1K7GA 1JANA 1C3IA 1X8OA 3EMMA 2G7BA 1R1HA 2N93A 1HQPA 3ZUKA 1VWIB 4YKOA 1HY7A 1K3BA 2DW0A 3HBVP 2I5ZO 2KTSA 1KQXA 3KFFA 4CTHA 3LTWA 3UVCA 1HY2A 4OEMA 3LIRA 4WF6A 1PBYA 3TS4A 4AZMA 1AKLA 3ZW1B 1Z3JA 4DQ4A 3WJGA 4ILWD 2K62A 1EPAA 3O64A 4XM7A 4LQZA 3WV2A 1VWBB 5IRWA 1SLNA 1RSTB 2OF9A 3FEKA 4U3QA 2Z4HA 2XS4A 4MIRA 1MEPA 2AH7X 1BM5A 3Q2HA 1OMJA 2RD7C 4KH8A 1I73A 3DPFA 2W13A 2OY4A 1SRFA 3P6CA 2ZAIA 1LIEA 5B2AO 2FTBA 4YGGA 4FGIB 1DC9A 2IZIA 4QGVA 2QMIA 3KEJA 2FKJA 3LV4A 4JA1A 4DPEA 5I3MA 1IKEA 3HDAP 4YMYA 1OPAA 4TQ2A 2OL8O 5CYBA 2GC9A 1JQPA 1E5PA 4NNTA 5FQ6E 2ALLX 2WEXA 1GE6A 2DW2A 1SXUA 4NP1A 1SWFA 1YUPA 2MHDA 1S4BP 3WJFA 4GWNA 3F6ZB 2L67A 1MK5A 4YH0A 3BS2A 1VWGB 4GH7A 1RLBE 4TKHA 1KZWA 1BRQA 1T0VA 3OHLA 3APXA 1ZRYA 5LJDA 1D8MA 4GU8A 1UMSA 1GT3A 2PI3O 2A5CA 3OD9A 3KFIA 2E3XA 1SWKA 3NX2A 3U9PC 1FBLA 3C77X 1BIWA 2Q2PA 4PKSA 1LCVA 2QCBA 2BS5A 3FIDA 4LKPA 2M4LA 3APWA 2J0TA 1R54A 4Z6JA 3P1VA 2W15A 2LBVA 2RTKA 4JIJA 1KL5A 3K3LA 2IZCB 2RTLA 2L5PA 4GR8A 4QGXA 1JK3A 5IO7A 4TKJA 3C78X 2CBSA 2CM9A 4ORYA 1YIVA 1AVDA 1KT3A 1B0OA 1LNMA 3GBOA 2A13A 4RUUA 2GTLO 1YWBA 4NLIA 2PJTA 1K7IA 4FVLA 1DMTA 1ICMA 1QJIA 2X4MA 1IKJA 1HV5A 3U03A 3MX7A 1S7DA 3VHMA 3BU1A 3NP1A 4O4UA 3V8UA 1CJ5A 1ZNGA 2WO8A 3TVCA 1G5WA 2OL6O 4I35A 4GDAA 4AXQA 1JMXA 3VTGA 2FV9A 3PH5A 2L9CA 5H9AA 4GRJA 2JSDA 2FS7A 4YBUA 1ZNKA 1VWJB 1GE7A 1BSOA 1KFFA 3L0TA 3T1DA 4AYKA 3P6DA 3BSZE 2N8RA 1OBQA 1T8VA 4QZUA 3S5XA 3KZAA 2P8GA 4GJVA 4PKRA 1FTPA 4QYPA 1LDQA 1HBPA 4ZR5A 2JT6A 4PKWA 4XMGA 3AKNA 1TOWA 3HWDA 1EI5A 1QY1A 5LJKA 3STMX 4LKTA 2X8FA 1B8EA 4Z27A 3FR4A 1QY2A 1EIOA 3EM0A 4CDCA 1MNCA 2NNDA 3F18A 3CKGA 2IZDB 3VG4A 2KD2A 1Y52X 2IZBA 4ZH6A 1OS9A 3EDZA 4WK7A 3B2IA 5F6ZA 1BKCI 5CE4A 1AVGI 1MMPA 1Y0VA 1JJXA 4QAEA 5FQ8E 2O62A 2RTMA 4BJ8A
chains in the Genus database with same CATH topology
2LB6A 1GKDA 5EDCA 2DW1A 1R1JA 1I04A 3WBGA 1MX7A 4ZHFA 3PP6A 2GTFX 4L63A 2K23A 2FR3A 4XMDA 2R73A 4YFRA 1NP4A 3CMPA 1QJJA 3BX8A 1AB0A 1CBQA 2WSJA 4O3XB 2L0RA 3EWJA 1G05A 3TT4A 2L68A 3VI1A 4A3WA 3SOTA 4PKVA 1GKAA 2HYSA 3WJCA 3NQKA 2OVZA 2X46A 1SA8A 3P6GA 3AIGA 1X8UA 3FIQA 5D48A 3OE3A 4DF9A 1L6MA 3KMEA 2WR6A 1HTDA 1XFYA 4N7DA 4OS8A 3RZYA 1PWQA 3B2HA 2PY1A 2I47A 1H91A 4BOEA 3GAQA 4AZNA 4LZVA 1GXAA 4GR0A 3L4RA 5CZMA 4AZRA 3F16A 1YWAA 2CZTA 3ZZVA 3DNGA 4HMAA 1CBIA 1H71P 2SRTA 2Q9SA 4ORSA 2WQAE 1EW3A 4ARHA 3WOVA 4NYQA 4XMCA 1KUHA 3PECA 4A8ZA 1KUKA 2YUFA 1JJJA 3NX7A 3N2UA 3LMCA 3BY0A 1GX8A 5D1TA 4EFSA 3OBLA 1GO7P 1SMPA 3VG3A 3LEAA 2NNEA 2AIGP 5HZ6A 4IAWA 1Y8JA 2E4JA 2X3AA 1TW4A 3OJYC 5F58A 3EYCA 3Q6LA 2QOSC 1MMQA 1OPBA 2X8TA 4H76A 1IFBA 4O3YA 3PQUA 3LJZA 1YP1A 5I12A 4ES7A 4FBRA 1O0TA 2FR2A 1G9KA 1E06A 2A3FX 4QNIA 2RJQA 2W12A 3ZW2A 5HCDC 3NR3A 2QM9A 4YKMA 3B2KA 3FR5A 1D5JA 1VYGA 2JIHA 2FV5A 4TLJA 2ASNX 1TOUA 3ZXHA 5JMYA 3LUMA 4DQ3A 2FLJA 2XSTA 4PJ2A 4JPAA 5KICA 5H9LA 2FWVA 3H3IA 1YQYA 4XCTA 1CGFA 1JBHA 2CLTA 2FS6A 5D2BA 3KFGA 5FQ7E 4HFOA 1Y9LA 1AELA 1YWCA 4TNNA 4O3ZA 1MVGA 4WFVA 4MVIA 1HFSA 1ALBA 4O4SA 1LF7A 4A1YA 5BYPA 1Q3AA 1DZPA 1JIZA 1GM6A 1MUPA 3G7XA 3ZW0B 4ZR2A 2JT5A 3B2LA 4QKZA 1ZTQA 2QO6A 4ORRA 3HWEA 1ATLA 1D7XA 1IAGA 2YG2A 5EDBA 3F17A 2JMBA 1GGLA 2ACOA 1ASTA 1IFCA 2MM3A 1HFCA 5HZ9A 2MZHA 1SATA 2MLRA 1D3SA 2X3CA 3DSLA 4O4OA 1O1VA 2GJ5A 4XBHA 2IFBA 2BHVA 2NP1A 3HY7A 3FLLA 1LIBA 3TGBA 2CZUA 5EPQA 3WJBA 3ZUIA 1KUGA 5LJHA 4HWMA 4KT5A 2W2BA 3FMZA 2KW1A 4IN9A 5CXAA 2AT0X 5LABA 3FA9A 4M6SA 1SXYA 1G12A 3I0AA 1HBQA 2XS3A 5L8NA 2WEWA 4ZHGA 1P6PA 1C7KA 3EDGA 1BLRA 4U8UO 2V4BA 3MA2A 5EEDA 1A3YA 1T68X 4Y0SA 1TVQA 3CR6A 1OBUA 4YCEA 4CSBA 3RWXA 3P02A 3ZW1A 1O8VA 3O22A 1BSYA 3HYGA 2CM4A 2QO5A 4LZUA 3UEUA 1FEMA 1QABE 4AZOA 1ERBA 4IB6A 4EDEA 5DPQA 1OO9A 1BM6A 3HOLA 5BPAA 3AKMA 1LFOA 4H30A 4A60A 5I2ZA 1OEKA 1XFUA 2RN4A 1ZNHA 1MX8A 1KOIA 2WWPA 4ON1A 2OVDA 5HA0A 2ERPA 3HOEA 1XUDA 4HPDA 2YMSA 4O49A 1KT4A 3P24A 4GK9A 4K19A 1CK7A 2MO5A 4Y0QA 4ZCBA 1BBPA 3BLGA 4DD8A 2MZIA 3TSKA 1BKCE 1BEBA 1LKEA 3LQ0A 1UREA 1OEJA 1RMZA 3DPEA 3LHNA 3TZSA 2EU7X 5FFHA 1CXVA 4IMOA 1YWDA 3LE9A 4YGZA 2Q2MA 3B2ZA 3KHIA 3VU1A 1X8QA 5L7FA 5AJCA 2QO4A 3BU9A 1MDCA 1BRPA 1PM1X 4H3XA 2Y6CA 4A7BA 3D4RA 1NGLA 3NPOA 4RUNA 2WOAA 1YCMA 1OEEA 3HBUP 4GQLA 4COTA 3FENA 5CUHA 4J4MA 3RTSA 1D2UA 2A2UA 5B5OA 1AYKA 4ORUA 1O0QA 3USNA 2KRJA 3FW5A 2AMMX 4L19A 1JYDA 2OVEA 4WBKA 3FEPA 1KT6A 1B8YA 3NQ3A 3B92A 1ZVXA 3EDHA 2OVXA 4AZQA 1ADLA 1JIWI 3O19A 3VE2A 1KXOA 1SY2A 5I0LA 1KUFA 4YFPA 2GTLM 1OBPA 4PKQA 1ROSA 2MWHA 4ZHHA 5I43A 2X45A 2O36A 4QYNA 3LJTA 3LUNA 4TJZA 4YDAA 3F19A 2W2AA 3JS1A 3F1AA 4ZFXA 1XCAA 2RJPA 3EDIA 1PWWA 1KT7A 3CQRA 1SY3A 1CAQA 1XFXA 1QY0A 1BJ7A 4HX3A 3CBSA 2JNPA 1SY0A 1EQDA 1IADA 1BSQA 1BUDA 5HTDA 5HBSA 4U8UN 4Y0PA 1XFZA 5L79A 1I76A 4N7CA 1G4KA 3HWFA 4YCHA 3HK1A 4WKIA 1LIDA 4GUYA 4NW4A 4HPCA 3ELXA 4ZGUA 3AYUA 3D97A 5AJBA 4UU2A 4JGLA 4PKTA 4GDZA 1KZXA 2TCLA 3NX1A 1IIUA 4JP4A 1EAKA 5H9NA 1KGLA 2LA7A 4FQBB 1JJ9A 1LPJA 2NNQA 4M7MA 4IB8A 5D1SA 1BKCA 2YIGA 1EPBA 3FW4A 1A85A 4IMNA 4ZH9A 2OXWA 5L8OA 3KQ0A 3CQNA 1Y9TA 2Z4IA 4TKBA 1CBSA 5HTEA 3UAQA 2MJIA 1MMRA 3P6HA 3O2XA 4AIGA 1FM1A 2GTLN 4ZJ0A 3P6FA 5BOTA 2POJA 5IO5A 1NP1A 3S5VA 1BSWA 4ML7B 3EBKA 4QZTA 3FA7A 1U18A 1DTHA 1DFVA 3K7NA 1FDQA 2HLVA 1IAEA 2ZAGA 2A8HA 4YGHA 4QRLA 3SAOA 1GE5A 2KT4B 1PBOA 4YFQA 4PSQA 4ORWA 3N2VA 4R3VA 1RBPA 5KIDA 1A86A 4ALBA 3VE1A 1OS2A 1LIFA 4MVKA 2Q4NA 1X8NA 4WZVA 5EEEA 4IABA 3E8RA 4EXZA 1ZXCA 4IB7A 3KWVC 4D6AA 2AT6X 2KTDA 2DM5A 1DZJA 5L8IA 3UEVA 1RM8A 4WKEA 1OM8A 1IW2A 5LKEA 3LILA 3LQBA 4GF1A 5D8JA 1XFVA 3LK8A 5AQ6A 5HZ5A 3STKA 4U9CA 1HN2A 3B8ZA 1HMRA 1SRPA 5H9KA 3ZUOA 4WFUA 3V96B 3GE2A 4H84A 2JU3A 2AKQA 4XMFA 3VPJE 3DL1A 4MVLA 5D1UA 1Y93A 1EUBA 5DG4A 4UU3A 5BVSA 3FR2A 3FA6A 2OVSA 1CBRA 4ALOA 4FU4A 1XURA 1WNIA 1JAQA 1I06A 2AT5X 2F73A 3U0DA 2RCQA 3APVA 5D7WA 5HZQA 3QKGA 3IFBA 4FBVA 5D47A 3ZWEA 4L3RA 1KT5A 2G78A 3BA0A 1LICA 3WJEA 2OXUA 5LJGA 2JU8A 2OFRX 4GE1A 2EROA 4I3DA 1S2PA 5AEOA 4CV7A 2RA6A 1ZXVA 2HZQA 4OS0A 4BVMA 1UMTA 4Q1LA 4I95A 2W0DA 1I05A 3HB2P 1E02A 3N91A 5IO6A 1HOVA 1ND1A 5I4OA 5EZ2A 5F6BA 4IBAA 3EBWA 1VPRA 4OS3A 4GWMA 4ZGFA 3PEDA 4ODDA 3MVFA 1U0XA 3OHOA 5KHPA 2JU7A 1YP6A 2QPJA 3DTEA 1QICA 4EEJA 5H8TA 2AT8X 1ML7A 3PQSA 3G42A 3ELZA 3APUA 3RKGA 5LJCA 3UEWA 2K9CA 3ZW0A 1GT1A 2AYKA 1HMTA 4AZPA 3G5CA 1QFVA 2D1NA 2FT9A 5D4AA 2HZRA 3HTYA 4CK4A 4I03A 3TGAA 3HDBA 1EIIA 1B56A 1FENA 2USNA 4L1NA 1PWPA 3S26A 2OZRA 1XKIA 2R74A 1JH1A 1QIAA 5H8XA 2D1OA 1DZKA 1I1IP 4FXQA 2Y6DA 1HMSA 1Z24A 3KRYA 3BX7A 3D96A 3I7GA 3EHYA 1B3DA 3NADA 5D45A 1AF0A 3UEXA 1K7QA 2RCTA 2XKLA 3RTTA 5HAEA 2BS6A 2ACPX 4OMWA 1X71A 4QGWA 1B4MA 4EQAC 2FRSA 3NQ9A 2OZQA 1UTZA 2OXZA 4I3CA 4XM8A 3ZVSA 3JSQA 1BQOA 1DZMA 5FAZA 2OW2A 4U8UM 2DDYA 1UEAA 1BZSA 1YOUA 1CGLA 2E2DA 2AT3X 3TF6A 5D3CA 3WXQA 5BOYA 4H82A 2F09A 2OW0A 4INNA 4AUOA 3L0VA 2X8SA 4O3WA 1KUIA 3BRNA 4DV8A 5K06A 2JOZA 4NLJA 1JZUA 1A2DA 1A18A 3VG2A 4L7AA 3KEKA 2POAA 2WO9A 1QWDA 4XMHA 3C76X 966CA 2A0AA 2BT9A 3LGPA 1ICNA 2X3BA 1G7NA 1X8PA 3EHXA 3DWBA 4O4XA 5HA1A 2X7MA 4G9LA 1EXSA 1UTTA 1GT5A 1SLMA 4A1HA 1GKAB 2DDFA 1AQBA 1C8TA 2OY2A 1FE3A 5F7GA 1X89A 3LIKA 1KBCA 3AYKA 3D95A 3B2JA 4ORXA 2W2FA 3SHIA 3ZQ3A 1G85A 3I7IA 1GXDA 3RBYA 1OM7A 3VG7A 3CBCA 1UZ2X 830CA 1I4UA 1ZNLA 3JQOA 1J7NA 4FXYP 2MZEA 4G0DA 1JAOA 2OFMX 3ELMA 3WV1A 2A2GA 1IACA 2ERQA 1BWYA 4IAXA 3KECA 1ZP5A 2JW1A 1GT4A 4H1QA 1KAPP 4AW8A 5LKFA 3RSWA 4YBPA 1SMPI 3F8AA 2YB9A 2OVAA 1BUVM 1ZS0A 1IAAA 3KMCA 1QFTA 3S60A 4ID2A 3ZI8A 2HNXA 1R0UA 3IA8A 2R56A 5B29A 1YP7A 1PWUA 3CWKA 2BLGA 2J83A 1G49A 4YDBA 2HMBA 4R0BA 2G79A 1QIBA 2LFOA 4JQGA 4GKCA 456CA 1QQSA 1EB6A 1R1IA 1OM6A 5HCCC 1ZNDA 1FELA 4MVEA 1CIZA 3I17A 1ACDA 1CRBA 4GETA 3LKAA 3E3CA 4FBOA 5HZ8A 1USNA 5B5PA 2Z2DA 5JR8A 5LJEA 1E00A 4KCAA 5BVQA 4I6SA 1ERXA 4EFGA 3LJGA 2HU6A 3Q2GA 1GO8P 4Y0RA 5BVTA 4BQUA 2OI0A 4IUWA 4KIIA 4L6TA 1R55A 3FELA 3P6EA 1EALA 1IABA 1PEEA 1XUCA 4H49A 3CKIA 1BQQM 4IJOA 1XFWA 2RQ0A 3BDRA 5F1EA 1D8FA 4IB9A 3U1RA 4WHIA 5HCEC 4GNWA 2WQ9A 3DTQA 1SXXA 1N0SA 2O3EA 1ZNEA 3HWGA 3MBTA 3DSZA 4I9RA 4QQ1A 4ZHDA 3PPTA 1SU3A 1KQWA 3VG6A 4I3BA 3TGCA 4PKUA 1DV9A 4GR3A 4NNSA 3PH6A 2CBRA 5B27A 3FYFA 1S44A 4GZVA 4D6BA 3DTIA 4NYRA 1GX9A 2ANSA 3KFHA 1JKYA 4MISA 1TXLA 2AL0X 1CQRA 3F15A 4AYHA 1O1UA 2OW1A 1CGEA 3WJDA 1QG5A 1JIWP 1L6JA 1PMPA 1PWVA 4O9SA 4I9SA 1A57A 2W14A 5C0NA 4XMEA 1JAPA 1JV4A 1VYFA 5LJBA 1GKCA 1MMBA 4KC8A 2JN3A 2LBAA 1JYJA 2WUTA 1U17A 2Q39A 3VG5A 3O2YA 4HPAA 3HY9A 4HPBA 2LKKA 1DF3A 1QUAA 2OW9A 2CKIA 5FENA 4OMXA 2K2GA 1G74A 3NBXX 1SXWA 1EUOA 5HWZA 3K7LA 4GNYA 3WVMA 3DTKA 4ZHCA 4H2EA 3F9DA 3WV3A 2MLSA 1FLSA 3STNA 4XM6A 4KC7A 3FA8A 1K7GA 1JANA 1C3IA 1X8OA 3EMMA 2G7BA 1R1HA 2N93A 1HQPA 3ZUKA 4YKOA 1HY7A 2DW0A 3HBVP 2KTSA 1KQXA 3KFFA 4CTHA 3UVCA 3LIRA 4WF6A 3TS4A 4AZMA 1AKLA 3ZW1B 1Z3JA 4DQ4A 3WJGA 4ILWD 2K62A 1EPAA 3O64A 4XM7A 4LQZA 3WV2A 1SLNA 3FEKA 4U3QA 2Z4HA 2XS4A 4MIRA 2AH7X 1BM5A 3Q2HA 1OMJA 2RD7C 4KH8A 1I73A 3DPFA 2W13A 2OY4A 3P6CA 2ZAIA 1LIEA 2FTBA 4YGGA 4FGIB 1DC9A 4QGVA 2QMIA 3KEJA 3LV4A 4JA1A 4DPEA 5I3MA 1IKEA 3HDAP 4YMYA 1OPAA 4TQ2A 5CYBA 2GC9A 1E5PA 4NNTA 5FQ6E 2ALLX 2WEXA 1GE6A 2DW2A 1SXUA 4NP1A 1YUPA 2MHDA 1S4BP 3WJFA 4GWNA 3F6ZB 2L67A 4YH0A 3BS2A 4GH7A 1RLBE 4TKHA 1KZWA 1BRQA 1T0VA 3OHLA 3APXA 1ZRYA 5LJDA 1D8MA 4GU8A 1UMSA 1GT3A 3OD9A 3KFIA 2E3XA 3NX2A 3U9PC 1FBLA 3C77X 1BIWA 2Q2PA 4PKSA 2BS5A 4LKPA 2M4LA 3APWA 2J0TA 1R54A 3P1VA 2W15A 2LBVA 4JIJA 3K3LA 2L5PA 4GR8A 4QGXA 1JK3A 5IO7A 4TKJA 3C78X 2CBSA 2CM9A 4ORYA 1YIVA 1KT3A 1B0OA 1LNMA 3GBOA 2A13A 4RUUA 2GTLO 1YWBA 4NLIA 2PJTA 4FVLA 1K7IA 1DMTA 1ICMA 1QJIA 1IKJA 1HV5A 3U03A 3MX7A 1S7DA 3BU1A 3NP1A 4O4UA 3V8UA 1CJ5A 1ZNGA 2WO8A 3TVCA 1G5WA 4I35A 4AXQA 3VTGA 2FV9A 3PH5A 2L9CA 5H9AA 4GRJA 2JSDA 2FS7A 4YBUA 1ZNKA 1GE7A 1BSOA 3L0TA 3T1DA 4AYKA 3P6DA 3BSZE 2N8RA 1OBQA 1T8VA 4QZUA 3S5XA 3KZAA 2P8GA 4PKRA 1FTPA 4QYPA 1HBPA 4ZR5A 2JT6A 4PKWA 4XMGA 3AKNA 1TOWA 3HWDA 1EI5A 1QY1A 5LJKA 3STMX 4LKTA 2X8FA 1B8EA 3FR4A 1QY2A 1EIOA 3EM0A 1MNCA 2NNDA 3F18A 2KD2A 3VG4A 4ZH6A 1OS9A 3EDZA 4WK7A 3B2IA 5F6ZA 1BKCI 5CE4A 1AVGI 1MMPA 1Y0VA 1JJXA 4QAEA 5FQ8E 2O62A 1SY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXV A;  1GKD A;  2O3E A;  2DW1 A;  4DD8 A;  2MZI A;  1R1J A;  3TSK A;  1SU3 A;  1BKC E;  1UMT A;  4Q1L A;  3LQ0 A;  2W0D A;  4L63 A;  3HB2 P;  1RMZ A;  3DPE A;  4PKU A;  1HOV A;  4GR3 A;  1ND1 A;  1CXV A;  3LE9 A;  3B2Z A;  5I4O A;  1QJJ A;  3KHI A;  5L7F A;  1JKY A;  2L0R A;  3EWJ A;  1G05 A;  3TT4 A;  3VI1 A;  4H3X A;  4A3W A;  2Y6C A;  4PKV A;  4GWM A;  1CQR A;  3F15 A;  4A7B A;  3OHO A;  2OVZ A;  3AIG A;  2QPJ A;  2OW1 A;  1CGE A;  1QIC A;  2WOA A;  4DF9 A;  1YCM A;  3HBU P;  3KME A;  1JIW P;  1L6J A;  3G42 A;  4GQL A;  1PWV A;  1HTD A;  5CUH A;  1XFY A;  2K9C A;  4J4M A;  3RTS A;  2W14 A;  1JAP A;  1PWQ A;  2AYK A;  3G5C A;  2D1N A;  1GKC A;  5B5O A;  2I47 A;  1MMB A;  1AYK A;  1O0Q A;  3USN A;  2KRJ A;  4GR0 A;  4I03 A;  4L19 A;  3HY9 A;  1QUA A;  2OW9 A;  5CZM A;  2CKI A;  1B8Y A;  3F16 A;  3HDB A;  2K2G A;  3DNG A;  4HMA A;  1H71 P;  2SRT A;  2USN A;  1PWP A;  3B92 A;  2OZR A;  1ZVX A;  3EDH A;  3K7L A;  1JH1 A;  2OVX A;  4H2E A;  1KUH A;  1QIA A;  2MLS A;  3WV3 A;  5H8X A;  1FLS A;  2D1O A;  1KUK A;  4XM6 A;  1K7G A;  1I1I P;  4FXQ A;  3NX7 A;  1JAN A;  3N2U A;  1C3I A;  2Y6D A;  3LMC A;  5I0L A;  1KUF A;  3KRY A;  5D1T A;  3I7G A;  3EHY A;  1R1H A;  1B3D A;  4EFS A;  4PKQ A;  3ZUK A;  1ROS A;  5I43 A;  1AF0 A;  1K7Q A;  1GO7 P;  1SMP A;  2O36 A;  1HY7 A;  3LJT A;  3LUN A;  3LEA A;  2DW0 A;  3RTT A;  3HBV P;  2AIG P;  3F19 A;  4CTH A;  1Y8J A;  3UVC A;  3LIR A;  2X3A A;  3F1A A;  4WF6 A;  3TS4 A;  2RJP A;  3EDI A;  1AKL A;  1PWW A;  1UTZ A;  2OXZ A;  1Z3J A;  4XM8 A;  1MMQ A;  3ZVS A;  1CAQ A;  1XFX A;  4H76 A;  4HX3 A;  1BQO A;  2JNP A;  4ILW D;  1IAD A;  3O64 A;  2OW2 A;  4XM7 A;  3LJZ A;  1YP1 A;  5I12 A;  1BUD A;  2DDY A;  3WV2 A;  1UEA A;  1O0T A;  1BZS A;  1YOU A;  1G9K A;  1SLN A;  1CGL A;  2E2D A;  2RJQ A;  1XFZ A;  2W12 A;  5L79 A;  1I76 A;  2XS4 A;  5D3C A;  5BOY A;  3Q2H A;  1OMJ A;  1G4K A;  4H82 A;  2OW0 A;  4AUO A;  3L0V A;  1D5J A;  4WKI A;  2JIH A;  1I73 A;  4GUY A;  3DPF A;  1KUI A;  3AYU A;  2W13 A;  4DV8 A;  2OY4 A;  4PKT A;  2FV5 A;  3ZXH A;  3KEJ A;  5JMY A;  3LUM A;  2TCL A;  4JA1 A;  4DPE A;  5I3M A;  4JPA A;  3KEK A;  4JP4 A;  1EAK A;  3HDA P;  1YQY A;  4XCT A;  1CGF A;  2WO9 A;  1JJ9 A;  5D1S A;  1BKC A;  2YIG A;  1A85 A;  966C A;  1GE6 A;  2DW2 A;  3LGP A;  2X3B A;  2OXW A;  2CLT A;  3EHX A;  1S4B P;  3DWB A;  4GWN A;  2X7M A;  4G9L A;  5D2B A;  1UTT A;  1MMR A;  1SLM A;  2DDF A;  3OHL A;  3O2X A;  1C8T A;  1HFS A;  2OY2 A;  4AIG A;  1D8M A;  1FM1 A;  1UMS A;  1Q3A A;  5BOT A;  3LIK A;  1KBC A;  1JIZ A;  2POJ A;  2E3X A;  1FBL A;  1BSW A;  1BIW A;  3AYK A;  4PKS A;  2JT5 A;  1ZTQ A;  4QKZ A;  1ATL A;  1D7X A;  1DTH A;  1IAG A;  3SHI A;  3K7N A;  2J0T A;  1R54 A;  3P1V A;  2W15 A;  3F17 A;  4JIJ A;  3I7I A;  1GXD A;  1AST A;  1IAE A;  1OM7 A;  1HFC A;  4GR8 A;  830C A;  2MZH A;  2A8H A;  1SAT A;  2MLR A;  1J7N A;  1JK3 A;  4FXY P;  2MZE A;  4G0D A;  1JAO A;  2X3C A;  3DSL A;  3ELM A;  3WV1 A;  4XBH A;  1IAC A;  3GBO A;  2ERQ A;  1GE5 A;  3KEC A;  1ZP5 A;  3HY7 A;  2PJT A;  1K7I A;  1KAP P;  4FVL A;  4H1Q A;  1DMT A;  3N2V A;  1QJI A;  1HV5 A;  1KUG A;  2YB9 A;  4R3V A;  1BUV M;  1ZS0 A;  1A86 A;  1IAA A;  4IN9 A;  3KMC A;  5CXA A;  2WO8 A;  1OS2 A;  3TVC A;  5LAB A;  4I35 A;  4AXQ A;  4WZV A;  3VTG A;  3E8R A;  1ZXC A;  1G12 A;  2FV9 A;  3KWV C;  1PWU A;  2XS3 A;  1C7K A;  3EDG A;  2JSD A;  1RM8 A;  4WKE A;  1OM8 A;  2J83 A;  1G49 A;  1GE7 A;  1QIB A;  2V4B A;  3MA2 A;  4JQG A;  456C A;  3LIL A;  3L0T A;  1EB6 A;  1R1I A;  1OM6 A;  4AYK A;  3LQB A;  2N8R A;  4GF1 A;  1XFV A;  1CIZ A;  3LK8 A;  4PKR A;  3HYG A;  3B8Z A;  3LKA A;  5B5P A;  4ZR5 A;  1USN A;  2JT6 A;  4PKW A;  1SRP A;  2Z2D A;  3V96 B;  4H84 A;  1OO9 A;  1BM6 A;  3LJG A;  2HU6 A;  5BPA A;  3DL1 A;  1MNC A;  3Q2G A;  1GO8 P;  4H30 A;  5D1U A;  3F18 A;  1Y93 A;  5I2Z A;  1EUB A;  1XFU A;  2OI0 A;  4IUW A;  4L6T A;  4FU4 A;  1XUR A;  1WNI A;  1JAQ A;  1OS9 A;  3EDZ A;  1R55 A;  4ON1 A;  5D7W A;  4WK7 A;  1BKC I;  2ERP A;  1IAB A;  1XUC A;  4H49 A;  3CKI A;  1BQQ M;  4IJO A;  1XFW A;  1XUD A;  3BA0 A;  1MMP A;  1Y0V A;  2OXU A;  1D8F A;  2ERO A;  3P24 A;  3U1R A;  1CK7 A; 
#chains in the Genus database with same CATH topology
 2LB6 A;  5IXG A;  1GKD A;  5EDC A;  2DW1 A;  5B3M O;  1R1J A;  1NC9 A;  1I04 A;  1VWE B;  3WBG A;  1MX7 A;  4ZHF A;  3PP6 A;  1SRJ A;  2GTF X;  4L63 A;  1VWM B;  2K23 A;  2FR3 A;  4XMD A;  2R73 A;  4YFR A;  1NP4 A;  3CMP A;  4Z2V A;  1QJJ A;  3BX8 A;  1AB0 A;  1CBQ A;  2WSJ A;  4O3X B;  2L0R A;  3EWJ A;  1G05 A;  3TT4 A;  2L68 A;  3VI1 A;  4A3W A;  3SOT A;  4DCB A;  4PKV A;  1GKA A;  2HYS A;  3WJC A;  3NQK A;  2OVZ A;  2X46 A;  1SA8 A;  3FDC A;  3P6G A;  3AIG A;  1X8U A;  3FIQ A;  5D48 A;  3OE3 A;  4DF9 A;  1L6M A;  3KME A;  2WR6 A;  3SLT A;  1HTD A;  1XFY A;  4N7D A;  4OS8 A;  3RZY A;  2RTC B;  1PWQ A;  3B2H A;  2PY1 A;  2I47 A;  2I5V O;  1H91 A;  4BOE A;  3GAQ A;  4AZN A;  4LZV A;  1GXA A;  4GR0 A;  3L4R A;  3T6F A;  4Z2P A;  5CZM A;  4AZR A;  3F16 A;  1YWA A;  2CZT A;  3ZZV A;  3DNG A;  4HMA A;  1CBI A;  1H71 P;  2SRT A;  2Q9S A;  4ORS A;  2WQA E;  1EW3 A;  4ARH A;  3WOV A;  2OYB O;  4NYQ A;  4XMC A;  1KUH A;  3PEC A;  4A8Z A;  1KUK A;  2YUF A;  1JJJ A;  3NX7 A;  3N2U A;  3LMC A;  3BY0 A;  1GX8 A;  5D1T A;  3RE6 A;  1NQM A;  4EFS A;  1SWG A;  3OBL A;  3T2W A;  1GO7 P;  1SMP A;  3VG3 A;  3LEA A;  4CPF A;  2NNE A;  2AIG P;  2JGS A;  5HZ6 A;  2VFB A;  4IAW A;  1Y8J A;  2FGS A;  2E4J A;  2X3A A;  5F2B A;  1TW4 A;  3OJY C;  5F58 A;  2IZF B;  3EYC A;  3Q6L A;  1VWO B;  2QOS C;  3VHH A;  1MMQ A;  1SRH A;  1DF8 A;  1OPB A;  2X8T A;  4H76 A;  1IFB A;  4O3Y A;  3PQU A;  3LJZ A;  1YP1 A;  5I12 A;  4ES7 A;  4FBR A;  1O0T A;  2FR2 A;  1G9K A;  4JNJ A;  1E06 A;  2A3F X;  4QNI A;  2RJQ A;  2W12 A;  3ZW2 A;  5HCD C;  3NR3 A;  2QM9 A;  4YKM A;  3B2K A;  3FR5 A;  1IJ8 A;  1D5J A;  1VYG A;  2JIH A;  4EKV A;  1LCW A;  2FV5 A;  4TLJ A;  2ASN X;  1TOU A;  3ZXH A;  1W4T A;  2RTD B;  5JMY A;  3AEH A;  3LUM A;  1HXZ A;  4DQ3 A;  2FLJ A;  2XST A;  4PJ2 A;  4JPA A;  5KIC A;  5H9L A;  2FWV A;  3H3I A;  1YQY A;  4XCT A;  1STR B;  4I60 A;  1CGF A;  3RDQ A;  1JBH A;  5IRU A;  2CLT A;  2FS6 A;  4BBO A;  4GJS A;  2DJF A;  5D2B A;  2RTO B;  3KFG A;  1GX3 A;  1VYO A;  5FQ7 E;  4HFO A;  1SLF B;  3D9W A;  1Y9L A;  1VWN B;  1YWC A;  1AEL A;  4TNN A;  4O3Z A;  1MVG A;  4WFV A;  4DNE A;  4MVI A;  1HFS A;  1ALB A;  4O4S A;  1LF7 A;  4A1Y A;  5BYP A;  1SLE B;  1N43 A;  1Q3A A;  4GGR A;  1DZP A;  1JIZ A;  1GM6 A;  1MUP A;  4GGT A;  3G7X A;  4Z2O A;  3ZW0 B;  4ZR2 A;  2JT5 A;  3B2L A;  2QO6 A;  4ORR A;  1ZTQ A;  4QKZ A;  3HWE A;  4BX6 B;  1ATL A;  1D7X A;  1IAG A;  2OY7 A;  2YG2 A;  1VWF B;  5EDB A;  3F17 A;  2JMB A;  2IZH B;  1GGL A;  2ACO A;  1AST A;  1IFC A;  2MM3 A;  1HFC A;  5HZ9 A;  1N7Y A;  2MZH A;  1SAT A;  2MLR A;  1D3S A;  2X3C A;  3DSL A;  4O4O A;  1O1V A;  2GJ5 A;  4XBH A;  2IFB A;  2BHV A;  2NP1 A;  3RDO A;  3HY7 A;  3FLL A;  1LIB A;  1RXH A;  3TGB A;  2CZU A;  5EPQ A;  3WJB A;  3ZUI A;  1KUG A;  5LJH A;  4HWM A;  4KT5 A;  2W2B A;  3FMZ A;  2KW1 A;  4IN9 A;  5CXA A;  1VWQ B;  1SRI A;  2AT0 X;  2IZL B;  5LAB A;  3FA9 A;  4M6S A;  1SXY A;  1G12 A;  3I0A A;  1HBQ A;  2XS3 A;  5L8N A;  2WEW A;  4ZHG A;  1P6P A;  1C7K A;  3EDG A;  1BLR A;  4U8U O;  2V4B A;  1LDO A;  5EED A;  3MA2 A;  1A3Y A;  1T68 X;  4Y0S A;  1TVQ A;  3CR6 A;  1OBU A;  4YCE A;  4CSB A;  1SLG B;  2AF5 A;  3RWX A;  3P02 A;  3ZW1 A;  2MF6 A;  1O8V A;  3WZQ A;  1RXK A;  3O22 A;  1BSY A;  3HYG A;  1LEL A;  2CM4 A;  2QO5 A;  4LZU A;  3UEU A;  1JMZ A;  1FEM A;  1QAB E;  1AVE A;  4AZO A;  1ERB A;  4IB6 A;  2RTB B;  1SWH A;  4EDE A;  5DPQ A;  1OO9 A;  1BM6 A;  3HOL A;  5BPA A;  3RDU A;  5CHK A;  3AKM A;  1LFO A;  4H30 A;  4A60 A;  5I2Z A;  1OEK A;  2RTH B;  1XFU A;  1E2T A;  2RN4 A;  1ZNH A;  1MX8 A;  1KOI A;  2WWP A;  4ON1 A;  5IRA A;  2OVD A;  5HA0 A;  2ERP A;  3HOE A;  2C4I A;  1XUD A;  4HPD A;  1N4J A;  2YMS A;  4O49 A;  1KT4 A;  3P24 A;  4GK9 A;  4K19 A;  1CK7 A;  2MO5 A;  4Y0Q A;  4ZCB A;  1KL4 A;  1BBP A;  3BLG A;  4DD8 A;  2MZI A;  3TSK A;  1BKC E;  1BEB A;  1LKE A;  3LQ0 A;  4MEE A;  1URE A;  3T2X A;  1UYN X;  1OEJ A;  1RMZ A;  3DPE A;  3LHN A;  3TZS A;  2EU7 X;  5FFH A;  4U46 A;  5B5F A;  1CXV A;  4IMO A;  1YWD A;  3LE9 A;  4YGZ A;  2Q2M A;  3B2Z A;  3KHI A;  3VU1 A;  1X8Q A;  5L7F A;  5AJC A;  2QO4 A;  4CDD A;  1SWL A;  3BU9 A;  1MDC A;  1BRP A;  1PM1 X;  4H3X A;  2Y6C A;  4A7B A;  3D4R A;  1NGL A;  3EC5 A;  3NPO A;  4RUN A;  2WOA A;  1YCM A;  1OEE A;  1VWP B;  3HBU P;  4GQL A;  4COT A;  4GUZ A;  3FEN A;  5CUH A;  2FHL A;  4J4M A;  3RTS A;  5B5G A;  4OKA A;  1D2U A;  2A2U A;  5B5O A;  3SZJ A;  1AYK A;  4ORU A;  1O0Q A;  3X00 A;  3USN A;  2KRJ A;  3FW5 A;  2AMM X;  4L19 A;  1JYD A;  2OVE A;  2BSZ A;  4WBK A;  3FEP A;  1KT6 A;  2UZ2 A;  1B8Y A;  3NQ3 A;  3B92 A;  1ZVX A;  3EDH A;  2OVX A;  4AZQ A;  1ADL A;  1JIW I;  3O19 A;  3RY2 A;  3VE2 A;  1KXO A;  4YVB A;  1SY2 A;  5I0L A;  1KUF A;  4YFP A;  2GTL M;  1OBP A;  4PKQ A;  1ROS A;  2MWH A;  4ZHH A;  5I43 A;  2X45 A;  1LUQ A;  2O36 A;  4QYN A;  3LJT A;  5B11 O;  3LUN A;  4TJZ A;  1Y55 X;  4YDA A;  3F19 A;  2OY1 O;  2W2A A;  3JS1 A;  3F1A A;  4ZFX A;  1XCA A;  2RJP A;  3EDI A;  1PWW A;  4NV7 A;  1KT7 A;  3CQR A;  1SY3 A;  1CAQ A;  1XFX A;  1QY0 A;  1BJ7 A;  4HX3 A;  3CBS A;  2JNP A;  1SY0 A;  1EQD A;  1SWD A;  1IAD A;  1HXL A;  1BSQ A;  3WYQ A;  1SWQ A;  1SRG A;  1BUD A;  5HTD A;  1NBX A;  5HBS A;  4U8U N;  4BX7 B;  3WZP A;  4Y0P A;  1XFZ A;  5L79 A;  1I76 A;  4N7C A;  1G4K A;  3HWF A;  4YCH A;  3HK1 A;  4WKI A;  1LID A;  4GUY A;  4NW4 A;  4HPC A;  3ELX A;  4ZGU A;  3AYU A;  3D97 A;  5AJB A;  4UU2 A;  4JGL A;  4PKT A;  2IZE B;  4GDZ A;  3WYP A;  4CPH B;  1KZX A;  2TCL A;  3NX1 A;  1IIU A;  2RTP B;  1VWA B;  4JP4 A;  1EAK A;  5H9N A;  1KGL A;  2LA7 A;  4FQB B;  1JJ9 A;  1LPJ A;  2NNQ A;  4M7M A;  4IB8 A;  5D1S A;  4Y59 A;  1BKC A;  2YIG A;  1EPB A;  3FW4 A;  1A85 A;  4IMN A;  4ZH9 A;  2OXW A;  5L8O A;  3VGW A;  3KQ0 A;  1WBI A;  3CQN A;  1SLD B;  1Y9T A;  2Z4I A;  4TKB A;  1CBS A;  5HTE A;  3WZN A;  3UAQ A;  1SWO A;  3MM0 A;  2MJI A;  1MMR A;  3P6H A;  3O2X A;  4AIG A;  2CAM A;  1FM1 A;  1SWS A;  2GTL N;  4ZJ0 A;  3P6F A;  5BOT A;  2POJ A;  5IO5 A;  1NP1 A;  3S5V A;  1VWD B;  1BSW A;  4CDE A;  4ML7 B;  3EBK A;  4QZT A;  3FA7 A;  1U18 A;  1DTH A;  1DFV A;  1VWC B;  3K7N A;  1SWU A;  1FDQ A;  2HLV A;  1IAE A;  2ZAG A;  1OZ9 A;  3KVN A;  2A8H A;  1SWE A;  4YGH A;  4QRL A;  3SAO A;  1GE5 A;  2KT4 B;  1SWA A;  1PBO A;  4YFQ A;  4PSQ A;  4ORW A;  3N2V A;  2OY5 O;  3HPE A;  1SWB A;  4R3V A;  1RBP A;  5KID A;  1A86 A;  4ALB A;  3VE1 A;  1OS2 A;  1LIF A;  2RTQ B;  1KL3 A;  4MVK A;  2Q4N A;  1X8N A;  4WZV A;  1SWN A;  5EEE A;  4IAB A;  3E8R A;  4EXZ A;  1ZXC A;  4IB7 A;  4D6A A;  3KWV C;  2AT6 X;  2KTD A;  2DM5 A;  1DZJ A;  2G5L A;  5L8I A;  4BGF A;  2F01 A;  3UEV A;  1RM8 A;  4WKE A;  1OM8 A;  1IW2 A;  2OY8 A;  5LKE A;  3LIL A;  3LQB A;  4GF1 A;  2IZJ A;  2G8C O;  2ZSC A;  5D8J A;  1XFV A;  1SY1 A;  1VWK B;  3LK8 A;  5AQ6 A;  2X34 A;  5HZ5 A;  3STK A;  4U9C A;  1HN2 A;  3B8Z A;  1SWJ A;  1HMR A;  1SRP A;  1PTS A;  5H9K A;  3ZUO A;  4WFU A;  2GH7 A;  2RTN B;  3V96 B;  2WPU A;  3GE2 A;  4H84 A;  3RDS A;  2JU3 A;  2AKQ A;  4XMF A;  3VPJ E;  5K67 A;  3DL1 A;  4MVL A;  5D1U A;  1Y93 A;  1EUB A;  2C1Q A;  4UU3 A;  5DG4 A;  5BVS A;  3FR2 A;  3FA6 A;  2OVS A;  1CBR A;  4ALO A;  4FU4 A;  2IZA A;  1XUR A;  1WNI A;  1JAQ A;  1I06 A;  2AT5 X;  2F73 A;  3U0D A;  2RCQ A;  3APV A;  4C5P A;  5D7W A;  5HZQ A;  5JD2 A;  3QKG A;  3IFB A;  4FBV A;  5D47 A;  3ZWE A;  4L3R A;  1KT5 A;  2G78 A;  3BA0 A;  1LIC A;  3WJE A;  2OXU A;  5LJG A;  2JU8 A;  2OFR X;  4B55 A;  4GE1 A;  2ERO A;  4I3D A;  3QQ2 A;  1S2P A;  3SZH A;  5AEO A;  4CV7 A;  2RA6 A;  1ZXV A;  2HZQ A;  4OS0 A;  4BVM A;  1UMT A;  4Q1L A;  1SWC A;  4I95 A;  2Y32 A;  2W0D A;  1I05 A;  3HB2 P;  1E02 A;  5CSE A;  1VWR B;  3N91 A;  5IO6 A;  1HOV A;  3EW2 A;  1ND1 A;  2A5B A;  5I4O A;  5EZ2 A;  4BCS A;  5F6B A;  4IBA A;  3EBW A;  1VPR A;  4OS3 A;  4GWM A;  4ZGF A;  3PED A;  4ODD A;  3MVF A;  1U0X A;  1W6F A;  3OHO A;  5KHP A;  2JU7 A;  1YP6 A;  2QPJ A;  3DTE A;  1QIC A;  4EEJ A;  5H8T A;  2AT8 X;  4CPE A;  1ML7 A;  3PQS A;  3G42 A;  3ELZ A;  3APU A;  3RKG A;  3AUM O;  5LJC A;  4GD9 A;  3UEW A;  2K9C A;  3ZW0 A;  1GT1 A;  2BC3 A;  2AYK A;  1HMT A;  4BX6 A;  4AZP A;  1NDJ A;  3G5C A;  1QFV A;  2D1N A;  2VFC A;  2FT9 A;  5D4A A;  2HZR A;  3SLO A;  3HTY A;  4CK4 A;  4I03 A;  3TGA A;  3HDB A;  1EII A;  4GGZ A;  4NV8 A;  1B56 A;  1FEN A;  2USN A;  4L1N A;  1PWP A;  3S26 A;  2OZR A;  1XKI A;  2R74 A;  4IRW A;  1JH1 A;  4JHQ A;  1QIA A;  3SLJ A;  5H8X A;  2D1O A;  1DZK A;  1I1I P;  4FXQ A;  2Y6D A;  1HMS A;  1Z24 A;  3KRY A;  3BX7 A;  3D96 A;  3I7G A;  3EHY A;  1B3D A;  3NAD A;  5D45 A;  1AF0 A;  3UEX A;  1I78 A;  1K7Q A;  2RCT A;  2RTJ A;  2XKL A;  1Y53 X;  3RTT A;  2X56 A;  5HAE A;  2BS6 A;  2ACP X;  1SWT A;  4OMW A;  1X71 A;  4QGW A;  2RTF B;  1B4M A;  4EQA C;  2UYW A;  2FRS A;  1UYO X;  3NQ9 A;  2OZQ A;  1UTZ A;  2OXZ A;  4I3C A;  4XM8 A;  3Q34 A;  3ZVS A;  3JSQ A;  1BQO A;  1DZM A;  5FAZ A;  2OW2 A;  4U8U M;  2DDY A;  1UEA A;  1BZS A;  1YOU A;  2RTA A;  1CGL A;  2E2D A;  1XM5 A;  2IZG B;  2AT3 X;  3TF6 A;  5D3C A;  3WXQ A;  5BOY A;  3RDM A;  4H82 A;  2A8G A;  2F09 A;  2OW0 A;  4INN A;  4AUO A;  3L0V A;  4CPI A;  2X8S A;  4O3W A;  1KUI A;  1STS B;  4CDF A;  1WUB A;  3BRN A;  4DV8 A;  1RAV A;  5K06 A;  2JOZ A;  4NLJ A;  1JZU A;  1A2D A;  2FKG A;  1A18 A;  3CKF A;  3VG2 A;  4BX5 B;  4L7A A;  2OL7 A;  2X55 A;  5B10 O;  1SWR A;  1NQN A;  2AVI A;  3MG5 A;  3KEK A;  2POA A;  2WO9 A;  5K68 A;  2OFB A;  1I9H A;  1QWD A;  4XMH A;  3C76 X;  966C A;  2A0A A;  2OF8 A;  2BT9 A;  3LGP A;  1ICN A;  2X3B A;  1G7N A;  1X8P A;  3EHX A;  3DWB A;  4O4X A;  5HA1 A;  1FJ1 E;  2X7M A;  4G9L A;  1EXS A;  2RTE B;  2C1S A;  1UTT A;  1GT5 A;  1SLM A;  4A1H A;  1GKA B;  2DDF A;  1AQB A;  3WZO A;  1VWH B;  1C8T A;  2OY2 A;  1FE3 A;  5F7G A;  1VWL B;  1SWP A;  2DJG A;  1X89 A;  3LIK A;  1KBC A;  3AYK A;  3D95 A;  3B2J A;  4ORX A;  2W2F A;  3SHI A;  3ZQ3 A;  1G85 A;  3I7I A;  1GXD A;  3RBY A;  1OM7 A;  3VG7 A;  4BX5 A;  1Y0G A;  3CBC A;  1UZ2 X;  1MOY A;  830C A;  4Z28 A;  1I4U A;  1ZNL A;  3JQO A;  1J7N A;  4FXY P;  2MZE A;  4G0D A;  1JAO A;  2OFM X;  3ELM A;  3WV1 A;  2A2G A;  1IAC A;  2ERQ A;  1BWY A;  4IAX A;  3RY1 A;  3KEC A;  1ZP5 A;  2JW1 A;  1GT4 A;  2HKD A;  4H1Q A;  1KAP P;  4AW8 A;  5LKF A;  3RSW A;  4YBP A;  1SMP I;  3F8A A;  2YB9 A;  2VDF A;  2OVA A;  1BUV M;  1ZS0 A;  1IAA A;  3KMC A;  3RDX A;  3VHI A;  1QFT A;  2Y3F A;  3S60 A;  4ID2 A;  3ZI8 A;  2HNX A;  1R0U A;  3IA8 A;  1OSP O;  2R56 A;  2X32 A;  5B29 A;  1YP7 A;  1PWU A;  3CWK A;  2BLG A;  2J83 A;  1G49 A;  4YDB A;  2HMB A;  4R0B A;  2G79 A;  1QIB A;  2LFO A;  4JQG A;  4GKC A;  456C A;  1HQQ A;  1QQS A;  1EB6 A;  1R1I A;  2QOM A;  1OM6 A;  1STP A;  2Y3E A;  5HCC C;  1ZND A;  1FEL A;  4MVE A;  1SRE A;  2IZK A;  3SZI A;  1CIZ A;  3I17 A;  1ACD A;  1CRB A;  4GET A;  4OEL A;  3LKA A;  3E3C A;  4FBO A;  5HZ8 A;  1USN A;  5B5P A;  1N9Y A;  2Z2D A;  5JR8 A;  5LJE A;  1E00 A;  4KCA A;  5BVQ A;  4I6S A;  1ERX A;  4EFG A;  3LJG A;  2RTI B;  2HU6 A;  4Y5D A;  4BX7 A;  3Q2G A;  1GO8 P;  4Y0R A;  5BVT A;  4BQU A;  1RSU B;  2OI0 A;  4IUW A;  4KII A;  4L6T A;  1R55 A;  3FEL A;  3P6E A;  1EAL A;  1IAB A;  1PEE A;  1XUC A;  4H49 A;  3CKI A;  1BQQ M;  4IJO A;  1XFW A;  2RQ0 A;  3BDR A;  5F1E A;  1D8F A;  4IB9 A;  4CPH A;  3U1R A;  1XAX A;  4WHI A;  5HCE C;  4GNW A;  2WQ9 A;  3DTQ A;  1SXX A;  1N0S A;  2O3E A;  1ZNE A;  3HWG A;  3MBT A;  3DSZ A;  4I9R A;  4QQ1 A;  4ZHD A;  3PPT A;  1SU3 A;  1TVI A;  1KQW A;  1W5R A;  3VG6 A;  4I3B A;  3TGC A;  4PKU A;  1DV9 A;  2OFA A;  1LCZ A;  4GR3 A;  4NNS A;  3PH6 A;  2CBR A;  5B27 A;  3FYF A;  1S44 A;  4GZV A;  4D6B A;  3DTI A;  3EW1 A;  1GX9 A;  4NYR A;  2ANS A;  2FHN X;  3KFH A;  1JKY A;  1RXJ A;  4MIS A;  1MM9 A;  1TXL A;  2AL0 X;  1CQR A;  3F15 A;  4AYH A;  1O1U A;  2OW1 A;  1CGE A;  3WJD A;  2RTG B;  1QG5 A;  1JIW P;  1L6J A;  1PMP A;  1PWV A;  4O9S A;  4I9S A;  1A57 A;  2W14 A;  5C0N A;  4XME A;  1JAP A;  1JV4 A;  1VYF A;  5LJB A;  1GKC A;  1MMB A;  4JO6 A;  4KC8 A;  3RE5 A;  2JN3 A;  3PK2 A;  2LBA A;  1JYJ A;  1K24 A;  2WUT A;  1U17 A;  2Q39 A;  3VG5 A;  3O2Y A;  4HPA A;  3HY9 A;  4HPB A;  2LKK A;  1DF3 A;  1QUA A;  2OW9 A;  2CKI A;  3PDF A;  5FEN A;  2RTR B;  4OMX A;  2K2G A;  3T6L A;  1G74 A;  3NBX X;  1SXW A;  1EUO A;  1JJU A;  5HWZ A;  3K7L A;  1N9M A;  4GNY A;  3WVM A;  3DTK A;  4ZHC A;  4H2E A;  3F9D A;  3WV3 A;  2MLS A;  1FLS A;  3STN A;  4XM6 A;  5L3Y A;  4KC7 A;  3FA8 A;  1K7G A;  1JAN A;  1C3I A;  1X8O A;  3EMM A;  2G7B A;  1R1H A;  2N93 A;  1HQP A;  3ZUK A;  1VWI B;  4YKO A;  1HY7 A;  1K3B A;  2DW0 A;  3HBV P;  2I5Z O;  2KTS A;  1KQX A;  3KFF A;  4CTH A;  3LTW A;  3UVC A;  1HY2 A;  4OEM A;  3LIR A;  4WF6 A;  1PBY A;  3TS4 A;  4AZM A;  1AKL A;  3ZW1 B;  1Z3J A;  4DQ4 A;  3WJG A;  4ILW D;  2K62 A;  1EPA A;  3O64 A;  4XM7 A;  4LQZ A;  3WV2 A;  1VWB B;  5IRW A;  1SLN A;  1RST B;  2OF9 A;  3FEK A;  4U3Q A;  2Z4H A;  2XS4 A;  4MIR A;  1MEP A;  2AH7 X;  1BM5 A;  3Q2H A;  1OMJ A;  2RD7 C;  4KH8 A;  1I73 A;  3DPF A;  2W13 A;  2OY4 A;  1SRF A;  3P6C A;  2ZAI A;  1LIE A;  5B2A O;  2FTB A;  4YGG A;  4FGI B;  1DC9 A;  2IZI A;  4QGV A;  2QMI A;  3KEJ A;  2FKJ A;  3LV4 A;  4JA1 A;  4DPE A;  5I3M A;  1IKE A;  3HDA P;  4YMY A;  1OPA A;  4TQ2 A;  2OL8 O;  5CYB A;  2GC9 A;  1JQP A;  1E5P A;  4NNT A;  5FQ6 E;  2ALL X;  2WEX A;  1GE6 A;  2DW2 A;  1SXU A;  4NP1 A;  1SWF A;  1YUP A;  2MHD A;  1S4B P;  3WJF A;  4GWN A;  3F6Z B;  2L67 A;  1MK5 A;  4YH0 A;  3BS2 A;  1VWG B;  4GH7 A;  1RLB E;  4TKH A;  1KZW A;  1BRQ A;  1T0V A;  3OHL A;  3APX A;  1ZRY A;  5LJD A;  1D8M A;  4GU8 A;  1UMS A;  1GT3 A;  2PI3 O;  2A5C A;  3OD9 A;  3KFI A;  2E3X A;  1SWK A;  3NX2 A;  3U9P C;  1FBL A;  3C77 X;  1BIW A;  2Q2P A;  4PKS A;  1LCV A;  2QCB A;  2BS5 A;  3FID A;  4LKP A;  2M4L A;  3APW A;  2J0T A;  1R54 A;  4Z6J A;  3P1V A;  2W15 A;  2LBV A;  2RTK A;  4JIJ A;  1KL5 A;  3K3L A;  2IZC B;  2RTL A;  2L5P A;  4GR8 A;  4QGX A;  1JK3 A;  5IO7 A;  4TKJ A;  3C78 X;  2CBS A;  2CM9 A;  4ORY A;  1YIV A;  1AVD A;  1KT3 A;  1B0O A;  1LNM A;  3GBO A;  2A13 A;  4RUU A;  2GTL O;  1YWB A;  4NLI A;  2PJT A;  1K7I A;  4FVL A;  1DMT A;  1ICM A;  1QJI A;  2X4M A;  1IKJ A;  1HV5 A;  3U03 A;  3MX7 A;  1S7D A;  3VHM A;  3BU1 A;  3NP1 A;  4O4U A;  3V8U A;  1CJ5 A;  1ZNG A;  2WO8 A;  3TVC A;  1G5W A;  2OL6 O;  4I35 A;  4GDA A;  4AXQ A;  1JMX A;  3VTG A;  2FV9 A;  3PH5 A;  2L9C A;  5H9A A;  4GRJ A;  2JSD A;  2FS7 A;  4YBU A;  1ZNK A;  1VWJ B;  1GE7 A;  1BSO A;  1KFF A;  3L0T A;  3T1D A;  4AYK A;  3P6D A;  3BSZ E;  2N8R A;  1OBQ A;  1T8V A;  4QZU A;  3S5X A;  3KZA A;  2P8G A;  4GJV A;  4PKR A;  1FTP A;  4QYP A;  1LDQ A;  1HBP A;  4ZR5 A;  2JT6 A;  4PKW A;  4XMG A;  3AKN A;  1TOW A;  3HWD A;  1EI5 A;  1QY1 A;  5LJK A;  3STM X;  4LKT A;  2X8F A;  1B8E A;  4Z27 A;  3FR4 A;  1QY2 A;  1EIO A;  3EM0 A;  4CDC A;  1MNC A;  2NND A;  3F18 A;  3CKG A;  2IZD B;  3VG4 A;  2KD2 A;  1Y52 X;  2IZB A;  4ZH6 A;  1OS9 A;  3EDZ A;  4WK7 A;  3B2I A;  5F6Z A;  1BKC I;  5CE4 A;  1AVG I;  1MMP A;  1Y0V A;  1JJX A;  4QAE A;  5FQ8 E;  2O62 A;  2RTM A;  4BJ8 A; 
#chains in the Genus database with same CATH homology
 2LB6 A;  1GKD A;  5EDC A;  2DW1 A;  1R1J A;  1I04 A;  3WBG A;  1MX7 A;  4ZHF A;  3PP6 A;  2GTF X;  4L63 A;  2K23 A;  2FR3 A;  4XMD A;  2R73 A;  4YFR A;  1NP4 A;  3CMP A;  1QJJ A;  3BX8 A;  1AB0 A;  1CBQ A;  2WSJ A;  4O3X B;  2L0R A;  3EWJ A;  1G05 A;  3TT4 A;  2L68 A;  3VI1 A;  4A3W A;  3SOT A;  4PKV A;  1GKA A;  2HYS A;  3WJC A;  3NQK A;  2OVZ A;  2X46 A;  1SA8 A;  3P6G A;  3AIG A;  1X8U A;  3FIQ A;  5D48 A;  3OE3 A;  4DF9 A;  1L6M A;  3KME A;  2WR6 A;  1HTD A;  1XFY A;  4N7D A;  4OS8 A;  3RZY A;  1PWQ A;  3B2H A;  2PY1 A;  2I47 A;  1H91 A;  4BOE A;  3GAQ A;  4AZN A;  4LZV A;  1GXA A;  4GR0 A;  3L4R A;  5CZM A;  4AZR A;  3F16 A;  1YWA A;  2CZT A;  3ZZV A;  3DNG A;  4HMA A;  1CBI A;  1H71 P;  2SRT A;  2Q9S A;  4ORS A;  2WQA E;  1EW3 A;  4ARH A;  3WOV A;  4NYQ A;  4XMC A;  1KUH A;  3PEC A;  4A8Z A;  1KUK A;  2YUF A;  1JJJ A;  3NX7 A;  3N2U A;  3LMC A;  3BY0 A;  1GX8 A;  5D1T A;  4EFS A;  3OBL A;  1GO7 P;  1SMP A;  3VG3 A;  3LEA A;  2NNE A;  2AIG P;  5HZ6 A;  4IAW A;  1Y8J A;  2E4J A;  2X3A A;  1TW4 A;  3OJY C;  5F58 A;  3EYC A;  3Q6L A;  2QOS C;  1MMQ A;  1OPB A;  2X8T A;  4H76 A;  1IFB A;  4O3Y A;  3PQU A;  3LJZ A;  1YP1 A;  5I12 A;  4ES7 A;  4FBR A;  1O0T A;  2FR2 A;  1G9K A;  1E06 A;  2A3F X;  4QNI A;  2RJQ A;  2W12 A;  3ZW2 A;  5HCD C;  3NR3 A;  2QM9 A;  4YKM A;  3B2K A;  3FR5 A;  1D5J A;  1VYG A;  2JIH A;  2FV5 A;  4TLJ A;  2ASN X;  1TOU A;  3ZXH A;  5JMY A;  3LUM A;  4DQ3 A;  2FLJ A;  2XST A;  4PJ2 A;  4JPA A;  5KIC A;  5H9L A;  2FWV A;  3H3I A;  1YQY A;  4XCT A;  1CGF A;  1JBH A;  2CLT A;  2FS6 A;  5D2B A;  3KFG A;  5FQ7 E;  4HFO A;  1Y9L A;  1AEL A;  1YWC A;  4TNN A;  4O3Z A;  1MVG A;  4WFV A;  4MVI A;  1HFS A;  1ALB A;  4O4S A;  1LF7 A;  4A1Y A;  5BYP A;  1Q3A A;  1DZP A;  1JIZ A;  1GM6 A;  1MUP A;  3G7X A;  3ZW0 B;  4ZR2 A;  2JT5 A;  3B2L A;  4QKZ A;  1ZTQ A;  2QO6 A;  4ORR A;  3HWE A;  1ATL A;  1D7X A;  1IAG A;  2YG2 A;  5EDB A;  3F17 A;  2JMB A;  1GGL A;  2ACO A;  1AST A;  1IFC A;  2MM3 A;  1HFC A;  5HZ9 A;  2MZH A;  1SAT A;  2MLR A;  1D3S A;  2X3C A;  3DSL A;  4O4O A;  1O1V A;  2GJ5 A;  4XBH A;  2IFB A;  2BHV A;  2NP1 A;  3HY7 A;  3FLL A;  1LIB A;  3TGB A;  2CZU A;  5EPQ A;  3WJB A;  3ZUI A;  1KUG A;  5LJH A;  4HWM A;  4KT5 A;  2W2B A;  3FMZ A;  2KW1 A;  4IN9 A;  5CXA A;  2AT0 X;  5LAB A;  3FA9 A;  4M6S A;  1SXY A;  1G12 A;  3I0A A;  1HBQ A;  2XS3 A;  5L8N A;  2WEW A;  4ZHG A;  1P6P A;  1C7K A;  3EDG A;  1BLR A;  4U8U O;  2V4B A;  3MA2 A;  5EED A;  1A3Y A;  1T68 X;  4Y0S A;  1TVQ A;  3CR6 A;  1OBU A;  4YCE A;  4CSB A;  3RWX A;  3P02 A;  3ZW1 A;  1O8V A;  3O22 A;  1BSY A;  3HYG A;  2CM4 A;  2QO5 A;  4LZU A;  3UEU A;  1FEM A;  1QAB E;  4AZO A;  1ERB A;  4IB6 A;  4EDE A;  5DPQ A;  1OO9 A;  1BM6 A;  3HOL A;  5BPA A;  3AKM A;  1LFO A;  4H30 A;  4A60 A;  5I2Z A;  1OEK A;  1XFU A;  2RN4 A;  1ZNH A;  1MX8 A;  1KOI A;  2WWP A;  4ON1 A;  2OVD A;  5HA0 A;  2ERP A;  3HOE A;  1XUD A;  4HPD A;  2YMS A;  4O49 A;  1KT4 A;  3P24 A;  4GK9 A;  4K19 A;  1CK7 A;  2MO5 A;  4Y0Q A;  4ZCB A;  1BBP A;  3BLG A;  4DD8 A;  2MZI A;  3TSK A;  1BKC E;  1BEB A;  1LKE A;  3LQ0 A;  1URE A;  1OEJ A;  1RMZ A;  3DPE A;  3LHN A;  3TZS A;  2EU7 X;  5FFH A;  1CXV A;  4IMO A;  1YWD A;  3LE9 A;  4YGZ A;  2Q2M A;  3B2Z A;  3KHI A;  3VU1 A;  1X8Q A;  5L7F A;  5AJC A;  2QO4 A;  3BU9 A;  1MDC A;  1BRP A;  1PM1 X;  4H3X A;  2Y6C A;  4A7B A;  3D4R A;  1NGL A;  3NPO A;  4RUN A;  2WOA A;  1YCM A;  1OEE A;  3HBU P;  4GQL A;  4COT A;  3FEN A;  5CUH A;  4J4M A;  3RTS A;  1D2U A;  2A2U A;  5B5O A;  1AYK A;  4ORU A;  1O0Q A;  3USN A;  2KRJ A;  3FW5 A;  2AMM X;  4L19 A;  1JYD A;  2OVE A;  4WBK A;  3FEP A;  1KT6 A;  1B8Y A;  3NQ3 A;  3B92 A;  1ZVX A;  3EDH A;  2OVX A;  4AZQ A;  1ADL A;  1JIW I;  3O19 A;  3VE2 A;  1KXO A;  1SY2 A;  5I0L A;  1KUF A;  4YFP A;  2GTL M;  1OBP A;  4PKQ A;  1ROS A;  2MWH A;  4ZHH A;  5I43 A;  2X45 A;  2O36 A;  4QYN A;  3LJT A;  3LUN A;  4TJZ A;  4YDA A;  3F19 A;  2W2A A;  3JS1 A;  3F1A A;  4ZFX A;  1XCA A;  2RJP A;  3EDI A;  1PWW A;  1KT7 A;  3CQR A;  1SY3 A;  1CAQ A;  1XFX A;  1QY0 A;  1BJ7 A;  4HX3 A;  3CBS A;  2JNP A;  1SY0 A;  1EQD A;  1IAD A;  1BSQ A;  1BUD A;  5HTD A;  5HBS A;  4U8U N;  4Y0P A;  1XFZ A;  5L79 A;  1I76 A;  4N7C A;  1G4K A;  3HWF A;  4YCH A;  3HK1 A;  4WKI A;  1LID A;  4GUY A;  4NW4 A;  4HPC A;  3ELX A;  4ZGU A;  3AYU A;  3D97 A;  5AJB A;  4UU2 A;  4JGL A;  4PKT A;  4GDZ A;  1KZX A;  2TCL A;  3NX1 A;  1IIU A;  4JP4 A;  1EAK A;  5H9N A;  1KGL A;  2LA7 A;  4FQB B;  1JJ9 A;  1LPJ A;  2NNQ A;  4M7M A;  4IB8 A;  5D1S A;  1BKC A;  2YIG A;  1EPB A;  3FW4 A;  1A85 A;  4IMN A;  4ZH9 A;  2OXW A;  5L8O A;  3KQ0 A;  3CQN A;  1Y9T A;  2Z4I A;  4TKB A;  1CBS A;  5HTE A;  3UAQ A;  2MJI A;  1MMR A;  3P6H A;  3O2X A;  4AIG A;  1FM1 A;  2GTL N;  4ZJ0 A;  3P6F A;  5BOT A;  2POJ A;  5IO5 A;  1NP1 A;  3S5V A;  1BSW A;  4ML7 B;  3EBK A;  4QZT A;  3FA7 A;  1U18 A;  1DTH A;  1DFV A;  3K7N A;  1FDQ A;  2HLV A;  1IAE A;  2ZAG A;  2A8H A;  4YGH A;  4QRL A;  3SAO A;  1GE5 A;  2KT4 B;  1PBO A;  4YFQ A;  4PSQ A;  4ORW A;  3N2V A;  4R3V A;  1RBP A;  5KID A;  1A86 A;  4ALB A;  3VE1 A;  1OS2 A;  1LIF A;  4MVK A;  2Q4N A;  1X8N A;  4WZV A;  5EEE A;  4IAB A;  3E8R A;  4EXZ A;  1ZXC A;  4IB7 A;  3KWV C;  4D6A A;  2AT6 X;  2KTD A;  2DM5 A;  1DZJ A;  5L8I A;  3UEV A;  1RM8 A;  4WKE A;  1OM8 A;  1IW2 A;  5LKE A;  3LIL A;  3LQB A;  4GF1 A;  5D8J A;  1XFV A;  3LK8 A;  5AQ6 A;  5HZ5 A;  3STK A;  4U9C A;  1HN2 A;  3B8Z A;  1HMR A;  1SRP A;  5H9K A;  3ZUO A;  4WFU A;  3V96 B;  3GE2 A;  4H84 A;  2JU3 A;  2AKQ A;  4XMF A;  3VPJ E;  3DL1 A;  4MVL A;  5D1U A;  1Y93 A;  1EUB A;  5DG4 A;  4UU3 A;  5BVS A;  3FR2 A;  3FA6 A;  2OVS A;  1CBR A;  4ALO A;  4FU4 A;  1XUR A;  1WNI A;  1JAQ A;  1I06 A;  2AT5 X;  2F73 A;  3U0D A;  2RCQ A;  3APV A;  5D7W A;  5HZQ A;  3QKG A;  3IFB A;  4FBV A;  5D47 A;  3ZWE A;  4L3R A;  1KT5 A;  2G78 A;  3BA0 A;  1LIC A;  3WJE A;  2OXU A;  5LJG A;  2JU8 A;  2OFR X;  4GE1 A;  2ERO A;  4I3D A;  1S2P A;  5AEO A;  4CV7 A;  2RA6 A;  1ZXV A;  2HZQ A;  4OS0 A;  4BVM A;  1UMT A;  4Q1L A;  4I95 A;  2W0D A;  1I05 A;  3HB2 P;  1E02 A;  3N91 A;  5IO6 A;  1HOV A;  1ND1 A;  5I4O A;  5EZ2 A;  5F6B A;  4IBA A;  3EBW A;  1VPR A;  4OS3 A;  4GWM A;  4ZGF A;  3PED A;  4ODD A;  3MVF A;  1U0X A;  3OHO A;  5KHP A;  2JU7 A;  1YP6 A;  2QPJ A;  3DTE A;  1QIC A;  4EEJ A;  5H8T A;  2AT8 X;  1ML7 A;  3PQS A;  3G42 A;  3ELZ A;  3APU A;  3RKG A;  5LJC A;  3UEW A;  2K9C A;  3ZW0 A;  1GT1 A;  2AYK A;  1HMT A;  4AZP A;  3G5C A;  1QFV A;  2D1N A;  2FT9 A;  5D4A A;  2HZR A;  3HTY A;  4CK4 A;  4I03 A;  3TGA A;  3HDB A;  1EII A;  1B56 A;  1FEN A;  2USN A;  4L1N A;  1PWP A;  3S26 A;  2OZR A;  1XKI A;  2R74 A;  1JH1 A;  1QIA A;  5H8X A;  2D1O A;  1DZK A;  1I1I P;  4FXQ A;  2Y6D A;  1HMS A;  1Z24 A;  3KRY A;  3BX7 A;  3D96 A;  3I7G A;  3EHY A;  1B3D A;  3NAD A;  5D45 A;  1AF0 A;  3UEX A;  1K7Q A;  2RCT A;  2XKL A;  3RTT A;  5HAE A;  2BS6 A;  2ACP X;  4OMW A;  1X71 A;  4QGW A;  1B4M A;  4EQA C;  2FRS A;  3NQ9 A;  2OZQ A;  1UTZ A;  2OXZ A;  4I3C A;  4XM8 A;  3ZVS A;  3JSQ A;  1BQO A;  1DZM A;  5FAZ A;  2OW2 A;  4U8U M;  2DDY A;  1UEA A;  1BZS A;  1YOU A;  1CGL A;  2E2D A;  2AT3 X;  3TF6 A;  5D3C A;  3WXQ A;  5BOY A;  4H82 A;  2F09 A;  2OW0 A;  4INN A;  4AUO A;  3L0V A;  2X8S A;  4O3W A;  1KUI A;  3BRN A;  4DV8 A;  5K06 A;  2JOZ A;  4NLJ A;  1JZU A;  1A2D A;  1A18 A;  3VG2 A;  4L7A A;  3KEK A;  2POA A;  2WO9 A;  1QWD A;  4XMH A;  3C76 X;  966C A;  2A0A A;  2BT9 A;  3LGP A;  1ICN A;  2X3B A;  1G7N A;  1X8P A;  3EHX A;  3DWB A;  4O4X A;  5HA1 A;  2X7M A;  4G9L A;  1EXS A;  1UTT A;  1GT5 A;  1SLM A;  4A1H A;  1GKA B;  2DDF A;  1AQB A;  1C8T A;  2OY2 A;  1FE3 A;  5F7G A;  1X89 A;  3LIK A;  1KBC A;  3AYK A;  3D95 A;  3B2J A;  4ORX A;  2W2F A;  3SHI A;  3ZQ3 A;  1G85 A;  3I7I A;  1GXD A;  3RBY A;  1OM7 A;  3VG7 A;  3CBC A;  1UZ2 X;  830C A;  1I4U A;  1ZNL A;  3JQO A;  1J7N A;  4FXY P;  2MZE A;  4G0D A;  1JAO A;  2OFM X;  3ELM A;  3WV1 A;  2A2G A;  1IAC A;  2ERQ A;  1BWY A;  4IAX A;  3KEC A;  1ZP5 A;  2JW1 A;  1GT4 A;  4H1Q A;  1KAP P;  4AW8 A;  5LKF A;  3RSW A;  4YBP A;  1SMP I;  3F8A A;  2YB9 A;  2OVA A;  1BUV M;  1ZS0 A;  1IAA A;  3KMC A;  1QFT A;  3S60 A;  4ID2 A;  3ZI8 A;  2HNX A;  1R0U A;  3IA8 A;  2R56 A;  5B29 A;  1YP7 A;  1PWU A;  3CWK A;  2BLG A;  2J83 A;  1G49 A;  4YDB A;  2HMB A;  4R0B A;  2G79 A;  1QIB A;  2LFO A;  4JQG A;  4GKC A;  456C A;  1QQS A;  1EB6 A;  1R1I A;  1OM6 A;  5HCC C;  1ZND A;  1FEL A;  4MVE A;  1CIZ A;  3I17 A;  1ACD A;  1CRB A;  4GET A;  3LKA A;  3E3C A;  4FBO A;  5HZ8 A;  1USN A;  5B5P A;  2Z2D A;  5JR8 A;  5LJE A;  1E00 A;  4KCA A;  5BVQ A;  4I6S A;  1ERX A;  4EFG A;  3LJG A;  2HU6 A;  3Q2G A;  1GO8 P;  4Y0R A;  5BVT A;  4BQU A;  2OI0 A;  4IUW A;  4KII A;  4L6T A;  1R55 A;  3FEL A;  3P6E A;  1EAL A;  1IAB A;  1PEE A;  1XUC A;  4H49 A;  3CKI A;  1BQQ M;  4IJO A;  1XFW A;  2RQ0 A;  3BDR A;  5F1E A;  1D8F A;  4IB9 A;  3U1R A;  4WHI A;  5HCE C;  4GNW A;  2WQ9 A;  3DTQ A;  1SXX A;  1N0S A;  2O3E A;  1ZNE A;  3HWG A;  3MBT A;  3DSZ A;  4I9R A;  4QQ1 A;  4ZHD A;  3PPT A;  1SU3 A;  1KQW A;  3VG6 A;  4I3B A;  3TGC A;  4PKU A;  1DV9 A;  4GR3 A;  4NNS A;  3PH6 A;  2CBR A;  5B27 A;  3FYF A;  1S44 A;  4GZV A;  4D6B A;  3DTI A;  4NYR A;  1GX9 A;  2ANS A;  3KFH A;  1JKY A;  4MIS A;  1TXL A;  2AL0 X;  1CQR A;  3F15 A;  4AYH A;  1O1U A;  2OW1 A;  1CGE A;  3WJD A;  1QG5 A;  1JIW P;  1L6J A;  1PMP A;  1PWV A;  4O9S A;  4I9S A;  1A57 A;  2W14 A;  5C0N A;  4XME A;  1JAP A;  1JV4 A;  1VYF A;  5LJB A;  1GKC A;  1MMB A;  4KC8 A;  2JN3 A;  2LBA A;  1JYJ A;  2WUT A;  1U17 A;  2Q39 A;  3VG5 A;  3O2Y A;  4HPA A;  3HY9 A;  4HPB A;  2LKK A;  1DF3 A;  1QUA A;  2OW9 A;  2CKI A;  5FEN A;  4OMX A;  2K2G A;  1G74 A;  3NBX X;  1SXW A;  1EUO A;  5HWZ A;  3K7L A;  4GNY A;  3WVM A;  3DTK A;  4ZHC A;  4H2E A;  3F9D A;  3WV3 A;  2MLS A;  1FLS A;  3STN A;  4XM6 A;  4KC7 A;  3FA8 A;  1K7G A;  1JAN A;  1C3I A;  1X8O A;  3EMM A;  2G7B A;  1R1H A;  2N93 A;  1HQP A;  3ZUK A;  4YKO A;  1HY7 A;  2DW0 A;  3HBV P;  2KTS A;  1KQX A;  3KFF A;  4CTH A;  3UVC A;  3LIR A;  4WF6 A;  3TS4 A;  4AZM A;  1AKL A;  3ZW1 B;  1Z3J A;  4DQ4 A;  3WJG A;  4ILW D;  2K62 A;  1EPA A;  3O64 A;  4XM7 A;  4LQZ A;  3WV2 A;  1SLN A;  3FEK A;  4U3Q A;  2Z4H A;  2XS4 A;  4MIR A;  2AH7 X;  1BM5 A;  3Q2H A;  1OMJ A;  2RD7 C;  4KH8 A;  1I73 A;  3DPF A;  2W13 A;  2OY4 A;  3P6C A;  2ZAI A;  1LIE A;  2FTB A;  4YGG A;  4FGI B;  1DC9 A;  4QGV A;  2QMI A;  3KEJ A;  3LV4 A;  4JA1 A;  4DPE A;  5I3M A;  1IKE A;  3HDA P;  4YMY A;  1OPA A;  4TQ2 A;  5CYB A;  2GC9 A;  1E5P A;  4NNT A;  5FQ6 E;  2ALL X;  2WEX A;  1GE6 A;  2DW2 A;  1SXU A;  4NP1 A;  1YUP A;  2MHD A;  1S4B P;  3WJF A;  4GWN A;  3F6Z B;  2L67 A;  4YH0 A;  3BS2 A;  4GH7 A;  1RLB E;  4TKH A;  1KZW A;  1BRQ A;  1T0V A;  3OHL A;  3APX A;  1ZRY A;  5LJD A;  1D8M A;  4GU8 A;  1UMS A;  1GT3 A;  3OD9 A;  3KFI A;  2E3X A;  3NX2 A;  3U9P C;  1FBL A;  3C77 X;  1BIW A;  2Q2P A;  4PKS A;  2BS5 A;  4LKP A;  2M4L A;  3APW A;  2J0T A;  1R54 A;  3P1V A;  2W15 A;  2LBV A;  4JIJ A;  3K3L A;  2L5P A;  4GR8 A;  4QGX A;  1JK3 A;  5IO7 A;  4TKJ A;  3C78 X;  2CBS A;  2CM9 A;  4ORY A;  1YIV A;  1KT3 A;  1B0O A;  1LNM A;  3GBO A;  2A13 A;  4RUU A;  2GTL O;  1YWB A;  4NLI A;  2PJT A;  4FVL A;  1K7I A;  1DMT A;  1ICM A;  1QJI A;  1IKJ A;  1HV5 A;  3U03 A;  3MX7 A;  1S7D A;  3BU1 A;  3NP1 A;  4O4U A;  3V8U A;  1CJ5 A;  1ZNG A;  2WO8 A;  3TVC A;  1G5W A;  4I35 A;  4AXQ A;  3VTG A;  2FV9 A;  3PH5 A;  2L9C A;  5H9A A;  4GRJ A;  2JSD A;  2FS7 A;  4YBU A;  1ZNK A;  1GE7 A;  1BSO A;  3L0T A;  3T1D A;  4AYK A;  3P6D A;  3BSZ E;  2N8R A;  1OBQ A;  1T8V A;  4QZU A;  3S5X A;  3KZA A;  2P8G A;  4PKR A;  1FTP A;  4QYP A;  1HBP A;  4ZR5 A;  2JT6 A;  4PKW A;  4XMG A;  3AKN A;  1TOW A;  3HWD A;  1EI5 A;  1QY1 A;  5LJK A;  3STM X;  4LKT A;  2X8F A;  1B8E A;  3FR4 A;  1QY2 A;  1EIO A;  3EM0 A;  1MNC A;  2NND A;  3F18 A;  2KD2 A;  3VG4 A;  4ZH6 A;  1OS9 A;  3EDZ A;  4WK7 A;  3B2I A;  5F6Z A;  1BKC I;  5CE4 A;  1AVG I;  1MMP A;  1Y0V A;  1JJX A;  4QAE A;  5FQ8 E;  2O62 A;  1SY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...