3P2EA

Structure of an antibiotic related methyltransferase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
201
Chain Sequence
b'LILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFELKNIADSISILFPWGTLLEYVIKPNRDILSNVADLAKKEAHFEFVTTYSDLSKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA methylase
publication title Structural basis for the methylation of A1408 in 16S rRNA by a panaminoglycoside resistance methyltransferase NpmA from a clinical isolate and analysis of the NpmA interactions with the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 67
structure length 201
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.1.1.180: 16S rRNA (adenine(1408)-N(1))-methyltransferase.
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p2eA00
5DRTA 4NECA 5T6BA 2B78A 3DMFA 5EIWA 2ADMA 3UWPA 2CMGA 2ONYA 3G8BA 3HA7A 2CMHA 4R05A 2FCAA 2VDWA 2YX1A 3KR0A 4QPPA 3OU2A 4FSDA 1DCTA 1MHTA 2QE6A 1F38A 3DTNA 1ZHFA 2LD4A 3VC1A 3ELDA 3MAGA 2ZCJA 2WK1A 3EVGA 2QYOA 4RVHA 5E2AA 4PONA 1SQGA 2HTEA 3A26A 3EVZA 3OZSA 2G71A 3QOWA 2P40A 4KWCA 5EZSA 5BXYA 5K0CA 5E9JA 2ONZA 5LQJA 5LR6A 2OY0A 2UZ4A 1WS6A 2ZZNA 3T0IA 2H1RA 2NXJA 2ZIGA 1YUBA 3E7PA 3GO4A 5LQNA 5CCXA 3UFBA 1JG1A 2PVCA 3AJDA 2P3QA 3ER9A 1KYWA 2GAFA 2HNKA 3R3HA 5EOVA 1FJXA 4P58A 1U2ZA 3THSA 4E2ZA 2ERCA 5GIPE 4R8RA 4QTUB 3EEOA 3C6MA 2F8LA 4WVLA 2YR0A 5DM1A 5EGSA 3SXJA 1INLA 4RTKA 2OO3A 1P39A 3G2PA 4R6XA 2UYHA 2O05A 1X1AA 2AZTA 1FPQA 2P3LA 1RI2A 2NXEA 1SUSA 3D2LA 3OZRA 1PJZA 3DUWA 3FPJA 3TM4A 3TKAA 1G6Q1 5FQOA 3UJCA 4PIPA 1VQ1A 4PYQA 2IBSA 3PFHA 4QDJA 1IY9A 5DXAA 3MHTA 4V0RA 1EIZA 2V74B 4WXHA 4X1OA 1NKVA 3O31A 5DTQA 1KYZA 2I9KA 3KHKA 1SG9A 1YB2A 2PXXA 5KYGA 2DPMA 4XUEA 3PTAA 4RTSA 5ERGB 5HEKA 3VC2A 1R00A 3LDGA 3CVOA 1O9GA 3M6VA 4OX9Y 3SR4A 5FA5A 5LQCA 3KKZA 4LWOA 2AOWA 2IPXA 3CKKA 3FUVA 5FUBA 5K0NA 4EKIA 3HM2A 3PS9A 5CD1A 5EG5A 4BP1A 3FTFA 2YXDA 4PYKA 4DA4A 3M6WA 2EFJA 5GIOE 1QAOA 1TPYA 2P41A 3GJYA 5DWQA 4UOEA 4YUYA 3O7WA 3ORHA 2IFTA 4CTKA 4PGHA 3B5IA 3EEYA 2R6ZA 4RSRA 2OYRA 2C7QA 4HC4A 3B3FA 4RVDA 4HG2A 4KW7A 3LSTA 5B1SA 3TLJA 3KQSA 1VBFA 3SMQA 5HIMA 1RJFA 4OA5A 2G70A 2I7CA 2P7HA 3OE5A 4R8SA 1EQAA 2XYRA 2UYQA 2YVLA 5K0GA 2VP3A 4PYLA 3R24A 3HNRA 3G5LA 2IGTA 3FYCA 1DUSA 3HEMA 3ID6C 3LGAA 4PINA 1HNNA 4GOND 2BM9A 4GC5A 3BUSA 4HGZA 3SVZA 4DKJA 3UBTA 3DULA 2PV0A 5C1IA 5DSTA 4RX1A 4E30A 1VP9A 2NNWB 3KQWA 4F84A 5K0EA 2AN4A 3TPZA 2N47A 1VP3A 3CBGA 2AVNA 2FPOA 3P9IA 3UJBA 3I9FA 4M38A 3HCAA 1R8YA 2I6GA 3K0BA 5D1HA 5GINE 4FZVA 1P1CA 1R18A 4E32A 5DX0A 2PX8A 1MJFA 2EJUA 1P1BA 1NV8A 3HA3A 3KPVA 4U7PB 1RI4A 4KRGA 1JTFA 4PCLA 1JSXA 2XVAA 3CC8A 3LCCA 5E8RA 2NP7A 2A14A 3P71T 4OBWA 5M5BA 1BOOA 1R8XA 3M6UA 3FPEA 1KXZA 2C7OA 1ZKDA 4L7VA 3EPPA 2YXEA 5U4XA 3G89A 3SSMA 2O06A 2OB2A 3ME5A 3X0DA 3GIWA 4AZSA 4AX8A 2VDVE 1UFKA 3TFWA 4Z2YA 5FULA 2AOVA 2ORED 3CJTA 2AS0A 3EGVA 5DLYA 4CKEA 5GM1A 1G38A 1H1DA 2ZW9A 5LQKA 1G55A 2Y1WA 1UIRA 2OXTA 5K0BA 4O29A 3BT7A 2GLUA 1JG4A 5K05A 1M6EX 4QTTB 5DRYA 3TR6A 3EVDA 4A6EA 2O07A 3B3JA 2Z6UA 4RTMA 3FTCA 3AWIA 2JHPA 1X1DA 2B25A 2PGXA 2VS1A 5F2OA 3NTVA 3NDIA 2IDKA 4YUWA 1FP1D 3OFKA 2C7RA 1AV6A 1AF7A 2E5WA 2Y1XA 1O9HA 3LL7A 4ZTBA 3EGIA 3NWEA 3UJ6A 7MHTA 2PBFA 1SVUA 2R3SA 1QZZA 1NT2A 4KDRA 2IH5A 3A4TA 1RJGA 3GNLA 2OKCA 3HVIA 2Q41A 5DM2A 1VIDA 2B3TA 2B2CA 4PWYA 2ZBPA 3PT9A 3KR9A 3I53A 5E8JA 5CVJA 2WA2A 1ZGAA 5EC8A 5EEHA 1VLMA 4EVIA 2QRVB 3FUUA 3M70A 5HZMA 2IBTA 4OBXA 3UJDA 2ZWVA 5MHTA 2AOXA 2QY6A 1G8SA 3B7PA 1RI3A 3G2MA 3MCTA 2ZIEA 3PX3A 4GQBA 5K03A 2YUIA 5KVAA 3EGEA 4HSGA 3LDFA 2FRXA 5EIFA 1JG3A 1O54A 1D2HA 3GWZA 4PYMA 5BP7A 5LQUA 3FPFA 3PX2A 3G2QA 4RTPA 3R6TA 2QRVA 4M36A 5ICFA 1VL5A 1NW5A 2P8JA 3OFJA 1NE2A 3GXOA 3LHDA 5FWAA 4PGGA 3AXSA 4DMGA 2WA1A 4GBED 4LWPA 4MIKA 2AVDA 1JG2A 4IV8A 4X60A 4XUCA 5K8VA 1ORHA 2AOUB 3DMGA 1UWVA 5T67A 3R9XB 2PLWA 4KIGA 2IDJA 3LBYA 4P7KA 3A7EA 4FS8A 9MHTA 4ISCA 3FTEA 1KR5A 1JQ3A 2KW5A 4QQKA 4C06A 2GH1A 3BKXA 4H0NA 5DPMA 2JH8A 2PWYA 1WZNA 3LCUA 5CVDA 4DF3A 3GRUA 2V7EA 1FBNA 2AOUA 2GA9A 3JWGA 1ZQ9A 3BGVA 4V0QA 4AZWA 3M4XA 5FADA 3EVCA 3ER8A 2ZBQA 4HTFB 3Q7EA 4CTJA 2ZIFA 3IHTA 4ER6A 3CJRA 4P7JA 4XCXA 1Y8CA 3KPUA 3DXXA 2XYQA 3MERA 5CCBA 2FK7A 4YUXA 3KQMA 2OB1A 4GF5A 5CVUA 1XJ5A 4C08A 4QDKA 4YV1A 1YF3A 4PYIA 5K0LA 4RVFA 3BWMA 1JSZA 1NW3A 2XVMA 4FR0A 2FYTA 4HTFA 4E70A 3KPJA 4ER3A 4AZVA 1NBIA 5H02A 4FT4A 5FHRA 5GP1A 4MHTA 3LKZA 4KDCA 4X63A 4YMGA 1L9KA 2H11A 1VE3A 2BR3A 2BR4A 3MGGA 4PIMA 5E9WA 1XDUA 4C04A 5E2BA 4R6WA 2ZZMA 3TKYA 1EG2A 2PJDA 3P9NA 1JQEA 1IM8A 3THRA 4A6DA 4AUKA 3SSNA 4ER5A 5GOZA 3G2OA 4EKGA 3E05A 3EVEA 4E2YA 5KQRA 1OR8A 1I9GA 4RTNA 4RWZA 3M33A 1XVAA 5EQJB 1L3CA 3GDHA 3JWJA 3ELYA 5IKMA 4MQ4A 1ZG3A 2PX4A 3KU1A 3EMDA 2XBMA 4K6MA 4POOA 2NP6A 1RI5A 3LCVB 3E23A 2CL5A 4DQ0A 5EMJA 4GEKA 5LQAA 3OCJA 3OZTA 4FSXA 4QVGA 2IIPA 1L3IA 3VSEA 1NBHA 2ZSUA 5LSAA 1BKYA 2G1PA 2PX2A 4IWNA 1X19A 2ZVJA 3GRRA 3MQ2A 4KIFA 1QAMA 3DP7A 3MCZA 2NXNA 5LQRA 2HR1A 5FCDA 5EKUA 3RODA 1XXLA 5BW4A 2JH9A 4ER0A 1QAQA 4RTLA 2Z6QA 3FRHA 4GOMD 3ERCA 1JTEA 2AN5A 3DLIA 3LECA 2VZ9A 2GB4A 5CUQA 3NVKI 1Z3CA 2QM3A 3KR1A 2PXCA 5KQSA 4RTRA 5ICEA 1SQFA 5EEGA 2CWWA 1N7JA 3GCZA 1KHHA 3G5TA 3GGDA 2H00A 3V97A 3SM3A 3NMUF 1AQJA 3IV6A 1IXKA 3S68A 1B42A 4EQZA 2C7PA 2EG5A 3P8ZA 5EHIA 2ZBRA 1NW7A 2YQZA 4GUAA 3O4FA 3I58A 3TRKA 4E31A 2Z6AA 1BC5A 2I62A 2OPBA 4M7RA 4YV2A 2DULA 3KR2A 5E1DA 3BWBA 1AQIA 5K01A 2IP2A 5FWDA 1SKMA 3G88A 5E1MA 3HTXA 1Q0TA 2IH4A 4U7TB 3HCEA 5ICCA 3DH0A 3E8SA 5C9ZA 4GC9A 2EJTA 2IH2A 3P97A 3NVMB 2PT6A 1EJ0A 3KPYA 5DTMA 2BM8A 3R0QA 1NW8A 1WY7A 1WXXA 3GRZA 1N7IA 3FYDA 3SSOA 4QPNA 3DOUA 2OBFA 2AOTB 3EMBA 4BY9E 3A27A 3IYLW 1QANA 4PYOA 3B89A 4C03A 5DTRA 1ORIA 3KPWA 3MTIA 3LKDA 4E2WA 3LDUA 4BLUA 3PFGA 5CM2Z 3GRYA 2PXAA 4RYLA 3OU6A 5DT2A 4Y30A 1NV9A 3I5UA 4P7FA 5EMMA 1M6YA 1XDSA 1FP2A 2AOTA 2GPYA 3A7DA 3Q87B 3HVKA 5T64A 3LX6A 5EZQA 4KVZA 3PVCA 1TW2A 3FUTA 3AY0A 3C3PA 4OQEA 5HIJA 5EMKA 3BGIA 3QOXA 4OQDA 4YUZA 3NW9A 3KQVA 2ZZKA 3PB3A 3TM5A 4ATNA 4BLVA 4F86A 5JUWA 1L3BA 4C07A 2JHCA 1BHJA 3DXYA 3T7TA 1PRYA 1X1BA 2VDUE 4LG1A 2YTZA 3C0KA 1M0EA 5HFJA 4DZRA 2AN3A 1G8AA 3BKWA 4BLWA 2PT9A 1R74A 3LBFA 1HMYA 1YZHA 3HCDA 1N2XA 5DM0A 5EKXA 5F2NA 1F3LA 3FZGA 5E1OA 5DM4A 4CXMA 2HWKA 3KQQA 5K0JA 4YV0A 2XYVA 5IH3A 3UZUA 1VPTA 4PCAA 2BZGA 1KPIA 2JJQA 3NWBA 4JXJA 5EPEA 3KQOA 1XTPA 1KPHA 3GRVA 2NYUA 2O0LA 3UJ9A 4MWZA 4RTQA 1XDZA 3JWHA 3UJAA 4PYJA 3EVFA 5CVVA 3EVBA 3QV2A 2ZWAA 5K0FA 3BWYA 3OPNA 2BR5A 5FTWA 5EMLA 8MHTA 3FTDA 2UYCA 1I4WA 2HMYB 3UA4A 2JG3A 2ZULA 3F4KA 3WSTA 5KS2A 5DXJA 5HIKA 3HVHA 1RI1A 4MTLA 2BH2A 1D2CA 1G60A 2PX5A 3HCCA 1I1NA 1T43A 3ELUA 3HCBA 4OA8A 4YMHA 4ER7A 5E1BA 3P2KA 5DSXA 5EHGA 3DR5A 3CCFA 3IEIA 3G8AA 1ZGJA 3HA5A 4IKPA 4C05A 3DLCA 1WXWA 1YFJA 2ZTHA 3AXTA 4EK9A 2PKWA 4CKCA 4GOOD 4X61A 1RJDA 10MHA 3FRIA 3V8VA 4C4AA 3MB5A 4HGYA 5GM2A 4RTJA 1NW6A 4QVKA 3H2BA 5F2KA 1YFLA 3ANXA 1Q0SA 3OE4A 5FA8A 2B9EA 1D2GA 1XCJA 3KQPA 4DCMA 5BW5A 3FPGA 5CVEA 1EAMA 3U81A 3SGLA 2OZVA 4AZTA 3P2EA 4G56A 3RIEA 4PYNA 4RV9A 2P3OA 2PWPA 3A25A 4HH4A 3C6KA 5C0OE 1V39A 1YZ3A 2G8NA 3TOSA 5HOQA 3JWIA 5P8WA 4DCGA 3P2IA 1RJEA 4FGZA 5DX8A 2EX4A 4FP9A 3B3GA 5FQNA 3T7RA 3PLAE 1JR4A 2FK8A 2ZFUA 4M37A 4EMSA 4GOLD 5JR3A 2K4MA 3KQTA 3M6XA 3C3YA 3MTEA 3RW9A 4E2XA 5ICGA 3HVJA 4CWAA 2CKDA 4HRAA 5GWXA 2P7IA 3BGDA 3K6RA 3OU7A 3TQSA 1L1EA 3KQYA 3BZBA 3TMAA 4QQNA 3DXZA 1EJ6A 3FUWA 3UA3A 2JHAA 4Y2HA 2O57A 1R6AA 2G72A 2UYOA 2P35A 4LECA 4X41A 5D1NA 3LPMA 4BP3A 1XCLA 2GS9A 3VYWA 1JQDA 2PSSA 2YXLA 3EVAA 3I64A 4CKBA 4RTOA 5DX1A 3GU3A 3UJ7A 3BWCA 3HP7A 2P1DA 3T7SA 3UJ8A 3FPHA 3REOA 2PY6A 4P7GA 2FHPA 3P9KA 3CJQA 4F85A 2ZLBA 4IV0A 5HILA 2ESRA 3CGGA 4PNEA 1TW3A 2AR0A 5E9QA 1KPGA 1X1CA 1P91A 4RVGA 4E33A 4DM3A 2NXCA 3G7UA 1KP9A 3NDJA 3P9CA 3FUXA 4YUVA 1QYRA 3BXOA 2HV9A 3HCFA 4FT2A 5EVJA 5G02A 4XUDA 5HIIA 3ELWA 3SX0A 4B17A 5K09A 3L8DA 1DL5A 5FHQA 3DMHA 5CIYA 3NJRA 1SUIA 1KIAA 1WG8A
chains in the Genus database with same CATH superfamily
1DG3A 2G08A 3PKZA 1BS9A 4PSCA 3BEOA 3JATA 1AK9A 5AUQA 1LGYA 1QV7A 4WZAA 1V6SA 2NU6B 2WJ3A 1YS7A 3TAHA 3K09A 1VKZA 1RPJA 2X8JB 4GPBA 1NLFA 4GVXA 1WNFA 2JKZA 4KK3A 4CPDA 2ZCJA 5HW0A 5I4BA 3NHRA 3AEUB 2LR0A 4PLGA 2W8BA 3KEQA 1KI8A 3WRXA 1SUFA 2XT6A 2ECKA 1V16B 3DBLA 2FLKA 2UZ4A 2LDXA 2BP7B 5TGZA 2JI7A 3P2MA 2ZIGA 1CJVC 1C1HA 1UBOS 3NHZA 4KXVA 4PANA 4B8ZA 4DJEC 4BN5A 1KYWA 1MH1A 1J1IA 3THSA 1LA2A 1AKNA 2RGXA 5DU2A 3R7BA 5GIPE 2BSQA 4LF4B 1WV1A 3S5UA 1PT9A 5JY6A 3W9SA 3RSQA 5IFLA 3V3TA 2G1UA 1FU8A 3DDUA 4RJ2A 3ZQJA 5CDTA 1B2RA 2UVQA 4N40A 5IP5A 1HRKA 4MEAA 1S01A 2ZI6A 1A4IA 1N2GA 1NJ6A 1B8VA 1PFVA 4Z7NB 3HDJA 2IXAA 4D92A 2UYHA 1DAPA 3BD8A 4DNOA 4LS3A 1XFDA 4OL0A 1TUBB 5TPZA 4GKBA 3OOWA 2PSJA 5THQA 5K3OA 3X1MA 2YWDA 2KWIA 4ND5A 3K2IA 4QULA 4UM8B 4C2AA 4R1TA 4QATA 1TLFA 1E69A 2F4NA 2IV2X 4BX0A 5A1TA 3V9AA 4BNYA 4M8KA 3ESAA 3BMCA 3JR7A 1JR2A 1Y82A 4LJ8A 2CSXA 5IU6A 2DY1A 1SZDA 5KOYA 3NYIA 4GKJB 2HSJA 1SCAA 4FGUA 2OQRA 2HK7A 1YBAA 2J6IA 4BNKA 5EE0A 5ERGB 3WKEA 4BECA 1X9HA 3MUOA 4EG5A 4BQQA 1VFPA 4O0LA 1VLZA 3VR1A 2NPIA 3U7GA 4I8XA 5I7WA 1QTNA 4NFHA 3A32A 1C80A 3IUMA 5CD1A 4ZHSA 5DI3B 5A03A 3Q2KA 3HVUA 4M0KA 2IEZA 2HU2A 5CIQA 3F9IA 1TPYA 4FYJA 3D5QA 3EZ2A 1ZL2A 3LK7A 2E1RA 1A9PA 1XZAA 4AF7A 4QYWA 3QTLA 3OHMA 1C3XA 1ESNA 3QFFA 1G6KA 2LZ0A 3A1TA 1C8LA 3QUBA 4HG2A 4MHOA 1RYBA 1IWOA 1A77A 4PZLA 2AEJA 2VYVD 3TLJA 1T8TA 1CJSA 2AFRA 4NMWA 4LDQA 5HIMA 3U56A 2I7CA 5AI6A 3FTPA 1S0UA 1W30A 4DV6B 2YRFA 4GYWA 4LV8B 3WZMA 3JYOA 5KVSA 1ENPA 3QSGA 1II9A 1EHIA 1K8ZB 4WKCA 1IDN1 1N4AA 3U17A 3DULA 1KZ6A 1LV8A 2H4HA 3CGWA 4NBLA 3W6UA 1PK7A 2AG8A 1JE0A 5CM8B 5ILQA 5A4JA 1FJHA 4CVNA 1FUKA 1F06A 3FLEA 4ZANA 4LJKA 3O8CA 3F9CA 1JALA 3FBWA 1MJ5A 2R5NA 3IAHA 3JYLA 4I99A 4CG2A 4Y2VA 3UJBA 1FFEA 3AZQA 4US2R 1KA9H 1M2GA 1AA6A 4CMIB 3EZYA 2B35A 3OZIA 5FTLA 2G17A 3VISA 5KB3A 3ZU4A 1N6RA 4H4CA 4ZD6A 4AXBA 3U4QB 5DK6A 3FFAA 5JLAA 3ZD8A 3BC1A 1ISFA 4Q4HB 2J46A 4I1YA 1N2SA 3WWCA 1N5MA 1QWOA 2J5RA 3PC8C 5I7SA 1EVIA 1MZPA 2JJMA 2CVQA 4BV2A 2H7XA 5A3VA 1EWYA 4GSKA 1JI3A 1XEFA 3QENA 4MAFA 4LQ4A 4P36A 1N0WA 4YY3B 5BR1A 4E5KA 3KWJA 4AY2A 3JY6A 1UFKA 2XV1A 3TFWA 2JS7A 3U7JA 1GCIA 1IHXA 3HZHA 5DLYA 5IMBA 4C3VA 1JR3D 5EUBA 5I7EA 2B69A 1ZW6A 3F6CA 1FX0B 1I3LA 2UUPA 3DL7A 2K7ZA 2IZ0A 2ZT8A 5K05A 2QRPA 3NS7A 3U4HA 3UCFA 3KIPA 1HDCA 5C3MA 4BJ5A 2NTEA 4JP2A 1V5WA 1I3OA 1NF3A 4OQFA 2G5GX 1T0PA 1E3QA 4KLRA 3O94A 3KJEA 4JEHA 4WBXC 3G6KA 2H5EA 3I04A 1JXQA 3SAJA 1VHTA 1AKTA 3ZXXA 1KEVA 1TYAE 3WMWA 2C7RA 4M6WA 4AJIA 4Q4LA 4PN7A 4NCHA 1IN5A 4AMZA 4BFTA 2DUNA 4QU9A 1QZZA 2QX6A 4L22A 1LLFA 1PBTA 3A4TA 3VYSB 4NZYA 4REMA 3ZLUA 4DQXA 1PNTA 3B6KA 4TKUB 3KLBA 1FE8A 1HKHA 2BRUC 3AO0B 1UBJS 3HQ4O 1RYEA 4D9BA 2QN9A 1CR4A 4CM5A 1SRQA 2YS7A 1C2YA 2AXQA 4LCJA 4YXWD 3U0VA 1Z7GA 2BI8A 2OORA 2V59A 4RK1A 4YT5A 2HCTA 1GPWB 1MX5A 1U3VA 2XDQB 2IT1A 1KS2A 5K6RA 2JAXA 3BIOA 5AKEA 1FP4A 1P7VA 4ZU3A 4BXOA 4BEBA 1C8KA 3SIPA 3LBIA 3GARA 3L8MA 3GWZA 5LYJF 4RTPA 4I9HA 4IIHA 1U9IC 2DHDA 2MR5A 1ZK3A 1IMOA 2KPOA 2ZRQA 4PR3A 4QUAA 3ROGA 1H0RA 1XEXA 4ZDIA 5GV8A 4CIAA 1RBMA 1XLUA 4ARZA 1OX4A 2XSZA 4R41A 4D4IA 4AT1A 1XG5A 3C1UA 3V80A 2EDCA 4K46A 3ZVKA 4LHVA 4P9NA 2C9MA 1UK6A 4M3NA 1XNHA 3HRKA 2WJPA 4FS8A 3SIWA 3LVFO 3TXAA 4DQKA 5CFNA 3RE1A 3MJRA 1PT7A 2H4WA 3OURA 1E79A 2YV5A 5D2CA 1Z0JA 4B74A 2B9VA 3PA6A 3EGDB 5F21A 4NMXB 5JDCA 3OOJA 3BGVA 4G5RA 3M4XA 1SHUX 1S2OA 3OJXA 4HTFB 4K7JA 5EERA 2EYQA 3UXYA 3MG9A 4ER6A 1RHRA 2W2NA 1A9QA 1IU9A 4JX9A 4UHEA 5DKFA 3U7QB 4BZPA 3K0KA 5CA0A 2RGBA 2A5LA 3H11B 1OFUA 3I9V1 3K96A 3RTCA 4C08A 1EFAA 3UV6A 1NW4A 1DEOA 4QNMA 3ETCA 2PRZA 4X8MA 2PGLA 2XVMA 3TN7A 3TSOA 4FNMA 1LNQA 2HN9A 3FRJA 3KPJA 5T4FA 1U0EA 3B5JA 1XDDA 3PJDA 2NZ8A 5EHZA 3CZ5A 4UNQA 4X63A 1NQWA 2IYNA 1XTKA 2Z1NA 3QQ5A 5CHYA 2QRMA 2I4NA 3C5HA 2IU0A 1DEHA 1HL3A 4K6CA 4LDZA 4RY8A 2DF8A 3BIJA 3PGA1 4A73A 1UMDA 3OLXA 4H60A 1D5CA 2C4TA 1PFGA 3C39A 3A9CA 3CURA 1RRMA 1U2RA 2CLSA 3BA6A 1DAGA 1O6BA 1E3SA 3G2NA 3PXEA 5KQLA 2OXEA 4BNMA 1PWHA 3IIIA 1JA1A 1ABFA 4F4FA 1NN5A 3GDHA 3EG9A 5TARA 3ZR4B 3MRVA 1RWVA 4POOA 1FLVA 4LJ9A 4TM8A 3ZXIA 5FPSA 4ZMSA 8LDHA 4GW3A 2VHJA 2OL4A 1T4DA 2WD7A 5EE1A 5G40A 3N7AA 5ENDA 2PXHA 3TG2A 4NSNA 3E1GA 4B3RB 4G0ZA 1WPRA 2O2DA 3L06A 1F8YA 1OXTA 4MRRA 3RJTA 5EJ7A 3E9CA 4F1JA 2G1PA 4B3TB 1VBNA 4B80A 3T95A 4GWKA 2A3NA 4JA2A 5EXXA 2WZCA 3E7DA 2JAQA 3ZJUA 2XB9A 1Y81A 2G80A 3RTEA 3AHIA 1JTEA 1CY4A 4CMBA 4EB3A 1JW9B 2WV9A 4DJTA 2GB4A 2O1XA 1KFBB 4OLFA 3RYIB 3NVKI 1KIMA 3P4UA 1PTJA 2ODNA 2BCEA 1MOPA 4FFBA 1KO1A 2WC1A 3I42A 4O6VA 4MQLA 4D9JA 4ZI7A 4YAUA 4XWWA 1KK3A 1JFFA 1TCCA 4HATA 4II3A 3A3OA 4Y6RA 4C43A 4CTNA 2C4NA 4EJ6A 4OHYA 1CCWA 4LISA 3BGOS 2X9QA 2GSWA 3IV6A 4A8PA 1KZYC 3ABIA 1UKAA 1GM5A 5LQMA 3RCBA 4H27A 3CNQS 4I81A 2O3TA 1CYDA 1Z28A 2C5GA 1Q57A 2JGFA 1YQTA 2POCA 3IGFA 3M4JA 1P1IA 2AEEA 3PE4A 5CTJA 1CJBA 4ZAXA 5KDLA 5B6JA 1FVXA 1PVDA 2CFOA 4BLTA 4CODB 1X9IA 2MSWA 1X8LA 2PA0A 4PPFA 4FZJA 4TS9A 5GGXA 5BR8B 2YY5A 1XZKA 2HXYA 2Y4OA 1I13A 4H3VA 4AJ1A 4DLNA 3IV9A 3AHJA 1BMTA 4WHMA 2HUNA 3E27A 1PR5A 2O0JA 1UIMA 1SPBS 3DBRB 1E8DA 4X7PA 3ZX5A 1GPBA 1PZGA 4P4GA 5LNK6 4CV0A 1GKIA 1HMPA 1P5ZB 5C2JB 5HJEA 1O97C 1VI6A 2EHDA 1IEQA 1M7GA 1QH8A 2K7FA 1N7IA 1V7QA 1F2UB 5ARBA 2AOTB 3ED5A 5KX5A 1X77A 4K9QA 3T38A 4JNCA 1YGYA 4YCJA 3L7BA 2C3OA 3LBNA 1X7YB 1REQA 4AYXA 2KLHA 4NJEA 3VMFA 5DYWA 3X1DA 4D5EA 2ZR9A 1M1NB 1GEGA 4IRUB 4OM7A 5EYPA 4KBFA 2XRFA 2O54A 1YD7A 4P7FA 1AHIA 2F3RA 4HDRA 4YQFA 4FX5A 4Y1RB 3TLGB 2ZI3A 5JAUA 3SQWA 4KQ1A 4J0JA 4IYJA 1Z5WA 4KXYA 4ZRDA 4XDGA 3SYMA 1EZ4A 4CT4B 5C8ZA 1AGPA 3MJ4A 4HX5A 2EP7A 4AKGA 4LZNA 2XT9A 2ID4A 3OJOA 2DQKA 4ZYVA 3LS2A 4D9GA 1E1LA 2HMSA 4NZNA 1UEXC 3FX2A 3NHJA 3P0HA 1LZKA 3G1UA 4NOJA 1NPYA 4P4NA 3TGLA 4XPIA 3VUEA 3ICEA 2NV0A 5KYXB 1P45A 2QUKA 3C0KA 1SB8A 4OQ4A 2ERYA 4UNRA 1QHNA 3TI7A 2JIMA 3NC1C 3NKLA 3VNBA 1F3LA 1ZLYA 4NPHA 1TA4A 1VZ2A 3CTMA 1MO2A 4J4TA 2WJWA 4O4JF 3RYHA 5HOEA 3QBVA 4QM6A 1Z6AA 3NBQA 1TTTA 2X8LA 2GEDA 5ECWA 1HEUA 3ZHXA 3DTVB 3WNVA 2QE7A 4AKSA 4LDAA 5AHOA 4W7SA 1JH9A 1QYDA 2H1FA 3B1XA 3U3RA 2YICA 4IBOA 1DJLA 1L4UA 1XDZA 3NWOA 3QFHA 4RV5A 1QK3A 3EVFA 5I4CA 2FF7A 3ECAA 5EJIA 1E9FA 2J09A 1O96B 1PYDA 3AHHA 1PL8A 4BMSA 1U11A 3C1AA 1E2NA 4R83A 1KBQA 3BBPA 1MX9A 4B4DA 2RH9B 5TS2A 3F4KA 1T8UA 3LX8A 4H7PA 4WESA 3B12A 5L7WA 1ZIPA 1RI1A 4Q6WA 4GO1A 5JG7A 1QB7A 1ORRA 3ZGZA 1YDWA 4GL2A 1XYVA 4ER7A 1V3QE 3QELA 3ZLBA 4D3ZA 2YMMA 3GMSA 2JW5A 4HADA 4LHEA 3W78A 1FJGB 4XQ9A 2PPLA 3K0CA 5BNWA 5H59A 2PA3A 2VP5A 4YAKA 2O8DB 3D8UA 2O6LA 1M0WA 1BNCA 3JALA 3TE6A 1AS3A 1E3WB 3V8VA 2CMFA 4DVJA 4RTJA 2HLNA 2I22A 2EX1A 2F9FA 1NMEA 4C0QC 1BG6A 3B85A 1MF7A 2PL5A 1Z5VA 4I5EA 1NSFA 4R8MA 2WWVD 1U0OC 2SKCA 3E7XA 2VTBB 3D8HA 4NDAA 2BUCA 4P54A 3P2EA 1A04A 4G56A 4PYNA 4JC8A 3BE6A 4CM4A 1Z0FA 4URVR 1BMFA 3K53A 3OIVA 4FE3A 4TTPA 5H70A 2JK1A 2Q3HA 5AOCA 4FGSA 1QFJA 1EXMA 1U8XX 3W5HA 1RJEA 4YASA 2CJWB 3G1WA 1AKYA 2ZFUA 3AQIA 3NALA 4KFRA 1YB5A 1NVBA 1NXWA 1R6XA 1UXJA 2C2XA 2R65A 4X1YA 5D3MB 1AD2A 1PS0A 3NR2A 3OLCX 1L7BA 3PHIA 2ZBUA 4NMLA 4K2AA 5CT4A 3EF0A 3VR5H 1R9JA 4MW5A 2WG0A 2FMTA 1KO5A 1R27A 3KQYA 3VYTB 2IGBA 3ZGYA 3DXZA 2YS6A 3OCWA 4COKA 3V4RA 3TCNA 1A8IA 1TFUA 1NBWB 1DAOA 3FKJA 5KNBH 4B4KA 3HDHA 4X41A 4CF6A 1YB7A 2JJ1A 1B8NA 4FOSA 4JBXA 5I51A 3D1VA 1SULA 1RLIA 3SJCA 1KEWA 3GU3A 1W29A 1U94A 3VR6D 1THTA 1SQ0A 4AYTA 5E3JA 3IVAA 4B3IA 3GAMA 2CXUA 2IZ6A 3P0EA 2GRAA 1X80B 3LUCA 3GUHA 2AE1A 1P6QA 3TZKA 4F85A 3MT8A 5KNLA 4R2HA 3PNYA 2G4VA 4DM3A 1PR4A 1E9CA 1YQEA 4H9GA 3ZI0A 4IP0A 2B82A 2XB4A 4G0MA 2WSYB 5EVJA 4RELA 2YFQA 3T9CA 1TF5A 1GVNB 3LH5A 3RSSA 2PM8A 1IPEA 1Z4MA 3I6ZA 1GZ4A 3FFTA 2WVJA 4GECA 2F9MA 4RVSA 1DGQA 1IH8A 5T6BA 4LQLA 3T7CA 5LU9A 4C3ZA 2QB5A 2OXFA 3HA7A 2HRDA 4N7JA 1LPPA 1EVYA 2H1HA 2VDWA 1XLTC 3UGQA 3WKAA 3HZOA 4V0LA 5FYQA 4EKNB 5KYWA 3EE6A 2A88A 1C0EA 3N2KA 1XDBA 1S89A 2YCBA 4ZQFA 3E5RA 2E49A 3AF4A 3HC7A 2P9TA 3MAGA 3VPHA 5AUNB 2PX6A 4CKZA 2HTEA 3EVZA 5J43A 3FVQA 4BB6A 3CCCA 5A1JA 3BF7A 1Z34A 1BW9B 3JQGA 2E21A 2VDKB 3HLYA 1WS6A 3P9RA 1OZGA 4KXNA 2HSEA 2WWXA 4IQ4A 1KS9A 3Q2IA 4GZ6A 2HMAA 3NFYA 1E92A 3AG5A 4QOEA 4DA6A 3OFVA 2H4ZA 1XNJA 2X1VA 3GA5A 2QQ5A 4ERNA 4FLEA 4RA6A 2XGMA 2ZSAA 4CMEA 5H4GA 1BCSB 4HYQA 3V9PA 4EL0A 3IEUA 5BUQA 3F5QA 1QH1A 3BICA 2Z95A 1MT0A 1V4NA 1YTLA 2VPWA 2XOEA 4MCHA 1ADCA 1JKXA 3K20A 1FPQA 4DIFA 3D2LA 1O6ZA 5HRAA 1J0CA 1FFGA 2BSAA 2VDOB 4JL8A 1U9JA 1VSBA 2APJA 3ENVA 3R76A 3VX4A 1KRHA 2LRHA 2XUAA 2RC6A 3TM4A 1ZJWA 3BD6A 2A1TR 4TQUS 3N0XA 4Q12A 4BFVA 3LK6A 3A4VA 3TJMA 1PJCA 3BL5A 4LTMA 5K2MA 3VPBA 3LC1O 1OLSA 3TRFA 4J0IA 2V4MA 3HCRA 1ZUD1 3O31A 1ZH8A 4MW0A 5GAJA 5AESA 2P1ZA 1L4NA 4BO2A 3ZD7A 2JI9A 2MMCA 1VC2A 1YJBA 1U4OA 5HEKA 5EHQA 3CZPA 4OX9Y 1Y0BA 3ASZA 3EDQA 3IQHX 3PNBA 4G4SO 4BQEA 3KKZA 4UTVA 2PQ0A 2W6QA 2ATXA 1G2IA 2BDUA 1Q21A 2IKSA 5BSHA 5JYEA 3Q2OA 1E6WA 2Q2OA 2IE0A 4Q21A 3IRUA 4JBNA 2Q5CA 3C8ZA 1YVEI 4E22A 4BHTA 2V9ZA 1DWPA 2A1UA 5A3RA 2XCSB 2EIHA 1R6VA 4RVDA 2XAUA 4P0QB 2W43A 1YMQA 4GUDA 1F5SA 5CR9A 5LD2C 4RIEA 4PLVA 4XB2A 1T0HB 5D5QA 1XYYA 1RJFA 4DRXA 1CZOA 2P7HA 2OZEA 3L79A 4RLFA 4M1YA 1PL0A 2G63A 1QWSA 4O4LF 1YONA 2PGIA 3K92A 2F43B 5DIZA 4ZCPA 2XKJE 6CHYA 1XPRA 4C29A 4L50A 3OSUA 1O57A 2GPSA 1C3EA 2FUG6 3ID6C 3KXKA 3PZRA 1RWBA 4A0RA 5ESRA 3C7TA 3UHFA 4EG6A 1XRJA 1JJIA 2OGUA 4FYIA 4HEJA 4KH1A 4MPPA 3K70C 4KYIB 1KNQA 3T99A 1S9DA 1JKIA 2YUTA 3TVTA 4MRMB 2OGSA 3EH2A 2IODA 2C88A 4WFQA 2DXIA 4UHHA 4D8UA 4H3HB 3ZXSA 1A1VA 1Y8AA 3HO6A 3N9IA 4L95C 2ZYAA 4N18A 1AKQA 4PLWA 1T5LA 4K3UA 4YJ2A 1BN7A 2BGMA 4HQ0A 4KGDA 5CDFA 2BBOA 4CMGA 3CVUA 3X2EA 1P1CA 1Q22A 3TUJC 1YRYE 4UCXA 4L6AA 4FBLA 2XA2A 2ZBGA 4O3MA 1QF9A 2BW0A 4KUEA 3WGQA 1WF6A 2C5BA 2EIXA 2AJTA 3DA8A 3HA3A 4BTLA 4NCXA 1ZYUA 3BCUA 2B4RO 4CKEB 3CZRA 5LYJA 4GWLA 1VPWA 3GJTA 3DV2A 1O8CA 2R7AA 3A2LA 3RC1A 3Q1LA 4CU2A 4FHGA 1JKJA 3QVKA 1QE3A 3STVA 2PMEA 2W2KA 1POWA 1WTAA 2Z98A 3U80A 4F4HA 3EG5A 3P9YA 4Y2JA 2O06A 3CLRC 3O21A 4JUIA 5KC8A 5L4NA 2VDVE 4MVJE 4C9BA 4GX2A 1HOTA 1X3SA 2G9QA 5D84A 5BV7A 3D43A 3RFVA 4XVUA 1GT91 1NZFA 1S1MA 3DQQA 4L85A 3EBLA 4H7JA 1U8AA 2QI9C 1ZD3A 1RZVA 3KZMA 1X3LA 3AEKA 2IHZA 1TLTA 2Z4RA 5AVOA 2E37A 3LFUA 2PYDA 4B43A 5BSWA 5KWVA 3IT3A 2Z6UA 1K5DA 3FTCA 3AWIA 3K35A 3NXKA 3PD1A 3QEMB 4AW9A 1ECPA 4MVJG 1U0NA 3X1XA 3N87A 3EPLA 1WUKS 1TK3A 4CGYA 4ZZ0A 1O94D 2LKDA 4YN3A 4CLDA 3OFKA 2Z4TA 5ALFA 1NN3A 2QKYA 4Y0AA 4A8HA 1DSSG 1AV6A 7MHTA 2BFDB 2O2EA 2EP5A 2ZYDA 5KOJB 4A0HA 4J94A 4ZK6A 1M6WA 2QT1A 5U9CA 3GNLA 3R5HA 3P9PA 3OQJA 4OFBA 5LD2B 2B2CA 4W5WA 2GD0A 4GL4A 1H9AA 1WX1A 1ZIXA 2BMEA 1NIPA 2OHOA 4HQRA 4Q1VA 4XARA 1EFRD 4B6EA 1AVTA 5IM4F 1TIKA 2PYZA 2WQ6A 3RG2A 3FN4A 4HR7A 4W5NA 1TK9A 2YRXA 2VYQA 3B7PA 3HXTA 4NHOA 2XWPA 3LZDA 2AD1A 1KAHA 2ZIEA 3NBFA 4MUMA 1P1KA 4K9LA 4KXFB 5J4HA 3L7MA 1AMUA 5JD3A 1Z0UA 2R7KA 2JGKA 3K5PA 4MKZA 3FOAA 3K70B 2JAWA 3N70A 3FPLA 2HJHA 3VOBA 4V02A 1DXYA 3PX2A 5CXUA 3O83A 2J0UB 1MMFB 1PDWA 2QRVA 3UWKA 4ALMA 3G9TA 5LZ8A 2XVXA 4EQ6B 1HYGA 2VXYA 5FWAA 2H1IA 3H3FA 4KX5A 4RPCA 4LWPA 1JQ5A 2DHRA 2CF6A 4H7IA 5HIAA 5K3EA 3OIFA 2FVYA 1EE9A 5EZ6B 5CW1A 4X85A 3V1LA 4WFKA 2QHXA 2AFIB 1T1GA 2IYQA 1LK5A 2I8LA 4TRMA 2BKLA 1JR6A 3GQVA 4PZ0A 2CJPA 3A7EA 4PO3X 4M49A 1D7AA 1R5NA 3SJAA 1QFMA 1P5JA 1YUNA 3L0ZA 1JQ3A 3GCXA 4BFCA 3DZKA 1PR9A 1YRAA 4BUZA 4XW2A 3EQ6A 2BM1A 5THKA 3GA0A 3GELA 1FYVA 2AYZA 2CVHA 4J91A 1F2DA 2V3VA 3FMFA 2ZBQA 3ESYA 3O8QA 4NOMA 4RVNA 3CJRA 3DDNA 4XFDA 3DE5X 4P4LA 5EKDA 1Y8CA 5CB4A 5SZJA 4P31A 2YWRA 2R66A 3I9MA 2H2AA 3PQ3A 3ETJA 1BTOA 1KKUA 2O8VA 3I23A 4C30A 3TW0A 3ZZ0A 1Z2OX 4MV9A 5IHPA 4IFEA 1NUTA 1NKTA 1DPFA 3PKIA 2FW0A 1E6EA 2Q8PA 2R2AA 2QZZA 1AGYA 3D0KA 3GK3A 4KN8A 4MGIR 4UNIA 3T9AA 5AK6A 4AJOA 3PNMA 1EE1A 3RQSA 4DQLA 1TAGA 1Z5NA 2BFMA 3K30A 2O8NA 2AB0A 3QVOA 5H02A 3WKCA 4YRAA 1P3JA 3UGJA 1P4GA 1UODA 2PNFA 4N54A 3SNKA 8ATCA 3ZD9A 4PSKA 2VRCA 4RZUA 2IHKA 1I2ZA 4UQOA 4YQYA 3THRA 1Q1AA 4JFRA 4OXRA 5FWXB 4FOLA 2IA5A 3AR8A 1NAIA 5K1ZA 2DYKA 2RGUA 2BKAA 4FI3C 2ZJ4A 1F17A 2OENG 1R1DA 1DKLA 2AMVA 2CNOA 1TVEA 5DGIA 2EF1A 2LCQA 5LVAA 4AO7A 1L3CA 3LGSA 1UAAA 5KSOA 2P9FA 2XVZA 2XXAA 4JS0A 3KU1A 1JNYA 5C7OO 3OZ7A 2I1VB 2GZHA 2R8BA 1CUXA 2O23A 3HS3A 3TQOA 5BV0A 3I5MA 4GEKA 5D85A 3AVOA 4DLTA 2EV9A 2IIPA 1R7RA 2N3ZA 1J9GA 3TIVA 4JXXA 1OAOA 4UTZA 3GT7A 3RWMB 1W88A 1WWKA 1ZJ5A 3E9MA 2OEPA 3GRRA 1ADGA 1J24A 3LP8A 1MDBA 3QFCA 1RNLA 3ITNA 4RTLA 3DWFA 3FRHA 3M9WA 2J5BA 2RHDA 5DO9A 5F77A 3VKFA 4XQEA 2PGNA 1Y1LA 5TPZD 4BNNA 3EOZA 3IKLA 2G88A 4P4SA 2D06A 2HPHA 4ETIA 1FQKA 3BULA 4RF5A 2PE5A 5A6SB 4MUNA 4U7WA 1KOFA 4ZOAA 3JZDA 3FB4A 4O25A 3RUCA 4A2PA 3EC1A 1T5TA 4ZO6A 3WYBA 5F1KA 2VJOA 4FHFA 1FRNA 2CD7A 5AO9A 3KUKA 1VL8A 2R87A 3Q8WA 5AJZA 3BGSA 1AQIA 5BVHB 2IP2A 3UUFA 4NYMQ 2QN1A 1KP3A 3EUWA 3DHVA 1YRWA 3FCUB 1W1WA 2BT4A 2X76A 1UP7A 2MMGA 4IDDA 4YGYA 1QVVA 3W9YA 1E96A 1Y42X 2OGZA 3QBTA 1Y3CE 1SCUA 3O03A 4OSEA 1L5VA 4PBTA 4J76A 1OD6A 3H1TA 3MWKA 1NBME 4KH0A 1DELA 1AG9A 1KYYA 4O4HF 3ILYA 3ZQUA 2ODAA 3ZIAD 2VN8A 4J16A 1QCDA 1E20A 5EIBD 1EIWA 4B7ZA 1SJ9A 1BVRA 4QPNA 4RZ3A 4LOKA 2VJPA 1KI9A 4Y9RA 4HWOA 4JC0A 4CEJB 4UMVA 2C3PA 3WLJA 1T4CA 2BI7A 4N5LA 2NSJA 1W0JD 1ZAKA 4KQHA 4HQOA 4O4IB 4LFCB 3W8DA 4AO8A 4RKQA 5CM2Z 1IEWA 1Z0KA 1IUOA 1GUBA 2H2IA 3GRYA 1KOLA 3L6BA 3OU6A 5HF9A 3HUFA 2IKQA 3EOAI 5DT2A 4LV5B 2D5AA 1XDSA 1YR6A 2K87A 3B48A 2QENA 3H2YA 3HVKA 1ML3A 1UAGA 4IDHA 4FW9A 1LPBB 2AG5A 2QJRA 4MWSA 4OX9B 1L5SA 5HRUA 2NU6A 3LO5A 3ILHA 4I3HA 3TW8A 2Z1MA 1V11B 3HFJA 3KYJB 2R68A 1SM4A 4KR6A 4C07A 5COQA 4B31A 1GSIA 2XNSA 3JZMA 3MWEA 1X92A 2NX2A 1G0NA 4N01A 1P0IA 4KODA 4NEGA 4RGVA 1G8AA 3BKWA 3BSSA 5DT9A 4BLWA 4DUYB 2GXQA 1RYMA 3F8SA 2G0TA 1E2LA 2XQIA 3QITA 4XR9A 3CVXA 2R96A 2WD8A 4D9FA 3WJ1A 2ZCVA 1L5FA 1UJ5A 1VM6A 1M54A 2AR9A 2HWKA 1R5OA 2D54A 5GVRA 5K0JA 5IH3A 2AKAB 5I9SA 1BDBA 3EK2A 1NASA 4NCBA 4KFCA 1MRSA 1H6AA 2F00A 4CETA 3JQDA 3JQFA 3QE4A 1JFTA 4F2WA 2PL3A 1D0IA 2Q0HA 3GJ3A 1UDCA 3QV2A 3HSSA 4MLPA 4O63O 1BDHA 3WJ2A 4NICA 2HJVA 4JI0B 1UZAA 5HF6A 3U9TA 4IO1A 2VKTA 4FN4A 4QL3A 4OFZA 3GDWA 1WQ3A 5T8KC 1QDEA 1E1CB 2QZSA 1Q6YA 2GJKA 1KO4A 3AW9A 1ZM9A 3F5MA 4ZC1A 2HKIA 3A3PA 2PUEA 1N5DA 1EBFA 5TEVA 4E14A 3W5CA 3NAGA 1FDUA 4TV8B 1AO3A 2DBYA 2Q0XA 3HFSA 1TYCA 5KVQA 3CB4A 2Q4OA 3JQ7B 4C4AA 3MB5A 2WF5A 3QOFA 1Y8RA 4GPZA 4N65A 2UZ1A 5ESXA 2VDJA 2YCLA 3FG9A 2Z09A 3O3OB 4G89A 4HX9A 4QWMA 5FA8A 2C1EA 4IGAA 7YASA 1DBIA 1DDOA 1OC2A 2MTBA 3HKBA 4RPKA 3NTOA 1KNXA 3U3DA 5BV8A 4C1BA 2I8AA 2OZVA 3BG5A 3E5NA 1U0JA 2P5TB 2R60A 1ZH2A 5DYNA 6REQA 3IUNA 3KZNA 1N3IA 1WP4A 3C6KA 4BKMA 3G85A 1C3VA 1YZ3A 1SKBA 3CLUC 5P8WA 4DCGA 3GL9A 4IRMA 1XZNA 4DUGA 4FOPA 1CF2O 5JMPA 1PKEA 3KT3A 1Z5PA 3EXIA 2WICA 3L7IA 4GOLD 4M9CA 4FHDA 5KWIA 1T2DA 4B6RA 4P80A 2Z6VA 3K1JA 4A8JA 1RQ7A 4LHZA 2PJRA 1NSTA 2C95A 2D6FA 1L1EA 3G8DA 3ZHBA 2JJYA 7ABPA 4NYIQ 3ITDA 1JHAA 4X5OA 1O5TA 3T7AA 4F7WA 2IS4A 1DBPA 1OV6A 1UC4B 1X13A 3GFSA 3RVJA 3CUKA 1C3LA 3USES 1ZISA 4CKXA 3VHXA 4TLMB 1R3DA 1Z63A 3SOZA 4GWGA 5JH7F 5KTSA 1GNRA 5BPFA 5MN6A 2GQ0A 1AGRA 2FE1A 1K2WA 1U3WA 4K0KB 1T4MA 1SIOA 1E9RA 3VNVA 2J3QA 1PKXA 3BRWD 5ALHA 3QF4A 2X0JA 3REOA 4KO1S 4M1OA 3CZCA 1TW3A 2B7CA 2QTHA 4IKOA 4LYFA 5ETJA 2QVBA 4F3YA 3O8OB 1QBGA 2BGTA 4LGVA 5EIOA 5BWMA 4Q4HA 1GGJA 2PUDA 2A4MA 2JI6A 4KMSA 2KX7A 2JGDA 5DNEA 5KYVA 1QF7A 3EWIA 3R0VA 2W9XA 4AQDA 4NV1A 3H4IA 4GGPA 4JCOA 5FPTA 3UKOA 1L5GB 5C5IA 4GH5A 5T4HA 6AT1A 3GLGA 3I5AA 1SUIA 3U44A 2CXHA 3SF0A 4V1CB 2KQUA 1HDEA 3C3EA 3DO5A 4LRSB 4D8YA 2JLXA 1F8GA 2FTKE 5GJBA 3M0EA 3VYUB 1UDWA 4TMVA 2YX1A 1CNFA 1L4HA 3OU2A 3TBFA 5EJ9A 3EN0A 4FFMA 3S7ZA 3I30X 4W7IA 4NX2A 4DILA 5GTDA 1JUDA 2LD4A 4ND2A 4RQAA 4NMHA 3SS8A 3CEJA 4IHQA 2D8MA 4ZOEA 2NTYC 1PK9A 4GM4A 3EIXA 4UOZA 1DKOA 5FOWA 3EAGA 5LQJA 4URFA 5CLLA 1KH2A 2CEAA 2OO7A 2ZG6A 4CQLA 3HKDA 3K2QA 2H1RA 5KJCA 4JXZA 3MF4A 1G59A 3ZWWA 3ER9A 3FWYA 2WIDA 2RDMA 2YW9A 1PGOA 2HRZA 3EC7A 3U3ZA 3PQ6A 4I0WB 3Q5DA 4O4LA 1M73E 4EHBA 1CV2A 1NQUA 2ODEA 3C6MA 3ZDQA 3FYTA 3QEAZ 2QTLA 2BFWA 3ZYCA 4UBJA 3RBZA 4P3OA 1TF2A 3IHLA 1VYHA 1X1AA 1LPMA 3OZRA 3IPRA 1P4RA 3WOHA 2YIVX 4BO5A 1XXHB 2ZYHA 2NPFA 2E4UA 3T1VA 2CNWA 5ECGC 1BWPA 1XEAA 2PMKA 2R1VB 3FYSA 3GBPA 3BILA 1C9NA 3FBGA 3HZRA 4OB7A 1ULSA 1K98A 2Q6TA 3PFHA 3VYVA 1HR0B 1FZTA 3QNWA 2VYCA 4NOLA 1NVMB 1NKVA 3SE7A 2QRUA 1XKQA 4LI3X 4LNHA 3GZJA 4RETA 4U7FA 2FQ1A 3PUYA 1PAUA 4LOAA 3VJKA 4CZ2A 3E1KA 3FFBA 1BGVA 4MULA 1RXEA 2B1IA 2QG4A 2GX6A 3AV0B 3QJYA 5FKJA 3NJ8A 3QLUC 4RL6A 1QG4A 1NJFA 2VJDA 5G0VA 5AYVA 1N75A 3FDZB 1KAQA 5H3CA 2AR7A 3FUVA 4XQGA 1A76A 2PH3A 1KVUA 2ZSJA 3VPAA 2ZAYA 3QUAA 3WFZA 1NP7A 3S29A 2ZRJA 3I1IA 3BJMA 1J0DA 1I8TA 1VBKA 5TB5A 5CXXA 2NUTB 2BFOA 1KO8A 1KAGA 2ZU6A 3NAZA 4IHAA 1NN1A 1RYHA 3OA2A 3CWQA 3ZZTA 1IHPA 2WM3A 1VTKA 1XF1A 3C6BA 4J9VA 2W2XA 4OHKA 3OE5A 3SCZA 1W25A 1JAYA 3OKPA 3UT5A 1L4BA 4BGVA 4UM9B 4IUDS 4OBBA 1YAJA 5IEJA 4N8EA 1Q44A 5IAGA 2QQFA 3BBLA 2H08A 1FNDA 1KQ3A 1YZLA 3ADCA 3T4EA 4Z4IA 2X1LA 3CO0S 5SY9A 3M7IA 4HMQA 2V7XA 5KI6A 4MB2A 5T4BA 2ZVPX 1N6IA 2DZDA 2FETA 2J67A 1VP9A 4KPGA 2YWHA 4UUNA 3ZWOA 2WJJA 1M72A 5GV7A 5JNTA 4HO1X 1GDTA 1NYQA 2OM2A 1ZRMA 3CBGA 1K9SA 2X0DA 1M2OB 2XF8A 1B0AA 3COYA 1HXHA 1I36A 2HJGA 3KKEA 1YA8A 2H54A 3CXUA 2FPIB 2J33A 4XX1A 1KSJA 3CLVA 1OT3A 4US1R 4ZVKA 1YBHA 2H31A 4RDHA 3V6MA 5HNKA 3F3KA 3NYWA 4KRGA 1NW9B 2ATVA 1F4LA 4J1SA 4J7XA 4WKPA 1WJGA 3E8XA 3LQFA 4OBWA 5M5BA 4LOHA 1R8XA 1V8ZA 3THYB 1K5GA 5IUKC 1E98A 1N2EA 2X9NA 3HU3A 1NF9A 1XZPA 4QXRA 5F12A 3ZDCA 4RQBA 3D5TA 3X0DA 4WK6A 3H87A 1WNTA 4QIHA 3T6KA 2ZJZA 1DOHA 1MB2A 5DHSA 2ZRDA 3DEIA 3EGVA 2OOSA 1G8GA 2FF5A 1U65A 5ADUS 1RMQA 1H8EA 2Y1WA 3OZWA 1HUQA 4D6YA 4A5SA 4B2IA 5K0BA 4Q3AA 3MXOA 1QM5A 3ZIDA 1GUZA 3ZK8A 3Q7RA 2V4ZA 2ZIZA 3GLHB 3UWSA 3UK1A 1T9KA 2IYEA 3T94A 4MVJD 5K8IA 5L6MB 2CL0X 5J2TA 4LDRA 5IBRA 1CQIB 4KSBA 1N2OA 1U9CA 2RBEA 4V0NA 1NR7A 3WNCA 5CT5A 1B8PA 1XWFA 3OO0A 2O50A 4PLTA 4JD5A 3HL0A 4LNUA 1X7XA 5BPHA 2PKEA 5LIRA 4M9ZA 4IJQA 2ZTLA 1BVUA 3KR9A 3V1YA 1C9EA 4RADA 1A8UA 4F46A 3PC2A 3M70A 2WTNA 3WLMA 2IX3A 4NBWA 2AOXA 2HREA 3DMTA 3G2MA 1FQJA 1LI4A 2VRWA 3PX3A 3OFSA 3AHGA 2YWFA 1IATA 3DBRA 3LDFA 3PA8A 1VFNA 4UC0A 4W63A 4URUR 2YDXA 2P5SA 3FA2A 5BXQC 4TXLA 4I50B 3DDOA 3WVNA 3RIHA 3F6YA 3O5AA 4PBSA 2XRZA 2XZTA 5ELLA 2BHNA 1MB0A 2VEDA 4X45A 4PZDA 3NOXA 4Y9TA 5AJYA 4YDQA 1U1CA 1OBCA 2AG6A 4L7QA 3K5HA 5CM9C 4WJLA 5E6RB 2RG7A 3W2TA 3FPCA 1MP0A 4PZ9A 2H18A 1F0PA 2SHKA 4WXEA 2PLWA 4Y3UA 3WNBA 2PZGA 2OHFA 4DYDA 3HJBA 2WF6A 9MHTA 2JFPA 1JDJA 3PI6A 5A9SB 4WMLA 2PBZA 4TX1A 3K1ZA 1H2FA 2V45A 1K9VF 1V9LA 3E5MA 4N8SA 2H2FA 4HV4A 3LCUA 3HJFA 3QE2A 5HX7A 3QHQA 3NASA 1YKSA 1L7PA 1EFVA 2VIIA 2E0IA 3JQQA 4NIMA 1RLTA 2YN0A 1A4RA 3AIOA 2OBLA 3TF5A 3VPGA 1FSPA 3I2FA 4HAOA 4UAJA 4E0BA 3DEKA 2D5BA 1LJLA 2YYSA 3G9ZA 3KFXA 4GF5A 1MGOA 5FX2A 1XJ5A 3HR7A 4N76A 3DAHA 3DHYA 1XLVA 4TTRA 2J3IA 1ADFA 4NJMA 4RY2A 5CFLA 3KDSE 4MS3B 5ITVA 4IHJB 5LA6B 1K89A 4M76B 1GG2A 4EPXA 2E4AA 2EXXA 2F1OA 2IU3A 3G2IA 3SZUA 5GP1A 4XH9B 4ODIA 1XPOA 1L4MA 1RWPA 2HNBA 5EXPA 4PGAA 3H3JA 4IXMA 3EGXA 5AKZA 3IPXA 5TE9A 2RGRA 1R5JA 3ZWXA 4Q7LA 3AUFA 1O96A 3H1EA 4MMYB 3SQOA 4QNRA 2OWEA 3OPVA 1MQ8B 5JCZA 1XTBA 3EVEA 4DPMA 1I9GA 2Q5QA 4BZXA 4Q9LA 4RTNA 2GNOA 2RK4A 4R01A 4QDXA 1GYRA 1U1GA 1AV7A 3EYWA 2VBGA 3JWJA 4J1TC 4O4HA 1XMSA 4OAQA 4WNAB 4DIOA 5IKMA 3E3AA 1RI5A 3ZV7A 4BO9A 4JBWA 3RLIA 3RYFB 2VJBA 4DQ0A 4CUJA 5JS8A 1IBKB 3OCJA 3R77A 4LV6A 2LGJA 4FK8A 4DIDA 2VWPA 2YZ7A 5D01A 4OTZA 1BXKA 4GRDA 4I08A 2Y05A 3IKVA 1FDOA 1GZUA 2PRIA 4MVJF 3ZZUA 4IWNA 3AZOA 3ZDXB 1G5PA 1GZVA 2IQIA 3MHPA 3AFIA 1HDYA 4NL4H 3KKKA 1U81A 1VYVA 3WBFA 3RODA 4BLPA 1Q0HA 4YJFB 1U8ZA 1VSTA 2O7RA 4YR7A 2IEDA 4RGBA 1E2EA 3S7TA 5JYDA 2GNAA 1V7ZA 2VZ9A 2GUWA 1AH2A 5CUQA 5LZ9A 1VOTA 4O2AB 4WOCA 1G7SA 2XE4A 5DOZA 5DVZA 1H2YA 2EEPA 3FI9A 3WLRA 4LOLA 1SQFA 3GC6A 4ENWA 3F5SA 5KSWB 4UMEA 3O8LA 2D7DA 1KHHA 1JDTA 1NOKA 4MW6A 4FR5A 2Y93A 1S96A 3C6QA 4QPCA 2FEXA 1PFQA 3RVLA 3S68A 3DS8A 3BIFA 4NQRA 1P1FA 2VZEA 2ISQA 3KBOA 5SY4A 3T7JA 3BMQB 4EI2A 1F6DA 5LQSA 1PGQA 1RHKA 1R4NA 5LZ5A 3KZVA 2G77B 1TCAA 2G0AA 5F9MA 2O4CA 4FYHA 4AB1A 3LXXA 2XW6A 5B53A 1BMQA 1AK1A 5C9ZA 1T10A 3FMGA 3O75A 4O1IA 1YHZA 3C98A 4XEHA 4DBZA 4K0RA 4RQUA 3OPQA 1DS6A 1ZM4A 3PCRB 3PUHA 5D6NA 4NAUA 1CZRA 4IQ8A 4GT1A 4WPGA 4Q9NA 5JZVA 5K3SA 3W8FA 4M9RA 3THXA 2XKBA 1UKBA 2BMFA 3DEFA 3IVGA 2J8ZA 2UAGA 1DQRA 3R3SA 5FFFA 2VXBA 3F71A 3VFDA 3D6NB 4PO9A 4OGLA 3SBEA 4PYOA 3WMFA 5EN4A 1JHYA 2BI4A 2G6TA 1NBMD 1ORIA 2EOAA 1BRTA 3CW9A 3R3XA 1P2SA 5FLYA 2GYUA 4M22A 3CG4A 1RSZA 2PXAA 3CKYA 1FUYB 4CMCA 1XVUA 3OUZA 3QWAA 4RKYA 1J8YF 1BQEA 4K9SA 2I4MA 1NUQA 3CISA 3F0TA 3AR3A 5BSUA 1LDMA 3HKEB 1KGSA 4FGWA 5T64A 1IEXA 3FNBA 3IJ5A 3JQBC 3T5PA 1FL9A 3P5SA 3FF1A 2QT0A 2M9MA 2PD6A 4GZ3A 2ST1A 5CX1A 4U9HS 1KWGA 4BPBA 1XI2A 2VOJA 2ZWPA 1DG1G 2FV8A 1NPDA 3UWOA 2HFJA 3T7TA 1QOPB 5FFMA 3TSAA 1GGVA 1RCUA 2MJLA 3TL2A 3ZQ6A 1EHCA 5AW6A 1A8HA 5ELMA 2VJAA 2PSHA 3EA4A 2GEJA 2B8EA 2W6ID 4YJ3F 5EKXA 3ANTA 1WUTA 4YR9A 4HDNA 5L3SB 4GLBA 3QEKA 2HRBA 2H6EA 1S3FA 4CXMA 2D5IA 1MTZA 3N7TA 3CFYA 3PG5A 4RM3A 4M9QA 2B4QA 3WL8A 1NXSA 4XDZA 2VHEA 5L3ZA 4KRFA 1DUIA 1EEHA 3T1YB 4DBLC 3PEEA 1LUAA 4MWZA 5JE8A 3T1NA 4Z49A 2V7UA 1GY8A 5FUVA 1E63A 1PF7E 1U8EA 2FZ4A 2Q2NA 5CVVA 1P81A 4JITA 3L40A 2BGJA 3CE6A 1QHXA 3KOXA 1PFWA 2XZDA 3L92A 4JT4A 4TUYF 3JVDA 4YAJA 5K99A 1GTVA 1NP3A 1XZ8A 2O2IA 3ENNA 1T43A 3ELUA 3PF9A 3GAAA 3LZ6A 3ANMA 4L1KA 1BD3A 3NBXX 2QZPA 2VPPA 1WBBA 4TLEA 1P6UA 1OXSC 3OE1A 4C22A 2ZSKA 3CCFA 3V32A 3LHFA 5ALUA 4TWZA 2C8JA 5BVGB 4JQSA 2P9ZA 2POQX 3KXLA 5EJ2A 4LRXA 5JD6A 1Z8HA 3NM6B 3F3SA 3EBPA 1TJ4A 1E3TA 2VPXA 3LRTA 3K05A 3JAMA 4RMNA 5C5DA 4FFDA 1CUFA 4KV7A 1BVHA 5EMNA 2D1FA 1C9DB 1BFKA 5F2KA 5JMTA 3L7AA 2GYYA 1RHUA 1A9SA 2X7XA 4ZKEA 1A5BB 3UMBA 4W5RA 5JFOA 5CAEB 3FNQA 3FPGA 4MINA 2GCOB 2K2WA 4FIDA 1UWCA 4HLDA 3IJRA 2FR8C 1WXQA 3GJ0A 3PWSA 3X1JA 4GP9A 2XCTB 1F9AA 3IQFA 4EUHA 2AJLI 3ADBA 1LF0A 5C0OE 5FOTA 3AR7A 1EZ1A 1CETA 1ZNZA 2WTAA 5IUJC 4DLRA 3BE4A 1LPOA 4G9BA 3L6RA 3W2HA 1SUAA 3LHSA 2LW7A 3K9LA 1OU4A 3DDHA 3H5RA 4M37A 2DT8A 1RWQA 3K0SA 2A4KA 2ATIA 5B55A 3MTEA 3RW9A 5ICGA 5BWCA 4IIVA 3MEQA 1ENZA 3C5EA 1W44A 2PLNA 4RK6A 3WDKA 2OV4A 4DREA 3BORA 5J63A 1H5QA 1DU4A 2Q4TA 3GFFA 3PC3A 1OOEA 2DR2A 3ZCQA 2W48A 2ZUWA 3ZE0B 1NWHA 3FWPA 4I1OA 5TEWA 4FB5A 1KYXA 3UAVA 3SF8A 1A7UA 3I64A 4U3JA 1X1TA 4NJOA 4A6XA 4L28A 3LUDA 4RZQA 4RHFA 4EHDA 2VVTA 1MAVA 3ZWBA 4B6FA 3OZCA 1HRDA 4K05A 3KB2A 3B51X 1BWQA 1USGA 3MJFA 3QPCA 4CM7A 4FC7A 4B4WA 1LWNA 4B4OA 5COAA 3UK0A 2V7WA 3ZI7A 5B5SA 1C9JA 1KP9A 3AZPA 3KB6A 1FTYA 1P29A 1AXGA 2B8TA 3PHHA 2I66A 3AUXA 4X1IA 4WACA 4BWGA 1YDMA 2WAYA 3GEDA 2HV8A 3WL5A 1UBRS 4MPRA 3SX0A 1E5XA 4JP3A 1QONA 4ZVLA 3ZU5A 2A9OA 2B94A 1N57A 2Q9AA 1GV0A 1M10A 3KVYA 1SD1A 2EARA 4FHCA 3VZQA 2W6CX 2C5EA 3PNVA 4AC9A 3E48A 4BMVA 1IY2A 3NORA 4BO7A 4ED9A 1E64A 4ND6A 4R16A 3OQMA 1NT4A 1J06A 5KKAA 4XVQA 4QVIA 1U0RA 1MLDA 1JIJA 1S5PA 1DTWB 3LPDA 1FDIA 4BFYA 1EX1A 1KZ7B 1VHJA 4PONA 4G0OA 4E5MA 3H2HA 3PCXA 5EMHA 4EUEA 1EGAA 3V2GA 4QYSA 4AWAA 5FUQA 3QEMA 4M7PA 4PU0A 5DSZA 3T0IA 1LDEA 1ACMA 3ZTWA 5K8UA 5CCXA 3AR5A 5T6MA 4HN2A 2FUG1 1NNI1 2GAFA 1MPXA 4BQOA 1ZJ6A 1IBLB 5EFZA 4JJ4A 1BHQ1 2JK0A 4QTUB 5GMOA 1IHUA 3T3PB 2XWJI 4BYMA 1ODLA 5B3AA 1U04A 1FXWA 4GQIA 3PWKA 5DM1A 3ZDFA 3JX9A 3QVJA 2DWCA 1I9CA 3ICCA 1KMNA 1S2LA 5FOXA 3O3CA 1K8XB 3MINA 2QOEA 3P52A 2IYLD 2C04A 1RI2A 2ZUBA 4S0ZA 5JNWA 5KMGB 5IYZF 4JB0A 3WGNA 2YC2C 1E4EA 4KAFA 3WK5A 1NFRA 5F2EA 2P4UA 2NQ8A 3OH8A 1P9NA 4D1YA 5B7QA 3UJCA 1B0UA 1UEIA 2M6KA 1IY9A 1FNSA 1VCIA 1WZCA 1ID8A 4Q9HA 4Y9UA 3L49A 5DTQA 2JFOA 1SG9A 5DZSA 1I3MA 1XGKA 1X15A 3BMOB 3U3KA 1IJFA 3IXMA 3OIDA 4LHWA 4KSYA 3OZGA 3INTA 1QHFA 4L8LA 1UPFA 4BNWA 1NI3A 2A0UA 2FWJA 3AI7A 4F9EA 4ETNA 4QPJC 4JYBA 4L73A 3WWOA 4EVRA 4DR1B 3EF3A 2ZJ6A 3IOYA 5T57A 3FSGD 3QWBA 5G1PA 1QGED 5K0NA 1LWOA 2P65A 4XE5A 1ZY2A 5EG5A 1XROA 3BXHA 2WBLC 3E3OA 3NBAA 4S2UA 3TTSA 5AW5A 4P4UA 2CLMB 4KXWA 2J87A 2DFVA 2EFJA 2QT9A 4J2HA 4KLNA 2MCFA 3FCYA 4UOEA 3L8GA 1IRXA 3ORHA 3IEXA 4PGHA 1LV7A 5JY1A 4GOJA 4MUFA 3PQ2A 3J81k 2QDXA 3ZQKA 2DBZA 4TMTA 4JSRA 1HYBA 1YASA 4CU5A 3D7MA 4QBTA 4ZO9A 1MRNA 4DV2B 5J23A 2XUQA 1NIJA 1UQUA 2GKSA 3NVDA 2FZ5A 5J4YA 1Y6FA 1C9KA 4R1LA 4DXDA 4K6FA 4XVHA 1G5QA 1EGVB 1CUCA 2G9NA 1QUEA 3PXGA 5IAAA 4JU8A 4PO8A 3FYCA 2O3UA 4C7KA 2HY7A 3ZDYB 4HNUA 3LUKA 1X9GA 3E1SA 3R8CA 5I7FA 3H42B 1JZTA 1CR2A 4TVOA 3QGMA 2PV0A 1XMVA 3ER6A 1OHHD 5SYAA 3ORQA 3UMSA 3KAQA 2MSNA 3ZDDA 1WZEA 1U7TA 1KERA 5K0EA 1QCZA 4J0KA 3DVLA 3HI4A 4H7KA 3W79A 1SEPA 3JQ8B 1CXZA 1RM3A 1K6JA 1QRRA 2D1YA 4LBVA 1M2FA 4RBNA 2X58A 2J3EA 2Z2ZA 1YMVA 2RHRA 3O4RA 5E9AA 3CF2A 1HA3A 4E32A 4JJAA 1CB0A 3PICA 1Y34E 4O5AA 1MJFA 1E62A 1II8A 3KPVA 4JZKA 3KOWA 2F1HA 2Q2QA 4PCLA 2I0FA 3A9WA 4JIGA 2WWWA 5CTAA 3BIWA 3D6VA 3DOCA 2WZDA 4WT7A 2V55B 2R00A 5F1YA 3FSJX 4KR0A 3TLEA 4M46A 1EK6A 3AOEA 2M1XA 4IDQA 3ZN2A 1LXCA 1PR0A 1VJCA 3AGQA 5G0UA 1M1YB 5IT5A 4L4YA 3A58B 4G63A 3N05A 1XMXA 1JMKC 5E4FA 2C92A 3RC3A 4UTRA 2VBFA 2TYSB 2F1RA 2WQZA 2VAWA 5CX4A 5DHRA 5EZYB 1N8KA 4LTDA 3GEMA 1ZH4A 2OV2A 1VLVA 4HFJA 4UARA 4Y2YA 5CLQA 2JFWA 4C4PA 1M6EX 4N48A 4W6QA 3BFJA 2Q6OA 4JKIA 3ZTYA 3ZJ4A 1GQSA 1GPKA 1KRXA 3PQCA 1VG0B 4UUAA 5CLGA 4GZMA 5MGBA 2Q3FA 1XWWA 4WY2A 4YIHA 5M2QA 2OXCA 3E2PA 1YL6A 2Q5JA 4FEYA 4I66A 3RSHA 2JGLA 3UJ6A 1WW8A 1ZK1A 2PU5A 1EB9A 3COZA 2PBFA 1SVUA 3I9LA 4YP7A 1UWKA 1ZKMA 3RM3A 3TKLA 4BBZA 1LBSA 1B0PA 1IYZA 3QU5A 5IUNC 4GRAA 3ZU2A 2GCNA 2WJGA 4QT0A 4RUKA 2XIQA 4U6SA 3RT9A 1I2DA 1WMSA 1Y1PA 2DEUA 1OLOA 1T9CA 2RK6A 4YRSA 3SFVA 1DLJA 3W06A 1SOMA 5JSUA 3D8BA 3FUUA 2CVOA 4Q7JB 3OC0A 3ZCTA 3WMEA 2P3SA 3EXEA 3GPLA 3SHVA 3C7DB 3L4JA 2VQSA 1F0YA 3RBXA 2VAMA 3L02A 1SOVA 2QTVB 4QEKA 1QVRA 2Y0PA 3B7GA 5SICE 4AP6A 1YE5A 1COWA 1R6TA 2XTNA 2AC7A 3EXFA 4WCFA 5IAEA 4BRZA 3FLAA 3AIKA 4IR7A 4TKVA 1MCZA 1XQ1A 1VLLA 2ZPTX 3GXOA 4CEJA 1OLUB 3HDTA 4R7GA 5AK5A 4AECA 2BEUA 4Q18A 1MPTA 4KFSA 1FDRA 4ZEXA 5KNDA 5KQPA 3TXXA 5IAOA 4HCJA 5CPBA 2XNJA 4PWZA 3CY6A 2W11A 3P4XA 4ZT6A 4BOYA 3L41A 3S2YA 3LBYA 4P7KA 1H6BA 4Z99A 4ZIRB 3T41A 4CLHA 1W96A 3VOAA 1UDBA 5BYJA 3KKPA 1WZNA 3GPIA 3SHFA 4ZMRA 5C8XA 4DR7B 4LHYA 1SG0A 2AOUA 1QRAA 4I36A 4YDRA 5TT1A 2O8FA 4HXEB 3JSXA 4PE5B 4OQYA 2WTEA 2ZETA 2WSBA 3IHTA 2YMQA 3NG1A 4YH1A 5EUQB 1OFTA 3C43A 1VI2A 1C4WA 2ZB2A 3DXXA 3PL1A 1W1IA 3PITA 1P9WA 2BLNA 3KTFA 4J0FA 1HDIA 4LXYA 3LXRA 4MQMA 4NU8X 4XLTA 2NMVA 1WIWA 3VQTA 1MOZA 4BATA 2JJ8A 4YV1A 5ED0A 5DF1A 2HA6A 3L1HA 4YMLA 2ZRFA 3NIGB 1J09A 2RHWA 3FUCA 1XK7A 3RS9A 1VJDA 1ZUIA 2WHQA 1QS0B 4RAQA 4YRMA 4FSHA 4L0MA 3S2UA 1I1QB 1P8JA 4MAMA 2ANCA 4R6WA 5E2BA 1SKUA 2DFTA 3IAXA 4M1EA 1O6GA 3FWKA 3SEZA 3GEPA 5BQOA 4CIWA 3QYFA 2VHTA 2ZYGA 3RHZA 5TX7A 1Q3TA 3FZYA 5ADWA 3R6GA 1EJ2A 2CNLA 3DM9B 3GZTB 4NDNE 4OQPA 3BREA 2H1LA 3GRPA 4OV6B 4CIDA 2VA9A 2H2GA 1YB1A 5AJWA 2IXBA 1HZZC 1Z3IX 2RFLA 4J2TA 2NIPA 5JCJD 3E23A 1YZUA 4EJSC 1IHOA 2Q4RA 3B6EA 3IR6A 2C2ZA 1L3IA 3PCTA 5AXDA 1CZHA 3G8YA 1IIBA 1W93A 4WX2B 4TTJA 3VR2A 3K0AA 4B3JA 4US0R 3MTGA 3VNSA 4AJNA 1DMRA 1BKYA 1BE8A 5KAPA 3K32A 3TS1A 4B7XA 2Q1WA 3GEBA 4C88A 3PIDA 5LQRA 5TGTA 4MIOA 3FPBA 3QPWA 2GM4A 4RENA 1M8FA 1DDIA 1MFPA 2BF4A 4E3WA 3E61A 4B40A 2ZR0A 2V5VA 5EGNA 2XCQA 5LBIA 3BDVA 1P74A 2GHRA 3WYNA 3SC6A 1M0SA 3GUYA 4RTRA 2W2LA 2V0CA 5EEGA 1YA6A 1KYVA 4U0JA 1DJPA 3LLMA 1WCIB 2Q1XA 4BVJA 3V97A 3SM3A 4QWWA 5CDYA 5HKKD 2V7QD 2ECPA 2A5GA 3VV2A 1SQSA 4MPJA 1OREA 2HLDA 4P53A 1X7WA 1Z07A 5JI3E 3T12A 3Q8XB 2I62A 4NYJQ 4M7RA 1WXGA 1YQXA 3ZCPA 2PX0A 4GX0A 5TJHA 4EF4A 5AKYA 2WR8A 1HFKA 2O3JA 4IIDA 1SHJA 3WBBA 1TZJA 3E58A 3FZQA 2H06A 5A71A 2ECOA 1PDVA 3GFBA 2R85A 1K97A 1LW6E 3RU9A 2IH2A 4M87A 2FCRA 1G5HA 3L0YA 1S2NA 4JLKA 2WUGA 4Q3NA 3I0NA 3TCKA 4M54A 5LXTB 1DI0A 4DV4B 1P18A 2RD2A 5DTMA 1Z39A 3G5MA 5FUWA 4ZVQA 2P2NA 1G3RA 4QD3A 3UW1A 2QVGA 3UK7A 4X66B 4UEKA 1V8OA 4QQFA 1ZVMA 3ZPXA 4QGSA 1ULZA 3EQ2A 2ZKLA 3PRYA 5JADA 1KARA 3DOUA 3DHWC 5UKDA 4BY9E 4Q0MA 1Z2CA 2HI0A 3ZKWA 3QM1A 3TLBA 2YBDA 1R8SA 1ZLXA 2HM7A 4XSGA 4U2EA 1NOIA 1O4VA 5DGTA 2WEKA 4E2WA 2WILA 2WP8J 5JJCA 1QFXA 1CHNA 4Z7QB 4D0SA 5JNRA 2FOXA 2RKOA 3FGNA 3BA1A 3PFIA 3RJ9A 3EEFA 1T8SA 1SHZA 1NULA 4X92A 3UK6A 5G0TA 3WNQA 4B71A 5BMVB 1YFZA 1NOJA 4AVYA 2EJCA 2GK3A 3WRVA 4ID9A 4EJSB 1ZEMA 2JLVA 2RSLA 2QLFA 3N39C 2F9LA 4YRRA 4C0WA 4F5ZA 3OZVA 4NCKA 2RCYA 3H5IA 1SBZA 1SCNE 3K8YA 3QOXA 5CNMA 2M6LA 2C2YA 1V9CA 3RVKA 1CK4A 5KYTA 1SB9A 4PLHA 1CY1A 2P6OA 3M83A 5TF0A 5EFOA 4S1WA 5ARCA 1E0DA 2A1TS 1LC0A 1QNLA 3CRVA 1FYWA 4LG1A 1SXJC 5FL7A 4DZRA 2WU1A 1DKRA 4F9TA 3KTDA 3ETGA 4EUKA 1VCMA 2C07A 2X5NA 1GPYA 4Q48A 3DD1A 4RDCA 1VYUA 4G0WA 4TS4A 3VAZA 1YDHA 3AINA 1HFWA 2QTNA 2KBFA 2PUVA 5H68A 2QAIA 4WJZA 2ZRHA 1GA6A 1GGMA 4YV0A 2VJQA 2E2WA 2JJQA 3ED1A 4WLUA 4LJYA 4UEWA 3SG0A 2GDJA 2BTOA 3UJ3X 1F7UA 1AUQA 3NBZC 1Z38A 1BJRE 3IAM6 1NI5A 4RH1A 1D3AA 1U4NA 3EZXA 4WZBB 5B6PA 3D8NA 1PJTA 4CIVA 1CJUC 2HMYB 5KOIA 3JRXA 2UYCA 2WWRA 3ROEA 1Y6JA 3L1UA 4TPKA 3ZGOA 3ZIUA 1G5IA 3MT0A 3KYCB 1UPAA 2X4IA 3AH8A 1YR3A 2Q3BA 3B2EA 3KYBA 2PKCA 4G2TA 1KWKA 4TZ6A 3GJZA 4HGRA 1JT9A 1Y89A 1JAZA 4Z1MA 2Q99A 4XGRA 3UATA 1WXWA 3QMMA 2ZTHA 4IDNA 2VP4A 4UFOA 2XWBF 4EB6A 4GOOD 1LRKA 1ELOA 2DQYA 5F3WB 1Y8QB 4NNOA 4NQZA 3IL2A 3OEED 6REQB 1IM2A 3Q9SA 4I9GA 3QE9Y 4GDFA 1ENOA 1G42A 2NAFA 3IT1A 5I7VA 3LTNC 3L46A 2C4VA 2QLTA 3PPXA 2GN2A 4QLAA 4MW2A 4EEXA 2GCPA 4TT8A 5E0KB 1XCJA 4WLVA 5BW5A 1NM5A 2QTRA 1UUFA 2AI3A 4DCCA 1JHVA 3OEHA 1IBSA 1VHQA 3S8MA 3OJWA 4DG8A 4PQGA 1R8QA 1U6KA 2X9LA 3A25A 3NNSA 4HWKA 1X6VA 2ZS7A 3NRJA 1TVMA 1UBEA 1CF4A 2OO5C 4JLAA 3GWGA 5FV4A 4DJ5X 4GX1A 3I2HA 4QUDA 4MWGA 4IJUA 4XCQA 4BX9A 1XRLA 3P0RA 4FP9A 3U7FB 4HPXB 3DV0B 3OQBA 4KNWA 4MUEA 2V6GA 3N8HA 4REOA 1FDVA 3HY6A 5BUSA 4KIJA 2GK6A 2Q4EA 3SXUA 4L8FA 3LT0A 4F4JA 3BGDA 5DULA 3ZBUA 1KZHA 4DAEA 1T3GA 3BZBA 4IFBA 5AOAA 1SXJB 2JHAA 3MRXA 1DB3A 2F7SA 2FX3A 5DCYA 3WMRA 1WVIA 1ESZA 5K8CA 4IIXA 3S2ZA 2P35A 3WZLA 4YMTA 4UU1A 2VJYA 4TTSA 1OFIA 3M3PA 4ZVPA 3ZE6A 5IKEA 4OAOA 2AXNA 4CLRA 5J3JA 1P33A 1CP3A 1YHNA 3HB9A 2XOKA 3HGMA 2QAGA 4H08A 2PR2A 3WLHA 1DWQA 1FSSA 5JQGF 1TLLA 2FPIA 2VUTA 3CJQA 3MTDA 4HDAA 4JJ8A 1G1AA 2QSYA 1JDBC 2EFHB 3KWFA 3LUJA 3MSCA 3JQ6A 3C8HA 2DSNA 4O2BA 3ANYB 3AHFA 3DT9A 4K9OA 2AG0A 1XL0A 4QJBA 2HV9A 2IIQA 2YVAA 5J1SB 1QORA 1X7HA 3JAWA 4B17A 1L1QA 3CUYA 4NNPA 3G2LA 3ETEA 4HWSA 1KKMA 4UATA 5AVZA 4PS1A 4D6XA 4H1UA 2B78A 3HN6A 4W5QA 4V0SA 1ZHHA 2CMHA 3K6JA 2R47A 2H0QA 2DFLA 1G291 2EBWA 2RJOA 2VATA 3DTVD 4PZYA 4OHVA 2QMQA 4WLFA 4CG0A 4RVHA 1U2DC 3KKNA 3PJFA 5C32A 2B6NA 4L8VA 3ZS9A 3CR8A 3TIXB 4TRRA 4CRWB 3GXBA 3FSRA 3PDIA 1Z35A 4MH0R 4N4AA 3W3AA 5LR6A 2IEIA 2PZ8A 1EVKA 1RJWA 1BROA 2L82A 2VPZA 3KK0A 4FX2A 5JJBA 3S2SA 4MR8B 5A0TA 5JNUA 3I32A 1C3OA 3KZCA 1FJXA 1DAFA 2ODTX 4B81A 2FPPB 2GLXA 2JNWA 2ID7A 1EINA 1YIAA 1EVJA 1Z26A 2BFPA 4FHEA 5EGSA 4BRSA 4XKJA 2JA2A 4BMDA 5JI2E 3RFXA 3TLZA 2OHXA 3G2PA 2JRLA 2EJVA 3WB1A 2ENWA 1BGWA 2YQ4A 2EW2A 1NLUA 2ZJ0A 2P3LA 2QD4A 1XZMA 1ZSNA 3MM4A 4HB3A 4CHTA 1PJZA 5BN4A 4IWXA 1NXQA 1SWVA 5FTNA 1DEXA 1HWYA 1P60A 1E2MA 5HSGA 2P9BA 3VDNB 4L74A 3J81A 2WSLA 2WWTA 4EM6A 1EXVA 1MORA 2FSUA 4ZDWA 3JYHA 5F23A 2EZUA 3R9IA 1CT9A 3DV9A 3I2JA 3UAYA 3NGMA 4XQCA 4MUGA 1FMLA 4R2JA 2WFLB 3M6IA 1QOZA 1QRDA 1NF2A 3JZIA 3TNLA 2HPZA 4MLCA 2OFFA 5FPQA 5JZMA 4N5NA 1KXJA 1JWBB 5JXWA 3QY9A 1W6RA 1SVNA 1TGYA 3S5JA 5IXJA 1FFYA 5F5NA 3HJUA 3UCXA 2IYPA 2WJ4A 1NUAA 3ZBTA 2D0PB 4YHHB 1NDQA 5CG2A 4FUTA 4HDKA 1L2TA 3DGEC 2IC5A 5LQCA 3BJRA 3CKKA 5LOVB 2ZUCA 1JDBB 5L3QB 4OQMA 2OYSA 4ZCTA 2WWGA 3AR9A 5A9SA 5KYYA 2YHIA 2MSLA 3VHLB 1I7QB 1KK0A 1QAOA 1E3IA 1JGTA 4ZZ3A 2I7TA 2FUCA 3U7HB 1KQNA 4C4YA 4L6CA 2WAMA 1Z12A 5IHXA 1KY5A 4F5DA 5JWOA 3QX3A 5IT0A 4X91A 2CL7X 4WN9B 3RF6A 1RXIA 2YJ3A 4AN0A 1I5EA 3WK7A 4UW9A 1XTJA 1RIIA 3ZK7A 4AG5A 3BTVA 2FOLA 3TI9A 2DH5A 2ZTUA 4M7WA 5THXA 4B79A 1V2GA 1TE2A 3GQBB 1HNNA 5E6UA 3ZWVA 4MITA 1C1YA 1XEWY 4H15A 1CR6A 4UNSA 4U2FA 4DLXA 3IVXA 3NHLA 1YQWA 3QH4A 4U1RA 1NSYA 2X6TA 2XX3A 4MV5A 1AX9A 3L6OO 2DU8A 3FSEA 3W2GA 5B1IA 4KO2S 5TQ2A 3TNJA 2C5LA 2SNIE 2XRYA 1URPA 3P9IA 4O0MA 2VWGA 1QKJA 2ATEA 5LLDA 3VPDA 1A82A 3BK7A 1R0BA 1AXEA 2A86A 2ALJA 3DE3X 3NO4A 4TWBA 3G0DA 4IDFA 4TVKA 3SLGA 1TCVA 3ZVLA 3DCJA 4NE7A 1GPLA 3VJLA 1C1XB 3EGWA 2X3YA 1OIXA 1SGWA 1T3TA 1ZX1A 4HXYA 3KSAC 1ECJA 2Q4DA 1ZM3A 1RDFA 3RYFA 5JECA 3DZ8A 3NGXA 3WQQA 1BOOA 3M6UA 4FEEA 4ZV9A 4KLZA 1Y6ZA 2ANBA 1Z4JA 2IU4A 2WD9A 5IM5A 2JLZA 3NHAA 1JIKA 1ZFNA 1VE1A 1JEOA 1XAIA 1Z17A 2R25B 3L4EA 2FQQA 4FZRA 1UPBA 1WF3A 1YGPA 1XXHE 4AZSA 4C7BA 3TQTA 5BSFA 1U98A 2G36A 3LY5A 1Z15A 3TQQA 3DVAB 1YCDA 1Z45A 4GU5A 3WGMA 5LQKA 3FR8A 1QU2A 1W2GA 2JGNA 3W7AA 5HKOA 1T15A 2C3MA 3STWA 2RHLA 2ZBEA 4IDCA 2CFTA 1DTEA 3ZD6A 1G19A 1JLLB 1YZTA 6Q21A 3OE7A 2IS6A 4KQKA 1LBTA 1MUUA 3AUJB 1LPSA 1KJ9A 1R6BX 4EB0A 1Y1QA 4L5BA 2CNDA 1CUGA 2A84A 4DC0A 1H2HA 2HF7A 1V3UA 4QYIB 1QGUB 2CFCA 4BMNA 3JD1A 3LQ1A 2PV7A 4YCMA 3R5TA 6GPBA 1CEQA 4PLCA 4RJLA 3CS3A 5LC1A 4DB2A 4MKHA 2XNDA 2IIBA 3H7AA 3KXDA 3VVLA 2HZBA 3AP3A 4DR6B 3HB1A 4FOOA 1FUEA 1Z4QA 2JCVA 2LIPA 1YS6A 1Z4NA 2Q50A 3IOEA 2J7PD 1A1SA 5C4GB 1QCCA 1YVRA