3P24A

Structure of profragilysin-3 from bacteroides fragilis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
365
structure length
357
Chain Sequence
b'PVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTNFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKYPVSVKINVDKAKKILNLPECDYINDYIKTPQVTRAVPSEPKTVYVICLRENGSTVYPNEVSAQMQDAANSVYAVHGLKRYVNLHFVLYTTEYACPSGNADEGLDGFTASLKANPKAEGYDDQIYFLIRWGTWDNNILGISWLNSYNVNTASDFKASGMSTTQLMYPGVMAHELGHILGANHADDPKDLMYSKYTGYLFHLSEKNMDIIAKNLGWEIADGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BFT-3
publication title Structure, function and latency regulation of a bacterial enterotoxin potentially derived from a mammalian adamalysin/ADAM xenolog.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Hydrolase
total genus 120
structure length 357
sequence length 365
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.74: Fragilysin.
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13583 Reprolysin_4 Metallo-peptidase family M12B Reprolysin-like
A PF16376 fragilysinNterm N-terminal domain of fragilysin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.470 Mainly Beta Beta Barrel Lipocalin Lipocalin 3p24A01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3p24A02
1ZS0A 4R3VA 5I2ZA 1KUIA 3Q2HA 1A85A 3LK8A 2MZHA 3KWVC 4FXQA 3HB2P 1GXDA 1XFUA 2DW1A 1DMTA 2MLRA 1ZXCA 1YQYA 3OHLA 4H82A 4DF9A 1BKCI 1XFVA 1G05A 2TCLA 1CGEA 1ROSA 4H3XA 1C8TA 1JIZA 2DW2A 1UMTA 1JJ9A 4AYKA 1AKLA 3LUMA 2OY2A 1MMPA 1IAAA 1IACA 5D1TA 4WZVA 4XM8A 1PWWA 2E3XA 2MLSA 4ZR5A 2X3BA 1FLSA 2DDYA 3WV2A 2JSDA 1QJIA 1KBCA 5JMYA 1BKCA 1BUDA 4JPAA 1HTDA 4H76A 3KEJA 3TSKA 2E2DA 3KEKA 4JP4A 2D1NA 1G4KA 3B92A 5LABA 2J83A 1OS9A 3LUNA 1XFWA 2W13A 4JQGA 1G12A 4PKWA 4HX3A 2O36A 3N2VA 1AYKA 2K2GA 4GWNA 4G0DA 1Y0VA 3LIRA 3LKAA 1HOVA 4PKQA 3TVCA 1Y93A 1B8YA 5CXAA 1I1IP 4I35A 1I73A 3HYGA 5BOYA 3AIGA 1FBLA 3E8RA 1OM8A 1R55A 2DW0A 1KUKA 3KHIA 2W0DA 3EDZA 3EDHA 2USNA 966CA 1BQOA 2FV5A 1QUAA 1R1JA 1ND1A 2EROA 3SHIA 3KMCA 1JAQA 3O2XA 5I12A 1XUCA 1BM6A 3LMCA 5H8XA 4A7BA 3K7NA 3L0TA 1HFCA 3OHOA 4GWMA 1S4BP 1QJJA 3AYKA 3B2ZA 1KUHA 4FXYP 1SATA 1D5JA 2I47A 5CUHA 1GE7A 5D1SA 4FU4A 3LQBA 4CTHA 1PWUA 1GE6A 1XFXA 1BKCE 1CIZA 4G9LA 1GKCA 4DD8A 3ZVSA 2RJPA 4PKRA 1OO9A 1KUFA 3DPFA 1OMJA 4IUWA 5B5OA 1SU3A 5BOTA 1HY7A 1XURA 3EHYA 3USNA 1BUVM 5I4OA 1BIWA 5L7FA 2Z2DA 2OXUA 1SLNA 1HFSA 1XFYA 3B8ZA 1YCMA 2L0RA 4EFSA 2CLTA 2PJTA 2XS3A 2JT6A 4ON1A 4L6TA 4H30A 2N8RA 4FVLA 1OS2A 1I76A 4WF6A 2WOAA 1IABA 4DPEA 1KUGA 5B5PA 1R1IA 1QICA 2AYKA 1C7KA 1H71P 4AUOA 4XM7A 4WKIA 2MZIA 5L79A 3KMEA 3DPEA 3ZUKA 1C3IA 4Q1LA 2HU6A 1B3DA 2W14A 4PKSA 2OVZA 1GE5A 1D8FA 2O3EA 1PWPA 1USNA 1JAOA 2OW2A 4L63A 1JIWP 3F15A 3LJZA 3ZXHA 3G5CA 3LEAA 1CK7A 1EUBA 1BZSA 2V4BA 5BPAA 2JNPA 2POJA 1GO8P 1BQQM 3LIKA 1EB6A 2RJQA 1XFZA 4GUYA 1ASTA 1RMZA 3EDIA 3G42A 3LQ0A 4GR3A 5I0LA 2YB9A 3DSLA 3WV1A 1CQRA 3Q2GA 1K7GA 1UTZA 2OW9A 1A86A 4H49A 1L6JA 3TS4A 5I3MA 4L19A 1XUDA 2AIGP 4PKUA 1SRPA 3EWJA 3DWBA 1GKDA 1G49A 2K9CA 3V96B 3CKIA 1K7QA 1UMSA 3N2UA 1G9KA 2QPJA 1FM1A 3KECA 3VTGA 5D2BA 4XBHA 1D7XA 1CAQA 5D3CA 1PWQA 3NX7A 1MMBA 1CXVA 1MMQA 3HY7A 1OM7A 1O0TA 3LJGA 3HDAP 1SMPA 1ZTQA 5I43A 3LJTA 4GR0A 3RTSA 4QKZA 1YOUA 5D7WA 1ATLA 3LE9A 1PWVA 1KAPP 4WK7A 2W15A 4IN9A 3RTTA 4ILWD 3L0VA 1J7NA 456CA 1O0QA 4JIJA 1IAGA 2YIGA 3O64A 1SLMA 3TT4A 2DDFA 1JK3A 2OVXA 2D1OA 2Y6DA 3I7GA 830CA 3HDBA 1UEAA 4J4MA 3VI1A 2FV9A 3EDGA 3KRYA 2KRJA 2J0TA 3F1AA 1JKYA 4GF1A 4AXQA 4DV8A 2CKIA 3ELMA 3K7LA 3BA0A 3MA2A 2A8HA 1IADA 1CGFA 2JT5A 4A3WA 1Z3JA 2X3AA 1R1HA 3UVCA 2OI0A 1UTTA 1AF0A 2W12A 1DTHA 3F18A 4WKEA 1JAPA 3F19A 4H84A 1BSWA 2XS4A 4GQLA 3I7IA 1MMRA 2OXZA 4XCTA 2OW1A 3U1RA 4H1QA 2WO9A 2X7MA 3P24A 2ERPA 3DNGA 1QIAA 2X3CA 1CGLA 2MZEA 2OZRA 4PKVA 3HBUP 1EAKA 5CZMA 4PKTA 1YP1A 4JA1A 4H2EA 2Y6CA 1GO7P 1RM8A 3HBVP 3DL1A 2SRTA 1ZP5A 1Y8JA 2OY4A 3EHXA 2WO8A 1ZVXA 3AYUA 1Q3AA 1MNCA 2ERQA 4XM6A 2OXWA 1K7IA 3LILA 1WNIA 3F16A 3LGPA 1R54A 1D8MA 5D1UA 2OW0A 2JIHA 1IAEA 1HV5A 3F17A 3HY9A 4GR8A 1JANA 1QIBA 3WV3A 1ZXVA 4HMAA 4I03A 1OM6A 3GBOA 4IJOA 3P1VA 1JH1A 4AIGA
chains in the Genus database with same CATH superfamily
1ZS0A 4R3VA 4U3QA 2WPUA 3LK8A 1TXLA 2MZHA 3KWVC 3MX7A 3IA8A 3ZZVA 4ALOA 5FQ8E 2Z4HA 4GGZA 1XFUA 1QY2A 2MLRA 1ZXCA 1YQYA 2MWHA 4DF9A 4HPDA 1LELA 1XFVA 1VYGA 1NDJA 1S44A 1CGEA 4H3XA 5D45A 1VWFB 1IFBA 4XMEA 3Q34A 1K24A 3TGAA 1OPAA 1IAAA 5K67A 5IO7A 3VHMA 3SZIA 3TZSA 4XM8A 1ACDA 2WEWA 3APXA 4K19A 3RE6A 3ZWEA 2MLSA 3KFFA 3RZYA 1LDOA 3WV2A 4AZMA 5FAZA 3WOVA 3FA7A 1BKCA 4JPAA 2GH7A 1X8OA 3KEJA 1U17A 4BX5B 1GXAA 2RTHB 3BX7A 1ZNKA 2ACOA 4CDCA 4Z2OA 2J83A 1XFWA 1SRFA 1T0VA 2IZJA 1DC9A 3NQ9A 2Q2MA 1H91A 4BGFA 1HY2A 3ZW1A 4ORWA 3P6DA 1VWKB 3WJBA 1B8YA 1RXKA 5CXAA 1O1VA 4CDDA 3BY0A 1RLBE 4BX6A 1I73A 1NP1A 1OM8A 3SOTA 2UYWA 1I9HA 1KUKA 5EPQA 4XMGA 4EQAC 3EDHA 966CA 1WUBA 4TQ2A 4O49A 4Y0QA 2HKDA 1ALBA 2EROA 2VDFA 5HZ8A 3O2XA 3SAOA 5I12A 4I60A 1AB0A 2L5PA 1SY0A 3B2ZA 3BU1A 1KUHA 1SATA 1D5JA 4NNTA 1GE7A 3PQSA 4FU4A 2HYSA 1SY2A 1PWUA 1FJ1E 1HXLA 1NP4A 1BSQA 3T2WA 1XFXA 2OF9A 1CIZA 5L8NA 3WZOA 2RJPA 2UZ2A 4ORUA 3HPEA 1JBHA 5B5OA 1HBPA 3FW4A 5BOTA 1XURA 1KQWA 2CAMA 4BOEA 2PI3O 3EM0A 4MEEA 3EHYA 2OL7A 1BUVM 5HBSA 2RD7C 1BIWA 5L7FA 2Z2DA 4ORSA 1SLNA 1HFSA 1XFYA 1HXZA 1YCMA 2RTIB 2RTJA 1E02A 3KZAA 4DQ4A 3BS2A 3CMPA 2BT9A 3RWXA 4H30A 4TKJA 4AZNA 2X45A 3P6GA 4WF6A 4A1YA 5L3YA 5HCCC 2AYKA 1PBOA 4QRLA 1VPRA 4YKMA 3KQ0A 4GGRA 3APWA 1LIBA 2MZIA 3KMEA 4IAXA 3DPEA 1KZWA 4Q1LA 2DM5A 3V8UA 2HU6A 3HOLA 2OVZA 4U46A 1GE5A 3BRNA 1D8FA 2Z4IA 5LKEA 1EPBA 1OBQA 3PECA 1LFOA 2RQ0A 2E4JA 3LJZA 3G5CA 4NV8A 1HN2A 2A3FX 1LDQA 4NV7A 2Q2PA 5DPQA 3FA8A 1ASTA 1OSPO 3G42A 3LQ0A 2RTFB 3DSLA 1CQRA 4MVKA 2W2AA 2F09A 2AT0X 1L6JA 4CPHA 1FTPA 5I3MA 1XUDA 2RTNB 4GD9A 1SRPA 3FEKA 2RTMA 1L6MA 5FENA 1K7QA 4I95A 3N2UA 3LTWA 2C4IA 3VTGA 4ID2A 1UYOX 3BLGA 1SXUA 2GTLO 4ZFXA 4XBHA 1B8EA 2GC9A 4BX7A 1SWBA 4ES7A 1OM7A 1SMPA 1ZTQA 3FW5A 3LJTA 4Y59A 2QCBA 3MM0A 2FHLA 1SRHA 2OY8A 4IN9A 456CA 1UYNX 3PK2A 1DFVA 4ZH9A 1DZJA 2YIGA 1OEEA 4EDEA 4GH7A 2D1OA 3D97A 4IB7A 3I7GA 1E5PA 3T6FA 3HDBA 2JU8A 1KT6A 4GNYA 2A0AA 1XCAA 4LKPA 1GM6A 1MK5A 3EDGA 4KC8A 1GGLA 3GAQA 4AXQA 4QZTA 1SWKA 2LA7A 4ORYA 1AVDA 3STNA 2JT5A 4YH0A 1Z3JA 4O4OA 1OEKA 3UVCA 2IZGB 4FQBB 2X8SA 2GTLN 4WKEA 2ALLX 1CRBA 4OEMA 1BSWA 2IFBA 4I6SA 4UU2A 1KGLA 1PTSA 2A5CA 4O3YA 1QG5A 4XCTA 3U1RA 1LNMA 2AT3X 1BM5A 2NP1A 4ARHA 2ERPA 1AVGI 2X3CA 3WBGA 3ELXA 2MF6A 4PKVA 1EAKA 2L68A 4LZVA 1YP1A 4JA1A 5EZ2A 4M7MA 3DTEA 3O22A 3APVA 4O3WA 1BRPA 4IABA 1LIFA 1GX8A 3PH6A 2MM3A 4Z2PA 5FQ7E 4CDEA 1RM8A 3HBVP 5BVQA 1MNCA 2I5ZO 4XM6A 3HWGA 3WJEA 4GETA 3LILA 1WNIA 3F16A 5F6ZA 2GJ5A 3IFBA 3HOEA 3VG6A 4HWMA 1SY1A 1UREA 2G79A 2W2FA 2A2UA 1KL5A 3KFGA 4WHIA 3PH5A 3APUA 4AIGA 4OS3A 4N7CA 4U8UM 1N9YA 3U03A 2FKGA 2ACPX 1UZ2X 3HB2P 2BSZA 4H82A 5IO6A 4I9SA 1G05A 2YUFA 1C8TA 2DW2A 3U9PC 1UMTA 2WSJA 4O3XB 1JJ9A 1EI5A 1KOIA 2HZRA 5JR8A 1STSB 4AYKA 4AZQA 4L7AA 2X32A 2RTRB 1MMPA 5AEOA 4CK4A 5D1TA 1LCWA 4IMOA 5DG4A 4ALBA 5B11O 5JD2A 4ODDA 5EEEA 1QJIA 2ZAIA 4D6BA 1BUDA 2EU7X 3VG7A 1OZ9A 1PM1X 3SZHA 3KVNA 3I17A 3BDRA 1OS9A 3QQ2A 3UEXA 4HX3A 4HFOA 2O36A 3N2VA 2K2GA 2FLJA 3EW2A 4ZHHA 5BVTA 5CE4A 4PKQA 1KT5A 3N91A 3RE5A 1VWIB 1X71A 1LPJA 1Y93A 1CBQA 2OY1O 4I35A 5EDBA 1SWFA 3P6CA 4I9RA 2BLGA 5LJBA 1CJ5A 3HYGA 4PSQA 2CM4A 5B10O 1TVIA 3MG5A 1ADLA 1FBLA 1SA8A 2RTKA 2KD2A 2R74A 2W0DA 3RDSA 3JQOA 4AZRA 1OPBA 4YFQA 2OFMX 1W4TA 3Q6LA 2IZKA 1Y9TA 2FWVA 3SHIA 4ZHDA 5H9AA 3CBCA 1BM6A 1XUCA 1N7YA 5EDCA 1AVEA 4GWMA 2OVEA 1QJJA 1NBXA 3B2KA 5BVSA 1SMPI 2KT4B 3UEWA 2I47A 5CUHA 5D1SA 4GKCA 3LQBA 4CTHA 3L4RA 4YDAA 5HTEA 4G9LA 2XSTA 3NX1A 1GKCA 4DD8A 2K23A 2IZHB 4MVEA 1OMJA 4IUWA 3FA9A 1VWCB 4GZVA 2OY5O 1ZRYA 4O4UA 4QGVA 3UEUA 1JMZA 2A5BA 3FR5A 3USNA 2VFBA 3KFIA 1FDQA 4JNJA 3WJCA 2C1SA 4OS8A 1IKEA 2L0RA 5F58A 5LJCA 2PJTA 3S5XA 3P6HA 4DCBA 1KL3A 4YBPA 4O4XA 4O3ZA 4FVLA 3BU9A 1I76A 2RTLA 2WOAA 3CR6A 1IABA 5B5PA 2CBSA 1X8PA 3STKA 5HTDA 3ZUOA 1I78A 1QICA 3KFHA 1E2TA 4JO6A 1TOUA 1C7KA 3EC5A 3AKMA 3P6EA 1JJXA 1JJJA 4RUUA 3S60A 3ZUKA 1T68X 3CQRA 1JYJA 4GNWA 4YGHA 2W14A 4GDAA 2ZSCA 4PKSA 5K68A 3NR3A 1GKAA 3OJYC 1PWPA 5H9KA 2Q4NA 2A13A 2OW2A 1I4UA 1RBPA 1BBPA 4L63A 2W2BA 1IKJA 3T2XA 1EUBA 1BZSA 1B4MA 1PEEA 3B2LA 2JNPA 1GO8P 2FKJA 1BQQM 3LIKA 2RJQA 1XFZA 4GUYA 2AH7X 2X34A 1KL4A 2YB9A 3WV1A 4TNNA 1VWAB 2OW9A 1Y52X 4L19A 1AELA 2VFCA 4HPBA 3NP1A 4TJZA 3UAQA 1RAVA 4LZUA 5LJGA 5BYPA 4KT5A 1A2DA 3G7XA 2AMMX 1FELA 5LJEA 1ZNLA 1JZUA 5HZ5A 5D48A 4EXZA 1Y53X 5K06A 1YWCA 1SY3A 1NQMA 5D3CA 4BBOA 4YGZA 1SWQA 3T6LA 1W6FA 1ICNA 3NX7A 2IZCB 1CXVA 1KT4A 1MMQA 1D3SA 3VG3A 3HY7A 1KXOA 1O0TA 2HNXA 3WYPA 5FFHA 5D7WA 1LKEA 3RDMA 2OVDA 4CPHB 4WK7A 1TW4A 3RTTA 3MVFA 4Y0RA 3VG2A 4JIJA 1NC9A 2WR6A 3E3CA 1JK3A 1GX3A 1GT4A 4ML7B 1UEAA 3PDFA 2JOZA 3FIDA 2X46A 1VWPB 2J0TA 3F1AA 4ZHCA 4GF1A 2XKLA 4DV8A 4BX7B 3K7LA 1PMPA 2JMBA 3BA0A 1IADA 1SLGB 3K3LA 1CGFA 3EMMA 1LUQA 4BJ8A 1SWHA 2BS5A 2AL0X 3PP6A 2LKKA 5LKFA 3SLOA 1UTTA 3OE3A 4AZOA 2W12A 4IMNA 5HCDC 3F18A 5AJCA 1EALA 1QY0A 2G8CO 4QQ1A 2XS4A 4GQLA 3B2IA 3PQUA 1MMRA 3D9WA 1VWLB 2OW1A 4H1QA 4IB9A 4HPCA 2WO9A 2X7MA 4YCHA 3DNGA 1N43A 1OBUA 4Y0SA 1CGLA 2MZEA 4BCSA 4FBRA 3VG4A 2RCQA 4PKTA 1JQPA 4ZJ0A 2RTBB 2Y6CA 3STMX 4Z2VA 4CPIA 3DL1A 2FS7A 2OYBO 3HWDA 1ZP5A 3FEPA 4COTA 1SWDA 4QYPA 4BVMA 2ERQA 3WVMA 1EXSA 4TKHA 3FDCA 1SWLA 1D8MA 2HMBA 2CZUA 3ZW0A 2OW0A 1HV5A 1B0OA 4FBOA 3F17A 4UU3A 1Y9LA 2FTBA 1LICA 4JGLA 3WV3A 5F6BA 4HMAA 3GBOA 4IJOA 3P1VA 3GE2A 4ZGFA 3T1DA 4NNSA 1KUIA 3Q2HA 2IZBA 3HK1A 2RTEB 2YMSA 1VYFA 1GXDA 1FE3A 3VE2A 4CPFA 1I06A 2R73A 3OHLA 1BKCI 1U18A 3OD9A 4GJSA 3RDQA 4AYHA 2TCLA 1ROSA 3ZQ3A 5HA1A 2LFOA 1DZMA 3LHNA 1AKLA 3LUMA 4GU8A 3HWFA 2JU3A 1IACA 3FIQA 3DTKA 4JHQA 1SWJA 1SREA 1FLSA 3S26A 2JSDA 1KBCA 5JMYA 1LIEA 4YFRA 2NNDA 3KEKA 2D1NA 3WJFA 4O4SA 4OMXA 5LABA 1U0XA 3LUNA 1VWMB 4JQGA 1YWAA 1G12A 3F6ZB 1AYKA 4GWNA 1SWPA 2LBVA 3SLTA 1Y0VA 3LIRA 2RN4A 1SWOA 4YVBA 1MM9A 5H9NA 3TVCA 2G78A 1YWBA 1I1IP 1SXWA 2OFAA 3SZJA 1BRQA 4EKVA 4OS0A 3DTQA 3VG5A 3E8RA 1X8QA 1R55A 2X56A 2DW0A 1JYDA 3KHIA 1XAXA 4YKOA 4A60A 1SWSA 5HA0A 2RTAA 4NP1A 2FV5A 2QO4A 2K62A 1ND1A 1JAQA 1MX7A 3VGWA 4RUNA 3LMCA 5H8XA 4A7BA 3K7NA 3L0TA 1SWCA 3FELA 3OHOA 1BSOA 3TF6A 1S4BP 3TGBA 3C78X 3F8AA 2CM9A 2FGSA 1HQPA 2OVSA 1VWDB 4A8ZA 1BLRA 2G7BA 1KQXA 1GE6A 2BC3A 1BKCE 3JS1A 1MDCA 4PKRA 1OO9A 1I05A 1KUFA 3DPFA 2RTGB 3DTIA 1NGLA 1SU3A 1HY7A 2GTLM 3QKGA 4QNIA 2L9CA 3OBLA 4YFPA 5KICA 4IBAA 2BHVA 1N4JA 5HAEA 4YDBA 5I4OA 1CBIA 5D4AA 2BS6A 1VYOA 2RTPB 3B8ZA 3AUMO 4LKTA 1A57A 4EFSA 2CLTA 4KH8A 2XS3A 3RDXA 1IFCA 1SLEB 4L6TA 2N8RA 1MVGA 2QO6A 4DPEA 2KTSA 2Y3FA 3O2YA 2AT5X 2GTFX 1S7DA 2MO5A 2LBAA 4XM7A 2OFRX 1D2UA 4WKIA 2C1QA 1SWRA 4ZCBA 3EBWA 2DJFA 1B3DA 1OBPA 1XKIA 1G5WA 3H3IA 4B55A 2O3EA 1MOYA 3D95A 4IRWA 4KCAA 3VHHA 3DSZA 4N7DA 4ZHGA 1JV4A 1DZKA 1JIWP 2OL6O 1T8VA 3ZXHA 3LEAA 4YGGA 1CK7A 1WBIA 1VWJB 2POJA 1B56A 1EIOA 1EB6A 4GR3A 1RXHA 3Q2GA 1K7GA 1UTZA 2CZTA 2AKQA 2KTDA 1GT5A 3TS4A 1XM5A 1E06A 4PKUA 4DQ3A 3PPTA 4WFUA 5FQ6E 3SLJA 2K9CA 4YMYA 1UMSA 3CBSA 3NPOA 3ZW1B 1G9KA 1FM1A 1E00A 3LV4A 3KECA 1GKAB 2ZAGA 4IB6A 5D2BA 4QAEA 2QOMA 1IW2A 2F01A 1D7XA 4BX6B 3VU1A 4YBUA 5AQ6A 3ZI8A 1SWUA 1QWDA 1LIDA 1LF7A 1DV9A 1MMBA 3P02A 1A18A 2Y3EA 3LJGA 2OVAA 3X00A 3D4RA 1SWAA 4TLJA 2FR3A 3RTSA 4QKZA 5C0NA 4QYNA 4MISA 1SRJA 1KAPP 2W15A 1ERBA 1K3BA 4ILWD 1X89A 5D47A 4CDFA 3WJDA 3O64A 3HTYA 3TT4A 2DDFA 1RXJA 3WJGA 4BQUA 1SXXA 830CA 1VWRB 4J4MA 2WQAE 3VI1A 2OY7A 2FV9A 1QFTA 3KRYA 5CSEA 5IXGA 2FHNX 3JSQA 2IZFB 3MA2A 2A8HA 1YP6A 4DNEA 4CPEA 2X3AA 4I3CA 1R1HA 4Z28A 2OI0A 1AF0A 5B3MO 1DTHA 1VWBB 1JMXA 2NNQA 3F19A 1TOWA 3I7IA 4KIIA 3S5VA 2OXZA 1G74A 3FMZA 2F73A 4NYRA 3P24A 1QIAA 2OZRA 2POAA 3HBUP 2MJIA 2OFBA 3UEVA 4H2EA 2Q9SA 2RA6A 2WUTA 3ELZA 4ZR2A 3VHIA 1GO7P 1VWEB 5F1EA 2OZQA 1SXYA 3EBKA 4FGIB 1LCVA 4IAWA 4QGXA 5HZ9A 2WO8A 3AYUA 1Q3AA 1SWNA 4I3DA 2AF5A 5HZ6A 1N9MA 2FT9A 1R54A 1G7NA 2JGSA 1RSUB 1SWGA 3O19A 3WZPA 2X8TA 4AZPA 1AQBA 3RSWA 2QMIA 2QM9A 1QIBA 1ZNEA 1ZXVA 1EW3A 1HQQA 3BX8A 4I03A 2IZDB 1Y0GA 4M6SA 4U9CA 5H8TA 5I2ZA 1DF3A 1A85A 4XMHA 4BX5A 4FXQA 3PEDA 2AVIA 4CV7A 4C5PA 1QABE 2IZLB 1W5RA 4Y5DA 1FENA 2DW1A 1SWTA 1DMTA 1ML7A 1KZXA 1BSYA 1DF8A 2OF8A 3I0AA 3C77X 1JIZA 5IRAA 1VWNB 2M4LA 1EIIA 4INNA 4FBVA 2OY2A 3ZW0B 4OELA 1CBRA 4WZVA 3B2HA 1PWWA 2E3XA 1PBYA 4ZR5A 2X3BA 2DDYA 4XMFA 2FRSA 1JH1A 1HMSA 1GT3A 5B2AO 5LJKA 2FR2A 5HWZA 1KT3A 1HTDA 4H76A 3TSKA 2OL8O 2JU7A 2E2DA 4JP4A 1G4KA 1YIVA 3B92A 4WFVA 1EQDA 2IZIA 2W13A 4QGWA 4PKWA 5IRUA 1X8UA 1I04A 2NNEA 4G0DA 1IIUA 3LKAA 3D96A 1HOVA 4OMWA 2KW1A 3CWKA 5KIDA 5B5GA 5BOYA 4Z6JA 5H9LA 1SWEA 5EEDA 3AIGA 3RY1A 3EYCA 4NW4A 5D8JA 1JIWI 1VWQB 3FENA 3EDZA 2USNA 3NQKA 1BQOA 4D6AA 3AKNA 5AJBA 1QUAA 4LQZA 1R1JA 3KMCA 4ZH6A 1SLFB 4GJVA 2HZQA 3F9DA 1HFCA 4AW8A 1QQSA 1Y55X 1JJUA 4GGTA 3AYKA 1CBSA 4FXYP 3VPJE 4U8UO 1LCZA 1STPA 2P8GA 3EW1A 5HCEC 1EUOA 1TVQA 3ZVSA 2RTOB 2AT8X 3BSZE 1A3YA 2IZEB 4I3BA 4KC7A 4GRJA 2L67A 1BWYA 4OKAA 5HZQA 1NQNA 2OXUA 2WWPA 4MIRA 2RTQB 4ZHFA 1MEPA 4ORRA 3HWEA 3FR4A 2JT6A 4ON1A 1OS2A 1QY1A 2ASNX 3WYQA 1KUGA 2HLVA 4YCEA 1VWGB 1R1IA 5CYBA 2A8GA 4GK9A 1H71P 4AUOA 1EPAA 4NYQA 4U8UN 3WZQA 1ZNDA 3CQNA 5F2BA 5L79A 4HPAA 4ZGUA 1C3IA 1RSTB 2A2GA 4A1HA 3FLLA 3CKFA 1VWOB 2RCTA 4NLIA 1HMTA 1G85A 3VE1A 4CSBA 1USNA 1JAOA 2Q39A 3P6FA 1S2PA 3F15A 1QFVA 3ZUIA 5LJHA 2V4BA 2CBRA 4TKBA 5BPAA 3FYFA 4L3RA 1KFFA 1RMZA 3EDIA 4WBKA 1ERXA 2ANSA 4EFGA 1KT7A 1GX9A 2X8FA 5I0LA 1SRIA 4GE1A 4Z27A 4H49A 1A86A 1ICMA 5KHPA 2AIGP 3EWJA 2YG2A 3DWBA 1G49A 3V96B 4ORXA 2I5VO 3CKIA 2QPJA 1ZNHA 5IRWA 2LB6A 3RBYA 5B27A 5L8IA 3CKGA 5L8OA 1YUPA 1CAQA 1FEMA 1Z24A 1O8VA 1PWQA 1BJ7A 1OEJA 4MVLA 4NLJA 2X4MA 1YP7A 1SLDB 2JN3A 3TGCA 3HDAP 2MHDA 5I43A 3RDUA 1STRB 4GR0A 2QOSC 3RKGA 4QZUA 1YOUA 1ATLA 3LE9A 1HBQA 1PWVA 1X8NA 2FS6A 1O1UA 3FA6A 3NQ3A 4GUZA 3L0VA 1J7NA 1O0QA 4PJ2A 5CHKA 3NX2A 1ZNGA 1IAGA 1SLMA 2WEXA 2OVXA 2Y6DA 5B5FA 2WQ9A 2RTDB 1N0SA 4R0BA 4EEJA 1P6PA 3WXQA 4IB8A 2KRJA 5IO5A 5B29A 1JKYA 3MBTA 1HMRA 2CKIA 3ELMA 3NBXX 5LJDA 4A3WA 4XMDA 1BEBA 2IZAA 2Y32A 1SRGA 2O62A 1JAPA 2N93A 1DZPA 4H84A 4MVIA 3RDOA 1YWDA 5F7GA 3ZW2A 3RY2A 2R56A 5CZMA 1VWHB 2AT6X 4L1NA 3FR2A 2G5LA 2RTCB 3U0DA 2SRTA 2PY1A 1MUPA 1Y8JA 2OY4A 4XMCA 3EHXA 2DJGA 3AEHA 3NADA 1ZVXA 2JW1A 3C76X 1R0UA 2QO5A 1IJ8A 2OXWA 1K7IA 3LGPA 2X55A 4GDZA 5D1UA 2JIHA 1GT1A 1IAEA 4Y0PA 3HY9A 3WZNA 3B2JA 4GR8A 1JANA 4O9SA 1OM6A 1MX8A 1GKDA
chains in the Genus database with same CATH topology
1ZS0A 4R3VA 4U3QA 3LK8A 1TXLA 2MZHA 3KWVC 3MX7A 3IA8A 3ZZVA 4ALOA 5FQ8E 2Z4HA 1XFUA 1QY2A 2MLRA 1ZXCA 1YQYA 2MWHA 4DF9A 4HPDA 1XFVA 1VYGA 1S44A 1CGEA 4H3XA 5D45A 1IFBA 4XMEA 3TGAA 1OPAA 1IAAA 5IO7A 3TZSA 4XM8A 1ACDA 2WEWA 3APXA 4K19A 3ZWEA 2MLSA 3KFFA 3RZYA 3WV2A 4AZMA 5FAZA 3WOVA 3FA7A 1BKCA 4JPAA 1X8OA 3KEJA 1U17A 1GXAA 3BX7A 1ZNKA 2ACOA 2J83A 1XFWA 1T0VA 1DC9A 3NQ9A 2Q2MA 1H91A 3ZW1A 4ORWA 3P6DA 3WJBA 1B8YA 5CXAA 1O1VA 3BY0A 1RLBE 1I73A 1NP1A 1OM8A 3SOTA 1KUKA 5EPQA 4XMGA 4EQAC 3EDHA 966CA 4TQ2A 4O49A 4Y0QA 1ALBA 2EROA 5HZ8A 3O2XA 3SAOA 5I12A 1AB0A 2L5PA 1SY0A 3B2ZA 3BU1A 1KUHA 1SATA 1D5JA 4NNTA 1GE7A 3PQSA 4FU4A 2HYSA 1SY2A 1PWUA 1NP4A 1BSQA 1XFXA 1CIZA 5L8NA 2RJPA 4ORUA 1JBHA 5B5OA 1HBPA 3FW4A 5BOTA 1XURA 1KQWA 4BOEA 3EM0A 3EHYA 1BUVM 5HBSA 2RD7C 1BIWA 5L7FA 2Z2DA 4ORSA 1SLNA 1HFSA 1XFYA 1YCMA 1E02A 3KZAA 4DQ4A 3BS2A 3CMPA 2BT9A 3RWXA 4H30A 4TKJA 4AZNA 2X45A 3P6GA 4WF6A 4A1YA 5HCCC 2AYKA 1PBOA 4QRLA 1VPRA 4YKMA 3KQ0A 3APWA 1LIBA 2MZIA 3KMEA 4IAXA 3DPEA 1KZWA 4Q1LA 2DM5A 3V8UA 2HU6A 3HOLA 2OVZA 1GE5A 3BRNA 1D8FA 2Z4IA 5LKEA 1EPBA 1OBQA 3PECA 1LFOA 2RQ0A 2E4JA 3LJZA 3G5CA 1HN2A 2A3FX 2Q2PA 5DPQA 3FA8A 1ASTA 3G42A 3LQ0A 3DSLA 1CQRA 4MVKA 2W2AA 2F09A 2AT0X 1L6JA 1FTPA 5I3MA 1XUDA 1SRPA 3FEKA 1L6MA 5FENA 1K7QA 4I95A 3N2UA 3VTGA 4ID2A 3BLGA 1SXUA 2GTLO 4ZFXA 4XBHA 1B8EA 2GC9A 4ES7A 1OM7A 1SMPA 1ZTQA 3FW5A 3LJTA 4IN9A 456CA 1DFVA 4ZH9A 1DZJA 2YIGA 1OEEA 4EDEA 4GH7A 2D1OA 3D97A 4IB7A 3I7GA 1E5PA 3HDBA 2JU8A 1KT6A 2A0AA 4GNYA 1XCAA 4LKPA 1GM6A 3EDGA 4KC8A 1GGLA 3GAQA 4AXQA 4QZTA 2LA7A 4ORYA 3STNA 2JT5A 4YH0A 1Z3JA 4O4OA 1OEKA 3UVCA 4FQBB 2X8SA 2GTLN 4WKEA 2ALLX 1CRBA 1BSWA 2IFBA 4I6SA 4UU2A 1KGLA 4O3YA 1QG5A 4XCTA 3U1RA 1LNMA 2AT3X 1BM5A 2NP1A 4ARHA 2ERPA 1AVGI 2X3CA 3WBGA 3ELXA 4PKVA 1EAKA 2L68A 4LZVA 1YP1A 4JA1A 5EZ2A 4M7MA 3DTEA 3O22A 3APVA 4O3WA 1BRPA 4IABA 1LIFA 1GX8A 3PH6A 2MM3A 5FQ7E 1RM8A 3HBVP 5BVQA 1MNCA 4XM6A 3HWGA 3WJEA 4GETA 3LILA 1WNIA 3F16A 5F6ZA 2GJ5A 3IFBA 3HOEA 3VG6A 4HWMA 1SY1A 1UREA 2G79A 2W2FA 2A2UA 3KFGA 4WHIA 3PH5A 3APUA 4AIGA 4OS3A 4N7CA 4U8UM 3U03A 2ACPX 1UZ2X 3HB2P 4H82A 5IO6A 4I9SA 1G05A 2YUFA 1C8TA 2DW2A 3U9PC 1UMTA 2WSJA 4O3XB 1JJ9A 1EI5A 1KOIA 2HZRA 5JR8A 4AYKA 4AZQA 4L7AA 1MMPA 5AEOA 4CK4A 5D1TA 4IMOA 5DG4A 4ALBA 4ODDA 5EEEA 1QJIA 2ZAIA 4D6BA 1BUDA 2EU7X 3VG7A 1PM1X 3I17A 3BDRA 1OS9A 3UEXA 4HX3A 4HFOA 2O36A 3N2VA 2K2GA 2FLJA 4ZHHA 5BVTA 5CE4A 4PKQA 1KT5A 3N91A 1X71A 1LPJA 1Y93A 1CBQA 4I35A 5EDBA 3P6CA 4I9RA 2BLGA 5LJBA 1CJ5A 3HYGA 4PSQA 2CM4A 1ADLA 1FBLA 1SA8A 2KD2A 2R74A 2W0DA 3JQOA 4AZRA 1OPBA 2OFMX 4YFQA 3Q6LA 1Y9TA 2FWVA 3SHIA 4ZHDA 5H9AA 3CBCA 1BM6A 1XUCA 5EDCA 4GWMA 2OVEA 1QJJA 3B2KA 5BVSA 1SMPI 2KT4B 3UEWA 2I47A 5CUHA 5D1SA 4GKCA 3LQBA 4CTHA 3L4RA 4YDAA 5HTEA 4G9LA 2XSTA 3NX1A 1GKCA 4DD8A 2K23A 4MVEA 1OMJA 4IUWA 3FA9A 4GZVA 1ZRYA 4O4UA 4QGVA 3UEUA 3FR5A 3USNA 3KFIA 1FDQA 3WJCA 4OS8A 1IKEA 2L0RA 5F58A 5LJCA 2PJTA 3S5XA 3P6HA 4YBPA 4O4XA 4O3ZA 4FVLA 3BU9A 1I76A 2WOAA 3CR6A 1IABA 5B5PA 2CBSA 1X8PA 3STKA 5HTDA 3ZUOA 1QICA 3KFHA 1TOUA 1C7KA 3AKMA 3P6EA 1JJXA 1JJJA 4RUUA 3S60A 3ZUKA 1T68X 3CQRA 1JYJA 4GNWA 4YGHA 2W14A 4PKSA 3NR3A 1GKAA 3OJYC 1PWPA 5H9KA 2Q4NA 2A13A 2OW2A 1I4UA 1RBPA 1BBPA 4L63A 2W2BA 1IKJA 1EUBA 1BZSA 1B4MA 1PEEA 3B2LA 2JNPA 1GO8P 1BQQM 3LIKA 2RJQA 1XFZA 4GUYA 2AH7X 2YB9A 3WV1A 4TNNA 2OW9A 4L19A 1AELA 4HPBA 3NP1A 4TJZA 3UAQA 4LZUA 5LJGA 5BYPA 4KT5A 1A2DA 3G7XA 2AMMX 1FELA 5LJEA 1ZNLA 1JZUA 5HZ5A 5D48A 4EXZA 5K06A 1YWCA 1SY3A 5D3CA 4YGZA 1ICNA 3NX7A 1CXVA 1KT4A 1MMQA 1D3SA 3VG3A 3HY7A 1KXOA 1O0TA 2HNXA 5FFHA 5D7WA 1LKEA 2OVDA 4WK7A 1TW4A 3RTTA 3MVFA 4Y0RA 3VG2A 4JIJA 2WR6A 3E3CA 1JK3A 1GT4A 4ML7B 1UEAA 2JOZA 2X46A 2J0TA 3F1AA 4ZHCA 4GF1A 2XKLA 4DV8A 3K7LA 1PMPA 2JMBA 3BA0A 1IADA 3K3LA 1CGFA 3EMMA 2BS5A 2AL0X 3PP6A 2LKKA 5LKFA 1UTTA 3OE3A 4AZOA 2W12A 4IMNA 5HCDC 3F18A 5AJCA 1EALA 1QY0A 4QQ1A 2XS4A 4GQLA 3B2IA 3PQUA 1MMRA 2OW1A 4H1QA 4IB9A 4HPCA 2WO9A 2X7MA 4YCHA 3DNGA 1OBUA 4Y0SA 1CGLA 2MZEA 4FBRA 3VG4A 2RCQA 4PKTA 4ZJ0A 2Y6CA 3STMX 3DL1A 2FS7A 3HWDA 1ZP5A 3FEPA 4COTA 4QYPA 4BVMA 2ERQA 3WVMA 1EXSA 4TKHA 1D8MA 2HMBA 2CZUA 3ZW0A 2OW0A 1HV5A 1B0OA 4FBOA 3F17A 4UU3A 1Y9LA 2FTBA 1LICA 4JGLA 3WV3A 5F6BA 4HMAA 3GBOA 4IJOA 3P1VA 3GE2A 4ZGFA 3T1DA 4NNSA 1KUIA 3Q2HA 3HK1A 2YMSA 1VYFA 1GXDA 1FE3A 3VE2A 1I06A 2R73A 3OHLA 1BKCI 1U18A 3OD9A 4AYHA 2TCLA 1ROSA 3ZQ3A 5HA1A 2LFOA 1DZMA 3LHNA 1AKLA 3LUMA 4GU8A 3HWFA 2JU3A 1IACA 3FIQA 3DTKA 1FLSA 3S26A 2JSDA 1KBCA 5JMYA 1LIEA 4YFRA 2NNDA 3KEKA 2D1NA 3WJFA 4O4SA 4OMXA 5LABA 1U0XA 3LUNA 4JQGA 1YWAA 1G12A 3F6ZB 1AYKA 4GWNA 2LBVA 1Y0VA 3LIRA 2RN4A 5H9NA 3TVCA 2G78A 1YWBA 1I1IP 1SXWA 1BRQA 4OS0A 3DTQA 3VG5A 3E8RA 1X8QA 1R55A 2DW0A 1JYDA 3KHIA 4YKOA 4A60A 5HA0A 4NP1A 2FV5A 2QO4A 2K62A 1ND1A 1JAQA 1MX7A 4RUNA 3LMCA 5H8XA 4A7BA 3K7NA 3L0TA 3FELA 3OHOA 1BSOA 3TF6A 1S4BP 3TGBA 3C78X 3F8AA 2CM9A 1HQPA 2OVSA 4A8ZA 1BLRA 2G7BA 1KQXA 1GE6A 1BKCE 3JS1A 1MDCA 4PKRA 1OO9A 1I05A 1KUFA 3DPFA 3DTIA 1NGLA 1SU3A 1HY7A 2GTLM 3QKGA 4QNIA 2L9CA 3OBLA 4YFPA 5KICA 4IBAA 2BHVA 5HAEA 4YDBA 5I4OA 1CBIA 5D4AA 2BS6A 3B8ZA 4LKTA 1A57A 4EFSA 2CLTA 4KH8A 2XS3A 1IFCA 4L6TA 2N8RA 1MVGA 2QO6A 4DPEA 2KTSA 3O2YA 2AT5X 2GTFX 2MO5A 1S7DA 2LBAA 4XM7A 2OFRX 1D2UA 4WKIA 4ZCBA 3EBWA 1B3DA 1OBPA 1XKIA 1G5WA 3H3IA 2O3EA 3D95A 4KCAA 3DSZA 4N7DA 4ZHGA 1JV4A 1DZKA 1JIWP 1T8VA 3ZXHA 3LEAA 4YGGA 1CK7A 2POJA 1B56A 1EIOA 1EB6A 4GR3A 3Q2GA 1K7GA 1UTZA 2CZTA 2AKQA 2KTDA 1GT5A 3TS4A 1E06A 4PKUA 4DQ3A 3PPTA 4WFUA 5FQ6E 2K9CA 4YMYA 1UMSA 3CBSA 3NPOA 3ZW1B 1G9KA 1FM1A 1E00A 3LV4A 3KECA 1GKAB 2ZAGA 4IB6A 5D2BA 4QAEA 1IW2A 1D7XA 3VU1A 4YBUA 5AQ6A 3ZI8A 1QWDA 1LIDA 1LF7A 1DV9A 1MMBA 3P02A 1A18A 3LJGA 2OVAA 3D4RA 4TLJA 2FR3A 3RTSA 4QKZA 5C0NA 4QYNA 4MISA 1KAPP 2W15A 1ERBA 4ILWD 1X89A 5D47A 3WJDA 3O64A 3HTYA 3TT4A 2DDFA 3WJGA 4BQUA 1SXXA 830CA 4J4MA 3VI1A 2WQAE 2FV9A 1QFTA 3KRYA 3JSQA 3MA2A 2A8HA 1YP6A 2X3AA 4I3CA 1R1HA 2OI0A 1AF0A 1DTHA 2NNQA 3F19A 1TOWA 3I7IA 4KIIA 3S5VA 2OXZA 1G74A 3FMZA 2F73A 4NYRA 3P24A 1QIAA 2OZRA 2POAA 3HBUP 2MJIA 3UEVA 4H2EA 2Q9SA 2RA6A 2WUTA 3ELZA 4ZR2A 1GO7P 5F1EA 2OZQA 1SXYA 3EBKA 4FGIB 4IAWA 4QGXA 5HZ9A 2WO8A 3AYUA 1Q3AA 4I3DA 5HZ6A 2FT9A 1R54A 1G7NA 3O19A 2X8TA 4AZPA 1AQBA 3RSWA 2QMIA 2QM9A 1QIBA 1ZNEA 1ZXVA 1EW3A 3BX8A 4I03A 4M6SA 4U9CA 5H8TA 5I2ZA 1DF3A 1A85A 4XMHA 4FXQA 3PEDA 4CV7A 1QABE 1FENA 2DW1A 1DMTA 1ML7A 1KZXA 1BSYA 3I0AA 3C77X 1JIZA 2M4LA 1EIIA 4INNA 4FBVA 2OY2A 3ZW0B 1CBRA 4WZVA 3B2HA 1PWWA 2E3XA 4ZR5A 2X3BA 2DDYA 4XMFA 2FRSA 1JH1A 1HMSA 1GT3A 5LJKA 2FR2A 5HWZA 1KT3A 1HTDA 4H76A 3TSKA 2JU7A 2E2DA 4JP4A 1G4KA 1YIVA 3B92A 4WFVA 1EQDA 2W13A 4QGWA 4PKWA 1X8UA 1I04A 2NNEA 4G0DA 1IIUA 3LKAA 3D96A 1HOVA 4OMWA 2KW1A 3CWKA 5KIDA 5BOYA 5H9LA 3AIGA 5EEDA 3EYCA 4NW4A 5D8JA 1JIWI 3FENA 3EDZA 2USNA 3NQKA 1BQOA 4D6AA 3AKNA 5AJBA 1QUAA 4LQZA 1R1JA 3KMCA 4ZH6A 2HZQA 3F9DA 1HFCA 4AW8A 1QQSA 3AYKA 1CBSA 4FXYP 3VPJE 4U8UO 2P8GA 5HCEC 1EUOA 1TVQA 3ZVSA 2AT8X 3BSZE 1A3YA 4I3BA 4KC7A 4GRJA 2L67A 1BWYA 5HZQA 2OXUA 2WWPA 4MIRA 4ZHFA 4ORRA 3HWEA 3FR4A 2JT6A 4ON1A 1OS2A 1QY1A 2ASNX 1KUGA 2HLVA 4YCEA 1R1IA 5CYBA 4GK9A 1H71P 4AUOA 1EPAA 4NYQA 4U8UN 1ZNDA 3CQNA 5L79A 4HPAA 4ZGUA 1C3IA 2A2GA 4A1HA 3FLLA 2RCTA 4NLIA 1HMTA 1G85A 3VE1A 4CSBA 1USNA 1JAOA 2Q39A 3P6FA 1S2PA 3F15A 1QFVA 3ZUIA 5LJHA 2V4BA 2CBRA 4TKBA 5BPAA 3FYFA 4L3RA 1RMZA 3EDIA 4WBKA 1ERXA 2ANSA 4EFGA 1KT7A 1GX9A 2X8FA 5I0LA 4GE1A 4H49A 1A86A 1ICMA 5KHPA 2AIGP 3EWJA 2YG2A 3DWBA 1G49A 3V96B 4ORXA 3CKIA 2QPJA 1ZNHA 2LB6A 3RBYA 5B27A 5L8IA 5L8OA 1YUPA 1CAQA 1FEMA 1Z24A 1O8VA 1PWQA 1BJ7A 1OEJA 4MVLA 4NLJA 1YP7A 2JN3A 3TGCA 3HDAP 2MHDA 5I43A 4GR0A 2QOSC 3RKGA 4QZUA 1YOUA 1ATLA 3LE9A 1HBQA 1PWVA 1X8NA 2FS6A 1O1UA 3FA6A 3NQ3A 3L0VA 1J7NA 1O0QA 4PJ2A 3NX2A 1ZNGA 1IAGA 1SLMA 2WEXA 2OVXA 2Y6DA 2WQ9A 1N0SA 4R0BA 4EEJA 1P6PA 3WXQA 4IB8A 2KRJA 5IO5A 5B29A 1JKYA 3MBTA 1HMRA 2CKIA 3ELMA 3NBXX 5LJDA 4A3WA 4XMDA 1BEBA 2O62A 1JAPA 2N93A 1DZPA 4H84A 4MVIA 1YWDA 5F7GA 3ZW2A 2R56A 5CZMA 2AT6X 4L1NA 3FR2A 3U0DA 2SRTA 2PY1A 1MUPA 1Y8JA 2OY4A 4XMCA 3EHXA 3NADA 1ZVXA 2JW1A 3C76X 1R0UA 2QO5A 2OXWA 1K7IA 3LGPA 4GDZA 5D1UA 2JIHA 1GT1A 1IAEA 4Y0PA 3HY9A 3B2JA 4GR8A 1JANA 4O9SA 1OM6A 1MX8A 1GKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS0 A;  4R3V A;  5I2Z A;  1KUI A;  3Q2H A;  1A85 A;  3LK8 A;  2MZH A;  3KWV C;  4FXQ A;  3HB2 P;  1GXD A;  1XFU A;  2DW1 A;  1DMT A;  2MLR A;  1ZXC A;  1YQY A;  3OHL A;  4H82 A;  4DF9 A;  1BKC I;  1XFV A;  1G05 A;  2TCL A;  1CGE A;  1ROS A;  4H3X A;  1C8T A;  1JIZ A;  2DW2 A;  1UMT A;  1JJ9 A;  4AYK A;  1AKL A;  3LUM A;  2OY2 A;  1MMP A;  1IAA A;  1IAC A;  5D1T A;  4WZV A;  4XM8 A;  1PWW A;  2E3X A;  2MLS A;  4ZR5 A;  2X3B A;  1FLS A;  2DDY A;  3WV2 A;  2JSD A;  1QJI A;  1KBC A;  5JMY A;  1BKC A;  1BUD A;  4JPA A;  1HTD A;  4H76 A;  3KEJ A;  3TSK A;  2E2D A;  3KEK A;  4JP4 A;  2D1N A;  1G4K A;  3B92 A;  5LAB A;  2J83 A;  1OS9 A;  3LUN A;  1XFW A;  2W13 A;  4JQG A;  1G12 A;  4PKW A;  4HX3 A;  2O36 A;  3N2V A;  1AYK A;  2K2G A;  4GWN A;  4G0D A;  1Y0V A;  3LIR A;  3LKA A;  1HOV A;  4PKQ A;  3TVC A;  1Y93 A;  1B8Y A;  5CXA A;  1I1I P;  4I35 A;  1I73 A;  3HYG A;  5BOY A;  3AIG A;  1FBL A;  3E8R A;  1OM8 A;  1R55 A;  2DW0 A;  1KUK A;  3KHI A;  2W0D A;  3EDZ A;  3EDH A;  2USN A;  966C A;  1BQO A;  2FV5 A;  1QUA A;  1R1J A;  1ND1 A;  2ERO A;  3SHI A;  3KMC A;  1JAQ A;  3O2X A;  5I12 A;  1XUC A;  1BM6 A;  3LMC A;  5H8X A;  4A7B A;  3K7N A;  3L0T A;  1HFC A;  3OHO A;  4GWM A;  1S4B P;  1QJJ A;  3AYK A;  3B2Z A;  1KUH A;  4FXY P;  1SAT A;  1D5J A;  2I47 A;  5CUH A;  1GE7 A;  5D1S A;  4FU4 A;  3LQB A;  4CTH A;  1PWU A;  1GE6 A;  1XFX A;  1BKC E;  1CIZ A;  4G9L A;  1GKC A;  4DD8 A;  3ZVS A;  2RJP A;  4PKR A;  1OO9 A;  1KUF A;  3DPF A;  1OMJ A;  4IUW A;  5B5O A;  1SU3 A;  5BOT A;  1HY7 A;  1XUR A;  3EHY A;  3USN A;  1BUV M;  5I4O A;  1BIW A;  5L7F A;  2Z2D A;  2OXU A;  1SLN A;  1HFS A;  1XFY A;  3B8Z A;  1YCM A;  2L0R A;  4EFS A;  2CLT A;  2PJT A;  2XS3 A;  2JT6 A;  4ON1 A;  4L6T A;  4H30 A;  2N8R A;  4FVL A;  1OS2 A;  1I76 A;  4WF6 A;  2WOA A;  1IAB A;  4DPE A;  1KUG A;  5B5P A;  1R1I A;  1QIC A;  2AYK A;  1C7K A;  1H71 P;  4AUO A;  4XM7 A;  4WKI A;  2MZI A;  5L79 A;  3KME A;  3DPE A;  3ZUK A;  1C3I A;  4Q1L A;  2HU6 A;  1B3D A;  2W14 A;  4PKS A;  2OVZ A;  1GE5 A;  1D8F A;  2O3E A;  1PWP A;  1USN A;  1JAO A;  2OW2 A;  4L63 A;  1JIW P;  3F15 A;  3LJZ A;  3ZXH A;  3G5C A;  3LEA A;  1CK7 A;  1EUB A;  1BZS A;  2V4B A;  5BPA A;  2JNP A;  2POJ A;  1GO8 P;  1BQQ M;  3LIK A;  1EB6 A;  2RJQ A;  1XFZ A;  4GUY A;  1AST A;  1RMZ A;  3EDI A;  3G42 A;  3LQ0 A;  4GR3 A;  5I0L A;  2YB9 A;  3DSL A;  3WV1 A;  1CQR A;  3Q2G A;  1K7G A;  1UTZ A;  2OW9 A;  1A86 A;  4H49 A;  1L6J A;  3TS4 A;  5I3M A;  4L19 A;  1XUD A;  2AIG P;  4PKU A;  1SRP A;  3EWJ A;  3DWB A;  1GKD A;  1G49 A;  2K9C A;  3V96 B;  3CKI A;  1K7Q A;  1UMS A;  3N2U A;  1G9K A;  2QPJ A;  1FM1 A;  3KEC A;  3VTG A;  5D2B A;  4XBH A;  1D7X A;  1CAQ A;  5D3C A;  1PWQ A;  3NX7 A;  1MMB A;  1CXV A;  1MMQ A;  3HY7 A;  1OM7 A;  1O0T A;  3LJG A;  3HDA P;  1SMP A;  1ZTQ A;  5I43 A;  3LJT A;  4GR0 A;  3RTS A;  4QKZ A;  1YOU A;  5D7W A;  1ATL A;  3LE9 A;  1PWV A;  1KAP P;  4WK7 A;  2W15 A;  4IN9 A;  3RTT A;  4ILW D;  3L0V A;  1J7N A;  456C A;  1O0Q A;  4JIJ A;  1IAG A;  2YIG A;  3O64 A;  1SLM A;  3TT4 A;  2DDF A;  1JK3 A;  2OVX A;  2D1O A;  2Y6D A;  3I7G A;  830C A;  3HDB A;  1UEA A;  4J4M A;  3VI1 A;  2FV9 A;  3EDG A;  3KRY A;  2KRJ A;  2J0T A;  3F1A A;  1JKY A;  4GF1 A;  4AXQ A;  4DV8 A;  2CKI A;  3ELM A;  3K7L A;  3BA0 A;  3MA2 A;  2A8H A;  1IAD A;  1CGF A;  2JT5 A;  4A3W A;  1Z3J A;  2X3A A;  1R1H A;  3UVC A;  2OI0 A;  1UTT A;  1AF0 A;  2W12 A;  1DTH A;  3F18 A;  4WKE A;  1JAP A;  3F19 A;  4H84 A;  1BSW A;  2XS4 A;  4GQL A;  3I7I A;  1MMR A;  2OXZ A;  4XCT A;  2OW1 A;  3U1R A;  4H1Q A;  2WO9 A;  2X7M A;  3P24 A;  2ERP A;  3DNG A;  1QIA A;  2X3C A;  1CGL A;  2MZE A;  2OZR A;  4PKV A;  3HBU P;  1EAK A;  5CZM A;  4PKT A;  1YP1 A;  4JA1 A;  4H2E A;  2Y6C A;  1GO7 P;  1RM8 A;  3HBV P;  3DL1 A;  2SRT A;  1ZP5 A;  1Y8J A;  2OY4 A;  3EHX A;  2WO8 A;  1ZVX A;  3AYU A;  1Q3A A;  1MNC A;  2ERQ A;  4XM6 A;  2OXW A;  1K7I A;  3LIL A;  1WNI A;  3F16 A;  3LGP A;  1R54 A;  1D8M A;  5D1U A;  2OW0 A;  2JIH A;  1IAE A;  1HV5 A;  3F17 A;  3HY9 A;  4GR8 A;  1JAN A;  1QIB A;  3WV3 A;  1ZXV A;  4HMA A;  4I03 A;  1OM6 A;  3GBO A;  4IJO A;  3P1V A;  1JH1 A;  4AIG A; 
#chains in the Genus database with same CATH topology
 1ZS0 A;  4R3V A;  4U3Q A;  2WPU A;  3LK8 A;  1TXL A;  2MZH A;  3KWV C;  3MX7 A;  3IA8 A;  3ZZV A;  4ALO A;  5FQ8 E;  2Z4H A;  4GGZ A;  1XFU A;  1QY2 A;  2MLR A;  1ZXC A;  1YQY A;  2MWH A;  4DF9 A;  4HPD A;  1LEL A;  1XFV A;  1VYG A;  1NDJ A;  1S44 A;  1CGE A;  4H3X A;  5D45 A;  1VWF B;  1IFB A;  4XME A;  3Q34 A;  1K24 A;  3TGA A;  1OPA A;  1IAA A;  5K67 A;  5IO7 A;  3VHM A;  3SZI A;  3TZS A;  4XM8 A;  1ACD A;  2WEW A;  3APX A;  4K19 A;  3RE6 A;  3ZWE A;  2MLS A;  3KFF A;  3RZY A;  1LDO A;  3WV2 A;  4AZM A;  5FAZ A;  3WOV A;  3FA7 A;  1BKC A;  4JPA A;  2GH7 A;  1X8O A;  3KEJ A;  1U17 A;  4BX5 B;  1GXA A;  2RTH B;  3BX7 A;  1ZNK A;  2ACO A;  4CDC A;  4Z2O A;  2J83 A;  1XFW A;  1SRF A;  1T0V A;  2IZJ A;  1DC9 A;  3NQ9 A;  2Q2M A;  1H91 A;  4BGF A;  1HY2 A;  3ZW1 A;  4ORW A;  3P6D A;  1VWK B;  3WJB A;  1B8Y A;  1RXK A;  5CXA A;  1O1V A;  4CDD A;  3BY0 A;  1RLB E;  4BX6 A;  1I73 A;  1NP1 A;  1OM8 A;  3SOT A;  2UYW A;  1I9H A;  1KUK A;  5EPQ A;  4XMG A;  4EQA C;  3EDH A;  966C A;  1WUB A;  4TQ2 A;  4O49 A;  4Y0Q A;  2HKD A;  1ALB A;  2ERO A;  2VDF A;  5HZ8 A;  3O2X A;  3SAO A;  5I12 A;  4I60 A;  1AB0 A;  2L5P A;  1SY0 A;  3B2Z A;  3BU1 A;  1KUH A;  1SAT A;  1D5J A;  4NNT A;  1GE7 A;  3PQS A;  4FU4 A;  2HYS A;  1SY2 A;  1PWU A;  1FJ1 E;  1HXL A;  1NP4 A;  1BSQ A;  3T2W A;  1XFX A;  2OF9 A;  1CIZ A;  5L8N A;  3WZO A;  2RJP A;  2UZ2 A;  4ORU A;  3HPE A;  1JBH A;  5B5O A;  1HBP A;  3FW4 A;  5BOT A;  1XUR A;  1KQW A;  2CAM A;  4BOE A;  2PI3 O;  3EM0 A;  4MEE A;  3EHY A;  2OL7 A;  1BUV M;  5HBS A;  2RD7 C;  1BIW A;  5L7F A;  2Z2D A;  4ORS A;  1SLN A;  1HFS A;  1XFY A;  1HXZ A;  1YCM A;  2RTI B;  2RTJ A;  1E02 A;  3KZA A;  4DQ4 A;  3BS2 A;  3CMP A;  2BT9 A;  3RWX A;  4H30 A;  4TKJ A;  4AZN A;  2X45 A;  3P6G A;  4WF6 A;  4A1Y A;  5L3Y A;  5HCC C;  2AYK A;  1PBO A;  4QRL A;  1VPR A;  4YKM A;  3KQ0 A;  4GGR A;  3APW A;  1LIB A;  2MZI A;  3KME A;  4IAX A;  3DPE A;  1KZW A;  4Q1L A;  2DM5 A;  3V8U A;  2HU6 A;  3HOL A;  2OVZ A;  4U46 A;  1GE5 A;  3BRN A;  1D8F A;  2Z4I A;  5LKE A;  1EPB A;  1OBQ A;  3PEC A;  1LFO A;  2RQ0 A;  2E4J A;  3LJZ A;  3G5C A;  4NV8 A;  1HN2 A;  2A3F X;  1LDQ A;  4NV7 A;  2Q2P A;  5DPQ A;  3FA8 A;  1AST A;  1OSP O;  3G42 A;  3LQ0 A;  2RTF B;  3DSL A;  1CQR A;  4MVK A;  2W2A A;  2F09 A;  2AT0 X;  1L6J A;  4CPH A;  1FTP A;  5I3M A;  1XUD A;  2RTN B;  4GD9 A;  1SRP A;  3FEK A;  2RTM A;  1L6M A;  5FEN A;  1K7Q A;  4I95 A;  3N2U A;  3LTW A;  2C4I A;  3VTG A;  4ID2 A;  1UYO X;  3BLG A;  1SXU A;  2GTL O;  4ZFX A;  4XBH A;  1B8E A;  2GC9 A;  4BX7 A;  1SWB A;  4ES7 A;  1OM7 A;  1SMP A;  1ZTQ A;  3FW5 A;  3LJT A;  4Y59 A;  2QCB A;  3MM0 A;  2FHL A;  1SRH A;  2OY8 A;  4IN9 A;  456C A;  1UYN X;  3PK2 A;  1DFV A;  4ZH9 A;  1DZJ A;  2YIG A;  1OEE A;  4EDE A;  4GH7 A;  2D1O A;  3D97 A;  4IB7 A;  3I7G A;  1E5P A;  3T6F A;  3HDB A;  2JU8 A;  1KT6 A;  4GNY A;  2A0A A;  1XCA A;  4LKP A;  1GM6 A;  1MK5 A;  3EDG A;  4KC8 A;  1GGL A;  3GAQ A;  4AXQ A;  4QZT A;  1SWK A;  2LA7 A;  4ORY A;  1AVD A;  3STN A;  2JT5 A;  4YH0 A;  1Z3J A;  4O4O A;  1OEK A;  3UVC A;  2IZG B;  4FQB B;  2X8S A;  2GTL N;  4WKE A;  2ALL X;  1CRB A;  4OEM A;  1BSW A;  2IFB A;  4I6S A;  4UU2 A;  1KGL A;  1PTS A;  2A5C A;  4O3Y A;  1QG5 A;  4XCT A;  3U1R A;  1LNM A;  2AT3 X;  1BM5 A;  2NP1 A;  4ARH A;  2ERP A;  1AVG I;  2X3C A;  3WBG A;  3ELX A;  2MF6 A;  4PKV A;  1EAK A;  2L68 A;  4LZV A;  1YP1 A;  4JA1 A;  5EZ2 A;  4M7M A;  3DTE A;  3O22 A;  3APV A;  4O3W A;  1BRP A;  4IAB A;  1LIF A;  1GX8 A;  3PH6 A;  2MM3 A;  4Z2P A;  5FQ7 E;  4CDE A;  1RM8 A;  3HBV P;  5BVQ A;  1MNC A;  2I5Z O;  4XM6 A;  3HWG A;  3WJE A;  4GET A;  3LIL A;  1WNI A;  3F16 A;  5F6Z A;  2GJ5 A;  3IFB A;  3HOE A;  3VG6 A;  4HWM A;  1SY1 A;  1URE A;  2G79 A;  2W2F A;  2A2U A;  1KL5 A;  3KFG A;  4WHI A;  3PH5 A;  3APU A;  4AIG A;  4OS3 A;  4N7C A;  4U8U M;  1N9Y A;  3U03 A;  2FKG A;  2ACP X;  1UZ2 X;  3HB2 P;  2BSZ A;  4H82 A;  5IO6 A;  4I9S A;  1G05 A;  2YUF A;  1C8T A;  2DW2 A;  3U9P C;  1UMT A;  2WSJ A;  4O3X B;  1JJ9 A;  1EI5 A;  1KOI A;  2HZR A;  5JR8 A;  1STS B;  4AYK A;  4AZQ A;  4L7A A;  2X32 A;  2RTR B;  1MMP A;  5AEO A;  4CK4 A;  5D1T A;  1LCW A;  4IMO A;  5DG4 A;  4ALB A;  5B11 O;  5JD2 A;  4ODD A;  5EEE A;  1QJI A;  2ZAI A;  4D6B A;  1BUD A;  2EU7 X;  3VG7 A;  1OZ9 A;  1PM1 X;  3SZH A;  3KVN A;  3I17 A;  3BDR A;  1OS9 A;  3QQ2 A;  3UEX A;  4HX3 A;  4HFO A;  2O36 A;  3N2V A;  2K2G A;  2FLJ A;  3EW2 A;  4ZHH A;  5BVT A;  5CE4 A;  4PKQ A;  1KT5 A;  3N91 A;  3RE5 A;  1VWI B;  1X71 A;  1LPJ A;  1Y93 A;  1CBQ A;  2OY1 O;  4I35 A;  5EDB A;  1SWF A;  3P6C A;  4I9R A;  2BLG A;  5LJB A;  1CJ5 A;  3HYG A;  4PSQ A;  2CM4 A;  5B10 O;  1TVI A;  3MG5 A;  1ADL A;  1FBL A;  1SA8 A;  2RTK A;  2KD2 A;  2R74 A;  2W0D A;  3RDS A;  3JQO A;  4AZR A;  1OPB A;  4YFQ A;  2OFM X;  1W4T A;  3Q6L A;  2IZK A;  1Y9T A;  2FWV A;  3SHI A;  4ZHD A;  5H9A A;  3CBC A;  1BM6 A;  1XUC A;  1N7Y A;  5EDC A;  1AVE A;  4GWM A;  2OVE A;  1QJJ A;  1NBX A;  3B2K A;  5BVS A;  1SMP I;  2KT4 B;  3UEW A;  2I47 A;  5CUH A;  5D1S A;  4GKC A;  3LQB A;  4CTH A;  3L4R A;  4YDA A;  5HTE A;  4G9L A;  2XST A;  3NX1 A;  1GKC A;  4DD8 A;  2K23 A;  2IZH B;  4MVE A;  1OMJ A;  4IUW A;  3FA9 A;  1VWC B;  4GZV A;  2OY5 O;  1ZRY A;  4O4U A;  4QGV A;  3UEU A;  1JMZ A;  2A5B A;  3FR5 A;  3USN A;  2VFB A;  3KFI A;  1FDQ A;  4JNJ A;  3WJC A;  2C1S A;  4OS8 A;  1IKE A;  2L0R A;  5F58 A;  5LJC A;  2PJT A;  3S5X A;  3P6H A;  4DCB A;  1KL3 A;  4YBP A;  4O4X A;  4O3Z A;  4FVL A;  3BU9 A;  1I76 A;  2RTL A;  2WOA A;  3CR6 A;  1IAB A;  5B5P A;  2CBS A;  1X8P A;  3STK A;  5HTD A;  3ZUO A;  1I78 A;  1QIC A;  3KFH A;  1E2T A;  4JO6 A;  1TOU A;  1C7K A;  3EC5 A;  3AKM A;  3P6E A;  1JJX A;  1JJJ A;  4RUU A;  3S60 A;  3ZUK A;  1T68 X;  3CQR A;  1JYJ A;  4GNW A;  4YGH A;  2W14 A;  4GDA A;  2ZSC A;  4PKS A;  5K68 A;  3NR3 A;  1GKA A;  3OJY C;  1PWP A;  5H9K A;  2Q4N A;  2A13 A;  2OW2 A;  1I4U A;  1RBP A;  1BBP A;  4L63 A;  2W2B A;  1IKJ A;  3T2X A;  1EUB A;  1BZS A;  1B4M A;  1PEE A;  3B2L A;  2JNP A;  1GO8 P;  2FKJ A;  1BQQ M;  3LIK A;  2RJQ A;  1XFZ A;  4GUY A;  2AH7 X;  2X34 A;  1KL4 A;  2YB9 A;  3WV1 A;  4TNN A;  1VWA B;  2OW9 A;  1Y52 X;  4L19 A;  1AEL A;  2VFC A;  4HPB A;  3NP1 A;  4TJZ A;  3UAQ A;  1RAV A;  4LZU A;  5LJG A;  5BYP A;  4KT5 A;  1A2D A;  3G7X A;  2AMM X;  1FEL A;  5LJE A;  1ZNL A;  1JZU A;  5HZ5 A;  5D48 A;  4EXZ A;  1Y53 X;  5K06 A;  1YWC A;  1SY3 A;  1NQM A;  5D3C A;  4BBO A;  4YGZ A;  1SWQ A;  3T6L A;  1W6F A;  1ICN A;  3NX7 A;  2IZC B;  1CXV A;  1KT4 A;  1MMQ A;  1D3S A;  3VG3 A;  3HY7 A;  1KXO A;  1O0T A;  2HNX A;  3WYP A;  5FFH A;  5D7W A;  1LKE A;  3RDM A;  2OVD A;  4CPH B;  4WK7 A;  1TW4 A;  3RTT A;  3MVF A;  4Y0R A;  3VG2 A;  4JIJ A;  1NC9 A;  2WR6 A;  3E3C A;  1JK3 A;  1GX3 A;  1GT4 A;  4ML7 B;  1UEA A;  3PDF A;  2JOZ A;  3FID A;  2X46 A;  1VWP B;  2J0T A;  3F1A A;  4ZHC A;  4GF1 A;  2XKL A;  4DV8 A;  4BX7 B;  3K7L A;  1PMP A;  2JMB A;  3BA0 A;  1IAD A;  1SLG B;  3K3L A;  1CGF A;  3EMM A;  1LUQ A;  4BJ8 A;  1SWH A;  2BS5 A;  2AL0 X;  3PP6 A;  2LKK A;  5LKF A;  3SLO A;  1UTT A;  3OE3 A;  4AZO A;  2W12 A;  4IMN A;  5HCD C;  3F18 A;  5AJC A;  1EAL A;  1QY0 A;  2G8C O;  4QQ1 A;  2XS4 A;  4GQL A;  3B2I A;  3PQU A;  1MMR A;  3D9W A;  1VWL B;  2OW1 A;  4H1Q A;  4IB9 A;  4HPC A;  2WO9 A;  2X7M A;  4YCH A;  3DNG A;  1N43 A;  1OBU A;  4Y0S A;  1CGL A;  2MZE A;  4BCS A;  4FBR A;  3VG4 A;  2RCQ A;  4PKT A;  1JQP A;  4ZJ0 A;  2RTB B;  2Y6C A;  3STM X;  4Z2V A;  4CPI A;  3DL1 A;  2FS7 A;  2OYB O;  3HWD A;  1ZP5 A;  3FEP A;  4COT A;  1SWD A;  4QYP A;  4BVM A;  2ERQ A;  3WVM A;  1EXS A;  4TKH A;  3FDC A;  1SWL A;  1D8M A;  2HMB A;  2CZU A;  3ZW0 A;  2OW0 A;  1HV5 A;  1B0O A;  4FBO A;  3F17 A;  4UU3 A;  1Y9L A;  2FTB A;  1LIC A;  4JGL A;  3WV3 A;  5F6B A;  4HMA A;  3GBO A;  4IJO A;  3P1V A;  3GE2 A;  4ZGF A;  3T1D A;  4NNS A;  1KUI A;  3Q2H A;  2IZB A;  3HK1 A;  2RTE B;  2YMS A;  1VYF A;  1GXD A;  1FE3 A;  3VE2 A;  4CPF A;  1I06 A;  2R73 A;  3OHL A;  1BKC I;  1U18 A;  3OD9 A;  4GJS A;  3RDQ A;  4AYH A;  2TCL A;  1ROS A;  3ZQ3 A;  5HA1 A;  2LFO A;  1DZM A;  3LHN A;  1AKL A;  3LUM A;  4GU8 A;  3HWF A;  2JU3 A;  1IAC A;  3FIQ A;  3DTK A;  4JHQ A;  1SWJ A;  1SRE A;  1FLS A;  3S26 A;  2JSD A;  1KBC A;  5JMY A;  1LIE A;  4YFR A;  2NND A;  3KEK A;  2D1N A;  3WJF A;  4O4S A;  4OMX A;  5LAB A;  1U0X A;  3LUN A;  1VWM B;  4JQG A;  1YWA A;  1G12 A;  3F6Z B;  1AYK A;  4GWN A;  1SWP A;  2LBV A;  3SLT A;  1Y0V A;  3LIR A;  2RN4 A;  1SWO A;  4YVB A;  1MM9 A;  5H9N A;  3TVC A;  2G78 A;  1YWB A;  1I1I P;  1SXW A;  2OFA A;  3SZJ A;  1BRQ A;  4EKV A;  4OS0 A;  3DTQ A;  3VG5 A;  3E8R A;  1X8Q A;  1R55 A;  2X56 A;  2DW0 A;  1JYD A;  3KHI A;  1XAX A;  4YKO A;  4A60 A;  1SWS A;  5HA0 A;  2RTA A;  4NP1 A;  2FV5 A;  2QO4 A;  2K62 A;  1ND1 A;  1JAQ A;  1MX7 A;  3VGW A;  4RUN A;  3LMC A;  5H8X A;  4A7B A;  3K7N A;  3L0T A;  1SWC A;  3FEL A;  3OHO A;  1BSO A;  3TF6 A;  1S4B P;  3TGB A;  3C78 X;  3F8A A;  2CM9 A;  2FGS A;  1HQP A;  2OVS A;  1VWD B;  4A8Z A;  1BLR A;  2G7B A;  1KQX A;  1GE6 A;  2BC3 A;  1BKC E;  3JS1 A;  1MDC A;  4PKR A;  1OO9 A;  1I05 A;  1KUF A;  3DPF A;  2RTG B;  3DTI A;  1NGL A;  1SU3 A;  1HY7 A;  2GTL M;  3QKG A;  4QNI A;  2L9C A;  3OBL A;  4YFP A;  5KIC A;  4IBA A;  2BHV A;  1N4J A;  5HAE A;  4YDB A;  5I4O A;  1CBI A;  5D4A A;  2BS6 A;  1VYO A;  2RTP B;  3B8Z A;  3AUM O;  4LKT A;  1A57 A;  4EFS A;  2CLT A;  4KH8 A;  2XS3 A;  3RDX A;  1IFC A;  1SLE B;  4L6T A;  2N8R A;  1MVG A;  2QO6 A;  4DPE A;  2KTS A;  2Y3F A;  3O2Y A;  2AT5 X;  2GTF X;  1S7D A;  2MO5 A;  2LBA A;  4XM7 A;  2OFR X;  1D2U A;  4WKI A;  2C1Q A;  1SWR A;  4ZCB A;  3EBW A;  2DJF A;  1B3D A;  1OBP A;  1XKI A;  1G5W A;  3H3I A;  4B55 A;  2O3E A;  1MOY A;  3D95 A;  4IRW A;  4KCA A;  3VHH A;  3DSZ A;  4N7D A;  4ZHG A;  1JV4 A;  1DZK A;  1JIW P;  2OL6 O;  1T8V A;  3ZXH A;  3LEA A;  4YGG A;  1CK7 A;  1WBI A;  1VWJ B;  2POJ A;  1B56 A;  1EIO A;  1EB6 A;  4GR3 A;  1RXH A;  3Q2G A;  1K7G A;  1UTZ A;  2CZT A;  2AKQ A;  2KTD A;  1GT5 A;  3TS4 A;  1XM5 A;  1E06 A;  4PKU A;  4DQ3 A;  3PPT A;  4WFU A;  5FQ6 E;  3SLJ A;  2K9C A;  4YMY A;  1UMS A;  3CBS A;  3NPO A;  3ZW1 B;  1G9K A;  1FM1 A;  1E00 A;  3LV4 A;  3KEC A;  1GKA B;  2ZAG A;  4IB6 A;  5D2B A;  4QAE A;  2QOM A;  1IW2 A;  2F01 A;  1D7X A;  4BX6 B;  3VU1 A;  4YBU A;  5AQ6 A;  3ZI8 A;  1SWU A;  1QWD A;  1LID A;  1LF7 A;  1DV9 A;  1MMB A;  3P02 A;  1A18 A;  2Y3E A;  3LJG A;  2OVA A;  3X00 A;  3D4R A;  1SWA A;  4TLJ A;  2FR3 A;  3RTS A;  4QKZ A;  5C0N A;  4QYN A;  4MIS A;  1SRJ A;  1KAP P;  2W15 A;  1ERB A;  1K3B A;  4ILW D;  1X89 A;  5D47 A;  4CDF A;  3WJD A;  3O64 A;  3HTY A;  3TT4 A;  2DDF A;  1RXJ A;  3WJG A;  4BQU A;  1SXX A;  830C A;  1VWR B;  4J4M A;  2WQA E;  3VI1 A;  2OY7 A;  2FV9 A;  1QFT A;  3KRY A;  5CSE A;  5IXG A;  2FHN X;  3JSQ A;  2IZF B;  3MA2 A;  2A8H A;  1YP6 A;  4DNE A;  4CPE A;  2X3A A;  4I3C A;  1R1H A;  4Z28 A;  2OI0 A;  1AF0 A;  5B3M O;  1DTH A;  1VWB B;  1JMX A;  2NNQ A;  3F19 A;  1TOW A;  3I7I A;  4KII A;  3S5V A;  2OXZ A;  1G74 A;  3FMZ A;  2F73 A;  4NYR A;  3P24 A;  1QIA A;  2OZR A;  2POA A;  3HBU P;  2MJI A;  2OFB A;  3UEV A;  4H2E A;  2Q9S A;  2RA6 A;  2WUT A;  3ELZ A;  4ZR2 A;  3VHI A;  1GO7 P;  1VWE B;  5F1E A;  2OZQ A;  1SXY A;  3EBK A;  4FGI B;  1LCV A;  4IAW A;  4QGX A;  5HZ9 A;  2WO8 A;  3AYU A;  1Q3A A;  1SWN A;  4I3D A;  2AF5 A;  5HZ6 A;  1N9M A;  2FT9 A;  1R54 A;  1G7N A;  2JGS A;  1RSU B;  1SWG A;  3O19 A;  3WZP A;  2X8T A;  4AZP A;  1AQB A;  3RSW A;  2QMI A;  2QM9 A;  1QIB A;  1ZNE A;  1ZXV A;  1EW3 A;  1HQQ A;  3BX8 A;  4I03 A;  2IZD B;  1Y0G A;  4M6S A;  4U9C A;  5H8T A;  5I2Z A;  1DF3 A;  1A85 A;  4XMH A;  4BX5 A;  4FXQ A;  3PED A;  2AVI A;  4CV7 A;  4C5P A;  1QAB E;  2IZL B;  1W5R A;  4Y5D A;  1FEN A;  2DW1 A;  1SWT A;  1DMT A;  1ML7 A;  1KZX A;  1BSY A;  1DF8 A;  2OF8 A;  3I0A A;  3C77 X;  1JIZ A;  5IRA A;  1VWN B;  2M4L A;  1EII A;  4INN A;  4FBV A;  2OY2 A;  3ZW0 B;  4OEL A;  1CBR A;  4WZV A;  3B2H A;  1PWW A;  2E3X A;  1PBY A;  4ZR5 A;  2X3B A;  2DDY A;  4XMF A;  2FRS A;  1JH1 A;  1HMS A;  1GT3 A;  5B2A O;  5LJK A;  2FR2 A;  5HWZ A;  1KT3 A;  1HTD A;  4H76 A;  3TSK A;  2OL8 O;  2JU7 A;  2E2D A;  4JP4 A;  1G4K A;  1YIV A;  3B92 A;  4WFV A;  1EQD A;  2IZI A;  2W13 A;  4QGW A;  4PKW A;  5IRU A;  1X8U A;  1I04 A;  2NNE A;  4G0D A;  1IIU A;  3LKA A;  3D96 A;  1HOV A;  4OMW A;  2KW1 A;  3CWK A;  5KID A;  5B5G A;  5BOY A;  4Z6J A;  5H9L A;  1SWE A;  5EED A;  3AIG A;  3RY1 A;  3EYC A;  4NW4 A;  5D8J A;  1JIW I;  1VWQ B;  3FEN A;  3EDZ A;  2USN A;  3NQK A;  1BQO A;  4D6A A;  3AKN A;  5AJB A;  1QUA A;  4LQZ A;  1R1J A;  3KMC A;  4ZH6 A;  1SLF B;  4GJV A;  2HZQ A;  3F9D A;  1HFC A;  4AW8 A;  1QQS A;  1Y55 X;  1JJU A;  4GGT A;  3AYK A;  1CBS A;  4FXY P;  3VPJ E;  4U8U O;  1LCZ A;  1STP A;  2P8G A;  3EW1 A;  5HCE C;  1EUO A;  1TVQ A;  3ZVS A;  2RTO B;  2AT8 X;  3BSZ E;  1A3Y A;  2IZE B;  4I3B A;  4KC7 A;  4GRJ A;  2L67 A;  1BWY A;  4OKA A;  5HZQ A;  1NQN A;  2OXU A;  2WWP A;  4MIR A;  2RTQ B;  4ZHF A;  1MEP A;  4ORR A;  3HWE A;  3FR4 A;  2JT6 A;  4ON1 A;  1OS2 A;  1QY1 A;  2ASN X;  3WYQ A;  1KUG A;  2HLV A;  4YCE A;  1VWG B;  1R1I A;  5CYB A;  2A8G A;  4GK9 A;  1H71 P;  4AUO A;  1EPA A;  4NYQ A;  4U8U N;  3WZQ A;  1ZND A;  3CQN A;  5F2B A;  5L79 A;  4HPA A;  4ZGU A;  1C3I A;  1RST B;  2A2G A;  4A1H A;  3FLL A;  3CKF A;  1VWO B;  2RCT A;  4NLI A;  1HMT A;  1G85 A;  3VE1 A;  4CSB A;  1USN A;  1JAO A;  2Q39 A;  3P6F A;  1S2P A;  3F15 A;  1QFV A;  3ZUI A;  5LJH A;  2V4B A;  2CBR A;  4TKB A;  5BPA A;  3FYF A;  4L3R A;  1KFF A;  1RMZ A;  3EDI A;  4WBK A;  1ERX A;  2ANS A;  4EFG A;  1KT7 A;  1GX9 A;  2X8F A;  5I0L A;  1SRI A;  4GE1 A;  4Z27 A;  4H49 A;  1A86 A;  1ICM A;  5KHP A;  2AIG P;  3EWJ A;  2YG2 A;  3DWB A;  1G49 A;  3V96 B;  4ORX A;  2I5V O;  3CKI A;  2QPJ A;  1ZNH A;  5IRW A;  2LB6 A;  3RBY A;  5B27 A;  5L8I A;  3CKG A;  5L8O A;  1YUP A;  1CAQ A;  1FEM A;  1Z24 A;  1O8V A;  1PWQ A;  1BJ7 A;  1OEJ A;  4MVL A;  4NLJ A;  2X4M A;  1YP7 A;  1SLD B;  2JN3 A;  3TGC A;  3HDA P;  2MHD A;  5I43 A;  3RDU A;  1STR B;  4GR0 A;  2QOS C;  3RKG A;  4QZU A;  1YOU A;  1ATL A;  3LE9 A;  1HBQ A;  1PWV A;  1X8N A;  2FS6 A;  1O1U A;  3FA6 A;  3NQ3 A;  4GUZ A;  3L0V A;  1J7N A;  1O0Q A;  4PJ2 A;  5CHK A;  3NX2 A;  1ZNG A;  1IAG A;  1SLM A;  2WEX A;  2OVX A;  2Y6D A;  5B5F A;  2WQ9 A;  2RTD B;  1N0S A;  4R0B A;  4EEJ A;  1P6P A;  3WXQ A;  4IB8 A;  2KRJ A;  5IO5 A;  5B29 A;  1JKY A;  3MBT A;  1HMR A;  2CKI A;  3ELM A;  3NBX X;  5LJD A;  4A3W A;  4XMD A;  1BEB A;  2IZA A;  2Y32 A;  1SRG A;  2O62 A;  1JAP A;  2N93 A;  1DZP A;  4H84 A;  4MVI A;  3RDO A;  1YWD A;  5F7G A;  3ZW2 A;  3RY2 A;  2R56 A;  5CZM A;  1VWH B;  2AT6 X;  4L1N A;  3FR2 A;  2G5L A;  2RTC B;  3U0D A;  2SRT A;  2PY1 A;  1MUP A;  1Y8J A;  2OY4 A;  4XMC A;  3EHX A;  2DJG A;  3AEH A;  3NAD A;  1ZVX A;  2JW1 A;  3C76 X;  1R0U A;  2QO5 A;  1IJ8 A;  2OXW A;  1K7I A;  3LGP A;  2X55 A;  4GDZ A;  5D1U A;  2JIH A;  1GT1 A;  1IAE A;  4Y0P A;  3HY9 A;  3WZN A;  3B2J A;  4GR8 A;  1JAN A;  4O9S A;  1OM6 A;  1MX8 A;  1GKD A; 
#chains in the Genus database with same CATH homology
 1ZS0 A;  4R3V A;  4U3Q A;  3LK8 A;  1TXL A;  2MZH A;  3KWV C;  3MX7 A;  3IA8 A;  3ZZV A;  4ALO A;  5FQ8 E;  2Z4H A;  1XFU A;  1QY2 A;  2MLR A;  1ZXC A;  1YQY A;  2MWH A;  4DF9 A;  4HPD A;  1XFV A;  1VYG A;  1S44 A;  1CGE A;  4H3X A;  5D45 A;  1IFB A;  4XME A;  3TGA A;  1OPA A;  1IAA A;  5IO7 A;  3TZS A;  4XM8 A;  1ACD A;  2WEW A;  3APX A;  4K19 A;  3ZWE A;  2MLS A;  3KFF A;  3RZY A;  3WV2 A;  4AZM A;  5FAZ A;  3WOV A;  3FA7 A;  1BKC A;  4JPA A;  1X8O A;  3KEJ A;  1U17 A;  1GXA A;  3BX7 A;  1ZNK A;  2ACO A;  2J83 A;  1XFW A;  1T0V A;  1DC9 A;  3NQ9 A;  2Q2M A;  1H91 A;  3ZW1 A;  4ORW A;  3P6D A;  3WJB A;  1B8Y A;  5CXA A;  1O1V A;  3BY0 A;  1RLB E;  1I73 A;  1NP1 A;  1OM8 A;  3SOT A;  1KUK A;  5EPQ A;  4XMG A;  4EQA C;  3EDH A;  966C A;  4TQ2 A;  4O49 A;  4Y0Q A;  1ALB A;  2ERO A;  5HZ8 A;  3O2X A;  3SAO A;  5I12 A;  1AB0 A;  2L5P A;  1SY0 A;  3B2Z A;  3BU1 A;  1KUH A;  1SAT A;  1D5J A;  4NNT A;  1GE7 A;  3PQS A;  4FU4 A;  2HYS A;  1SY2 A;  1PWU A;  1NP4 A;  1BSQ A;  1XFX A;  1CIZ A;  5L8N A;  2RJP A;  4ORU A;  1JBH A;  5B5O A;  1HBP A;  3FW4 A;  5BOT A;  1XUR A;  1KQW A;  4BOE A;  3EM0 A;  3EHY A;  1BUV M;  5HBS A;  2RD7 C;  1BIW A;  5L7F A;  2Z2D A;  4ORS A;  1SLN A;  1HFS A;  1XFY A;  1YCM A;  1E02 A;  3KZA A;  4DQ4 A;  3BS2 A;  3CMP A;  2BT9 A;  3RWX A;  4H30 A;  4TKJ A;  4AZN A;  2X45 A;  3P6G A;  4WF6 A;  4A1Y A;  5HCC C;  2AYK A;  1PBO A;  4QRL A;  1VPR A;  4YKM A;  3KQ0 A;  3APW A;  1LIB A;  2MZI A;  3KME A;  4IAX A;  3DPE A;  1KZW A;  4Q1L A;  2DM5 A;  3V8U A;  2HU6 A;  3HOL A;  2OVZ A;  1GE5 A;  3BRN A;  1D8F A;  2Z4I A;  5LKE A;  1EPB A;  1OBQ A;  3PEC A;  1LFO A;  2RQ0 A;  2E4J A;  3LJZ A;  3G5C A;  1HN2 A;  2A3F X;  2Q2P A;  5DPQ A;  3FA8 A;  1AST A;  3G42 A;  3LQ0 A;  3DSL A;  1CQR A;  4MVK A;  2W2A A;  2F09 A;  2AT0 X;  1L6J A;  1FTP A;  5I3M A;  1XUD A;  1SRP A;  3FEK A;  1L6M A;  5FEN A;  1K7Q A;  4I95 A;  3N2U A;  3VTG A;  4ID2 A;  3BLG A;  1SXU A;  2GTL O;  4ZFX A;  4XBH A;  1B8E A;  2GC9 A;  4ES7 A;  1OM7 A;  1SMP A;  1ZTQ A;  3FW5 A;  3LJT A;  4IN9 A;  456C A;  1DFV A;  4ZH9 A;  1DZJ A;  2YIG A;  1OEE A;  4EDE A;  4GH7 A;  2D1O A;  3D97 A;  4IB7 A;  3I7G A;  1E5P A;  3HDB A;  2JU8 A;  1KT6 A;  2A0A A;  4GNY A;  1XCA A;  4LKP A;  1GM6 A;  3EDG A;  4KC8 A;  1GGL A;  3GAQ A;  4AXQ A;  4QZT A;  2LA7 A;  4ORY A;  3STN A;  2JT5 A;  4YH0 A;  1Z3J A;  4O4O A;  1OEK A;  3UVC A;  4FQB B;  2X8S A;  2GTL N;  4WKE A;  2ALL X;  1CRB A;  1BSW A;  2IFB A;  4I6S A;  4UU2 A;  1KGL A;  4O3Y A;  1QG5 A;  4XCT A;  3U1R A;  1LNM A;  2AT3 X;  1BM5 A;  2NP1 A;  4ARH A;  2ERP A;  1AVG I;  2X3C A;  3WBG A;  3ELX A;  4PKV A;  1EAK A;  2L68 A;  4LZV A;  1YP1 A;  4JA1 A;  5EZ2 A;  4M7M A;  3DTE A;  3O22 A;  3APV A;  4O3W A;  1BRP A;  4IAB A;  1LIF A;  1GX8 A;  3PH6 A;  2MM3 A;  5FQ7 E;  1RM8 A;  3HBV P;  5BVQ A;  1MNC A;  4XM6 A;  3HWG A;  3WJE A;  4GET A;  3LIL A;  1WNI A;  3F16 A;  5F6Z A;  2GJ5 A;  3IFB A;  3HOE A;  3VG6 A;  4HWM A;  1SY1 A;  1URE A;  2G79 A;  2W2F A;  2A2U A;  3KFG A;  4WHI A;  3PH5 A;  3APU A;  4AIG A;  4OS3 A;  4N7C A;  4U8U M;  3U03 A;  2ACP X;  1UZ2 X;  3HB2 P;  4H82 A;  5IO6 A;  4I9S A;  1G05 A;  2YUF A;  1C8T A;  2DW2 A;  3U9P C;  1UMT A;  2WSJ A;  4O3X B;  1JJ9 A;  1EI5 A;  1KOI A;  2HZR A;  5JR8 A;  4AYK A;  4AZQ A;  4L7A A;  1MMP A;  5AEO A;  4CK4 A;  5D1T A;  4IMO A;  5DG4 A;  4ALB A;  4ODD A;  5EEE A;  1QJI A;  2ZAI A;  4D6B A;  1BUD A;  2EU7 X;  3VG7 A;  1PM1 X;  3I17 A;  3BDR A;  1OS9 A;  3UEX A;  4HX3 A;  4HFO A;  2O36 A;  3N2V A;  2K2G A;  2FLJ A;  4ZHH A;  5BVT A;  5CE4 A;  4PKQ A;  1KT5 A;  3N91 A;  1X71 A;  1LPJ A;  1Y93 A;  1CBQ A;  4I35 A;  5EDB A;  3P6C A;  4I9R A;  2BLG A;  5LJB A;  1CJ5 A;  3HYG A;  4PSQ A;  2CM4 A;  1ADL A;  1FBL A;  1SA8 A;  2KD2 A;  2R74 A;  2W0D A;  3JQO A;  4AZR A;  1OPB A;  2OFM X;  4YFQ A;  3Q6L A;  1Y9T A;  2FWV A;  3SHI A;  4ZHD A;  5H9A A;  3CBC A;  1BM6 A;  1XUC A;  5EDC A;  4GWM A;  2OVE A;  1QJJ A;  3B2K A;  5BVS A;  1SMP I;  2KT4 B;  3UEW A;  2I47 A;  5CUH A;  5D1S A;  4GKC A;  3LQB A;  4CTH A;  3L4R A;  4YDA A;  5HTE A;  4G9L A;  2XST A;  3NX1 A;  1GKC A;  4DD8 A;  2K23 A;  4MVE A;  1OMJ A;  4IUW A;  3FA9 A;  4GZV A;  1ZRY A;  4O4U A;  4QGV A;  3UEU A;  3FR5 A;  3USN A;  3KFI A;  1FDQ A;  3WJC A;  4OS8 A;  1IKE A;  2L0R A;  5F58 A;  5LJC A;  2PJT A;  3S5X A;  3P6H A;  4YBP A;  4O4X A;  4O3Z A;  4FVL A;  3BU9 A;  1I76 A;  2WOA A;  3CR6 A;  1IAB A;  5B5P A;  2CBS A;  1X8P A;  3STK A;  5HTD A;  3ZUO A;  1QIC A;  3KFH A;  1TOU A;  1C7K A;  3AKM A;  3P6E A;  1JJX A;  1JJJ A;  4RUU A;  3S60 A;  3ZUK A;  1T68 X;  3CQR A;  1JYJ A;  4GNW A;  4YGH A;  2W14 A;  4PKS A;  3NR3 A;  1GKA A;  3OJY C;  1PWP A;  5H9K A;  2Q4N A;  2A13 A;  2OW2 A;  1I4U A;  1RBP A;  1BBP A;  4L63 A;  2W2B A;  1IKJ A;  1EUB A;  1BZS A;  1B4M A;  1PEE A;  3B2L A;  2JNP A;  1GO8 P;  1BQQ M;  3LIK A;  2RJQ A;  1XFZ A;  4GUY A;  2AH7 X;  2YB9 A;  3WV1 A;  4TNN A;  2OW9 A;  4L19 A;  1AEL A;  4HPB A;  3NP1 A;  4TJZ A;  3UAQ A;  4LZU A;  5LJG A;  5BYP A;  4KT5 A;  1A2D A;  3G7X A;  2AMM X;  1FEL A;  5LJE A;  1ZNL A;  1JZU A;  5HZ5 A;  5D48 A;  4EXZ A;  5K06 A;  1YWC A;  1SY3 A;  5D3C A;  4YGZ A;  1ICN A;  3NX7 A;  1CXV A;  1KT4 A;  1MMQ A;  1D3S A;  3VG3 A;  3HY7 A;  1KXO A;  1O0T A;  2HNX A;  5FFH A;  5D7W A;  1LKE A;  2OVD A;  4WK7 A;  1TW4 A;  3RTT A;  3MVF A;  4Y0R A;  3VG2 A;  4JIJ A;  2WR6 A;  3E3C A;  1JK3 A;  1GT4 A;  4ML7 B;  1UEA A;  2JOZ A;  2X46 A;  2J0T A;  3F1A A;  4ZHC A;  4GF1 A;  2XKL A;  4DV8 A;  3K7L A;  1PMP A;  2JMB A;  3BA0 A;  1IAD A;  3K3L A;  1CGF A;  3EMM A;  2BS5 A;  2AL0 X;  3PP6 A;  2LKK A;  5LKF A;  1UTT A;  3OE3 A;  4AZO A;  2W12 A;  4IMN A;  5HCD C;  3F18 A;  5AJC A;  1EAL A;  1QY0 A;  4QQ1 A;  2XS4 A;  4GQL A;  3B2I A;  3PQU A;  1MMR A;  2OW1 A;  4H1Q A;  4IB9 A;  4HPC A;  2WO9 A;  2X7M A;  4YCH A;  3DNG A;  1OBU A;  4Y0S A;  1CGL A;  2MZE A;  4FBR A;  3VG4 A;  2RCQ A;  4PKT A;  4ZJ0 A;  2Y6C A;  3STM X;  3DL1 A;  2FS7 A;  3HWD A;  1ZP5 A;  3FEP A;  4COT A;  4QYP A;  4BVM A;  2ERQ A;  3WVM A;  1EXS A;  4TKH A;  1D8M A;  2HMB A;  2CZU A;  3ZW0 A;  2OW0 A;  1HV5 A;  1B0O A;  4FBO A;  3F17 A;  4UU3 A;  1Y9L A;  2FTB A;  1LIC A;  4JGL A;  3WV3 A;  5F6B A;  4HMA A;  3GBO A;  4IJO A;  3P1V A;  3GE2 A;  4ZGF A;  3T1D A;  4NNS A;  1KUI A;  3Q2H A;  3HK1 A;  2YMS A;  1VYF A;  1GXD A;  1FE3 A;  3VE2 A;  1I06 A;  2R73 A;  3OHL A;  1BKC I;  1U18 A;  3OD9 A;  4AYH A;  2TCL A;  1ROS A;  3ZQ3 A;  5HA1 A;  2LFO A;  1DZM A;  3LHN A;  1AKL A;  3LUM A;  4GU8 A;  3HWF A;  2JU3 A;  1IAC A;  3FIQ A;  3DTK A;  1FLS A;  3S26 A;  2JSD A;  1KBC A;  5JMY A;  1LIE A;  4YFR A;  2NND A;  3KEK A;  2D1N A;  3WJF A;  4O4S A;  4OMX A;  5LAB A;  1U0X A;  3LUN A;  4JQG A;  1YWA A;  1G12 A;  3F6Z B;  1AYK A;  4GWN A;  2LBV A;  1Y0V A;  3LIR A;  2RN4 A;  5H9N A;  3TVC A;  2G78 A;  1YWB A;  1I1I P;  1SXW A;  1BRQ A;  4OS0 A;  3DTQ A;  3VG5 A;  3E8R A;  1X8Q A;  1R55 A;  2DW0 A;  1JYD A;  3KHI A;  4YKO A;  4A60 A;  5HA0 A;  4NP1 A;  2FV5 A;  2QO4 A;  2K62 A;  1ND1 A;  1JAQ A;  1MX7 A;  4RUN A;  3LMC A;  5H8X A;  4A7B A;  3K7N A;  3L0T A;  3FEL A;  3OHO A;  1BSO A;  3TF6 A;  1S4B P;  3TGB A;  3C78 X;  3F8A A;  2CM9 A;  1HQP A;  2OVS A;  4A8Z A;  1BLR A;  2G7B A;  1KQX A;  1GE6 A;  1BKC E;  3JS1 A;  1MDC A;  4PKR A;  1OO9 A;  1I05 A;  1KUF A;  3DPF A;  3DTI A;  1NGL A;  1SU3 A;  1HY7 A;  2GTL M;  3QKG A;  4QNI A;  2L9C A;  3OBL A;  4YFP A;  5KIC A;  4IBA A;  2BHV A;  5HAE A;  4YDB A;  5I4O A;  1CBI A;  5D4A A;  2BS6 A;  3B8Z A;  4LKT A;  1A57 A;  4EFS A;  2CLT A;  4KH8 A;  2XS3 A;  1IFC A;  4L6T A;  2N8R A;  1MVG A;  2QO6 A;  4DPE A;  2KTS A;  3O2Y A;  2AT5 X;  2GTF X;  2MO5 A;  1S7D A;  2LBA A;  4XM7 A;  2OFR X;  1D2U A;  4WKI A;  4ZCB A;  3EBW A;  1B3D A;  1OBP A;  1XKI A;  1G5W A;  3H3I A;  2O3E A;  3D95 A;  4KCA A;  3DSZ A;  4N7D A;  4ZHG A;  1JV4 A;  1DZK A;  1JIW P;  1T8V A;  3ZXH A;  3LEA A;  4YGG A;  1CK7 A;  2POJ A;  1B56 A;  1EIO A;  1EB6 A;  4GR3 A;  3Q2G A;  1K7G A;  1UTZ A;  2CZT A;  2AKQ A;  2KTD A;  1GT5 A;  3TS4 A;  1E06 A;  4PKU A;  4DQ3 A;  3PPT A;  4WFU A;  5FQ6 E;  2K9C A;  4YMY A;  1UMS A;  3CBS A;  3NPO A;  3ZW1 B;  1G9K A;  1FM1 A;  1E00 A;  3LV4 A;  3KEC A;  1GKA B;  2ZAG A;  4IB6 A;  5D2B A;  4QAE A;  1IW2 A;  1D7X A;  3VU1 A;  4YBU A;  5AQ6 A;  3ZI8 A;  1QWD A;  1LID A;  1LF7 A;  1DV9 A;  1MMB A;  3P02 A;  1A18 A;  3LJG A;  2OVA A;  3D4R A;  4TLJ A;  2FR3 A;  3RTS A;  4QKZ A;  5C0N A;  4QYN A;  4MIS A;  1KAP P;  2W15 A;  1ERB A;  4ILW D;  1X89 A;  5D47 A;  3WJD A;  3O64 A;  3HTY A;  3TT4 A;  2DDF A;  3WJG A;  4BQU A;  1SXX A;  830C A;  4J4M A;  3VI1 A;  2WQA E;  2FV9 A;  1QFT A;  3KRY A;  3JSQ A;  3MA2 A;  2A8H A;  1YP6 A;  2X3A A;  4I3C A;  1R1H A;  2OI0 A;  1AF0 A;  1DTH A;  2NNQ A;  3F19 A;  1TOW A;  3I7I A;  4KII A;  3S5V A;  2OXZ A;  1G74 A;  3FMZ A;  2F73 A;  4NYR A;  3P24 A;  1QIA A;  2OZR A;  2POA A;  3HBU P;  2MJI A;  3UEV A;  4H2E A;  2Q9S A;  2RA6 A;  2WUT A;  3ELZ A;  4ZR2 A;  1GO7 P;  5F1E A;  2OZQ A;  1SXY A;  3EBK A;  4FGI B;  4IAW A;  4QGX A;  5HZ9 A;  2WO8 A;  3AYU A;  1Q3A A;  4I3D A;  5HZ6 A;  2FT9 A;  1R54 A;  1G7N A;  3O19 A;  2X8T A;  4AZP A;  1AQB A;  3RSW A;  2QMI A;  2QM9 A;  1QIB A;  1ZNE A;  1ZXV A;  1EW3 A;  3BX8 A;  4I03 A;  4M6S A;  4U9C A;  5H8T A;  5I2Z A;  1DF3 A;  1A85 A;  4XMH A;  4FXQ A;  3PED A;  4CV7 A;  1QAB E;  1FEN A;  2DW1 A;  1DMT A;  1ML7 A;  1KZX A;  1BSY A;  3I0A A;  3C77 X;  1JIZ A;  2M4L A;  1EII A;  4INN A;  4FBV A;  2OY2 A;  3ZW0 B;  1CBR A;  4WZV A;  3B2H A;  1PWW A;  2E3X A;  4ZR5 A;  2X3B A;  2DDY A;  4XMF A;  2FRS A;  1JH1 A;  1HMS A;  1GT3 A;  5LJK A;  2FR2 A;  5HWZ A;  1KT3 A;  1HTD A;  4H76 A;  3TSK A;  2JU7 A;  2E2D A;  4JP4 A;  1G4K A;  1YIV A;  3B92 A;  4WFV A;  1EQD A;  2W13 A;  4QGW A;  4PKW A;  1X8U A;  1I04 A;  2NNE A;  4G0D A;  1IIU A;  3LKA A;  3D96 A;  1HOV A;  4OMW A;  2KW1 A;  3CWK A;  5KID A;  5BOY A;  5H9L A;  3AIG A;  5EED A;  3EYC A;  4NW4 A;  5D8J A;  1JIW I;  3FEN A;  3EDZ A;  2USN A;  3NQK A;  1BQO A;  4D6A A;  3AKN A;  5AJB A;  1QUA A;  4LQZ A;  1R1J A;  3KMC A;  4ZH6 A;  2HZQ A;  3F9D A;  1HFC A;  4AW8 A;  1QQS A;  3AYK A;  1CBS A;  4FXY P;  3VPJ E;  4U8U O;  2P8G A;  5HCE C;  1EUO A;  1TVQ A;  3ZVS A;  2AT8 X;  3BSZ E;  1A3Y A;  4I3B A;  4KC7 A;  4GRJ A;  2L67 A;  1BWY A;  5HZQ A;  2OXU A;  2WWP A;  4MIR A;  4ZHF A;  4ORR A;  3HWE A;  3FR4 A;  2JT6 A;  4ON1 A;  1OS2 A;  1QY1 A;  2ASN X;  1KUG A;  2HLV A;  4YCE A;  1R1I A;  5CYB A;  4GK9 A;  1H71 P;  4AUO A;  1EPA A;  4NYQ A;  4U8U N;  1ZND A;  3CQN A;  5L79 A;  4HPA A;  4ZGU A;  1C3I A;  2A2G A;  4A1H A;  3FLL A;  2RCT A;  4NLI A;  1HMT A;  1G85 A;  3VE1 A;  4CSB A;  1USN A;  1JAO A;  2Q39 A;  3P6F A;  1S2P A;  3F15 A;  1QFV A;  3ZUI A;  5LJH A;  2V4B A;  2CBR A;  4TKB A;  5BPA A;  3FYF A;  4L3R A;  1RMZ A;  3EDI A;  4WBK A;  1ERX A;  2ANS A;  4EFG A;  1KT7 A;  1GX9 A;  2X8F A;  5I0L A;  4GE1 A;  4H49 A;  1A86 A;  1ICM A;  5KHP A;  2AIG P;  3EWJ A;  2YG2 A;  3DWB A;  1G49 A;  3V96 B;  4ORX A;  3CKI A;  2QPJ A;  1ZNH A;  2LB6 A;  3RBY A;  5B27 A;  5L8I A;  5L8O A;  1YUP A;  1CAQ A;  1FEM A;  1Z24 A;  1O8V A;  1PWQ A;  1BJ7 A;  1OEJ A;  4MVL A;  4NLJ A;  1YP7 A;  2JN3 A;  3TGC A;  3HDA P;  2MHD A;  5I43 A;  4GR0 A;  2QOS C;  3RKG A;  4QZU A;  1YOU A;  1ATL A;  3LE9 A;  1HBQ A;  1PWV A;  1X8N A;  2FS6 A;  1O1U A;  3FA6 A;  3NQ3 A;  3L0V A;  1J7N A;  1O0Q A;  4PJ2 A;  3NX2 A;  1ZNG A;  1IAG A;  1SLM A;  2WEX A;  2OVX A;  2Y6D A;  2WQ9 A;  1N0S A;  4R0B A;  4EEJ A;  1P6P A;  3WXQ A;  4IB8 A;  2KRJ A;  5IO5 A;  5B29 A;  1JKY A;  3MBT A;  1HMR A;  2CKI A;  3ELM A;  3NBX X;  5LJD A;  4A3W A;  4XMD A;  1BEB A;  2O62 A;  1JAP A;  2N93 A;  1DZP A;  4H84 A;  4MVI A;  1YWD A;  5F7G A;  3ZW2 A;  2R56 A;  5CZM A;  2AT6 X;  4L1N A;  3FR2 A;  3U0D A;  2SRT A;  2PY1 A;  1MUP A;  1Y8J A;  2OY4 A;  4XMC A;  3EHX A;  3NAD A;  1ZVX A;  2JW1 A;  3C76 X;  1R0U A;  2QO5 A;  2OXW A;  1K7I A;  3LGP A;  4GDZ A;  5D1U A;  2JIH A;  1GT1 A;  1IAE A;  4Y0P A;  3HY9 A;  3B2J A;  4GR8 A;  1JAN A;  4O9S A;  1OM6 A;  1MX8 A;  1GKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...