3P2KA

Structure of an antibiotic related methyltransferase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
197
Chain Sequence
LILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFELKNIADSISILFPWGTLLEYVIKPNRDILSNVADLAKKEAHFEFVTTYKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the methylation of A1408 in 16S rRNA by a panaminoglycoside resistance methyltransferase NpmA from a clinical isolate and analysis of the NpmA interactions with the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 16S rRNA methylase
total genus 63
structure length 197
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.180: 16S rRNA (adenine(1408)-N(1))-methyltransferase.
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p2kA00
3OFJA 5G02A 3EVAA 2ZSUA 3KQOA 4K6MA 1YF3A 1KP9A 2JHPA 4GQBA 3EVGA 4PCLA 3UWPA 5LQAA 2PBFA 1D2CA 1PRYA 2NXEA 1SG9A 1INLA 2G72A 1NV9A 2AOUA 2JH8A 3R24A 4GC9A 3I64A 3RODA 4DA4A 3HEMA 1YFLA 4YV2A 1RJDA 2AR0A 5E1DA 1D2GA 4RVDA 1WG8A 2GLUA 2G70A 4KWCA 5HIKA 4RTNA 1KR5A 2BM9A 3LPMA 3R9XB 3G88A 2ZIGA 1Z3CA 5T67A 3MCZA 3R6TA 5HFJA 2OB1A 2OB2A 5K8VA 5LQRA 3OPNA 4AUKA 2PWPA 5LQUA 3EVDA 3P2KA 3X0DA 1O9GA 5FWDA 3GRYA 2ZLBA 4OBXA 2IH5A 2PX8A 3AWIA 1Y8CA 5GP1A 5K0EA 1R18A 3A7DA 2BR3A 2BZGA 1QZZA 5P8WA 4E2ZA 3V8VA 1G38A 5EMLA 1L1EA 3FRHA 4PYLA 5KS2A 4FS8A 1NKVA 3G5LA 5T64A 3GRZA 3UBTA 1WZNA 5BXYA 3C6MA 1SUSA 4H0NA 3U81A 3LDUA 1KXZA 3GU3A 3KPVA 3RIEA 1N7JA 3BWYA 3KU1A 2Q41A 3K6RA 2Z6UA 2XBMA 5H02A 4P7GA 5DM4A 2IBTA 2C7RA 2E5WA 4PIPA 3R0QA 2AVNA 3A27A 2QRVA 1JQEA 2IGTA 4R6WA 4RVFA 3EEOA 5E2AA 2PXCA 4ER7A 1Q0SA 1TW2A 3HCAA 3M70A 5FULA 5LQKA 1EAMA 1ZGAA 3PTAA 1FP1D 1YB2A 2PVCA 2YVLA 3DULA 3T7TA 5GIOE 2AOTA 4IKPA 2HR1A 2ZZNA 5CD1A 1VP9A 3DMFA 4YMHA 4M38A 3CC8A 5DRTA 4GEKA 2UYOA 3M6VA 5F2OA 3GNLA 2ZULA 3NTVA 1VL5A 4AZVA 4R6XA 1I9GA 3KQPA 3KR1A 4HGZA 3V97A 1WXXA 1BOOA 1RI4A 3KQTA 1P1CA 4OBWA 5EIWA 5M5BA 3AXTA 1H1DA 4GF5A 1JG4A 1QAOA 5E1MA 1G6Q1 2YR0A 3BKWA 5GM2A 5K0BA 3FZGA 5C1IA 4GOOD 2AN4A 3DLIA 4C07A 1BC5A 1EJ6A 2OXTA 1YZ3A 3UJ6A 3A26A 5E9QA 3UJCA 3ERCA 2ONYA 5C9ZA 4DQ0A 4JXJA 3CVOA 4LECA 1G8SA 4U7TB 5DWQA 5E2BA 5GWXA 2ZIFA 3REOA 4EQZA 4AZSA 5E8RA 1NW5A 2B3TA 2QE6A 4RTOA 4M7RA 4PGHA 3HVJA 2QM3A 5ICCA 4QPPA 2H00A 5FCDA 3G2OA 3KR0A 3KQMA 3M6WA 1IY9A 2PSSA 2IIPA 4E70A 1G8AA 2B2CA 4IWNA 5BW4A 2PT6A 1L3BA 1L9KA 1F38A 2BR4A 3GRVA 4DMGA 3HCBA 4DM3A 4C4AA 5EMJA 4RTLA 5DX8A 3B7PA 2ZBQA 4MWZA 4EK9A 1DUSA 1F3LA 1AQIA 5EHGA 3VYWA 3E8SA 2WK1A 3FUTA 2AOXA 5K09A 1XTPA 3P9CA 5EEHA 3A7EA 2AN5A 2P41A 4RTPA 2AN3A 2DPMA 2O57A 4DZRA 4GC5A 1XDUA 5B1SA 4PYMA 3SSMA 2ZIEA 5E1BA 2ADMA 2F8LA 5BW5A 2ZCJA 3ELYA 3G2MA 5HIMA 3CJQA 3DUWA 4CKBA 4PYQA 4QTTB 2EFJA 2R3SA 1G60A 3PS9A 4KW7A 3SM3A 2A14A 2FHPA 2G71A 2FK7A 1AV6A 3E05A 3E23A 3UJ7A 5E8JA 1IM8A 2P3OA 5JUWA 1R74A 5LSAA 5DSXA 4RTQA 3FTDA 2PT9A 3KQVA 1JTFA 3BGIA 4ER3A 5CIYA 8MHTA 3HCFA 5EMKA 2C7QA 1T43A 5DTQA 3FYCA 3BUSA 3LCCA 4RTKA 2PY6A 1U2ZA 3QOWA 3UJDA 2BR5A 2CMHA 1AQJA 3ANXA 1JSZA 1X1DA 2WA2A 3FPGA 3OU7A 4BLUA 1EIZA 4FGZA 2NXNA 4YUVA 3FTEA 5HOQA 4FSDA 3D2LA 1ZQ9A 3P9NA 4HRAA 5F2NA 4PYNA 5EPEA 2FPOA 1ORHA 3TM5A 4C06A 2P3QA 5EHIA 4HGYA 3EMDA 5ICFA 2G8NA 4E33A 3ELUA 5EZQA 4E2YA 2R6ZA 3NMUF 4RVHA 3KKZA 4P7KA 2G1PA 4HTFA 4YUWA 3PFHA 2ZFUA 5FQNA 1QANA 2ZZMA 4F86A 3CKKA 3THRA 2PXXA 2PLWA 3FUXA 3DP7A 4M36A 3KQSA 4RSRA 3DXYA 5CVUA 3KQWA 3GJYA 4V0QA 2Y1WA 3OFKA 3P71T 4E31A 2Z6AA 3ELDA 3K0BA 4PYKA 3LBYA 4UOEA 1VIDA 1RJFA 3A25A 3GRRA 3OE4A 4C08A 3FPFA 3LCUA 3FUWA 3TR6A 4KVZA 5JR3A 3G2QA 2B78A 4YUYA 4HTFB 2PWYA 3EVEA 3T0IA 1XXLA 5C0OE 3EPPA 3I9FA 3OU2A 2Z6QA 3H2BA 1YUBA 1VQ1A 5FADA 5HILA 4MIKA 3EVZA 1SQFA 4R05A 1KPHA 4E32A 5KQRA 2I62A 3CGGA 3JWJA 3OZSA 4X63A 1ORIA 1UIRA 5EIFA 1HNNA 2B25A 3SGLA 2NXJA 3B5IA 3LSTA 2ESRA 3TFWA 3NVKI 4BLWA 2VDUE 2GA9A 2JH9A 3HA7A 3G8BA 3GO4A 3HA3A 4BY9E 1MJFA 1RI1A 1XCJA 3DMHA 4YUXA 2QRVB 4RV9A 4POOA 5GINE 1RJEA 3BXOA 2EJTA 3DXXA 3ELWA 1FBNA 1NW3A 2LD4A 2NXCA 3G7UA 3ME5A 3SX0A 3WSTA 2YUIA 4E2WA 4RWZA 2PKWA 5HZMA 2P3LA 5FHQA 3SSNA 3OCJA 4YUZA 2OPBA 3SR4A 3IV6A 3LBFA 3M6XA 2YX1A 2ORED 1VE3A 3HVKA 5EC8A 5LQCA 2AS0A 1WS6A 2BM8A 1N7IA 2JG3A 3TOSA 1VPTA 2B9EA 2FK8A 1NW6A 1JG3A 3I58A 3LKZA 1HMYA 2CWWA 3KPJA 4GBED 5EOVA 4G56A 1M0EA 2YXDA 1SVUA 3HCEA 2IH2A 2JHCA 1JQDA 3RW9A 2P8JA 4PYJA 3KPWA 2OYRA 2ZZKA 5EZSA 2DULA 3TPZA 2EJUA 2YXEA 3HA5A 5FHRA 1KIAA 1FPQA 4BLVA 3PVCA 4YV0A 2UYHA 4PNEA 1ZG3A 1NW8A 3O31A 5EG5A 4HSGA 4XUEA 5IH3A 5DX0A 3GXOA 4E30A 4P7JA 2HNKA 4AX8A 4RYLA 2ONZA 5DM1A 1XCLA 2Y1XA 1EG2A 3S68A 4E2XA 3LHDA 3VC2A 5LR6A 5LQNA 4ZTBA 2P40A 3GGDA 3LCVB 2CL5A 3LDFA 5DXJA 5CVVA 5CVJA 3TKAA 2GPYA 3BWCA 3EMBA 3P97A 1AF7A 5D1NA 3OU6A 3P2EA 2NYUA 1X1CA 4A6EA 3EVBA 1Q0TA 1XDZA 3NDJA 3MGGA 2CKDA 3IHTA 4RTRA 3UJ9A 2OY0A 1JTEA 4IV0A 1L3CA 2OBFA 3SVZA 1I1NA 2PX2A 4L7VA 1EJ0A 2UYQA 3DMGA 3FPEA 1RI5A 3HM2A 3TM4A 2HMYB 2K4MA 1P39A 1PJZA 3LKDA 4LWPA 1KYWA 4XCXA 4F84A 3Q87B 2VDVE 4RTMA 4C05A 4C04A 1WY7A 3C0KA 3G2PA 2IPXA 4EMSA 3OZTA 2FYTA 1D2HA 4CKEA 1NE2A 2ZW9A 4QTUB 5DM2A 2GAFA 4ER0A 5E9WA 1OR8A 4MQ4A 3OE5A 3BGDA 3KQQA 3KHKA 5CUQA 4QVKA 3EVFA 3JWGA 3EGIA 4XUDA 2GH1A 5FWAA 5T6BA 5HEKA 3NWEA 2UYCA 2HTEA 4PWYA 5CVDA 2AOVA 5EGSA 4V0RA 4OX9Y 3HTXA 3T7RA 1BHJA 1UFKA 1RI3A 5LQJA 5K0GA 3P2IA 3LGAA 2FCAA 4LG1A 3BT7A 1R8YA 3ORHA 3B89A 2ZVJA 3E7PA 4Z2YA 4R8RA 3UJBA 3B3FA 4A6DA 5KVAA 3GIWA 4QPNA 4PIMA 5GOZA 3JWIA 4HG2A 5DPMA 3VSEA 4KIFA 5CVEA 5ERGB 2P35A 3ER8A 1BKYA 2H1RA 4EKIA 2PXAA 3MAGA 3Q7EA 4LWOA 3P9IA 4F85A 4Y2HA 4GOND 5KYGA 2PX5A 4RVGA 5D1HA 4B17A 5HIIA 3UJ8A 2ERCA 3O7WA 2C7OA 3LDGA 4KRGA 3T7SA 2XVAA 1SUIA 3CJRA 4U7PB 2YTZA 3DOUA 2FRXA 4GOMD 1MHTA 3HVHA 2OKCA 2IDKA 2XYQA 2V74B 3CBGA 2IP2A 3I53A 4HH4A 1M6EX 3I5UA 2ZBRA 3R3HA 1QAQA 1X19A 2ZTHA 3B3JA 3AJDA 1IXKA 3A4TA 3AXSA 1XVAA 3CJTA 3FUUA 3NWBA 4FT4A 2YXLA 2WA1A 5GM1A 4CKCA 4YV1A 3UZUA 1NW7A 4AZWA 5K0LA 1RJGA 3EGEA 3OZRA 1SKMA 5EMMA 3VC1A 2AOWA 3DTNA 4R8SA 3ER9A 3FTFA 3MHTA 2P7HA 1ZKDA 3QV2A 5E1OA 3BWBA 5K0FA 1N2XA 2NP6A 1SQGA 3AY0A 1P91A 3FTCA 5CCBA 5DTRA 3GDHA 2PX4A 1X1AA 1ZGJA 3M6UA 3EVCA 2IH4A 5EKUA 2I7CA 2QYOA 4FZVA 3UJAA 5K01A 3G89A 1DL5A 1NBHA 4FSXA 4CTKA 3M4XA 1ZHFA 4OQDA 4DCMA 5BP7A 3ID6C 3MTIA 3NVMB 3G8AA 3PX2A 4PYOA 1G55A 4X60A 2UZ4A 2AOTB 4X41A 1JSXA 5KQSA 3BKXA 5FUBA 4DKJA 3JWHA 1KHHA 1JG1A 3O4FA 2C7PA 4NECA 2XYVA 2VZ9A 5MHTA 4BP3A 1O9HA 2IFTA 5DT2A 2EG5A 2GB4A 2PGXA 5EVJA 3SSOA 1UWVA 2I6GA 10MHA 4X61A 2I9KA 3B3GA 1O54A 4FP9A 3KPUA 5K05A 7MHTA 5EQJB 1NBIA 4EVIA 5FQOA 1QYRA 1KYZA 3HCCA 3FRIA 4MHTA 1WXWA 1NT2A 4QQKA 3C3YA 3FYDA 4WVLA 1M6YA 1R8XA 2VS1A 1TPYA 1EQAA 2VDWA 1VLMA 2YQZA 3F4KA 1FJXA 9MHTA 2XYRA 3EGVA 1YFJA 3HCDA 3MERA 3MTEA 3SXJA 5DXAA 4RTSA 2VP3A 4PONA 5EKXA 5CCXA 4QDKA 3UA3A 4PYIA 3GWZA 2AVDA 2ZWVA 4EKGA 1TW3A 5K0NA 2ZWAA 4M37A 4PCAA 5ICEA 3NDIA 3C3PA 4KIGA 5DSTA 2QY6A 5EEGA 3BWMA 4DCGA 3SMQA 4BP1A 3FPJA 3CCFA 5DLYA 3THSA 2V7EA 3FUVA 5K0CA 3PT9A 4CTJA 1DCTA 4RX1A 4DF3A 4GOLD 1JG2A 1KPIA 3P9KA 2P1DA 4OQEA 5GIPE 2ZBPA 3C6KA 4QDJA 2OO3A 3GCZA 4Y30A 3KR2A 5E9JA 3BZBA 4YMGA 2IDJA 3G5TA 5DRYA 5FA5A 2BH2A 3NW9A 2HV9A 2NP7A 2GS9A 2O06A 1R00A 3TQSA 4PINA 1FP2A 2N47A 2H11A 2O0LA 3TLJA 4GUAA 3HVIA 2IBSA 3UA4A 3LL7A 3UFBA 1XJ5A 2EX4A 3MB5A 3NJRA 3MQ2A 2JJQA 1JR4A 3DR5A 4QQNA 4P7FA 5DTMA 4C03A 2PV0A 3DLCA 3M33A 3FPHA 1NV8A 3IEIA 4OA5A 2XVMA 5K0JA 5FTWA 2NNWB 3HNRA 4FT2A 2O05A 1VP3A 4P58A 2OZVA 1JQ3A 2JHAA 4PGGA 2KW5A 4WXHA 5U4XA 3TRKA 2CMGA 2P7IA 1KPGA 3DXZA 3KQYA 3MCTA 1VBFA 4KDCA 4ER6A 3TKYA 1YZHA 1L3IA 5DM0A 4FR0A 3TMAA 4QVGA 5HIJA 3GRUA 4CWAA 4CXMA 1P1BA 1X1BA 1XDSA 3PB3A 3IYLW 2HWKA 3EEYA 1RI2A 3LECA 3LX6A 3PX3A 2O07A 3DH0A 5IKMA 4KDRA 5CM2Z 4ISCA 5F2KA 3L8DA 4HC4A 3KPYA 1I4WA 3P8ZA 3PFGA 4O29A 4OA8A 4X1OA 5K03A 5DX1A 4ATNA 1QAMA 2AOUB 3BGVA 3HP7A 4ER5A 3KR9A 4XUCA 5FA8A 1B42A 5ICGA 4MTLA 2PJDA 4AZTA 3PLAE 4RTJA 2AZTA 3QOXA 4IV8A 1V39A 1R6AA
chains in the Genus database with same CATH superfamily
1YRHA 3T7DA 4KWIA 4DT1B 1KP9A 2ZU6A 3IO5A 4FJ1A 3SZLA 1RNLA 3KSAC 3BVPA 4D98A 4LMBA 5DI3B 1CKEA 1HDRA 3QVWA 2VDOB 4R98A 2CNKA 4CU2A 1D2GA 1I7NA 3T6KA 1Z5GA 5KYWA 1JBKA 3VPCA 1E1NA 4WN3A 5T67A 3VNBA 3A3YA 5LIPA 1F60A 1M54A 4MAMA 3X0DA 4GWLA 4CDRA 5EJFA 5A5FA 2RH8A 2VOEA 1KSGA 2H08A 1F2UA 1KY2A 1MJ5A 5JWOA 3L8MA 1LBQA 1G4HA 1V5EA 3D31A 2ECQA 2K7FA 3ZOZA 1JUDA 2GBPA 2WW8A 3QEAZ 2PS3A 1CRWG 3CA8A 4YPVA 1P4SA 1KH1A 2DPYA 5HRCA 4R2MA 4DABA 1H8HD 5D00A 4KI0A 5CURA 3G68A 3KLBA 3BYZA 1W47A 2ODBA 2W7TA 4OYRA 1WW2A 4IW3B 4B3IA 1NM5A 3B1WA 4NQRA 1BHQ1 2VEDA 4E88A 4BGDA 5JO0A 1SUFA 3BMCA 2BFMA 3RIEA 1Y6JA 3PE4A 2Z30A 3K9QO 4G4SP 3COYA 3N59A 1N7JA 2I33A 4M0DA 4WZZA 3FYSA 3HCWA 4EPXA 3ZWCA 4IVNA 3GT0A 3JYNA 3NDRA 5H02A 3TDNA 4RK0A 5HKAA 1SXPA 1F17A 3DAOA 3HRKA 1JSLA 1MGPA 3H5NA 4KRYA 4PN3A 5KNBH 2FFBA 5FUXA 3RRBA 1N36B 1FIUA 1WO8A 3DTTA 4ER7A 4QT0A 1CUWA 4IZ6A 1FQJA 1TMYA 3IV9A 1EAMA 4NHOA 3N9IA 3ND9A 2PVCA 4K81B 1ZIPA 3SCZA 4BMVA 4M86A 4QDUA 3QPBA 3X43A 4W1QA 1VP9A 1WB9A 4YJ3A 2WWWA 2XD9A 2FQYA 4PLGA 6AT1A 1FNDA 2IZOA 2FSGA 3HHEA 4MYUA 3CC8A 4WZAB 5AIAA 4ZCIA 5DNUA 3KT3A 3IJPA 1W0KD 3G7NA 2REOA 3TB4A 3SAJA 1XQXA 3LLUA 3HDHA 1XB2A 4GKVA 1DNPA 4FE7A 4GSYA 1OBFO 2Q6VA 2ZIUB 4KG7A 3K9CA 1E9DA 3EZNA 3KQPA 4HGZA 1VRWA 1Y1PA 3DAPA 5T57A 4ALLA 2F67A 3GUCA 4GPTA 3OQPA 4OBWA 1NNEA 5KU1A 3NV9A 2QZ9A 3S2YA 1Y81A 2EBWA 1IZ7A 2V5AA 2X7XA 2OL4A 3NV7A 3DLIA 4G8DA 2OXTA 1XZMA 3PRKE 2D8MA 4Q82A 2XHZA 3ZGNA 2C4TA 1ATIA 2NPIA 3EAGA 3O92A 5E4YA 3PC8C 4CM1A 5C7LO 4NE9A 3OPMA 4BU1A 4DR5B 1S3FA 3W2GA 5CLLA 1RSZA 3QXJA 4ZZ2A 1HE8B 3QA9A 2XUOA 2WINI 3ZCQA 5JBIA 3QLEA 4H7DA 2ZSBA 4IDNA 2E7ZA 3M6WA 3HY3A 4FFRA 2C2OA 4X93A 1QFMA 5F7OA 3QVUA 4QDTA 4JLVA 5BW4A 4ZCLA 4CEIA 4YH1A 2G08A 2PT6A 5JAIA 1L5HB 3WJ1A 2AHRA 4C20A 3ZVMA 4DCPA 4F9GA 1Q22A 1LEHA 2RFLA 1EDEA 4WVFA 1QH8B 1W8DA 2FN8A 4OXKA 1YS6A 1ZOSA 1F3LA 3DHEA 2Z3VA 2EJCA 1EYZA 2EW1A 3WMFA 1V5FA 5LYJB 1RQ7A 2XGGA 3KSBC 2WKPA 2JLBA 3SQXA 3K1AA 2Z4SA 1H0KA 1KEZA 4J0CA 1Q92A 1SUBA 4XQCA 4XUGB 2F1IA 4ZIRA 3D4IA 2BCGY 1CIVA 1IOLA 5SY6A 1VIAA 5B58T 1E2IA 3HCOA 4XPIA 5AKGA 3U6KA 5A9SB 5HIMA 5L53A 3CV3A 4KW7A 1OH8A 2GEUA 5F33A 3RUIA 3FWPA 4Q02A 3D7NA 4LGVA 3E23A 3RIYA 2BZSA 3HN7A 3UUWA 2F43B 4FHZA 4LHYA 4HLUC 4D44A 5EERA 1ZOIA 4E2WA 3HI6A 4KCGA 4OI1A 4ETNA 4EZIA 1J2EA 821PA 3ORQA 4BMOB 2QPLA 3L7LA 3CWQA 3EGDA 5EYPA 1N6OA 3EOZA 2BGLA 4RNCA 3TX2A 2Q1YA 3WKAA 4BQRA 3IPRA 3ZVNA 1F8YA 1XO1A 4LDAA 3H3FA 4JVNA 1X7YA 3QOWA 5TMEA 2BR5A 2CMHA 3PJEA 3T9EA 4AJ9A 3KALA 1A5AB 3BREA 3DV2A 4K9DA 1HDOA 2OZLA 2WF7A 4ESOA 1RADA 2ISSD 3AC0A 2AFVA 2RBEA 2C5EA 4HK4A 2IYSA 2ZSKA 2CHVA 4JLUA 4L5BA 4I55F 4G65A 5ED0A 3ZVLA 1AK2A 2PMKA 4HGYA 4UMVA 5IN4A 4BP8A 1F2VA 5AI4A 4QTYA 2ZPUA 1T8RA 1XCBA 1XLTA 3DE6X 3EX7C 1DO0A 2IYVA 3TNFA 3JVEA 2NM0A 4HI0E 2BY4A 4OATA 3Q15C 3KLOA 1C9KA 3GUVA 2IH2A 1UKVY 2NUTB 4MUMA 3O26A 2ZETA 3BRWA 3WAKA 3WA7A 3AJ8A 3D8NA 3OOWA 2J5KA 2CMFA 1XN4A 3STWA 2A0WA 5AXDA 4M0EA 1ESCA 1VZ3A 1HYBA 1SEVA 2OCLA 1LI4A 3IQDB 4H1UA 3AFHA 3LBYA 4HGNA 4TLMB 1VIDA 3HFGA 3PNKA 1C7JA 1CQJA 4Y9TA 5FOQA 5I7EA 1U8FO 2WTAA 3W5UA 4D3XA 4CW7A 3L8FA 4E0BA 4JJIA 2BEUB 2J0UA 4MA5A 3I9FA 3IEUA 3LXRA 5FI0B 5DN6D 3RC8A 3PITA 4UD2A 1LFDB 1UINA 4JLMA 4TQAA 5ADHA 5TE9A 4EH1A 3X1YA 4QODA 3R5XA 4UNPA 2BFDA 2W22A 3JD2A 1NBMD 1YA4A 1BX0A 3PV0A 4GDMA 4RV4A 3WKDA 3N86A 4B6RA 1O2DA 5JJCA 1DAMA 1RFLA 5FDFA 1NVVQ 1C2TA 3G8BA 4PV7A 4BY9E 1RI1A 2PRKA 4YUXA 3HUTA 4YJGB 1I6KA 1B93A 1ZN8A 1Z5WA 3BXOA 5CDFA 3LE8A 3UHOA 1OZFA 2P2DA 3GQBA 5I9MA 4QOJA 3TLZA 3CSDA 1T26A 4L16A 1WZCA 4PIVA 5DN6A 1KZ6A 5EE9A 1SCBA 1FNSA 4QGHA 4N5MA 1N0VC 2Z5FA 4N9QA 1VKNA 2PLNA 1GAEO 3QNWA 4HY3A 3GZ4A 3ABZA 1VZ2A 3PJGA 2PYDA 1L7NA 2JGFA 2C84A 5AKIA 3DF7A 5U9CA 4E2FA 3QLTA 4L8VA 3VU9B 3QIVA 3MRVA 4GZ3A 4G4IA 4KK3A 1W85B 1OLOA 2OVFA 2OV4A 4PN7A 5ES3A 3FF1A 2O0JA 2OCAA 2W6IA 4MWBA 1WLYA 4N0MA 4Q3AA 4HAVA 2W6ZA 5DTIA 3GJ7A 4RF3A 4RVNA 1MTZA 3RW9A 4M7PA 3VO1A 2WI8A 4O2AF 1QYWA 3T5MA 3RQSA 5L3QA 2HIMA 1CU1A 1KIAA 3HMQA 5LWQA 1CVLA 1QIFA 3DC7A 3ICCA 1AZTA 1BDHA 1TCCA 3I73A 3PTLA 2O4CA 4HSGA 4JI5B 2OLJA 5JJBA 2PUAA 3R9XA 2AWOA 2XUDA 5KPJA 5FLKA 3BM5A 2VEOA 3ICOA 3NIGB 4LE2A 4QGFA 1YJQA 4PNZA 4F5DA 2G7MC 3QMVA 4BWYA 5JW6A 1J00A 5DGTA 2NUBA 1IAVA 2P65A 3PPVA 5EIBD 3GGDA 2CL5A 4XCQA 2RAUA 3E3LA 4WZAE 4DS3A 1BVUA 2GPYA 3EMBA 3OQIB 2WMNB 1KEPA 4S0ZA 2RGAA 3USZA 1NX9A 3JQ7B 2F1OA 4QWWA 3NDJA 5AW3A 5KU7A 3TI9A 2ZR8A 3OF3A 3IHTA 4MV4A 5AK4A 4R0MA 2W2NA 4AL4A 1C80A 5TPWB 1CRZA 3ZKAA 2MT9A 1ESMA 4JMPA 1SCNE 3NM5A 3TQTA 2OAGA 3GD7A 2CDAA 1OTHA 2GQ0A 3K8YA 2VH1A 3P2MA 3VZDA 3WGUA 1NZJA 3PGA1 4LWPA 2ZDGA 1DHTA 5AVQA 3SZOA 1Z83A 4CZ2A 1PFGA 1GADO 1PV4A 4XQEA 1WY7A 5EIEA 4G4JA 1EUQA 4TTJA 5DBIA 3A36A 3OQVA 4EHAA 2ZBEA 2EKPA 3H86A 4Q6BA 1X74A 2P68A 4RS4A 3S5JA 4BNDA 4OQNA 1KERA 3H8WA 1YFKA 4N54A 1N5OX 1S2LA 4QVKA 4D02A 3EGIA 2GH1A 1PWYE 4J4HA 3KVRA 2XZLA 1FP6A 3OECA 3BC1A 4KB5A 3FG9A 7ABPA 5KNBA 1R27A 2HIHA 3LW7A 4LRTB 4M1SA 5B58C 5DTEA 5BQ3A 3WK7A 3AOEC 5A3SA 2ZSIA 2ZPTX 4M0CA 2V6JA 3WISA 3O21A 1WVMA 1E9RA 5LIRA 4BNDB 5FIUA 4BPBA 4A36A 2FWJA 2GCPA 2OVBA 5FBQB 5D3KA 5BUQA 4XR4A 2H1RA 1ZD9A 2XYHA 4HH0A 1PT8A 2BGMA 2QAGC 2JFNA 3HKDB 1F0NA 1R8QA 1OJ7A 3CLSC 1YS9A 3IBTA 1LCIA 2PX5A 1VL1A 1X7HA 2MSLA 4JL8A 2VQ6A 1JPNA 3NOXA 4YR9A 1QVAA 1NVVR 2EFCB 1CUCA 4R68A 5D3QA 3UJ8A 3HKBB 4L51A 3BH7A 3OZDA 3Q4GA 3H8JA 1ORVA 4OKIA 1V11A 1B2RA 1SU6A 4WLOA 1USGA 2YTZA 5AO9A 3ZU2A 3RBXA 1RE0A 4AW9A 3FB4A 2F1RA 4Y9SA 2O0MA 2DU8A 4D9GA 4ZCMA 1U63A 3T5PA 1UBOS 2R68A 1H8ED 2HLPA 1EZ4A 1S9HA 3I53A 4ZT6A 3AKEA 2CJYA 4XDGA 2C1ZA 2CEKA 2J7PD 4Q00A 3UEOA 1KK1A 2ZTHA 3AG6A 4R31A 3ZOKA 1BWRA 3LQQA 3AEUA 1IXKA 1JKIA 3C7TA 5EJ9A 4B9EA 1Y1SA 1O03A 3OG9A 1Q21A 1NW7A 2PYZA 1G7CA 3AJ9A 4NU5A 4N5LA 5AJHA 5K0LA 1WWKA 4JYBA 3EGEA 1QH1A 2GPSA 3KYCA 8ADHA 3VR3D 1EHIA 1VSTA 2Y0EA 1KFCB 3RRMA 3CIOA 2IYWA 3PRYA 4J1SA 4NH4A 5KOHA 1VHJA 4HNQA 4M89A 2BGJA 1QQTA 4WOBA 3RG8A 4CL8A 3UWSA 1DE0A 1P91A 4UM9D 2WMDA 2GOYA 2WWTA 2F3PA 4BNHA 2X8WA 4YMUA 5F7XA 1OFTA 4ALJA 1TECE 1TO6A 4DCNA 4F2DA 3WA6A 1JZSA 1CR1A 1YMQA 5J4LA 4F8YA 5H3HA 3HE3A 4KIJA 2O2GA 4O4LB 5KJ6A 2NZ2A 2WSBA 1NBEA 3KB8A 5F1KA 4AMZA 3PX2A 4H6PA 4D4MA 2OG1A 1PLLA 2CB9A 4X41A 3TTWA 1NQUA 1JHUA 1Y1LA 2RI1A 3PFFA 4KX3A 1KHHA 2X2FA 5K3BA 3WLQA 4NECA 4NARA 4HFMA 4A5OA 3MD9A 1QUEA 4GLLA 2O3RA 4QD3A 5HKOA 5JSHA 3A1SA 4HX2A 4DIUA 5DBHX 3SOZA 3E35A 1H1LB 3C43A 3CRW1 1GDHA 1O54A 2YL2A 4IXMA 3EG9A 3IUSA 3BMNB 4KVFA 5BOVA 5IF3A 2QVBA 4CQMA 2UYGA 2BF7A 2WYIA 3Q10A 1DO8A 4X8HA 2POQX 5BMOA 2QW1A 4UUQA 5K4HA 1CULC 1EQAA 3H0KA 3A9UA 2RK6A 3I32A 3NCHA 3OETA 4KAAA 4R5HA 1A9YA 1NX6A 3GR6A 1N0HA 2A1TR 2B1QA 4DR1B 2GETA 1EVZA 4EB0A 2RHLA 2PU5A 4XEHA 3WGQA 2YWDA 2JIPA 3TEJA 5L45A 521PA 2X5NA 4KGZA 4D3ZA 2FGKA 3K05A 4L5IA 4I3HA 5KSZA 2GNPA 1PFUA 1ZK1A 1XNQB 2XTNA 3G79A 3GFRA 4GR9A 4UJ3A 3N76A 1L5MA 4YACA 3H05A 3IDZA 4GZMA 1UFOA 5DI9A 4AJHA 4ED9A 4OQEA 1KPIA 4MRNA 5HPYB 3LO8A 1SOWA 3RYFA 2ECPA 3V7YA 1TF7A 2DY1A 3GUYA 4YAWA 1W59A 4CVNA 5I9SA 3PQ4A 4WXEA 1JKMA 2IZ7A 4NJMA 2JF0A 4LRUA 1CFZA 2BH2A 1MB3A 1W76A 2C59A 3S1SA 5LDDC 5KWIA 1E8DA 1U0BB 2AX4A 3TLJA 3FSGD 4HDAA 3LGXA 3Q3JB 3BZWA 4HJXA 2N1MA 2YW9A 3MB5A 2QVZX 1SB9A 1SNYA 2QP4A 1JR4A 2W4QA 3GLSA 3CX3A 4MGYR 3TUJC 3DLCA 1Y4ZA 4P80A 3NBAA 4OA5A 2V97A 2J3KA 2LV8A 2OCPA 2V58A 4NYJR 1YDMA 4CJXA 4DYHA 3GFFA 3GFSA 3CTPA 1PHPA 3LOUA 3FBGA 4TL8A 2AFHB 4RLQA 1L5SA 4M1ZA 2DSTA 4KAFA 1LSUA 4AJOA 1EVIA 3NHMA 3A6PC 1L3IA 2QX7A 5A62A 4JBYA 4M3NA 3EEFA 1Q95A 5HVNA 4XYLA 1RC1A 4NBWA 3PX3A 2C94A 1H42A 2DTDA 4FOTA 4JBGA 3B2NA 2ZG6A 1Z4MA 2YIDA 4PLTA 5GGXA 2Q4OA 5IKMA 2WFMA 3DZBA 2NSYA 3AUUA 5DX1A 2QP3A 1C41A 3DEFA 5F78A 1N8NA 2AJTA 2JJ8A 3CN7A 5I51A 3RVBA 1N33B 1KARA 4ZI7A 4DDHA 3MIZA 1WEHA 4E14A 4BFSA 4ARZA 4WKBA 1LX7A 2AZTA 2ZSFA 3D02A 3HXPA 3IDQA 2WHYA 4ZQGA 2CUNA 4YMWA 3RROA 4ZFNA 1NMXA 3GEMA 2XT0A 4IEFB 5DTJA 3TXXA 3BL8A 5HZKA 4RIHA 1W4BA 2JH8A 3WLNA 5COAA 1T8UA 2ALJA 3THWA 4DA4A 1PR6A 3QUAA 1XMXA 3JD1A 4URVR 2OT3B 1J90A 3VZCA 2BI7A 1RCTE 5KVCA 1KI7A 2ZIAA 1MH9A 3SFVA 3B8HA 1QP7A 4H7HA 2SHKA 4AZ3B 4D0NA 4KDEA 3FDZB 1UMDA 1BFDA 3NHZA 5D01A 4Q12A 5TT0A 3C97A 4R5MA 2YW2A 2OHXA 1ETUA 3N0XA 2QTVB 3KKNA 1JS1X 5I3CA 1YVRA 3IJEB 2QAJA 1JLLA 1MJNA 2Q4BA 1R18A 3PRJA 1UKBA 3H16A 4GXTA 3C1TA 1JEYA 1PEYA 3CF4A 3WY9A 1LRKA 1DC5A 3N05A 4HN4B 3N74A 4J3JA 4A0FA 2BEUA 2NW6A 4TRMA 4XM2A 3RLIA 3OOHA 5JCXA 3OMLA 4HB3A 4KE9A 3L02A 3FF4A 4LRWA 4CIBA 2QAGB 1N6NA 2IXTA 3G9UA 1SUSA 2R86A 5AVSA 5KC8A 5I7SA 1AKWA 1R50A 4MLZA 1VC2A 2B1IA 4M55A 4E4TA 3HCRA 5JFTA 2OLEA 2ZJ8A 4J7AA 5H5JA 4M87A 5DM4A 4U39A 3DD1A 2OP1A 3SJZA 1E2JA 1SKQA 2EERA 2J08A 1L7EA 4M0LA 4P22A 3WYBA 4D4KA 4OK3A 2PMBA 1AKEA 1ZUHA 4WK0B 3GQBB 1O1YA 1WA5A 4HUQB 1GGVA 1L5WA 2F62A 4LHEA 4DNOA 2FSUA 3CMCO 4YEDA 4LBVA 1GTZA 1XRLA 2H0RA 2HA5A 2QPTA 4H1HA 4LZOA 4YMHA 1Y3FE 5JQGF 2J0QA 2D0PB 1GNVA 1H1TA 3G0DA 1XU4A 1Y7IA 4RANA 1C14A 3NG1A 2OTCA 1QQ5A 1ONBA 1LLCA 3RS3A 4D8VA 1JHAA 1VL5A 3GEIA 3P32A 5PGMA 5F52A 4FZJA 4BGVA 4EOGA 3HJAA 3OSUA 3RGWS 2PGDA 4TWJA 3A1CA 1YR2A 2Y9MB 2ZI5A 1TB4A 2BFWA 4M6WA 5J40A 1CE8A 3ZHUA 1YOBA 1H85A 2Q9AA 1ACLA 1BEEA 3GDOA 4HAUA 4C2AA 1JR3E 1F20A 5KYXB 2D5IA 2VPIA 1M3SA 4FCTA 4R3NA 1YZ3A 2ZTSA 3E7XA 3ZDQA 3A26A 3ERCA 1NQTA 2BN4A 2GD0A 1PZFA 3QQPA 4EI8A 5H4HA 4Z6KA 4D6XA 4FDAA 3PXCX 3MLAA 1HKHA 4WY5A 2V7PA 4R51A 1YBAA 3HVJA 5C51B 4RY2A 4IIJF 4EHNA 2Y1EA 2H00A 5ALSA 3VHRA 1RACA 1MOQA 4IWXA 4QRIA 2R6JA 3A05A 4PX3A 2WR8A 4WBNF 2PX6A 5C4GB 1G0OA 1L9KA 1D07A 2Q5CA 2WMYA 2ZRCA 5D5PA 1ZN2A 4DMGA 4E11A 1ZIYA 4HYQA 4B31A 4GKJB 4YPFA 2QLNA 1Z4OA 3QKRB 4EHFA 4OCZA 3B3QA 4QSMA 3TAHA 1PDOA 3L0CA 5JD5A 1QIHA 3R5KA 1HDZA 4FMCB 5K09A 3WGOA 5L7WA 5JRZA 2V4ZA 3Q88A 1HDIA 4G5QA 4N6OA 1H5NA 4C87A 5D84A 2RB4A 3CLVA 2XA2A 1HTTA 2P0YA 5E1BA 4OX9B 1HBJA 3UKDA 1SU8A 1MB2A 2QN9A 3PEYA 2I6TA 4IIEA 3ZLJA 3PEUA 4BO0A 3W5JA 1E3LA 1JG7A 2Z1NA 1NYRA 2YOGA 3ND7A 1TM1E 4KI7A 5TQ2A 3CMMA 4YS6A 5DSXA 3OCWA 4RTQA 2I2DA 1EGQA 3DZJA 4RYDA 3B51X 2V0CA 5CHYA 3TD2A 4MKGA 3E3MA 5I7OA 3BGIA 3CF2A 3CKLA 3QKSB 2JBWA 4HHEA 3LZCA 5BNIA 5EJ8A 1ZISA 1G9SA 3QI7A 4UEQA 2DAPA 3VOAA 2MDTA 3PDHA 3AYZB 3TLXA 1MQSA 2P11A 1TM4E 3WIVA 1EFCA 2W71A 2XCQA 3IXQA 3KSMA 5IN5A 3A2LA 3TBHA 4DZZA 2JLWA 3V42A 1KK3A 4H31A 3I5MA 5CA0B 3FTEA 3M5PA 1KJIA 1K4KA 2IPNA 4ZQHA 3VR4A 1CP2A 2LR0A 4EO9A 3K6SB 1JEOA 3TM5A 4Z3OA 4MLDA 5G4LA 3C15C 1JHYA 2RGGA 3UTCA 3DE2X 2H48A 3NRBA 4INJA 1CJTC 2GYUA 3AL3A 4C30A 5I4IA 1RPTA 1QQ7A 1BHO1 1QHSA 1CBUA 1STOA 3HHPA 4N01A 3I9OA 4P3NA 2ZFUA 4DLLA 3U7EB 3KQKA 4ITUA 2ZZMA 1FSSA 4F86A 4QUAA 3ILXA 2DFPA 5KNDH 3R44A 4D57A 5IJ0A 3W6UA 1EZ1A 3G0OA 1JIVA 3OFKA 3VOTA 4G1UC 4D56A 1QB7A 1TF5A 4CKBB 4LI3X 2FXVA 4NOLA 1U3WA 2I7TA 4UAVA 1PD1A 3GJ3A 4TN5A 5BV2P 1I2MA 1Y8AA 3IBSA 3PUVA 4N0DA 4MUBA 1H05A 4FWIB 2AEEA 3OU2A 1BD3A 1ECBA 3RUEA 3I83A 3C5VA 1HQDA 4L28A 5AUNB 4DSAA 3DL2A 3ZU3A 1J1IA 1YT5A 3WLMA 1ESEA 1YB7A 4JUAA 3OZSA 2PCJA 2OK8A 3WKBA 3IOMA 3SBDA 3T5AA 1EX7A 1G2IA 1U8XX 2DPHA 4D9JA 4R2JA 2Q3DA 3L1VA 1XCJA 4YGYA 3M4YA 3MMZA 3ULKA 1NURA 3OZGA 5MGNA 2HO4A 2IPMA 2X41A 3PUYA 2VATA 4PPNA 1DDOA 1JKJB 2R11A 4D9IA 5FJIA 4KFTA 1SCDA 3V4VB 1BQEA 1NBWB 3KOZA 3N0RA 3ICQB 4LY0A 2WWIA 2YFHA 4RWZA 4M83A 2FLWA 3C85A 1XVVA 3LQ2A 2VPZA 4US0R 2PZGA 4P5EA 4D9FA 2OFXA 3WMXA 4PQEA 1L7OA 2RAVA 1MXHA 2X42A 2A1IA 3DMPA 3DS8A 4QVIA 2R5FA 4FMDB 4RWEA 2JG3A 4E7PA 4M98A 2FEAA 1IM2A 5ENDA 4JX9A 3DKVA 2FK8A 3T1HB 1JKFA 2QV0A 3DKPA 1JG3A 3TVTA 4PBRA 1FNBA 1T4MA 4CLRA 2HAEA 5LZ8A 2HZ7A 1F51E 4B6GA 3OM8A 3IVXA 4Y0NA 1J2RA 2EQAA 2WU3A 2K5UA 1QGED 2VXCA 2HBQA 2VNJA 1K63A 1QH0A 2OO5C 3PXEA 3VKUA 3HUFA 1GAXA 4HB0A 4LJYA 3W5CA 2WPDD 1UP7A 4G86A 2ZWIA 4RGYA 5G4KB 3THOA 4QHTA 4XUEA 2BTOA 2D0OB 5EG5A 4MJ3A 5A3RA 1NJSA 3BFVA 1E7YA 1WF3A 2RGDA 4UBMA 3PNPA 4H60A 1QS0B 3LPDA 4ONEA 5K9ZA 4AUNA 2GBCA 5IH7A 3G0CA 3LC2O 2EX1A 1WBDA 3LHDA 2XKBA 3W90A 3LDFA 3WWZA 5DXJA 1QTNA 4O33A 5CVJA 3AZOA 3H1EA 3RB8A 1QRTA 3DUFB 1IEWA 1GCGA 4U2BA 4D41A 2CLHB 2PMDA 1M33A 3H4MA 1XTZA 1GL7A 3PZRA 2ZE8A 3VX4A 5DNAA 2OHIA 1DT3A 1T8TA 3VR5D 3ETNA 2Q50A 1N5KA 1C0IA 4C1NA 1ZU4A 3T15A 1DBSA 1PYGA 2ST1A 4LZAA 2HPAA 1LFAA 4R01A 5HXAA 4W8HA 4PZUA 3BDAA 2GKOA 5FPKA 1XEWX 2QMOA 4K9RA 4IQ4A 1KZ7B 1OV4A 3S44A 1UK6A 3N3BC 4WLVA 3C0KA 2PMCA 2IPXA 2ONCA 3EW7A 4NFYA 4MQEB 1NE2A 4PR3A 2VI5A 1XTUA 4MQ4A 4DEVA 3H2SA 4BASA 3LHKA 5GJWC 2NSLA 4PWYA 2X0EA 2YWRA 1HV8A 4DV3B 2HK8A 1BXKA 2OILA 2VDRB 3GEEA 3WXMA 3ZU5A 2FCAA 1UBLS 4NZNA 1YQWA 1CV2A 3AR8A 3PPYA 4RA6B 4EJ2A 3EH1A 1MO4A 4W5RA 2X14A 3HWRA 2Q49A 4QATA 5CVEA 1UH5A 4EY6A 5HKKA 3TGWA 2X9NA 1FCJA 3BEDA 3BN3A 1NNI1 3S8YA 1CQIA 3R6GA 1GLGA 1NXXA 3EEIA 3RU9A 5HR5A 1XRMA 3Q11A 2RSLA 3MUEA 2WQZA 5BT9A 1NKSA 1CHDA 4BVEA 2O8CB 5FPTA 4UKDA 1WIWA 3RVQA 4B47A 1LPNA 3AFOA 5H1YA 1Q11A 1OX4A 2V6IA 1HDCA 3OT5A 1V0JA 3UIEA 4Q3EA 3L43A 4BV9A 4K9PA 4LPKA 4UNSA 2FEXA 4GECA 5DHFA 2QJOA 1P7YA 1XALA 3GCDA 5HJ2A 3EN0A 2F2TA 2REXB 3ZHCA 3IKLA 4C0XA 4RJKA 4WZBA 1P4HA 4ZYUA 4G5GA 1NY5A 3AOEA 1SBTA 5IZCA 1ZWLA 3QLUC 1KIFA 4I5IA 3GPBA 1GZDA 2VHXA 2ZTVA 2I1LA 3ZDDA 4YV1A 4AZWA 4LQLA 1K3FA 4QJ4A 1V71A 2HF8A 1BWPA 1FRZA 3AEKA 4QICA 4W6QA 3ZK7A 1U7ZA 2PR7A 4HQOA 1N8KA 1KEUA 4MRSA 5AYVA 3VR5A 2H31A 4MIYA 5IDQA 2Y92A 5BN4B 2P9EA 1RQ2A 3EJ6A 1N2XA 3QE4A 3F2VA 1J8MF 2OBBA 3TR0A 5ICGA 3U60B 2Y1GA 1SBHA 1OYYA 4FD3A 2XV1A 2YWFA 4KX5A 3ZV7A 2E55A 2X5JO 5EKUA 1VYTA 3B38A 4PTZA 2QYOA 1JL3A 1HTBA 1GARA 2EAUA 5KSYA 3CVXA 4IZIA 4OB8A 3MTIA 2FN7A 2UZ4A 1E2UA 4RSHA 3ZXUB 3OPYI 3BKXA 1KJ8A 3S3TA 3JWHA 1MFZA 1E79A 1S2MA 4XYGA 1W36C 3UB2A 4C4XA 4CM7A 3ZH2A 5KHAA 1OB2A 2O8DA 3ZVKA 1EUDA 4A2WA 2FEOA 2EG5A 2GB4A 4BZWA 2BHRA 4KGDA 1NMQA 4X61A 5F7ZA 3ZBQA 5C46F 1PAUA 2OO7A 2DCUA 2XVXA 3AUSA 3U4GA 3WQBA 3EZYA 3GJSA 4YCMA 1E96A 2ZBGA 2HJWA 3GH1A 3PYXA 4KQIA 4P3OA 3I9JA 1OLSA 1H4SA 3VGJA 3DBVO 1QP8A 2QPOA 3MBKA 1O87A 1W94A 5A2GA 1FJXA 1FMFA 3EGVA 5CCDA 3I0ZA 3A6HA 4UFOA 4HL6A 1VCMA 3QF4A 4ZEOA 4N5NA 2VP3A 2AK3A 5F3WB 1SRQA 1XQWA 2BH9A 3DLTA 5EN4A 4EI2A 4YMVA 3FR8A 2ZWVA 4EKGA 3O8OA 3KELA 2XOKA 1XZPA 2TMDA 2A9OA 4YA6A 3DVAA 3MT0A 4X7BA 2I2FA 3SMQA 2V7GA 1PSZA 2REQA 4BS9A 2C98A 5ULLA 1FTYA 1P1FA 1FXSA 3I6YA 1JHXA 5A6SA 1GZHB 2G40A 3IV7A 3WIUA 2BVNA 1GEGA 1R6DA 3ELBA 4BFTA 5AW9A 2RH5A 1GKYA 2X86A 3F5MA 2Q3HA 4E3WA 2GBIA 2CZQA 1EWQA 2IDJA 4IIYA 3E9CA 3I5AA 1K9SA 5ALKA 4OXYA 4WFKA 4UU8A 5DCYA 4A27A 3JQ8B 4B7ZA 3K70B 2O2SA 3EC2A 1B16A 3GLIA 4WN9A 3QE2A 3KOWA 2ZKIA 2HBYA 4Z4CA 3HH8A 2IV2X 2EX4A 2YDXA 3PCTA 3TZCA 3VU8A 4II3A 1MP0A 4R4JA 2W4MA 3BHMA 1F5NA 4ZGWA 1JA0A 1NV8A 4KEAA 3NEJA 4UBIA 5G1OA 4KNYA 3N8KA 1LPOA 1VHDA 2GKGA 3Q3IA 4P0PB 1JWBB 2YXNA 1B3RA 2C2WA 2JA2A 2NZUG 4X6XA 2HMWA 3T7AA 4JBXA 5FNVB 3MCTA 4NSNA 1I4DD 2W2PA 4C6TB 4DG9A 2MSNA 1Y5MA 1UBMS 2IYZA 3C70A 4HNGA 4Z0TA 4KPFC 3SS8A 3RV4A 1W7AA 4MWSA 1SHUX 3IIJA 2RI0A 3GVPA 3LYAA 2BUCA 2ZJBA 1ADJA 2QD2A 1BG6A 3PFGA 1JBEA 2VTVA 3KU4A 5K03A 5SY4A 2XWPA 1FUYB 1I30A 3OT1A 3CRMA 3DD5A 3ZJVA 1E6CA 1K5DA 2ILVA 4DPKA 3H1BA 1IE3A 3LPNA 3PEFA 3EIUA 2QKYA 5EQDA 1FFYA 3PYMA 2X8AA 4O25A 5J1SB 4BL5A 4UEJA 1GP2A 1CZUA 2DFNA 3KQOA 4H1TA 2F48A 1U0GA 3UMBA 1HQCA 1CR0A 1QC5A 5DIFA 2QBYB 1OE0A 1QDLB 1TZJA 2GO7A 4NH0A 3RUPA 1IZ0A 4R40A 1RKQA 2AR0A 4QJ3A 1H0RA 4DQXA 2J3IA 1VECA 1QCYA 4QQRA 2P6RA 1U81A 1EWRA 2NQTA 1BROA 4QFMA 4R2HA 1YRYE 4U3JB 2NTEA 4UVGA 5EJAA 5EAIA 2EIXA 5E2IA 3P2KA 1ISGA 1G9TA 2QTRA 2QW8A 4OQQA 4XCVA 4ARUA 1YBMA 5HK9A 1YK0A 4WX2B 5T4FA 3T9AA 3OBBA 3O3MB 4QUDA 3RLFA 2I29A 1OXUA 2J9GA 3DZKA 4I1SA 5IW8A 4PLHA 2LXNA 4HPJB 4QOEA 2Q5FA 3KJFA 4IG4A 1NC3A 1EBBA 1SVLA 1Z88A 4MUJA 3FCEA 2Y2UA 5IM5A 1WCXA 5JO9A 1JWAB 2CNBA 4RKEA 1E2LA 3GU3A 1ZC4A 4MINA 2FMXA 1NQOA 1PSWA 4W1PA 2G0NA 5K3FA 2UZ0A 1SG0A 1BGWA 2P9YA 1DG1G 1PJ2A 2QK4A 5LLTA 1SQ5A 4MVJF 1KBQA 3LSYA 3MUOA 4CKEB 4XLTA 4IXWA 4RVFA 1HUQA 4FC7A 4GKAA 2C4KA 3V8BA 1RP7A 2W6MA 2XNDD 3COPA 4YRFA 5FO0A 4LF6B 3ZCXA 3DT8A 4AP5A 1AKQA 1M8FA 2NU9A 2P4UA 4DR3B 1Z2PX 1PQPA 2XEDA 2XNCA 3S2ZA 4ADSG 5BORA 4BU0A 5JAUA 2WHEA 2CFIA 4F1KA 3DGEC 3E0QA 4IQFA 1OI2A 2PQ6A 1DLIA 3CZCA 2GD1O 2WFAA 4UDNA 4DJEC 4ZIRB 1LDBA 3H9EO 1Q7CA 4RD2A 3SZMA 4Y2VA 4ASUD 1P77A 1PQUA 2J7PA 3ND6A 3QPDA 2OCGA 5IMSA 2WD7A 1ZI6A 2X40A 4EG7A 4OHOA 3VSDA 5K6AA 3I28A 3SE7A 4GM1A 4K9QA 2VDWB 4E6EA 2AEMA 1SVOA 1Y7TA 2PL5A 2I8AA 3JQ9C 5HF5A 3ECAA 5THQA 2NO9A 1O89A 3O2JA 2PYIA 5ECWA 1BNCA 3T41A 2JFPA 2ZWMA 3E81A 4ETWA 3NOQA 2GZ1A 1S96A 1ZU5A 3OCCA 5FOSA 2YMLA 1BXGA 2O8CA 1TUBA 2W9XA 1FL9A 3GA5A 4KKXB 4ZJYA 1G8SA 2FKAA 2J45A 3FBTA 3HYCA 5EMNA 2MYTA 3TE6A 4KHPB 2IV3A 5FV7A 4IJMA 1WSAA 4NX2A 4C4TA 3LRPA 4I55A 1PFQA 4OHUA 3ZV6A 5CDFE 3IL2A 1Z3IX 1G20B 1XKXA 2CXQA 2EJWA 5DEIA 3ZKWA 2YWJA 4EDHA 4TL6A 3BICA 4IXDA 4MGHA 1NP6A 1J22A 1ZD3A 1A97A 3L18A 4NMWA 2YWGA 4OEHA 4P4SB 1QG6A 2J5QA 4XVHA 1WSDA 3JVVA 2CFOA 2VF7A 3SQOA 3GJ0A 1POWA 3WHPA 5ECGC 3U3MA 1L7PA 2CD9A 5EMJA 1PKEA 4EK9A 2H1IA 2XUGA 4DIOA 4RQUA 1QU3A 1DBRA 5FFMA 2D2VA 3D2CA 1ZGBA 5HG0A 1TXGA 3IURA 3TDKA 1G9XA 3UK1A 1O5OA 5D51S 5EEHA 2I78A 4IIFA 1ABFA 3TN7A 1C9EA 1NVXQ 4MPRA 1E8MA 3KYDB 4TS4A 3QEJA 2EL7A 4ZVNA 4B43A 2J8ZA 5JIBA 3GLKA 4I4CA 1EP2B 5D3MA 4XM1A 2YS6A 3C4JA 3ENWA 3E2IA 2VCHA 3F49S 2V1UA 1Q77A 4IY1A 3FZNA 2XDWA 1J0XO 3VR5H 1FB5A 1QG2A 2V7QD 3EMVA 4ZP1A 4E51A 4F96A 1F6WA 1Y7PA 1KYIA 1ZICA 3ZCVA 2XWSA 4Y3UA 4Z9FA 4NBVA 1WV0A 3UAXA 1YQUA 2H6EA 4NEHB 3H84A 1KWGA 3CR3C 2VLIA 1JIKA 4TVKA 2JFYA 2PT9A 3PE3A 2FPSA 4KH0A 3K0CC 4GQIA 1KOJA 2P9JA 3IDAA 4BKRA 5BT8A 5CIYA 1TA0A 3AY3A 4JCOA 3N8IA 2A7XA 3IX7A 5DTQA 3LCCA 3O8NA 3UC5A 1AGPA 2WWYA 1E2GA 1JIQA 1HFEL 1T2FA 2J9RA 3SQLA 1TAUA 1EDZA 2WA2A 2P9GA 3FPGA 4DSUA 3HB4X 4QL3A 4CKWB 2V8OA 2QTMA 1PR1A 2X9LA 1XTVA 1UXHA 4G41A 1YVEI 2XRMA 1Q14A 3EXHC 3F7TA 4A9AA 1PV2A 2WSMA 3EXG1 1EXMA 2NSJA 1NJ2A 3U49A 1ORHA 3WYAA 1JSRA 1VCNA 2G8NA 2ASEA 5A02A 2A5FA 2PK3A 1RCFA 2DPXA 1XHFA 5D5QA 1NP7A 4IAOA 1TDJA 3I6ZA 2XQKA 4XWGA 3NNSA 5AVYA 3GP8A 2R66A 1GPKA 1QWSA 3GAZA 1EK6A 2VPWA 3GGOA 3UJHA 3IP1A 4KMSA 4NQZA 4Z5XA 2WZCA 3X1ZA 1NLFA 4K88A 1E3WA 2BEVA 4ZAXA 3W5AA 5J1TB 1JMVA 4OHCA 3X2SA 2FFRA 2YBEA 5ALRA 4FEAA 4RDXA 3TLBA 1AHHA 5L7TA 5GADl 3ELDA 5LNK1 3VGPA 4C0KA 1SULA 3CX4A 2HFJA 2NPOA 2FPIA 3HFSA 3IJ5A 2GHRA 2AX3A 4RACA 4DIBA 1JR2A 2IOFK 4O1HA 1OGIA 4CL3A 4EGJA 1HZZC 4I19A 1SHKA 3KT6A 1RLTA 1YUBA 1H66A 1YSCA 3GF4A 4G5YA 5BSGA 1TI7A 1CY2A 4LVOA 4MIKA 3BFKA 1YH3A 1JR3A 4WN9B 1SM4A 5DULA 1FDIA 1WU7A 1FJHA 3FW1A 1B76A 5K4AA 4X63A 1SVWA 3VVBA 3I12A 2WSLA 4YB8A 3VTFA 5AD1A 4A26A 1CUZA 1W25A 2G9ZA 1HRDA 3DLPX 1ZNYA 1ZM9A 5LBTA 4WAUA 1K4MA 3RUCA 3F6BX 1OTXA 4EUHA 1G3QA 1AX9A 1UK7A 1P2DA 4AYTA 4DMFA 4Z51A 5CB4B 4LVNA 3WZ2A 1QE3A 4PHHA 2JCYA 2BRUC 2A7QA 3KZKA 3D6NB 4UTRA 2ZIVB 4IVPA 2X77A 5CA1A 1NXTA 1Y42X 3LV8A 4JJZA 2Q29A 3LTEA 3DMTC 4NJEB 3TL6A 1B6RA 3JZIA 3TR5A 5LMCA 1PBTA 2W6JA 4G5XA 2HEIA 1Z12A 2IEAA 3STXA 3P52A 1C0EA 1MC4A 4MS3B 2ET6A 4FEEA 3TZLA 4B7UA 5HDBB 4LHSA 4OHXA 3TF5A 1GL9B 2YXDA 4XEUA 4FQ8A 3CLRC 3PGJA 4AO6A 1FDRA 1IHUA 2FZWA 1QYXA 5FUWA 5IUKC 4MKRA 4PYJA 4I1OA 3QVKA 4PFQA 1PV1A 3UG7A 1C4WA 1T0UA 3WMEA 1P3Y1 1UXGA 2H4FA 1HE5A 1X9IA 4N3AA 4XSGA 5IH3A 3M4JA 4WOPA 2VWHA 1N1EA 2QRHA 2CXOA 1MW8X 4W82A 2BP7A 3S2SA 1KKMA 1NN1A 3VX3A 3ZYCA 3CLTD 3MINA 2WUDA 3VC2A 1WDTA 3Q2IA 5DFAA 1X38A 4AECA 5LZ5A 1R0BA 1TO2E 3PD7A 5JFGA 4ALMA 1G21A 4WERA 5FL3A 4A0GA 2Q4EA 5CXUA 2DP4E 1P75A 2CJWB 4OGFA 3DBRA 1G6KA 1XRJA 4Q47A 3UOAB 3WGIA 1EM8A 2J5BA 1Z35A 1Q0LA 2ISQA 3HB1A 1GVNB 2Z1MA 5HUJA 3IAM6 1FSZA 3Q6MA 1NF8A 4E5UA 1ZSNA 3WX0A 3TLGB 4NCHA 2VPXA 2IEBA 1E3DA 1JFLA 2Z56A 3AZPA 4LK2A 5FWXA 2Q6OA 1K27A 2Q6TA 1KR2A 2JFBA 1K08A 4Q37A 3ZJ5A 2BTEA 2P6UA 3B5JA 3QP9A 3K9LA 4O6VA 4CKEA 2XOEA 4DBLC 2GAFA 3C6ZA 3CZ4A 4V3CA 2P91A 3OE5A 1N2ZA 5CUQA 4PC1A 2NTYC 3DNMA 4QGBA 4CIAA 4BB9A 5HEKA 6CHYA 3PNLA 5ADUS 3HTXA 2HXSA 2CC2A 3E7WA 3ZZ1A 2XD4A 3BTOA 3RKRA 5G0VA 2GPTA 3T38A 3T0GA 3W0LB 1T2DA 2CXUA 1R8YA 2Y68A 3LZ6A 1FTQA 4LZLA 3CN9A 5CNMA 4Z2YA 3QEKA 1RTTA 1VRCA 3B1YA 4TVOA 4CV1A 1KY5A 1W48A 1FF9A 4MYRA 1G5QA 1R6XA 5GOZA 3WWEA 1M6NA 4KIFA 3IP3A 4OUKX 5JJLA 3ZCTA 4YTEA 3ROZA 1FZTA 2C9DA 3ZDAA 2AT1A 1J21A 1V5WA 3OJXA 2H0QA 2X0IA 2YOHA 4RMGA 3WNDA 4ZYVA 4I50B 3ESXA 1SGWA 3W34A 2ERXA 3A28A 1RQPA 1ZCFA 2VJPA 5IF9A 1DMSA 3O7WA 5CEJA 3I61A 3E48A 3E9ZA 3PGXA 4LK3A 2ZVQX 3U4DA 2QE7A 3OJOA 5AXAA 1DDGA 3I9V1 1OJLA 4U7DA 1DRUA 3HSSA 2OG2A 3FNHA 3UHPA 3OQOA 3OLCX 4OFXA 2W37A 5FP0A 3EBLA 1PWHA 3OZEA 1ZD4A 1KP3A 1DHRA 2EBUA 1IHYA 2PPVA 1V26A 2ZVPX 3B3JA 3H83A 3IQFA 3PUIA 1BMFA 1OASA 4JJ7A 3DO8A 4MW1A 4WCFB 2XUAA 3IDOA 3OQBA 5ILQA 3ZKWB 2BT4A 5LL6P 1HMPA 4GXNA 1V6CA 1WXEA 1LLQA 4J0QA 2XHEA 5M29A 1LPAB 3E18A 1Z62A 2AOWA 2FPRA 3KKEA 3LUKA 2VDLB 1FRFS 3KEMA 2FPXA 4MWEA 2QN1A 5K0FA 3NVDA 1QZUA 3KYDA 1DQSA 3G8YA 3L05A 2W58A 5LC1A 4ZGGA 5CXSA 4G6ZA 2E89A 2PX4A 3WSWA 1AN0A 2GK4A 4RK1A 3A2MA 3L06A 3ZQKA 5IJ9B 2A0XA 2I7CA 1GSIA 1K7CA 1XVUA 2Y0PA 4EJ6A 5A1TA 5EJ4A 3R0ZA 4C76A 4DIEA 1ECJA 4K28A 3GJ4A 3REGA 3SXUB 3B6IA 1BXZA 1D1TA 2Q8NA 4HEHA 2UVDA 4X60A 1NR5A 4PF1A 1T91A 4D99A 3KKPA 4EF4A 5JECA 5KQSA 3SEZA 6PFKA 2A2ZA 3CURA 3NAZA 1JKJA 2ZR7A 4L75A 4UATA 3L77A 1V35A 3NIFB 1CP3A 1W93A 4OY3A 1VTKA 1YI1A 2QPAA 1RWBA 2WTEA 2FP4A 2X76A 4GLBA 4J3FA 2I65A 4LDQA 3X3HA 3TG8A 5KNLA 4JLSA 3D9QX 4ZAZA 2M6RA 1COZA 3KD3A 4DEXA 3EIXA 4FGKA 3ESDA 4O02B 4MHTA 5B7GA 2ZYGA 5LOVB 1X7YB 3EYWA 4RIGA 5DM60 1DWQA 4WZBB 2XBLA 1IVYA 3A8TA 3ESCA 1HC7A 1U0LA 5B12A 3H2ZA 1Z4IA 1SZCA 1JDTA 2L17A 3M6AA 3MTBA 4Y2RA 2B8EA 3HVUA 4Q9JA 4BQPA 4D4IA 4KU4A 3QUTA 5DHPA 4PONA 3RH0A 3HYSA 5FWYA 2QI9C 1Y6ZA 4FFOA 1IDOA 2O2CA 2AR7A 4KMRA 2PZ8A 5K0NA 1R64A 2Q2WA 3QFRA 3U26A 4M4SA 5HHTA 4QAJA 3VU0A 4XVQA 2MSKA 2WIFA 3I04M 1D0SA 1W19A 1XZLA 3QF7A 4M1QA 2OCXA 1MAHA 1P8AA 1WE2A 3LQ4A 3PI6A 4OKNA 4NATA 5ARCA 4EP1A 4K5QA 3RFUA 3ES9A 1JPVA 3OCZA 4MEJA 2QXTA 1V3UA 2R6HA 1VPDA 3DBHA 1CUAA 4PO8A 4X3PA 5GIPE 2GPWA 5ISMA 3PDIB 2FWIA 1AUXA 4YUAA 1IN7A 4DUGA 3G5TA 4F6CA 5IAAA 1JXAA 1I7SB 5F64A 2QL5A 4O0MA 3KDSE 2E4XA 2JJ2A 3S0JA 1QMPA 2ZRAA 4I9HA 2VSOA 1HSOA 2ZYAA 3Q1LA 1KAMA 4JS0A 4LOAA 3LQFA 4EELA 4F06A 1ZR2A 4HLNA 3LL7A 4CR7A 2WQ6A 1UZMA 4H9GA 1LBSA 3NHRA 1HWYA 5C5DA 3DL0A 3R8CA 4F4CA 2JCGA 5KYVA 1FS5A 2FLKA 1PHRA 1ZJYA 2C31A 2I3BA 4TS3A 3BIFA 3KTAB 5JV5A 4L0MA 4EJ0A 5IHXA 2JNWA 3HLKA 4HAZA 3NT5A 4URHA 3MJVA 2HHLA 3ZIAA 1GN9A 3KOMA 1ZBDA 4UVIA 1AKTA 1L4NA 1U4NA 3AF4A 3T1QA 3BFXA 5IKXA 1D6NA 1W52X 2WJZB 1DEKA 4Z9AA 5AP9A 3P5BA 2EP5A 3VNRA 1QG0A 3LX6A 3CR7A 4B32A 2VSFA 3QF4B 4QRDA 4RHFA 2O07A 4CDMA 4D9BA 3NIBA 2RB5A 4HC4A 4EGSA 3P8ZA 4LNHA 4OA8A 1M2GA 2P2CA 2W2KA 2WILA 4PFKA 2XPCA 4G37A 4R0NA 2Z95A 3U7RA 4BUJA 2V0NA 3KR9A 4XUCA 4ZV9A 1M2VB 1FXUA 2Q5IA 4LZPA 1EX1A 3M89A 3I8SA 1E6LA 3GQVA 5JS2A 3U4HA 3GJZA 4EHHA 1I6WA 3IP9A 5IS2A 1WM1A 5T4EA 3HPQA 3H1FA 2RHDA 2XKAA 3NB0A 2VBGA 3IVMA 4H15A 2PBFA 4GR5A 3WDSA 3FNQA 4YXWD 2XZDA 1NV9A 1XLTC 3R24A 4IV5A 3MAAC 3WWYA 2A92A 4MV9A 5KVQA 1G6HA 1TFUA 3WOVA 3EVTA 3JSXA 2DH5A 2Z09A 5SYMA 2MOKA 4YJHB 1HG0A 5BWLA 5TX7A 4EG8A 3NDPA 1ORRA 1S01A 4KVGA 4J1TC 5LQUA 2XB9A 4EPRA 1O9GA 2P0EA 2IT1A 2ZLBA 1HOTA 2ZRJA 4BC1A 3C7DB 2FMUA 2RBKA 2VWGA 1VXRA 1KBZA 3D7RA 4MITA 4MJXA 1M1YE 5K0EA 1HZZA 2QU7A 3FLMA 1GNRA 3IHWA 2VSXA 1K6MA 5TF0A 2CKMA 5B7QA 4RENA 4N41A 4DLVA 5KNCD 5JCJA 4DB4A 2ZDHA 3S2IA 4J16C 5J2UA 2DLNA 1KAQA 3C3KA 4RAQA 4D96A 2VP9A 4JJ4A 1C1DB 3R6LA 1W2HA 2DR2A 1BRMA 4MWCA 3U81A 4B6SA 3S81A 2H1VA 3P9PA 3KPVA 4UM8B 2IYTA 1SU4A 1X87A 2FHSA 1P29A 3B6KA 1N2CE 4JGIA 1H6AA 1G5IA 2B83A 2DX7A 4KUHA 4TTVA 1T1GA 1E2PA 2QTLA 4DANA 3A27A 4Y1EA 3H2JA 1UOOA 3BTUA 3PQEA 4U02A 5J2UB 4QYIA 3P45A 2PVSA 1VBMA 1SPBS 2QX4A 1MQ8B 4PBSA 2ISCA 4EAQA 1ZGAA 4N48A 2IS4A 1FP1D 4KR2A 1DJQA 4G8BA 2ZRDA 2LKCA 1F1BA 1NNSA 4YIHA 3ICWA 4I14A 1N9GA 1AURA 1MAWA 2JD0A 3CTMA 1E1LA 1ZEJA 3L4SO 1A9XA 4EMBA 5BQXA 1O6CA 4GPEA 5J4HA 2P9QA 1CVRA 1SOUA 4UBJA 2YBDA 2OD2A 2PU7A 4ZAFA 4PC3A 2O3UA 3AFMA 4GT1A 3BBPA 4KVAA 1E0JA 3VDMA 2OSBA 1RI4A 3JR7A 1CS4C 3VH1A 5JS1A 3LX5A 1ESZA 1XTBA 4WDRA 1TM5E 3BKWA 3EHEA 1V25A 2GJ8A 1OFUX 4DLYA 2Q2NA 2AN4A 1O8BA 2W8BA 2R00C 4JJGA 3HKBA 3V4SA 1PGNA 4JXJA 1EXWA 1G7RA 3REOA 1W9HA 1WKVA 2ZS9A 3EH2A 4E08A 4K6FA 2HDNB 3NORA 4ZJZA 1T5HX 2B3TA 2D2EA 3NNDA 3WR5A 2JL1A 4M8KA 4TZ6A 3L1HA 1D4ZA 3V4LA 1C8BA 4WINA 1KGDA 2PLFA 4AMYA 4E1AA 2VHTA 5A2QA 4V0ME 4M9QA 2P1ZA 3QM1A 2EZ4A 2H3EA 3E82A 4EF6A 2B2CA 3BRQA 4WMLA 2O3TA 3KWFA 4BEVA 1W4AA 1F38A 2QJTA 2WRZA 4ON9A 1NYQA 3DUFA 2HO5A 2EQBA 3AP1A 3R7DA 1QX3A 1H8HA 4KQ9A 3RVLA 4C4AA 4TXMA 3WRYA 3G0HA 3IFSA 1DUSA 2PO5A 4E12A 2F17A 2WV7A 3VYWA 2I8LA 1AKYA 3GX1A 2X5OA 4U2DA 3WGMA 5TDHA 2PUDA 1FNCA 2NZJA 2XGSA 4MQFA 3QU9A 2WJIA 2WF6A 1YCGA 4BVHA 1KEWA 1TA4A 5KB3A 1YGYA 5EUCA 2F8MA 2VQFB 1ZGGA 2H29A 2OZPA 4RQAA 1ZMRA 1D6JA 4EGFA 2XUQA 5IDYA 1LZKA 3T52A 1GKIA 3B9PA 2WF9A 1H3NA 5JY1A 3ANTA 2A14A 1VGVA 5K3OA 4H35A 4K9SA 1F7UA 4M1WA 1O6ZA 1L4FA 3PR2B 1XAHA 3IT2A 3NBZC 3BH6A 3E6AA 1WCIB 3EEBA 7GPBA 5L40A 5DO9A 1L4HA 2C92A 2QROA 5KTMA 2OUKA 2HSGA 4NZZA 1ZESA 4LYAA 4GPZA 2W6QA 1G3UA 5AJYA 2J59A 8LDHA 5JH7F 4GLOA 1T43A 1D5CA 3MAJA 4PZPA 3VSCA 3K70D 1ZO8A 1A88A 2Z57A 1L5KA 7REQA 4Y6RA 4LFCB 4YROA 4QEZA 3WLOA 2ONKA 1E1CA 4RBNA 4L9SA 2FSVC 5JNRA 3T94A 1BRTA 4Y6PA 5BSRA 4A0QA 1YHZA 5ALPA 4Q93A 5BSUA 1UFVA 3KBBA 4P4SA 1FTGA 3OUUA 1XYGA 5G41A 4UXIA 3QYPA 3CLHA 1KO7A 4X6YA 5LQMA 3FZYA 5E7MA 5BRNA 3LNTA 5E6UA 1K97A 3P1JA 4CI0B 3HYTA 2EDAA 3BQ9A 3GB9A 4I8IA 1L5OA 2BGTA 3DW1X 3GFQA 1T1EA 2QAIA 3THWB 3LUDA 1TF2A 2PGLA 4M36A 3IOEA 2ORIA 3QPUA 3WRYC 5IVKA 3W5HA 5IT4A 2ENWA 1DO2A 2NG1A 2X2PA 4S24A 5LXTF 3RVMA 4AVYA 3GNQA 1AB5A 2ZI4A 1UIMA 3RREA 4I3GA 3SX4A 2ZRLA 3TR6A 1A96A 4PZZA 3NBMA 2BM0A 4OSOA 1UJNA 4Q4AA 4Y6LA 1WP9A 2IZ1A 3ZNOA 1JQAA 4BGUA 3UGKA 1BS2A 1Z6PA 1MG0A 2J6CA 4C7BA 3I05A 4TSKA 5IFLA 5BN4A 3QHQA 5I7RA 1PJ8A 1FX1A 3MJFA 3VISA 1IRXA 1GAWA 4TVSA 4XQ0A 1XWWA 1WW3A 2AMFA 3AR5A 4YP7A 2AG5A 2Z2ZA 3CGGA 2O3QA 3ZHTA 1VA4A 3RIGA 3OZUA 2IWRA 1JFTA 1CZKA 3B5IA 1HE3A 1RHKA 3UOWA 1TQ6A 3ADKA 1ZITA 1SOVA 2JH9A 3KEGA 5EWMB 4EHKA 4RH1A 4U00A 4JKIA 3L40A 3QEOA 3IRVA 3I6BA 3SXUA 3HEBA 3W9SA 3E53A 1TU4A 4MRVA 4DA9A 4DUPA 3B6MA 3BCHA 3C8DA 5LMZA 4R69A 4ZDWA 3N53A 4BQSA 1MNAA 3ELWA 3PXDA 3GUHA 4TKLA 4PRKA 4CMGA 2ZTUA 3UB4A 4ECAA 3UN1A 2XTMA 3L7AA 2PKWA 3U9LA 4C6SA 4DV7B 2X1VA 3UTDA 1K2VN 4UEWA 1U31A 3IV6A 4FXOA 1T8SA 2C97A 5LQCA 4E5VA 5GAJA 1JH9A 1T2CA 1XMQB 1Q3HA 2BAGA 1GPLA 1TOAA 1K7SN 1OFGA 1BH6A 3JYPA 2AYXA 4HAXA 4MAAA 4PVDA 4YRPA 2F4NA 3UVEA 4BDSA 2Z2YA 1UOQA 4ZEXA 2OHJA 1S4QA 3K4PA 3LQKA 4GBED 3RPEA 4WK6A 3SMVA 2AI3A 1QNLA 4NAHA 3TKLA 5FLXA 1XU9A 4BECA 1DIGA 1TLFA 1TFRA 3U7HB 2HPVA 1VE6A 1DB3A 2P9HA 4ENQA 3UV6A 1MJHA 2H59A 3CYFA 3EA4A 1IQRA 3QZUA 5FHRA 3EWSA 2M32A 3RT7A 1Z4QA 1JX6A 4B71A 4MHOA 3DAHA 3PG5A 4JU9A 4XJTA 4DMLA 5ES4B 4UDYX 5IAEA 5B3LA 2UYHA 3OTQA 3VHXA 2DECA 1G8HA 2CF6A 2HF7A 4OI2A 1T6YA 3RIMA 2CMDA 4UCQA 1R10A 3VSAA 3E8XA 3LXMA 5EHQA 4OMDA 4AUEA 4ZTBA 3GHYA 5J4YA 4DNFA 1A76A 1NDUA 4XI9A 1MFPA 4R81A 3WGLA 3K5IA 3W04A 3DLHA 3D7LA 2BKEA 5JYBA 4URYR 2DUUA 4NU8X 4IZHA 2OLKA 1RWVA 5DE3A 4P54A 4HV4A 4DCUA 1WTCA 2XCOA 4HWTA 3TLMA 5CT6A 4ICIA 2ZT8A 3JAKB 2FFJA 4K8OA 3NBKA 4ZARA 1MRSA 5HYVA 4MUXA 1NBAA 1NBMA 4UNNA 3WLHA 1LK5A 1P39A 2WABA 3PGMA 3T0FA 3Q87B 3OQIA 2M6LA 3ON5A 1P1IA 1VPVA 3LAWA 2CUKA 3G2PA 4RTMA 2VBCA 4F38A 1UPAA 5FUVA 3VU9A 4QBGB 2FYTA 4JR0A 1D2HA 4PCVA 5G3YA 3TQRA 2YIMA 1XIVA 3DHWC 1H2AS 4BMPB 1C4OA 2HI0A 3VDRA 3ECSA 3I9LA 4YT4A 4KSCA 1OWLA 3RYHA 3I45A 3V1KA 1CJSA 3JRNA 3OD1A 3P7MA 4EA7A 1VL8A 1L9XA 2WYVA 2WTBA 1I24A 2CXTA 4Y9RA 1ZLYA 1ILEA 3HBJA 1RYHA 1EVEA 2WAMA 3W7VA 5H9WA 2AMJA 3P2IA 1J07A 1C7IA 1FRVA 1P0PA 4YCBA 3FXAA 4LV6A 5FTLA 1V4NA 1YR9A 2EKZA 1DC3A 3K2BA 2HRCA 2D7DA 1I4OA 1GPJA 1XVTA 3ZHYA 1VKHA 4O4JF 1U5AA 4EG5A 5FA5A 2VF5X 4XD7D 3F6RA 2XBUA 1Q1NA 1QDEA 1YRAA 4C5AA 2GRAA 1SHZA 2IEGA 1TQHA 2GLXA 5JEEA 1V47A 2DBYA 5BW8A 4Q6WA 1O57A 4YIKA 1D4AA 1E9SA 2ACWA 2ERCA 2C7OA 2HEGA 4XARA 1IEXA 4NOMA 3DV9A 3K1TA 3GZNA 3QFTA 4WNCA 2QT1A 2XQIA 1L7XA 5EQTA 1M6WA 4FYJA 1PQYA 5ALZA 1JQKA 2Q62A 2HBZA 4DJ5X 4D8XA 1S2DA 3RUFA 4DUYB 4KC0A 1YB4A 3R3HA 1EZZA 1V4BA 3KSRA 1X19A 5JG7A 2Q0XA 3UPDA 2OD9A 4FFMA 2PFSA 4MVJD 4OJMX 4BUCA 5JANA 1Y3HA 2H4XA 4FPXA 3WL6A 2AI1A 3C3AA 4FT4A 4I66A 3RNOA 1XG5A 3WQQA 2RIPA 5A9RA 4RL4A 3OD5A 1RJGA 2R1UA 5ESWA 5J2TB 3QW2A 2QLLA 1NNUA 1A8UA 4GYJA 5SICE 4FB5A 1NZFA 4DHWA 3ZY4A 4OAQA 4H0CA 3H5AA 3V8EA 4PTLA 3W06A 2QRGA 3N0TA 1UBGA 1V5GA 3SX2A 4QQ8A 1X7ZB 1DINA 1T2UA 4MQMA 1HE2A 5E4TA 3KXKA 3QPWA 3IVRA 3NC4A 3ZU4A 1BOFA 2JCXA 2OCIA 3CVJA 4MQFB 4L73A 1QHHB 4MRPA 1IZYA 4NV3A 4KQEA 2OFFA 2IHKA 1BSVA 1CRLA 2PUTA 3P9YA 3LC1O 4FQ5A 4Q7QA 2XXAA 2P9FA 4EUSA 1I51A 4EW6A 2VNIA 1YQQA 2GN1A 2Z2JA 4MH0R 4DA0A 4BQFA 1LDEA 4XJSA 3W9BA 1UQUA 2ZRKA 1QHXA 1V7CA 3KCQA 1NT4A 3MMPA 4UE6A 2OXIA 4U5QA 4BO3A 5KX5A 3HKCB 4BX9A 2PUCA 2XYVA 1J8QA 3ITDA 1ES9A 1ZH0A 4FS3A 2YXBA 3IAHA 4XB2A 5FR2A 1P33A 1TADA 4ENTA 4E5YA 4BFUA 2IOFA 3PIDA 3OQ1A 2V4MA 5AUPB 3R0XA 3O93A 2ZDQA 1OHHD 1N78A 2VUTA 5EQJB 3X2EA 4WOJA 4FFBA 1QYRA 3MCVA 4F11A 3FRIA 1WXWA 2PKRA 3IPLA 3EUAA 4QQKA 2WAXA 1XN1A 4F0JA 2AWNA 2NTVA 3C5WP 1R8XA 1SRRA 3LRXA 4MICA 4UU0A 4DVJA 5B57C 4G1BA 1TMOA 1DRVA 2YQZA 5K0SA 4DCJA 5J23A 4D3YA 2ADFA 2EGHA 3Q41A 2B7LA 2EKDA 3FOBA 3GH3A 3QU4A 4X9XA 1NXSA 2DWUA 2Y8EA 5IKOA 4TMZA 5DIZA 5MDHA 1Z7WA 2FX5A 1M2EA 4G5HA 2F00A 1E61A 1QGYA 4LE1A 3VHQA 4OMFG 3OUZA 4O4HB 4PCAA 1XXHB 3NDIA 4CQMB 1Q1BA 1DFIA 3C3PA 3OI7A 5DSTA 3B82A 2IYLD 3GMDA 5DW0A 1EJ2A 4UUNA 4DCGA 2CVPA 4I1PA 4LVCA 4ZN6A 5KNCH 2BOVA 1YHYA 2DJ5A 1WDLA 2QRZA 3O8RA 3AB7A 3W5IA 2UVQA 3L5OA 1CX9B 1JG2A 2W6CX 3BCUA 4JIMA 2QL7A 4QPJC 4UE2A 4AB1A 1NUQA 3FLEA 3VKGA 2XODA 2OO3A 1IG0A 2FF7A 2ZBDA 4Y2GA 4JLNA 2ID4A 1KMNA 2Q1SA 1BQ4A 4IO1A 4KLZA 5LWHA 3IE1A 2AFHA 2OXEA 3BXGA 3ITNA 5DP1A 4Z0HO 5JRJA 4P2GA 2OV6A 4DG5A 1Z82A 1L6IA 3LLSA 1C4XA 4MQ6A 4Q1AA 4ETIA 1IJEA 1Q17A 3BMQB 1KHTA 5BYAA 3IUMA 2O48X 1R6TA 2H54A 3FDJA 3LFTA 3RYFB 3AUKA 2XDYA 2AZXA 1E2DA 2P5YA 1ZP6A 1U2DA 1IBRA 3A4VA 3QYAA 5THKA 3VDNB 5C1OA 4KO4S 2J09A 3C8UA 1RM0A 1VP3A 4BO9A 5LN1A 1JDJA 3HZRA 4BNLA 1K7YA 2O2EA 3O0DA 2BUBA 2JLXA 4JU8A 2Y77A 2G80A 1PTJA 4L2IB 4R7GA 5AVKA 4RY0A 1YZYA 1ZNWA 3IYLW 5LYJF 2QLBA 3KE8A 2I80A 5IXSA 4G0VA 2XT6A 2H4WA 5CDYA 4YT5A 1M0SA 3QFCA 2P79A 1I4WA 5E9AA 3ESBA 2W6ID 3LYHA 3ZY3A 4BB0A 4ITRC 1A2BA 1QAMA 4PX9A 1QHYA 1MF7A 4YK7A 1VKJA 1G0NA 5F3DA 4V0MA 3SM9A 3D8HA 3QE3A 3VO8A 5E7IA 5BUCA 5C5IA 2GLTA 5CB0A 3G2KA 1KYTA 5L4LA 4GSKA 1V39A 1TW2A 5J4KA 1K98A 1GL6A 3EC7A 2ZSUA 3AI3A 4QBHA 1KF0A 3N3AC 1XUOA 4PSKA 3L4EA 1J8FA 1AHPA 1VL0A 4Q7MB 5AW5A 2HMUA 3K2EA 5IASA 1LRJA 4PZ0A 2AOUA 5EJ6A 5LD2B 1WVGA 1JLMA 2CMKA 4D3FA 3OTGA 5CMLA 3MN1A 4QG3A 3BJZA 1MB4A 2DBQA 1E7SA 1I10A 1Q3TA 3PC6A 3G88A 5IKPA 3MXOA 2GBFA 2OB1A 3BXFA 2XRZA 1CFJA 1RS0A 4BNZA 2H92A 2VSYA 1OXTA 1OGYA 1RPJA 4HWKA 3GRYA 3N7TA 5KC9A 1AQUA 1XELA 5C31A 5FUMA 4HQ6A 5B4UA 3AVWA 4Y1FA 2X8JA 1UP6A 3VZQA 4F4UA 1L5YA 3FNFA 3NO4A 2C9YA 1XI2A 3M6IA 2Q21A 4NYJQ 4QA9A 5J5AA 5A7GA 3TZEA 4CBVA 1Q6ZA 1C3VA 3K35A 3OEHA 2Z4TA 4PXYA 4RQTA 3ZLBA 2VH5R 3DW3X 4ZT2A 5KHLB 1LDNA 3I1YA 1IHXA 5H7XA 1DAHA 1JXQA 5ITWA 1YE3A 2BD0A 1II8B 1PO7A 4AJKA 2OENG 3TIXB 3HU5A 2O54A 1T0JB 1HO3A 2IZ6A 3P4YA 4K05A 4KSBA 4ILKA 2IIVA 3W2TA 3VVLA 5FD8A 3LIPA 3L92A 3HDTA 4AN1A 5BNZA 1ZRHA 2HGZA 4KN5A 1M73E 1E20A 2Q41A 3UJPA 1CK4A 2AC2A 1YL5A 1S0UA 2IITA 4PRYA 1WUJS 1A82A 3R0QA 3PTZA 1KQNA 1E2MA 2J9YB 4AJIA 3VR1A 4MIOA 4MHSA 5JROA 2QG4A 5FOTA 2FRDC 1G5FA 1TK9A 5LQKA 4LMRA 3PTAA 4ND2A 3F96A 1RAEA 1XA0A 4AYWA 1WV1A 3K1YA 3HP1A 4QDOA 4BKPA 4BQOA 1TU3A 3CT6A 1ULUA 3C3XA 5AKYA 2JFUA 2TECE 1KYQA 4B4VA 4A23A 3ANLA 1I3MA 4I1YA 4JJFA 1DIBA 1Y6QA 3NTVA 3VHLB 4M54A 4Z4HA 4IDDA 1WXHA 4YMTA 2D5LA 1U0SY 1JQLB 1OFIA 1PJLA 1WXXA 5C4MA 1FYDA 2FZLA 5CYFA 4MMZB 2OORC 1P1CA 5D2CA 3EXFB 2A88A 3H7IA 2CYBA 4QYTA 1KDYA 1YTUA 1XCOA 3A4YA 3T1YB 3QLVC 5F9FA 3OX2A 2FRVA 4O8CA 4BO8A 2Q7XA 1EJ6A 1AD2A 1USVA 3PHLA 3E3NA 3FOWA 3Q6NA 2C42A 1JJVA 2VRCA 3U3XA 1DU4A 2QAGA 2WT8A 1U8ZA 2BMAA 4OHPA 4ZV7A 3R76A 2ZJ0A 4J75A 3FCYA 4JEIA 2PTHA 3CT4A 4E09A 5IYZB 4RTOA 1W36D 1H93A 4M7RA 5KNBD 1J6UA 1DCMA 2IXEA 2FMIA 5EI5A 2BTQA 5KNDA 3WBJA 4DV2B 3RUHA 3G1TA 2VR1A 3RI3A 4K9OA 3RS9A 1JR6A 3KAQA 3DBHB 3ISJA 4ZEMA 1C7QA 4LXQA 4KSYA 1AA9A 1E6UA 5SZHB 4XRGA 2PGIA 1JU3A 2ZS7A 1CERA 1NBOA 3HCBA 4MVWA 5IVDA 3UNXA 1JHRA 2LRHA 3KTFA 2PZAA 2JVKA 2NXWA 3QVOA 4ZDIA 3OVMA 4QJ5A 4FFPA 3I01A 4LSMA 4J49A 5JTUA 4B3MB 2FPKA 4GBGA 2WK1A 1ZYUA 5BMVF 2RDMA 1IH8A 1SJ9A 2P41A 2QW0X 3DTVB 4UPDA 1YRQA 3PEEA 1QF9A 3OIVA 5I4KA 4QREA 3LP5A 2OP0A 3QKSA 1NBME 1KRHA 2BHNA 3ASUA 4BQIA 4KYUA 4EM6A 2Y1KA 3I6QA 2XQGA 2IU0A 4CLOB 5G0UA 1OMOA 1QHHA 3H1GA 1AXEA 4JUCA 1CY0A 1QHFA 2B4RO 2FW9A 5HKLA 4F60A 1OWMA 2P3OA 1XCGB 4DQKA 3WIEA 1KQ3A 4M7OA 2BHSA 1ZNQO 4TZTA 2P8SA 3HB7A 3T34A 2I4TA 5ALMA 1ONOA 1WPQA 3DDUA 2CUZA 2W2KB 1U3FA 1E3JA 2C9MA 4ARCA 2ZB4A 2EGGA 3BDIA 3EDOA 4OQYA 4QLBA 5JYCA 4WW0A 5MN4A 1RAFA 3Q0TA 3TTVA 4QDXA 1OWPA 5L6LB 4KFSA 2HT1A 1J8YF 1JJ7A 3PUHA 1SUEA<