3P3KA

The crystal structure of translationally controlled tumor protein (tctp) of plasmodium falciparum
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
182
structure length
159
Chain Sequence
b'MEFRMKVFKDVFTNDEVCSDSYVQQDPFEVPEFREIAFEVKSNKRIKHVIDIVDSFQLTSTAFSKKEYSAYIKNYMQKVAKYLEEKKPDRVEIFKTKAQPFIKHILTNFDDFEFYMGESLDMEAGIIYSYYKGEEITPRFVYISDGLFEEKYLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translationally-controlled tumor protein homolog
publication title Molecular interaction of artemisinin with translationally controlled tumor protein (TCTP) of Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Metal binding protein
total genus 46
structure length 159
sequence length 182
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00838 TCTP Translationally controlled tumour protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.10 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A 3p3kA00
1HXRA 1H6QA 2KWBA 2LOYA 1TXJA 1YZ1A 3EBMA 2HR9A 3P3KA 2FU5A 1FWQA 1H7YA
chains in the Genus database with same CATH superfamily
3FACA 4V2YA 2LOYA 4TZUA 3WX2A 5F98A 4CI3B 2QFBA 3WX1A 4V2ZA 3LRRA 3E0MA 5F9HA 3ZD6A 5AMHA 4V30A 4CI2B 3CEZA 4AY2A 5F9FA 4TZ4C 2KV1A 2RMJA 4V31A 5E3HA 3MAOA 4A2XA 3HCGA 3EQTA 3GA3A 2FU5A 1FWQA 2YKGA 2RQBA 4TZCA 1H7YA 1HXRA 2QFDA 2W4RA 4CI1B 3E0OA 1YZ1A 1L1DA 2LVLA 3EBMA 3HCHA 2HR9A 3P3KA 1TXJA 2KWBA 1H6QA 3DJMA 3HCIA 4BPBA 3LRNA 4A2VA 2RQAA 2K8DA 3NCUA 3OG8A 3CXKA 3ZD7A 3HCJA 2KZNA
chains in the Genus database with same CATH topology
3FACA 2LOYA 5F98A 2QFBA 3LRRA 5F9HA 3ZD6A 4AY2A 5F9FA 2RMJA 5E3HA 4A2XA 3EQTA 3GA3A 2FU5A 1FWQA 2YKGA 2RQBA 1H7YA 1HXRA 2QFDA 2W4RA 1YZ1A 2LVLA 3EBMA 2HR9A 3P3KA 1TXJA 2KWBA 1H6QA 3DJMA 4BPBA 3LRNA 4A2VA 2RQAA 3NCUA 3OG8A 3ZD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXR A;  1H6Q A;  2KWB A;  2LOY A;  1TXJ A;  1YZ1 A;  3EBM A;  2HR9 A;  3P3K A;  2FU5 A;  1FWQ A;  1H7Y A; 
#chains in the Genus database with same CATH topology
 3FAC A;  4V2Y A;  2LOY A;  4TZU A;  3WX2 A;  5F98 A;  4CI3 B;  2QFB A;  3WX1 A;  4V2Z A;  3LRR A;  3E0M A;  5F9H A;  3ZD6 A;  5AMH A;  4V30 A;  4CI2 B;  3CEZ A;  4AY2 A;  5F9F A;  4TZ4 C;  2KV1 A;  2RMJ A;  4V31 A;  5E3H A;  3MAO A;  4A2X A;  3HCG A;  3EQT A;  3GA3 A;  2FU5 A;  1FWQ A;  2YKG A;  2RQB A;  4TZC A;  1H7Y A;  1HXR A;  2QFD A;  2W4R A;  4CI1 B;  3E0O A;  1YZ1 A;  1L1D A;  2LVL A;  3EBM A;  3HCH A;  2HR9 A;  3P3K A;  1TXJ A;  2KWB A;  1H6Q A;  3DJM A;  3HCI A;  4BPB A;  3LRN A;  4A2V A;  2RQA A;  2K8D A;  3NCU A;  3OG8 A;  3CXK A;  3ZD7 A;  3HCJ A;  2KZN A; 
#chains in the Genus database with same CATH homology
 3FAC A;  2LOY A;  5F98 A;  2QFB A;  3LRR A;  5F9H A;  3ZD6 A;  4AY2 A;  5F9F A;  2RMJ A;  5E3H A;  4A2X A;  3EQT A;  3GA3 A;  2FU5 A;  1FWQ A;  2YKG A;  2RQB A;  1H7Y A;  1HXR A;  2QFD A;  2W4R A;  1YZ1 A;  2LVL A;  3EBM A;  2HR9 A;  3P3K A;  1TXJ A;  2KWB A;  1H6Q A;  3DJM A;  4BPB A;  3LRN A;  4A2V A;  2RQA A;  3NCU A;  3OG8 A;  3ZD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...