3P4OA

Crystal structure of h2-kb in complex with the mutant np205-lcmv-v3a epitope ytakypnl, an 8-mer modified peptide from the lcmv
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
278
structure length
278
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4oA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3p4oA01
1M05A 2PW2A 3RJDA 1LDPL 1BWWA 1R24A 3IGAA 2IWGA 3BKJL 1JYXA 3H9SD 1VKXA 4PJDB 3ARBD 4RDQG 5INCA 3W9DB 2BSRB 1FDLH 4FP8H 4I13B 3HE6C 3I3EA 1V05A 2CIIB 3ILPA 5KZCB 2EC9U 1OAUH 1WT5A 4LDEB 1FDLL 1R5WB 4IEFB 4FFZH 4FP8L 4W6WB 2OL3H 3GSVA 2QADD 1CCZA 2WY3A 3LRSA 1OAUL 3MXWH 3IETB 2VLME 2ZPKL 5F1OB 3TO2A 4FFZL 1PZ5B 4ORGB 2BOBB 2OL3L 2Z91A 2DLEA 1P5UA 3MQIA 4YIQB 1UWEH 2A83B 3EYQD 3K1KC 4S0TD 3P40A 2P46B 4Q6IB 1KT2A 5HYQB 1UWEL 1JRHH 3UTTA 5HYJE 3RL1A 3DUSA 3HTLX 4BZYA 5KTEL 1N0LA 5B21A 3VFGL 3T0EE 2OX5A 5D1ZB 4KZDH 2XFXA 1JRHL 1IVLA 3P9LB 4U7KA 2OTUB 4KZDL 3V5KA 2BDNL 3CH8A 2XZAH 2XOTA 3SKMA 5KSBB 3VRIA 3FT2A 2NCMA 1EMTH 5CZVH 1MAJA 1KFAH 4JLRB 5DJ0B 2XZAL 1U3HD 4GW4A 4JY4A 4RNRB 2P5WE 5DF0A 3CX5J 4BFBD 3I02B 3JZ7A 4KK6C 2IH3B 5FEBA 2QHRL 3PHQB 1EMTL 5DJZB 1KFAL 3FQTA 3IFLH 5E00B 2VE6A 5IHZA 1FN4B 5T5NG 3HG1D 2X05A 4R4FH 1DQTA 1GGCL 4KY1H 5GGTA 4FQLH 5HY9B 2VLLA 1K6QL 2YUVA 1FHGA 1MFNA 2VSCA 4R4FL 1KCVL 2QQNH 5GSVA 4RBPH 5HHXL 4RX4D 5C0AE 5CGYC 3F58H 2JTDA 4FQLL 4XZUB 3OXSB 1JZ4A 3L3HA 1CDYA 3RWIB 4XI5D 2QQNL 4U1HA 4EI5D 4Z8FL 3CDGA 4EKXA 1W0VA 4YX2L 4QT5B 2FO1A 1EGJH 1ZANH 2R8SL 3T3PF 1RUML 2KH2B 3VH8B 1LEGB 2ADIA 4PYGA 3QIWB 3VWJD 3W81A 4W4NA 1EGJL 3BI9X 3AB0C 4YDJA 5D7JB 3KGRA 1S7WB 1AQKH 3CSYA 5IB3A 1JFMA 1X5IA 1F3JB 4NQEB 4P46A 4P2CG 2YPLA 1WCBA 3QG7H 3ULSB 2GT9B 3H8NA 1MJUL 1AQKL 3PUCA 1T04B 1G7MA 3LDBC 3PWPB 4YFEA 5J7CC 4APQD 3QG7L 4PD4K 4XP9H 2XTJB 3REWA 3FO2A 3CLEL 5KSAD 1T20A 1CLZH 4EN3B 1ZLVK 4XP9L 5BMFL 4HIHA 4LU5H 1NC4A 1ZGLB 4JVPA 3JTSB 4QNPE 1KGCE 5IV2A 3C60B 4JO3L 2H3NB 4K3GA 2FEEI 4H20H 1UVQB 1C7SA 2MFNA 1I1AC 4LU5L 4NM8L 1LO5B 3BKYH 3EYUL 3OG4B 3O8XC 3GKZA 3PGDA 4ZSOE 1FYTE 1UACL 3JV4B 5FFLA 1JZ7A 4MJIA 3VJ6A 3BKYL 2VO5A 3PQYE 1HCVA 1TXKA 2AXGB 2NZIA 1FRGH 3QFJE 2G75B 2EXWD 3VD3A 2RCSH 2CR3A 3QA3B 3JV5A 4NDMB 5BZDB 1FRGL 3FQXB 3T4AB 4DN4H 1AP2A 3CVIH 2IPUG 2RCSL 2WUCH 1ZXQA 5IR1B 2M8XA 1IGTA 2XWTA 5GGRB 5EOQH 1I9RH 1U3JA 4YGVA 4DN4L 2CDFA 2APXA 1N6QL 3TJHA 2WUCL 43CAB 4CU7A 1DN0A 3EOAB 2ZUVA 1TPXB 4WJ5B 5D7LA 1WBXA 1I9RL 5DRXA 3EIFA 1I3UA 3ABZA 5BS0A 4FQHA 1QLFA 4M9PA 1GVIA 4O5LH 4LSTH 1FFRA 3Q0HA 3QO1A 1II4E 1PLGH 4O02H 4YXLH 3ETBF 4MXWL 2JJUA 4LCWD 1HXMB 3V0VA 4M03A 3EFFB 5D1QD 5DK0A 3LV3A 2HLFD 1NC2D 3IDIA 4LHUA 3SDAA 1KB5H 4P2QA 3FFDB 4X4ME 1F90H 1BZ7B 1KB5L 3ERYA 1WIOA 1G7QB 4Y5VB 4PJ9C 1F90L 4MX7B 3PL6D 2V9QA 2PXYD 5FCUL 4Z5RB 1C08A 4NZRH 3PABA 4OI8A 4OI9A 4I3RL 5F9WC 4IRJC 2MTPA 1E28B 3UTZA 1XR9A 4ODSH 3RZCB 4TSBH 2MOVA 4NZRL 5C0JB 1CDHA 3D85A 4ELKA 3BVNA 3ARPA 4J1UB 4Y2DC 4ODSL 2R23A 4QHLA 2NY4D 3RPKA 1X5YA 3O0RL 1D5MB 3GM0A 3ARYA 3SDDA 4CMHC 1FL5B 4HJJH 5FV2A 2VH5L 3UJJH 4Q2ZB 2FWOB 4Z76B 3TN0D 1R3JA 5A2KH 5JPNA 4BH8B 1INDH 2LTQC 3HE7D 4PJIA 5H37G 3UJJL 5F3HA 3QDJD 1NH6A 3SKOA 1WGOA 2HTKC 5H94A 2Z4QB 1INDL 2OR7A 4GW5A 4PRNA 4ODTH 1RULH 1A9BB 1X5AA 2FCBA 4P5KB 1U3YA 5DYOA 1IAIL 2R1YA 3SOBH 5EG6C 4ODTL 1RULL 4YHYC 1LNUB 5EU4B 2F19H 1OW0C 4FRWA 3L5HA 4BFEA 3MBED 2G5BA 2XWJA 1NAMB 4JFFD 2F19L 3T04D 4IRSB 4ODHH 1URLA 3QXDA 4U05A 5F3BB 4NC1C 5LCVH 4P23B 2FB4H 4N5ED 1NGQL 2CPCA 4U49A 1X5KA 4ODHL 4U3HA 2H2SC 4UOW0 3NCBB 4O00A 4D0DA 4U7SA 2ADGA 2FB4L 1U92B 4MJ5A 4R96A 5HDOA 4AH2A 4LCUA 3VXRA 5J1TC 3C2AH 4DUVA 5FO7B 3TF7C 4LLYB 3CMGA 1MFBH 5JW4M 2VZUA 4XTRD 5ESVA 4Z7OE 4LF3B 2Y5TB 3QEQE 4ZUVA 3RKDD 1UQSB 4I18A 4KUZL 4UV4H 3QRFM 5E5MA 3P4NA 2FHCA 12E8L 3IKCB 4HEPG 4NO3B 4BFGA 4DQOH 2CJUH 1KTKE 1LMKA 4UV4L 2B20A 2G5RA 4MQSB 3RVTC 3MV8D 3G6JE 3WNNA 5IK3A 4G80A 4ZODA 4YBQD 4LQ1A 4DQOL 4C54A 4GW1B 3TJEH 4KRPD 4HUXB 4MDIA 5MERA 4RMTA 4BJLA 1X5ZA 1CL7H 5DRNA 5E9DD 2EDJA 3G5YB 4IOFC 5HYIA 1CL7L 4ZG1A 1NBYB 4Z6AT 4N1HB 1Q9WA 3ZL4H 4QRPE 5D1ZD 3KYMA 4MD0A 1XF5B 3HZVA 3V0AC 4L8BB 3O4LB 3T08A 5DMKB 3ZL4L 4I77H 5J06A 1N5AA 1CDCA 4XHJD 3EDFA 4AIZB 1S5IH 2XN9A 4UMGA 2XA8H 5AD0B 2IFFH 3O41B 4I77L 1EA9C 3V6OC 4F33B 4C4KT 1S5IL 1Z3GH 3MRFA 3L95A 5F8QC 1QFUH 4OGZA 1N4XH 4ZQKA 1P7KA 4RMQA 3UJIL 3E2HA 1DQLH 1Z3GL 3MACL 3LRHA 4ZO9A 5DMGC 5IG7B 1L0XA 1QFUL 5ACLA 3C5SB 1N4XL 4UT7H 3G9AB 4PRAB 1UM4L 1DQLL 4PRIE 5L8KB 5ID1A 1NDGA 2EKSB 3H9SA 3ARBA 4EXKA 3LKQA 4PRBA 1TTGA 4OCXH 1RUQH 4G6KH 3IDJA 4QRRB 3OKOB 1PEWA 3U0PB 2AABL 4TTGA 2FH8A 4Y4KB 1RUQL 4TVPE 5GZOC 1KJ2A 5J0BA 5GSRA 3QIWD 2NMSA 1T4KB 3L9RA 5BXFB 3M8OH 1S9KC 5DJ6B 1OTSD 4JPKH 4EJ1C 2V2TA 3ILQC 4NQED 4RAUB 4TRPL 5F6HI 2AJXL 2ZJSH 3KPPA 1C7TA 1DN2A 4JPKL 3TBVB 4P4KB 5B39B 4PJXF 3GJFB 5F7UA 1FVCB 2GY7B 3VXSE 3MV9B 2JF1A 2QQKL 4PGEB 3TYFB 1NDMA 1AJ7H 3U48A 5DJYB 5EUOE 4O2EB 5HHME 2BVUA 4PRHD 1MCDA 4TPRH 1WFOA 4QRQB 1RJLB 3C60D 4TNWK 2Z8RA 4J7RA 5EBWB 4L4TD 1ZEAH 1CLOL 3BEVB 3IXAA 4PTUB 4TPRL 1U3HA 3S36X 1ZEAL 4NN6C 4YBLB 3HC0A 3S96A 4JY5H 1TDQA 4QGTA 7FABH 4JFDB 1IKFL 2VR9A 3SE3C 5IQ9B 2FECL 3CFDB 4OD1L 3HG1A 1G7JA 4QNPF 3U36A 5D70H 3RKPA 5ISZD 3WYRA 3GB7A 2V17L 5TQ0H 2UWEA 1HN1A 1DE4B 4PGDA 4UIKL 1S78D 5D70L 2AS5M 5DD5H 2V5RA 2NZ9C 4RX4A 2ICES 1BVKB 4KPHH 2HVJA 3VFRB 2XZCH 3BZFA 2YKLH 5IIEA 5KN5A 4XMKH 3H0TB 5IBLC 4EI5A 2ATKA 4M61B 3C8KB 2XZCL 5CILH 2YKLL 4JGUA 2IPTH 2PW1B 3VWJA 4PR5B 3NPZB 4PB0H 3I6KA 4EDXA 1BMGA 4WWKD 4PB0L 3O81A 1BFOB 1EHNA 2J8UF 5IHUH 3VGBA 3AXLB 4NRZB 4APQA 2VZ3A 2EZ0D 3DX7B 3U4EB 1KPRA 5IHUL 5KSAA 2XG4A 3DROA 1OARH 3WFEL 4H26B 1JNLH 1P84J 3CSBA 4HV8A 3EO0A 1PKQE 2O61B 5J9PB 3LKNA 5EO1A 2WBKA 5J57B 4K3DL 1OARL 1WFUA 1JNLL 4OZGA 1WSST 2WSKA 1FO0A 1ED3A 1B3JA 2DIAA 5HYJB 2BMKB 3SCMC 3T0EB 1XH3A 3PWNB 5HXMA 4F3FA 3KXFE 1MELA 5GS1A 2OSLA 4XNZC 1K85A 1BEYH 2KKQA 1NGZA 3AAZB 5EC2B 5D6DC 4QWWC 1JTPA 5E7FA 2NY2B 4U1IB 3HPLA 1DSFH 4O51B 2R1XB 5TPWH 3B5GA 1H3GA 3CNKA 4XPGL 1DSFL 4NGHH 5DJ2A 3D2UB 3G5XB 5TDNB 1A1OB 2ESVE 5TPWL 3ULVH 3O6LH 3C2SA 1FC1A 5A1AA 5B8CC 4LVOB 3L3IA 1BFVH 2AXHA 2DBJA 3K2UL 4NGHL 4X9HA 1GSMA 3VGFA 3ULVL 2A0LC 4F9PC 5FCSH 1Z9MA 2V2WA 1EDQA 1BFVL 1MJ7H 5GGTH 1FVEB 1OP3K 4JR9H 4J8RB 4LCWA 5C0AB 4JPIB 2R4SH 4OKDA 3RBGA 5D1QA 1G1CA 1BQUA 1G6VK 4Q9BA 2DQJH 3UBXA 5GGTL 4JR9L 1NC2A 3V52H 2DLGA 2OTWB 1FORL 2R4SL 5E7BA 1F58H 1UJTA 2OZ4A 2DQJL 4PLKC 4LVNC 3QO0B 4U31A 4PJXB 3EYOA 4MJ6B 4P23D 3VD5A 2DQUH 4YXHH 1F58L 4H25A 1H3XA 4QO1A 1JWUA 3PL6A 2VXQH 3UPRA 2DQUL 5IFJA 1GC1H 5DHVB 3JWDL 3U2SB 2LU7A 3VXQA 3AU1B 4C57C 2VXQL 4WTXA 1MRDL 3E6HA 2HMID 3B6SA 4D9QD 1AD9B 1LO4H 2C5DC 5GS2H 1WWCA 1UZ8B 3N1QC 3ARQA 4TQEH 1GH7A 5CJXA 3BP6A 3WUZA 1U9KA 1UH2A 4CDGC 3W5MA 4DZBB 3OJDA 3DGCR 1C1EL 2FBJL 3TN0A 4Z7OF 3IT8D 2NYYD 1ZHKB 3ROOA 2E7LC 3HE7A 4F7TA 4DVBB 3B2UC 3QDJA 3BYTA 1FYTB 1J8KA 4NJAH 3PQYB 2BRRH 2VDRL 1UKTA 4P5MB 2VXTH 5D7IA 1YNLL 3PDGA 2GJZA 3WKMH 2AQ2A 4K23L 2BRRL 1AR1C 2B39A 1OTTD 4LCYB 1DBBH 4PY8J 2OI9A 3MBEA 5I1LA 1WICA 5CWSA 4CVZB 2GK2A 4JFFA 3RVXD 1DBBL 4PJBE 3EJZC 2CUHA 4LLWB 4YHMH 2J8UB 4N5EA 2XWBA 3MSPA 4AEIH 4YHML 1KJ3H 2GCYB 1CTOA 5MEQA 4JM2F 1FGNL 3IJYA 5GXBB 2F5BH 1INQB 4WUKH 4G42B 4NO2B 3QRGH 5D7SH 2DQIH 2GY5A 2F5BL 2DTMH 1AGFA 4HWZB 4XP1H 4WUKL 5IOPB 2DI9A 3QRGL 5D7SL 4A6YH 4OGAD 3U1SL 4PJDA 1HE7A 1T1YB 1T89C 1ZMYA 2BSRA 4RZCB 3QQ9C 4PJ5B 4HKZB 2CIIA 4P3WA 1R5WA 3FO1B 3MV8A 4PB9H 1CFSB 4Y4KD 1L7IH 3UTQB 5E2WH 1AGEB 1LO2L 2QL1A 2YD1A 4K7PX 4YFDB 1TVBB 1I3RB 3GBNL 5DD3H 4ORGA 4PB9L 5I0DA 1L7IL 4YIQA 5E2WL 4DK6A 1F4XH 1UKSA 4UB0H 3D3VD 5HYQA 4LGRB 4JJ5B 1P6AB 1F4XL 4P4KD 2F54E 2R1WB 4UB0L 5L2KB 5I8KH 5GRJH 4LPXA 3FB8A 3MV9D 5D1ZA 3G6AB 2DM7A 4HJGB 5I8KL 1MCWW 2R29H 5GRJL 3G04B 1KTRL 4RBPK 3M45A 4MLIA 5GS0D 5JW4N 4FQXC 4HG4J 1Q1JH 5D93B 4TUOB 2R29L 5KSBA 2Y72A 2GJJA 3WUWG 2NY3B 2GTWB 2VDLH 4PP1D 5DJ0A 1JNNH 4RNRA 1RD6A 1Q1JL 1BBJB 3I02A 1JI2A 3G08B 2VDLL 5DJZA 2R2EA 5E8DH 5CSBA 4JFDD 3NACH 5EUOF 2J8HA 3ZYZA 1GOHA 1Q8MA 1MFDL 1J7VR 4H0HB 1Q0YH 3GMLA 3NACL 5HY9A 4I0PC 5SWQB 5HJ3B 1EVUA 3Q2CA 1Q0YL 3CFEA 5T1KB 2CK2A 4NZDA 3QNXB 4L5FH 2NNAA 5CEYA 5IJKA 3RVUD 4QT5A 5EU7C 5IROA 4L5FL 1L9MA 2F8OA 1LEGA 2P24B 3VH8A 4TOYH 4QRTA 3QIWA 2F9BT 2ZZUT 3C87A 4F7PB 1NCCH 1DZBA 1BX2A 3N1GC 3PJSA 3O3EA 1S7WA 3QEQB 1CQYA 4NQEA 4PG2C 4I48A 3GMNB 2BSTB 1NCCL 2F53E 2GT9A 4HD9A 2NW2B 1TCRA 1T04A 3S5LG 4KKAC 2ZUSA 3FAXA 1XMWA 3BT2H 3VDBA 1FGVL 2CUMA 3IDUA 5T5FH 1CDIA 2A6JB 1AE6H 1I8IB 4OF0A 1BQHB 3MRCB 3BT2L 3ZKND 1ZGLA 5D1XD 4YHNA 4PRHA 3JTSA 5I6XC 5GGQH 3C60A 1MLCB 1UVQA 4L4TA 3FN0L 1LO5A 4OCSH 3HHRB 3FO0H 2F5AH 5F89B 4GRLB 1WT5C 3JV4A 3DVIA 5ICXA 3HB3D 5LQBH 3QXUA 5T3XH 4QRPB 3Q6FB 2FL5A 3FO0L 4KKNA 4X7TB 4Y5XB 4DJMA 5HD8C 4JM2B 3VU2A 1LK2B 2EH7L 4KROB 1T0NB 5LQBL 2NY0C 5ISZA 2GJ6E 3I6LD 5FGCE 1YEEH 2XQYK 5C09E 4NDMA 2FR4B 5E6IB 2AW2A 5BZDA 4CU8A 2J12B 3FQXA 2HFEB 1HNGA 1NCWH 5DFVD 1U36A 1YEEL 5IR1A 3QDMD 1GPOH 1N6VA 3A67L 3VG0H 4U3CA 3HNSH 1ZK9A 43CAA 3VXTB 1GPOL 4WJ5A 2BNRB 2MKWA 3VG0L 3QHFH 1UENA 2H1PH 3HNSL 1Y6KR 1CQKA 5SWZE 1ZE3C 2XKUA 1K5NA 4KK8D 2W9LA 1QUNA 1NUDA 4PRIB 4WWKA 1KLUA 2H1PL 3HAEG 3NBNA 1QBLH 1HXMA 3GM8A 1JNHB 1OTUD 4HH9B 2R4RH 3CDFA 3IS0X 2CLZB 3ULVC 4LCCB 2I26N 3FFDA 3SDCD 3O9WB 4BK5A 2R4RL 2X44D 1BZ7A 4N0UA 1OOAA 1G7QA 4Y5VA 5CEZD 2PETA 4MX7A 1WTLA 4XPTH 2C7UB 4ZPTB 1KJ2L 5AG9A 4UBDD 5I30H 4Q9RH 1WBYB 3RVWD 1E28A 2X1XR 1UXWA 1YY9D 1QBAA 4H1LG 4XPTL 3RZCA 2GK0A 3K81A 3ZZ1A 1XF3B 5C0JA 4KRMB 3RNKB 1ACYL 35C8H 1XT5A 2WIIA 4J1UA 5D2NB 3OG6B 3KR3H 1D5MA 1OGAE 2DWEA 35C8L 4D0CB 3QDGB 1GC1C 3PGCB 3MFFB 1FL5A 3MRJB 3KR3L 2FX8H 1FCGA 3DYPA 3RHWK 4Q2ZA 2FWOA 4P46C 4Z76A 5EORH 3IU3B 2EO9A 3MV7E 3MUZ1 4PGCB 2FX8L 2DM3A 5SV3A 2Z4QA 5KSUA 1W2KT 3BOVA 1ES0B 1A9BA 5B3JE 3HA0A 5ERWA 5C3TA 1UM5L 2VXSH 4MNGE 1LNUA 5EU4A 4ZUWB 4PIRF 3MCKB 6CGTA 5B22A 5DT1H 5KG9B 4KVCH 2VXSL 3QH3B 5CSGA 5DI8B 2JJVA 1NAMA 5T3ZE 4I9WE 4IRSA 1IC5H 1FLTX 4JPWH 4PDCE 5F3BA 1RJZB 4P23A 1A3LH 1MFCH 5DUBB 2ICWA 5FYJD 3SGJC 5D96B 1A3LL 5I1AB 3IFNH 3MC0A 5KS9E 3TCLB 4RGOH 5JDJA 2C3HA 5FO7A 4LLYA 4UDTA 1JI1A 1KEGH 5HBBA 3ZSTA 4LF3A 3ZTJG 3BP7B 3V5HB 4EIGB 4YPGB 2PTVA 4PJ5D 3IKCA 5K93A 2ZOKA 2OS7A 2WBJC 3GJEB 3NA9H 4YWGH 3QUXB 4KDTA 3ULUD 2JCCA 2V5SA 1MUJB 5IVZA 1XIWB 2YK1H 4FN0A 3QP3A 3ZHDA 5HPOA 3NA9L 4KDWA 4CVWA 1MY7A 4GW1A 4DVRH 2Y07L 4HUXA 1U8PB 2YK1L 4GMSH 5EUKB 1FO0H 3SDAC 5JOPE 1YEIH 3U9PH 4FFWC 2PNDA 1BF2A 2K3TA 1D9KC 3HZMB 1ODAA 4MD5B 3G5YA 1A64A 4GMSL 1FO0L 1NBYA 5L2KD 1QZ1A 4NN7B 4XBPA 1UADC 4GKOA 2PF6A 1XF5A 5JQ6L 1CT8A 4L8BA 5DMKA 5F9JA 4G9FE 4YPJA 3MRMB 5BRZB 2V7NB 3MRNB 5CP3A 3TIEB 1V5JA 4NCC1 5FA3A 2ESVB 5AD0A 3O41A 2NY3D 3CSGA 1J12A 5F1NB 1LGVA 4F33A 3N1MC 3CX5K 4N90D 1BFTA 1J9CT 4L4VE 4N68A 3SDDC 3BSZH 1NAKL 1EZVY 3QUMB 4PJ7F 2MHAB 1RZ7H 1JGUL 2VL5B 1AC0A 3BSZL 3QIUB 3OKMB 4GSDL 4Z78B 3C5SA 1E27B 1IAMA 4OCWH 4PRAA 2IADB 2Y1VA 5DHYB 3BDYH 1RZ7L 2EKSA 1KN4H 3VDAA 2EIEA 4K7PH 4HLJA 4OCWL 5LKNA 5C0NC 1VB9A 5D2LA 1T1WB 3BDYL 4HK0B 1KN4L 2JJTC 1T5XA 2G2RA 3QQ4B 4X6DF 5KSVA 2OZ4L 2HT3D 3OKOA 3U0PA 4TYUA 2EDXA 3RX8A 1L0YA 1VACA 2OR9H 1L6ZA 4Y4KA 1KIQB 4P2OB 1F02I 4RFNC 4E9LA 2R0LH 4WTZA 5EOTB 1IE5A 5DD0H 2FYYB 1P4BL 3V4UH 4V3EB 1T4KA 5BXFA 2OR9L 3NN8A 1HWGB 1YEDB 4KQ3H 5DJ6A 3QNZB 5GPRA 2R0LL 3LMJH 4PJHE 3V4UL 4OLYL 4KQ3L 3D3VA 2KZWA 4KK9C 3LMJL 3TBVA 4B5EA 4P4KA 4ZD3H 5B39A 3GJFA 5T1LB 4R4BA 3CMOL 1FVCA 4TSAL 4JZOB 4Z7UE 5F70A 4JCMA 4OT1L 3MV9A 4G43B 3S4SB 3IDXH 3TYFA 3ZYJA 4ZD3L 4ERSL 5DEGA 3VFUA 5DJYA 1XF4B 3B5HA 4O2EA 1H8SA 3VI3E 4OD2B 4I18C 5EBWA 4ODVH 3CX2A 2R0WH 5HYSB 3FFCE 4OBRA 4PTUA 4YXKL 4GRLD 3DRQB 2R0WL 3MLWH 4KI5C 5CAYB 4JFDA 5GGSY 1N3NB 4Y0GA 2IH1B 3TBYA 3EOBA 3GSUB 3WNMA 4V1DE 3FOLA 4XBEH 2E3VA 1BVKA 2ZG2A 4P2RD 3QCTL 5DMYA 3QUZD 4X6CE 5JHLL 2HN7B 4XBEL 4M3JA 4M61A 5BV7B 3C8KA 3QDAA 2BNRD 1XZ0A 4R0LB 5FK9A 3GSRA 2DICA 4GXVH 2PW1A 2COQA 3RU8H 3TIDB 4PR5A 4FMFA 1JYWA 4BUHA 3VGDA 3QHTC 4B7LA 5LWYH 4LDOB 3UJTL 2AK1H 3BFOA 1A7QH 3M07A 3RU8L 2DYPB 4M4PA 1FV1B 1BFOA 1BLNB 5LWYL 1OSPL 3KS0J 1SJHB 2AK1L 3HI6H 4ZO7A 3B9VA 4NRZA 2NXZC 1KB9J 1N7ML 4U1KB 3O9WD 1BVLB 1X5JA 3DX7A 3E2HC 4QTIH 3C09B 3HI6L 1GJIA 4H26A 2L4OA 3ORJA 1HDMB 5D1XA 4QTIL 5FO8B 3ARGB 3MRLB 2O61A 5EB9A 4P59H 3BZEB 4YNYA 2R56H 2HG5A 2O26U 2VLKE 2V9TA 2B5IB 1UZ6E 1AXIB 4NPYB 4P59L 1YEGL 4OLEA 5DFTA 3TA3B 2R56L 2F54B 1QFWI 1UJ3B 1NMCC 3B2VH 4OLUH 2BMKA 5D6CB 1Q0XH 1XGPA 2QADC 1JN6B 3LEVL 5HI4C 3ARDB 3F7YB 1ZLWH 1H5BC 5IESL 4OLUL 1G7IB 3QDGD 1Q0XL 3NPSB 3E1F1 1P2CA 4PJ7B 5EC2A 3VXME 2EEDA 2ADJA 4U1IA 3DYMA 4O51A 4ZNEA 2R1XA 4JFXB 5CP7B 2EDDA 2IANE 3QDMA 4UT6H 3VWKB 3WXWH 5DJXB 4OAWB 3RI5K 3OB0H 2KQMA 3G5XA 5TDNA 1A1OA 1Q9KB 3ZSSA 3TNMB 4JDZB 4WFEE 2EE9A 1IGIH 2VIRA 4X6DB 5EN2B 3WXWL 2NX5E 1YEJH 3WIHA 4ZFZB 3PWUB 1KG0A 1IGIL 3NFSH 1QLEH 3OR6B 2HKHH 3DUHA 3INUH 1FVEA 1YEJL 1PFCA 4J8RA 1JUFB 5C0AA 4JPIA 1QLEL 3VFPA 4K3HA 5C0CE 2HKHL 1U3HC 3INUL 2DLTA 3BN9C 3MROB 1NJ9B 1OAXH 2E9BA 2SEBB 1JGVH 2OTWA 1L8JA 4N9GB 4XX1G 5B3JF 1YC8A 3SDCA 3QO0A 3ZDYE 4PJXA 4MJ6A 3Q3GB 1JGVL 3WLWD 4G6AD 3ZTNH 1LK3L 5I9QC 4MB4A 1G0XA 1RY7B 5DHVA 2P5EE 4OFYD 3T0AA 3U2SA 3ZTNL 2D9CA 1UCTA 2VAAA 4OCYH 1ZS8B 5FYKH 3UYRH 4F37K 1FG9C 3MGTA 1NCBH 4XI5C 3ZKQD 1AD9A 4JDTH 4OCYL 1LVEA 4L8SB 4Z0XB 2YD7A 1E4XH 1NCBL 4JDTL 2A6KB 1K4DB 1I7UB 4I4WB 5KS9F 1CG9B 3VWJC 1PSKH 4DZBA 1KEML 1GHFH 5C0DB 3QUXD 1NGXB 3P9WB 1XIWD 3SKUD 1JPSH 2FJGA 4PBWD 1PSKL 3HCVB 1GHFL 2X1PA 3B8SA 3RGVB 1ZHKA 3FB5B 3UPCA 2NY5L 3D39E 3QG6B 1ONQB 2XIDA 4UTAH 4APQC 4EQ2A 1AGBB 4ZXBC 4ZS7H 3PQYA 4QXTB 2DKMA 5L0QB 1BJ8A 1KELH 4UTAL 4HS6B 2DIJA 1ZLSL 2RR3A 3L3DA 4ZS7L 2GJ6B 5J89A 1IT9H 1KELL 4LHUG 5C09B 4LCYA 5HHNA 1IEBB 3AS0A 3DX9B 3LY6A 5JW4R 4ZDHA 2AEIT 1IT9L 4RCAA 5BRZD 4AM0A 3WJJA 4LLWA 4WNQB 4ETQA 2ESVD 2HKFH 1YC7A 2J8UA 3RTQD 1YECH 4NO5B 4FA8A 4HZAA 5D71L 4CGTA 1Q94A 5CJ8A 1BIIB 1OT2A 2HKFL 2GCYA 5SWZB 4Z77B 1AGDB 2AJVL 1INQA 3NZ8B 3AVEA 4G42A 4ONGH 4NO2A 2A9NH 3X11B 3TVMB 4FZEL 2FDBP 4JGJA 2RFXB 2V5YA 3DV4B 3OGCB 1J18A 2AEQL 4HWZA 2ZCKH 5IOPA 1JRHI 1DVFB 5ALBL 4JHBA 2A9NL 4HWNA 5I17B 4X4MA 4RZCA 4LAQH 4QHKJ 4ZTPH 2BNUB 3CJJA 4PJ5A 4HKZA 1HOCB 1D6EB 4TNVF 4MA8H 2KBGA 3QWOB 3EDJA 2OK0H 2YWYA 4ZTPL 1JZ5A 3FO1A 1MRFL 1CFSA 4FQ1H 5C86A 3UTQA 1W72B 4KGLA 4P2OD 4JHZA 5FYJU 1TVBA 1LILA 5T1DL 4JRXE 1I3RA 4G8FB 5FF6B 2OK0L 5I8EB 4FQ1L 1IGJA 3I50H 4OCRH 2FLRT 3OKYA 5I1EH 3PIQA 3BPOC 4J3SA 3I50L 4JJ5A 1OGAB 4OCRL 2R1WA 3OF6D 2VUYA 5L2KA 3WN5B 5I1EL 1KTLB 3G6AA 1X4ZA 4MAYC 2YPVH 4IDJH 4IJ3C 5HHPA 4WI3A 3G04A 4W81A 4PJHF 4RMWA 1FIGH 4L1DA 5DWUH 4M7ZC 2YPVL 4IDJL 2AJYH 3NCYP 3V5DB 4TUOA 2NW3B 1U8LB 3MZTA 4NFDA 4DKEH 5CJXC 5J6GB 4JFHE 1KTDB 5IGXH 4Z7UF 3IDGA 2AJYL 1BBJA 5FDWB 2XNAA 4DKEL 3RWCB 4MNGB 1A6TB 3VXNB 3TN0C 1MNUH 3VI3F 1DDHB 2QQLH 1F45A 3QI9B 1IKNA 4XCCH 5DR5L 3HE7C 5FDYA 4N8VB 4LL9A 4RA3A 1NAMH 3VW3H 5HJ3A 4TULH 2O5YH 3DLQR 4NBXB 2XG5A 4KJYB 5CGYD 1T7WA 1KCLA 3NCJH 1NAML 4TULL 4LSQH 3QNXA 1U8MA 1FG2B 2WZPD 4NZJA 1CFVH 5I2IB 3DOSA 1WF5A 4S1SL 4JQIL 5KS9B 4HKXA 2OI9C 3O6KH 3MBEC 1CFVL 2P24A 4BSWB 3ES6B 1ZGLP 4F7PA 2DM4A 3O6KL 2E6PA 1EIBA 1FE8H 3BIBX 3TO4B 3GMNA 2BSTA 2FATL 5DLMH 1F6LL 2C1PA 4NQTA 2NW2A 1JFQH 3T8XB 4GKSB 4ZUSB 3FQUB 5DLML 4Y7MA 4V2BA 1JFQL 2WQ8A 1MHPH 4J3TA 1P84K 5C08E 1I8IA 4NO0D 4IRZH 3D5OF 3N85H 4FNLL 4PV9A 2JK5B 2AEPH 3UDWA 3ARGD 1MHPL 1MLCA 2D31B 3MLVH 4GMTL 4OF7A 1I1AD 2AK4D 1OLLA 5DJ8B 5C8JB 3N85L 3D69B 4OFVA 3WL9B 2ZKHH 2AEPL 5T33H 1TZHB 3TH2T 3O8XD 5ENWB 3TA3D 5F89A 4GRLA 3OV6A 1S7RB 2ZKHL 1SJEB 4H0GA 4O4YH 3IS1X 5AEAA 3Q6FA 2YUWA 3TWCH 3MLYH 1IZKA 4X7TA 4Y5XA 4YBQC 3KS0H 1VDGA 2VKXA 3VGAB 3TPUE 4I1NB 4XAWH 4OCLC 1T0NA 1U8NB 4O4YL 4U6XB 3RZWA 3MLYL 1XGTA 3EW3B 3LIZH 5CGMA 4BQCA 3THML 4M8VA 2FR4A 4XAWL 5CP3H 5E6IA 5GGSB 4Q6IC 4HUNB 4L8DB 3STBA 5AZ2H 5C0BB 4KMTL 3LIZL 4XMPH 1Z0NA 4L4VB 3VWKD 1UC6A 1FJ1A 1X5LA 1KPVB 4P2RA 5LAXB 4X80H 2FHBA 3MRDB 5KVDH 3GEWB 3QUZA 5D1ZC 2G9HB 4XMPL 5JXEC 2D7QA 4Y1AE 2BNRA 3HRPA 3MLXH 4X80L 2MCG1 4AG4H 3QXTA 2BRQA 2W0PA 3DETD 4HWUA 3MLXL 1RK0B 1S5HB 2WMPA 3U4BH 4AG4L 1JNHA 4HH9A 1L4IA 1FC2D 1G9NL 3MRRA 3QXWA 2O5ZH 3EOTH 2CLZA 4LCCA 1W0WA 4X9IA 5F7EH 2IC2A 3O9WA 3GZKA 1BZ9A 1F3DJ 5L7XH 5F7EL 3MUHL 5ITBH 1MIMH 1CXKA 2Q7NA 5HGAB 2CLVB 2C7UA 3W0WD 4ZPTA 3HC4H 1RHHB 4PJHB 3GI9L 1WBYA 4NWTH 3LKPA 1TJGH 4WUUE 3HC4L 1XF3A 5EC1B 3ZDYF 1S8DB 3MRKB 5IJKC 4Z7UB 4RDQF 1TJGL 2AKRB 5D2NA 2D03H 3RIAK 5EBGA 1KXTB 4Q7DA 4XGZB 4BFIA 3QIWC 4D0CA 5K9KB 2OYPA 2ZP0T 3QDGA 3PGCA 2D03L 1OTSC 3MFFA 4WDIB 5D7JC 4LLDB 5GS0H 3MRJA 5DK2A 3N1FC 2BVOB 1FL3B 3VA2C 2CIKB 3IU3A 3FFCB 4JANB 4DTGH 3GSWB 3SQBA 4PGCA 4FHBD 5GS0L 3W5NA 4G6ML 5ACZA 4OI7A 4DTGL 1X5FA 2XTJC 3REVB 3SE9L 4LRNL 2JJSA 1HSAB 1ES0A 3VA6A 4EN3C 5HTSA 5E6ZA 3KYAA 5DHXB 1P53A 1XFPA 5FYLE 2GJ6D 3AS3A 3QEGH 3C60C 1MVUA 2GEEA 3BKMH 5C09D 1ZHBB 4LFHD 1I85C 2VOTA 2XXCB 4ZUWA 4V1DB 3MCKA 4HW6A 5KG9A 1F6AB 5F7KC 5LGHH 3QEGL 1LO0H 4XB8A 2GUOA 4X99B 1X7QB 4GAJH 4OB5L 3HC3H 3BN3B 5LGHL 1YMHB 1B0GB 1RJZA 4WFGD 4GAJL 4ZFOA 5E2VH 3LN9A 5DUBA 1U42A 1QSEB 4XNMB 3UAJC 4CMMB 2DQHL 1U6AH 3HR5B 1FFQA 4M4RA 5DURD 5I1AA 5E2VL 1AGCB 1S78C 1CL7I 1T2JA 1JF5A 4OFYA 5T5NF 1NCUA 3PHSA 4LCIH 3TVMD 4R26L 1LWRA 1U6AL 4S1DD 3BDXA 5J12B 1MWAB 5LXGL 4NQCE 1DVFD 3BP7A 3NZHH 4LCIL 4U1LB 3IAQA 3F5WB 4I3GA 2FJHB 1TPXC 5GRVK 3L7EB 3NZHL 4LASH 4XCNB 3GJEA 5K59E 3VGHA 3RVTD 3QUXA 3A6BH 5FGRA 5BW7A 5EU5B 1MUJA 5GISL 1EFXB 1XIWA 1A1MB 4G3YH 2Z8VC 5E2UH 1H3WM 5EUKA 4G3YL 3WIIL 5E2UL 2WV3A 3S3PA 2EZ0C 3HZMA 5DC0A 1ETZA 1IILE 4XCEB 5CUSH 2LVEA 1O0VA 4Q9CA 1YPZE 1BVZA 4AY0A 2L0DA 2W9EH 4Y5VC 4WU7A 3UBXG 1UA6L 4HDIB 4HS3B 1GGIL 4QXGH 5CUSL 4ALAH 1J5OL 5JHDE 1H9VA 2W9EL 3GIVA 4MA7H 4QY8A 4QXGL 4ALAL 2MKLC 3RZCC 3MRMA 5INDB 2IANB 2HWZH 4QOKD 1NFKA 5BRZA 4HG4K 3TPKA 2V7NA 3MRNA 3JWOL 4ZAKB 1I3GH 4ACPA 4FQ2H 2ESVA 3NA4A 2BFVH 3RNQB 3RTQA 1DBAH 5F1NA 5I1HH 2HWZL 5DJAB 1SHMA 2RHEA 1I3GL 1MCWM 4JO1H 1UB6A 4FQ2L 3WIHH 2BFVL 4ISVB 5DQDH 5HPMA 5I1HL 5C07E 2D7TH 1I9EA 2VLRE 2OXHA 3QUMA 3I3BA 5DMGD 3CFIC 4W70A 3WIHL 3GHBL 2MHAA 3R1GH 2PTTB 1PGRB 5DQDL 5F9OH 3QI9D 4Z78A 4G9DA 4P3CH 2IADA 3H9ZA 5DHYA 3R1GL 3KPSE 4WW1B 3IU4H 2HJFB 4LPWA 5LJYH 4P3CL 3OKDA 1T1WA 1CIDA 4HK0A 1P1ZB 1J0HA 4YZFE 4AK1A 3QQ4A 2I07B 3IU4L 4ZPVB 3MUGB 5CEZH 4NHCH 5C6TH 1KLFA 4QF1B 4P2OA 4LLMA 5DHVH 4QYOB 5CEZL 4NHCL 1VCAA 1VERA 2J2ZA 1YEDA 4IRSC 1QSFD 4CBPA 2YOCA 3W82A 2CKBB 1MHHB 4P23C 1KJVB 5AZEL 3OKNA 2VAJA 3BX7C 3DVGB 3OF6A 3QWRD 5EPMA 4NRYA 4HIEB 4JZOA 3HI1B 4G43A 3K80A 1HHGB 1K8DB 4JPVL 2Q1EA 2HMIC 1XF4A 4MCYB 5DD1H 2DN7A 1CLCA 3PWVB 3KG5A 4OD2A 5TH2B 5HYSA 2KDGA 3JUYA 5DD1L 4PREB 3J7HA 4HWBA 5K9QG 3DRQA 2APTA 4Y4FB 4E0RB 5DRZB 1N3NA 2EKJA 2J4WH 4OUUB 1A3QA 3QISA 3ZDZE 2W1NA 2IH1A 3E8UH 3V95A 4RMSA 3GSUA 5EFIB 2FLBT 3LPWA 2N56A 1N5YH 1A7OL 3E8UL 4YHLH 5C0BD 1RURH 4YFLI 4GAYB 1GGBH 3BGAA 2X9XA 4YHLL 2Z92B 4OZHB 1A6VH 4PPTA 2HN7A 1DLFH 1CE6B 4OZIB 1GGBL 4M02A 1JNJA 2Z8WC 2LV4A 4R0LA 5FYJL 5FXCH 1A6VL 2ARWA 4QRUB 3SO3B 3TIDA 3BH8A 4RWYH 1AC6A 3ALPA 3HN3A 5F7MC 2DYPA 1U93A 3CCHB 1FV1A 1ZLWK 1SJHA 5CD3A 4M7KH 1RZJH 5I8CB 4U1KA 3V7AG 4LGSB 1U2CA 1UWGL 3VGGA 4LLQB 5M95B 3RWGB 3MRPA 2A6IB 1CF8H 1RZJL 4JRXB 4NO0A 4X5LA 1HDMA 1CGVA 3ULUL 5FO8A 5JIPA 3ARGA 3MRLA 4X4XB 3BZ4B 4OGAC 3KYNA 5DS8B 3BZEA 1CF8L 1OF2B 2AK4A 3OB0K 4O2CA 4HIXH 1MI5D 1X5GA 1GOGA 4NPYA 3O8XA 1U2HA 3TA3A 1CVRA 1UJ3A 3SCMD 4Y4KC 4DW2H 3HRZB 3IJSB 3F7YA 1G9MH 5J4MA 3GKWH 1G7IA 4UOW1 4MNQE 4Y19E 4PV8B 4DW2L 2X4UB 5ID0B 4PJ7A 5JW3H 1JPTH 4QWWD 4WCYH 1G9ML 3GKWL 1T1XA 1D5ZB 3EGSB 2E6QA 5JW3L 4K9EH 1JPTL 5CP7A 4WCYL 3FMGH 3KAAA 5GGVY 4P4KC 3VH8G 3VWKA 3DX6B 5DJXA 2ID5A 5F7DB 4OAWA 3BRFA 2CK0H 2GQHA 4JDZA 3RWJB 5JO5B 4WTWA 4X6DA 5EN2A 2YMXH 4KKCC 4ZFZA 2A0LD 2CK0L 1RVFH 3F7RA 2W9DH 1G6RB 3H9YA 5F96H 5GS0C 4M5ZH 3S35X 4FTVD 2YMXL 4XVUD 1QRND 1MSPA 1RVFL 2W9DL 5EDXA 1YNKH 2ZUWA 4Z7WE 5C6WH 4M5ZL 4OZFA 2W0KA 3MROA 3ALWA 3ZKXB 3RPIB 4YBLC 1NJ9A 2SEBA 3SE8H 3IXTA 4PP2B 4JFYB 4N9GA 1YNKL 4MXQD 5F7YC 3TESA 2EDNA 4HX1B 3Q3GA 5DJCA 1ADQA 4PTTA 4JO4H 1MCNA 1QSED 2ZCHL 5FGBA 3W0WA 5JOFB 2RIKA 4UUJB 3W9EA 1WVZA 1ZSDB 1ZS8A 1QBMH 3VCLA 3NIDE 4NRXB 4AENB 2IBZY 2FHFA 2QKIA 3RVUC 4Z0XA 1QBML 1WZKA 3O2DA 4L9LB 1G7LB 1I7UA 1K4DA 5DEZA 3EKCA 4C56D 4ZOEA 1MJJB 1GGUA 2PO6B 5C0DA 1F11B 1NGXA 3N50A 3FQWB 4G8EB 1OAQL 3S88H 3SBWA 5IEHA 3EFDH 3RGVA 4WGWB 3BPNB 3JXAA 5IKCB 3FB5A 1T80A 4P99A 5HI3D 2BNQE 1A6ZA 3LPGA 3B2UD 3QG6A 4LSVH 3BE1H 4WEUD 2ENYA 2E8YA 1MY5A 1AGBA 2H45A 2JLLA 4Z95H 5MEPB 3EFDL 4CAGA 2B4CH 4PRPE 4FOMA 4HIIB 4QXTA 5K59F 4NOFA 4LSVL 3TPUB 4UAOB 1CVSC 3BE1L 3MA9H 4HHAA 5HHOD 4HS6A 4LEOB 4Z95L 1IFHH 3QCVL 2B4CL 2Y4SA 1V8HA 4HH8A 5DVNA 1RZKL 1AR1D 2GJ6A 2Z93B 4GQ9H 1XEDA 3GSOB 2PR4H 5C09A 5I74B 4Z0BH 1IFHL 2YD3A 4E41D 1AO7E 3WFCH 3DX9A 1C5CH 2IMMA 2K1MA 1WJ3A 4GQ9L 5IW3A 3HS0B 4OIIL 2DQFA 2PR4L 2VNCA 1CGYA 4Z0BL 4WFFE 2EYSA 4AYFA 4CRPA 4FG6D 3WFCL 1HH9B 4WFHE 4Y8DC 1YPZF 3P4OB 4ZAKD 1C5CL 3T0EC 3FHQA 4JKWA 1E4WH 3KPNB 2XICA 2HFGL 3F6LA 5H2BA 3X3FH 5T1MB 2JB6B 4MSWA 4U1GB 4XP4H 5SWZA 4Z77A 1E4WL 3T2NL 3B3IB 2NY2C 5A2JH 3X3FL 2ED9A 4XP4L 3TVMA 5C7XH 5DFVC 2RFXA 1SYSB 4RFEB 5ICZB 3Q5OA 1DVFA 3E0GA 3CK0L 4LSDA 1RIVH 2W0FB 4AQ1B 4OZ4B 3HNVH 5C7XL 4LVOC 5JORB 3QQ9D 2ZUXA 3RBSA 2BNUA 3HLAA 4TVPH 2VDQL 1HOCA 3HNVL 2GIYA 1GZPB 5AUMB 3BO8B 4NQXB 4JAMA 3P4MB 3MJ8B 3RL2B 1LP9A 1A9EB 1W72A 1Y6MR 1E6OH 5D7KD 1H3VA 4R6UA 5FF6A 4A6YB 5I8EA 1R5IB 1E6OL 3UYPA 2V7HA 1TQCB 2VDPH 3K4ZA 4NC0B 1FBIH 4MB3A 4YZFF 1EHXA 4OIBA 5ABDE 1OGAA 1V3JA 2P4AB 2VDPL 4L3EE 3WE6A 3WN5A 1FBIL 1CFBA 3CFBB 4C4KO 4R8WL 4UBDC 1TLKA 1FPTL 5C92A 3RVWC 3TBTB 3MGOB 2E9IA 4FQXD 4QOKA 2QSQA 5DMJB 3V5DA 2NW3A 1U8LA 3H2WA 5J6GA 4G59A 4AMKL 3MNWA 1CXFA 3V6OA 5GHWL 3RIFF 1C5DA 3W11D 3G9VA 4OV5B 5FDWA 5MI0B 1IL1B 3ARZA 1HWHB 1JK8B 3JWNC 4LKCB 5ILTH 4K8RH 3EYSL 1AI1H 4HK3J 5K9JH 4R3SB 3V0WH 2B1HL 3VXUD 1DDHA 1ND0A 4LOUD 3QI9A 5JA8B 5K9JL 4N8VA 2VUOA 4I0PD 3V0WL 4YO0B 5FHAL 3HZKB 4XCYB 5F1SA 1N59A 3FN3A 3KYOB 4QHUA 3C08H 1XGRB 1Z5LB 3UO1H 3UXFA 1FG2A 1ULVA 2RQ8A 3PHOB 2NY7H 5C0RH 3C08L 1H15B 2WAHA 3ZDZF 4ZFOL 3BPCB 2IJ0C 1NCAL 1YDPA 2NY7L 3X3GH 5C0RL 2A38A 1RFDH 4NQCB 3KPRE 3WJJC 1QSFA 1FLRH 5I71C 1WEJH 3SGEH 1MREH 3X3GL 4Y16B 1XF2A 4C55A 1S9VB 3BGFB 1MREL 5DVKA 5KOVC 3CFKA 2HP4A 2ZUYA 3QWRA 1MHEB 1KB9K 4ZUSA 1T22A 4WHYH 4HBCH 2BOCA 4PRDB 2E7HA 4NKMA 2L7JA 4YQXH 2R9HC 3GSQB 3Q1SH 2JK5A 4BH7B 3WIFB 4HBCL 4HF5H 8FABB 4HGWA 2D31A 1A1NB 1N6UA 4JFPA 3U9UB 5C8JA 1CICB 4BYHA 3WL9A 1MCRA 4HF5L 5L9DH 1WWWX 1YPZB 5ANME 1YA5A 3P0VH 1RZJC 4PFEA 2XPGA 2DL2A 3MRGB 5JHDB 4B53A 2E7BA 3P0VL 5HD8D 2EXYC 5IB5B 1FZJB 2NY0D 1U8NA 1V3MA 1F4WH 1J8HE 3U30B 1FFPB 1N8ZB 1M7IB 3GSXA 1ZAGA 5JW4Q 2GTZB 1ROWA 5GGSA 5HVFB 4L8DA 2E7LE 1F4WL 1PG7X 2Y7QB 3IDNB 4M8QB 5C0BA 4CKVX 5ADPH 4WTZG 1YN7B 3C6LB 3IJHA 1KPVA 3MRDA 2G9HA 1G9MC 5CCKH 1NKOA 3QUMH 1U95B 4XNQB 1CLYL 1U8OB 1UH4A 3B9KC 3MJGX 3D25B 5HGHB 5CCKL 5IEKB 5B39G 3L3GB 3QUML 5FKPB 3U46B 1YMMB 5D93C 1RK0A 1S5HA 2NY3C 4K9EC 3RFZC 3FAWA 5BOPA 3WDJA 1C12B 2OXGA 1R3IH 3ULVD 4POZD 4NUJB 5F72S 4G8GD 5DVLA 3A6OA 5CBAB 1EZVX 1F8TH 1IKNC 1IC1A 4TUKH 1BD2D 1C5BL 5HGAA 3CZFB 3F6IA 3GMRB 4Z7WF 1RHHA 1F8TL 3JTTB 1TMCB 1FNHA 1REIA 4PJHA 5IJVA 4TUKL 1S9YB 1MI5A 4X4YB 3M1BB 4HLZH 2L7UA 3MRKA 1OM3L 1NEUA 1IAIM 4S1RH 4Z7UA 3SCMA 3VRJB 2AKRA 3OPZL 2EE3A 4HUWB 1A14H 5DVMA 2A77L 4Y8AA 4S1RL 3MR9B 5K9KA 4XVJH 2GSGB 2YC1A 3G5ZB 3O2WL 4WDIA 1A14L 4LLDA 3FB7B 3WHE1 3BD4A 5EU6E 4KHXH 2BVOA 1FL3A 1AH1A 4XVJL 1QFPA 3R06B 2JELH 4JANA 3NIDF 2VZVA 4JRYE 2ICEB 4KHXL 4YHKH 2DMKA 3S35H 3VE0B 4HWBH 5IW1B 4Z7QE 2FBOJ 1HSAA 4ODUB 3S35L 3IF1A 3DVNB 3QCUL 4HWBL 4X0KB 1CDGA 5MENE 1TZGH 2XKNB 3UDWC 5C1MB 2EDWA 3W39B 3OQ3B 1ZHBA 5F6HJ 1UCBL 1QRNA 4V1DA 5IFHH 4C59B 1TZGL 4H0IA 4UINH 3U7YL 2DQGH 5AG8A 1XCQB 1U58B 3SQOH 1X7QA 3GBLA 4GRLC 3T65B 2B4CC 5IFHL 2EDQA 4MXQA 2D7OA 4QHNA 3LKRA 4MDJB 1B0GA 3NABH 4Y5XC 5E8PB 3SQOL 3TLRA 1CXEA 1XR8A 3HPJB 4JM2C 2W91A 2VLJE 4K2UH 4BSVB 5BV7H 4KROC 3S37X 5IUSA 1QSEA 4XNMA 3T0BA 3NABL 3HR5A 2XA3A 2F58H 4K2UL 5IQ7H 2YZ8A 5E6IC 4ODXA 3ROLA 4BQBA 4ELMF 1KIUA 1SM3L 2QTEA 3C9NB 1LD9A 2F58L 1MWAA 3MZGB 5IQ7L 5M94B 4OCMC 3P0GB 3LS4H 4U1LA 3F5WA 1YY8B 3GMOB 1FAIH 1TTUA 2KQNA 3L7EA 4Q0XL 5FECB 5GIRB 1BF8A 3LS4L 4U6TA 5E5RB 1QR4A 2G60H 4OQTA 2WBJD 3N9GL 4XCNA 4XAKD 4C56A 5EU7E 1FAIL 4IIQB 1F42A 5EU5A 1MCKA 1O7SA 3SJVE 1A1MA 4Q6YA 2G60L 4HGKC 3GRWA 1RU9L 2YBRB 4UT9H 5F7FA 3DGGB 1CZ8H 1IM9D 4RGMB 4LCCC 2AXJA 1D9KD 3LEYH 3TBWB 3O9WC 4UT9L 4M6NL 4PLJC 4KU1A 3O11B 4HS3A 2FRGP 4Y19B 4PJAF 5LVEA 3UBXI 3PV6B 4XVSH 4XXCC 2BERA 3QJFB 4E41A 4JZJB 4ZTOH 1RUPH 1OCWH 4N0CD 3BISA 5INDA 5I1KH 1Q38A 3MMEB 4ZAKA 4ZTOL 4GXUN 1RUPL 4NIKB 5D2NC 3RNQA 1SEBB 2AJZB 5I1KL 4IBLT 1T0MB 3ME0A 4QXWA 2BHYA 4ISVA 3DRTB 3VXPB 4U6VH 4MLSA 4BZ1H 3RX7A 3S8WA 1I9IH 5A2IH 2PTTA 2P8MB 2GSIB 5A16B 4Z7WB 3HMWH 2D7NA 4BZ1L 5TE4H 3EO9L 5EBLB 4WW1A 2JJSC 3UTTE 1A2YB 2UZIH 3HMWL 3MFGB 4N8PA 5I18H 1HQ4B 5H8DA 4K8RC 1ADQH 5F7LB 1MIEL 5J1SC 5IMOB 5JZ7C 1ZHLB 2UZIL 1FYHB 2VN7A 2X2YA 3DURA 2P44B 1JPFB 5I18L 2R69H 4QF1A 1SBSL 1ADQL 4QYOA 4MHHG 3LS5H 2D0FA 3O3BB 2R69L 4NQCD 3VFVB 4HKJB 2NY6B 4OGYH 4ODWB 2YD5A 3QEHB 2CKBA 2XY2A 2GITB 1WAAF 1CR9L 1MHHA 1P4LB 1KJVA 3DI3B 4OGYL 3JV6B 4KK9D 1E6JH 3WLWC 3O2DH 4G6AC 3D9AH 2BVYA 2LAGB 3DVGA 3H9HB 1FNEB 5D96C 3RUGA 4DCQA 4HIEA 1CFNA 1KCRH 2YUZA 3VXRD 3HI1A 1E6JL 5I16B 3O2DL 4PJGE 4R97B 2DMBA 3D9AL 2W60A 4G8IB 5E8EB 1JGLH 4WI6A 3G5VB 3WS6A 2XZQL 4MCYA 2BNQB 3M17B 2DKUA 4FABL 1MH5B 3PWVA 4M62H 2AGJH 4Y2OA 4I5BB 4PRPB 1CICD 1CD1A 1U8KA 1TZIB 1FVDB 4PREA 1Q9LA 3MYZA 3WO3B 3WUWB 3BEWB 3DUUB 5K9QI 3QUXC 4KI5D 5GGUA 5HHVL 4E0RA 1XIWC 1N2RB 2P47B 5TF0A 4HWEH 5JOEA 2Q20A 4ELMB 4I0PA 1QA9A 2YPLE 3P77B 2P45B 4HWEL 3NFNA 2WUBH 4X6BA 1M6OB 1NFDB 4YDKL 5B3NA 4PJFF 4BSJA 4GAYA 1MCHA 3C6LD 5T3XD 4H5SB 4NN7C 4MMXC 2DLFH 2QLVB 2AI0H 2Z92A 3WLBA 4OZHA 5TE6L 2X1QA 1D6VL 4OZIA 4P5TB 3F8UB 4XX1E 2DLFL 2AI0L 2H2PD 4QRUA 5GRUL 2EIZB 4Z7VA 3DTXB 3R8QA 1YMMD 5LG1A 4PG2A 2D0HA 1VGKA 4I3SH 1NCDH 4X6FB 4IMKA 2X10A 3CCHA 4MJIE 1YNTB 1WZLA 3SGKA 1RIUL 4XC3H 4GT7A 2DQCH 5I8CA 4I3SL 1P69B 1EAPB 4HZLB 4LLUB 2NLJA 4PJAB 1BIHA 3RWGA 4XC3L 2Z31B 1W72H 4OGXL 5ACMA 2A6IA 2QSCL 1Q9OA 3QIUC 2VXVH 3RP1A 2QSVA 2FEDC 4X4XA 1W72L 4F15B 1OF2A 2VXVL 1MPAH 3NIGE 4OLWH 5D5MF 1BP3B 3X17A 1R3HB 4GRWB 5FM4A 1AXTH 1WBZA 1MPAL 1NLDH 1FQ9C 3MYJB 5D7LE 1O5DT 2Y06H 3HRZA 4P2OC 1PG7H 2MQ3A 5HI4D 3IJSA 2YWZA 1AR2A 1AXTL 3T4YB 1NLDL 3ZDXE 4R2GB 2Y06L 4PV8A 4S11A 3QIBB 5ID0A 4D94A 3MXWL 5H35A 3QWQB 1PG7W 1I1FB 1D5ZA 3EGSA 4M5YH 3SKNB 5K33A 1HILB 4CNIB 3MPCA 4V2CB 4RMRA 3KLSA 1EH9A 1WC7B 4PGZA 1P6FA 3MCLH 1K4CB 5F7DA 2EYTA 4M5YL 4NNXA 4NKOB 3T3MF 2YS4A 1I1YB 3RWJA 5JO5A 4MZ2A 3MCLL 1A4KB 4PJEB 1JPST 4MJ4A 5BJTB 4QRSA 5C70A 4Y4HB 2CDGB 1MRCH 3H3BC 5T3ZH 3I75A 1MCJA 1PY4A 5MHSE 1U8QB 1HQRB 1MRCL 5HHQB 3BJLA 5I1JH 3BN9D 3HAEB 4Z7QF 4M93B 4X9FA 3RPIA 4D9RD 1AKJB 2EH8H 4P9MH 5CZVL 3T77A 5I1CH 1WITA 4JFYA 5FOBB 4NNYB 3L7FB 4G8GA 4HX1A 5DA0B 1VSCA 3FB6A 2RAMA 2EH8L 1J88A 5I1CL 2NY1B 3IFLL 5F93C 2XT1B 3ZHKA 2ARJA 1BD2A 5DGRA 3KPRB 5JOFA 2NTFB 1QYGH 2CRIA 4KY1L 4UUJA 4PJIE 3OKKB 5IB4B 1XGUA 1IAKB 4WEBH 5CBEB 1ZSDA 4ONFH 1IQWH 3F58L 2VB5A 4NRXA 4AENA 2QHLA 4WEBL 4ONFL 5BV7C 1IQWL 3KYKH 4M1DH 1UYWH 4L9LA 4R0LC 3AREB 4JQVC 1MJJA 1ZANL 3FQNB 1F11A 1UYWL 4M1DL 5EOCJ 4RGNB 1MCPH 4G8EA 4D9LH 1S7VA 2X4RB 3PWLA 1OGTB 1MCPL 3MNZA 4GG6B 4D9LL 4PJFB 1B0RB 3PDOB 43C9B 4ZXBD 1QOKA 1T21B 3P3YA 4FZ8H 4HIIA 3FT4B 3C09C 4LEOA 3EO1B 4YHIB 1NQBA 4FZ8L 4X7CC 3ARGC 2Z93A 1CLZL 3GSOA 3CIQA 4U6YA 2B5IC 3WHXB 5C9JB 3HS0A 2JJWA 4H20L 3TA3C 3SDXF 1UJ3C 3S34H 1HH9A 1BOGB 1N0XH 4RWHA 15C8H 3ARDC 3KPNA 4U1MB 3S34L 4KH2A 3H3KA 1N0XL 3SGJA 3NPSC 3T1WA 4F57H 3BGMA 3WD5H 3B3IA 1TCMA 4L3CB 1CGUA 3BHBB 2IALB 4F57L 3WD5L 1SYSA 2C3GA 3VWKC 5ICZA 5TGBB 3CVIL 1J05B 3DXAB 5D5MB 4QTHA 2W0FA 4MD4B 4OZ4A 3SGDH 1JHTB 2J6EH 5EOQL 3B9AA 5FA4B 1T6WA 4OJFH 4NBZB 3MA7A 2WBJA 1GZPA 2W92A 4JJHA 4NQXA 5DQJB 5FM5O 2BVTA 4YLQT 3DETC 1NCNA 1QO3B 3NAAH 3P30H 5IMLA 3RL2A 2H8PB 3TZVB 1A9EA 3GUTB 4DUXA 4O5LL 4LSTL 2CGRH 4DKFH 1EEZB 3DO7B 2EDLA 1PLGL 4O02L 2ED8A 2XN9E 4A6YA 4M7JH 4YXLL 3GMQB 2NY6D 1R5IA 4NHUA 5EU3B 4X5XB 1IM9A 3UROR 1D9KA 4DKFL 4M7JL 4JKPH 1V7MH 5F1IA 5F6IB 5E56A 3C6SB 4O58H 5DQ9A 4MVBC 2HLAB 1MFAH 3K2MC 1YN6B 1R3LA 1V7ML 5FGBC 3CFBA 2ZOLB 5JMRA 1FL6B 4MAYD 4O58L 2DJSA 1MFAL 3TBTA 5E5UB 3CGTA 3DSFH 1PKOA 4JVWA 4N1EA 4N0CA 4U0QB 3H9SE 4WV1B 3X14B 4BQ8A 3MGOA 5HDBE 5IW6B 4HS8H 1VFBB 2C9AA 3JVGC 4NCC2 4HULB 9CGTA 1GGYA 2ICWI 4L8SC 4PRPD 4TSBL 4OM1H 4L8CA 2GYSA 1MLBB 3UZVB 3WV0A 1IL1A 5JQHC 5MENB 1CGTA 4LKCA 4PJGF 1CGXA 1RI8A 3I3DA 4R3SA 1SEQH 5E8NB 3SBWC 4NT6A 3UTPD 4LIQH 4HJJL 3RGVC 4NNPH 1OSZB 5E0QA 3FO9A 4ONHB 6FABH 1SEQL 1KC5H 4F8QA 4LIQL 3HZKA 1FFNB 4XCYA 5ITFB 3S6CA 1AY1H 2BVPB 5L0QC 4WGVB 6FABL 1XGRA 1Z5LA 2VLJB 3F7VA 1I8MB 3BJ91 2JJTA 2FJFB 3RY5A 3PHOA 5GJTH 3SY0A 3RWEB 1JBJA 2R0ZH 4P5TD 3BPCA 4X8XA 3SOBL 5GJTL 2VWEE 1T7XA 1KCSH 4RQQB 4NQCA 1MWAH 4OF6A 2RBLA 4F8TA 3KPOA 3DIFB 5DSCA 2O5XH 1MWAL 1NBQA 4CW1B 4XP5H 4DGVH 2P43B 5LGKA 2DWDB 5IVNA 5E8OB 5LCVL 4OQTH 1MHEA 1S7QB 1K8IB 4D8PA 4ZUTB 1E0OB 1G7HA 3HG1E 3SJVB 1WV7T 4IM8A 5ETUA 2PYEB 4DGVL 1H0DB 2X89D 4PRDA 2Z31D 2IAMB 1B6DA 3TVMC 3OMZA 1J1PH 4OQTL 4S1DC 4ZOAA 3GRWH 3MJ7B 1SYVB 4BH7A 3WIFA 1DVFC 3C2AL 1J1PL 3L5WB 1MFBL 3GRWL 3UTSB 3SDXB 1CICA 4F7MB 1F5WA 3CU7A 2QV2A 1YPZA 5KJRH 4FFEX 5KZCD 1S7UB 2Z8SA 5IT2H 3V6FB 5F9AC 1M05B 4S2SB 5KJRL 4LSRH 2CJUL 1RZGB 5IB5A 1FZJA 4XPFH 3IGAB 4KI1A 4WI7A 1JHKH 2HAZA 3NIGF 3QIBD 5INCB 1N8ZA 1M7IA 2GTZA 3QFDB 4UQ2B 3TJEL 4XPFL 3OB8A 1JHKL 2Y7QA 2CQVA 3IDNA 5JDSB 1QTYT 3BWUC 1RQ5A 1YN7A 3C6LA 3JV0A 3WN5C 3V79C 2X1OA 2X42A 3ELAT 3ZDXF 5JXED 1X4YA 2OBGA 2C4XA 1U95A 4XNQA 1U8OA 3D25A 3MOBH 4HLZG 4Y4HD 4OZGE 3WDHA 5IEKA 1BQSA 3L3GA 5FKPA 3U46A 1YMMA 4KUCD 3MOBL 3RL1B 2P8LB 1Y18B 1C12A 2XA8L 2IFFL 1QHPA 1AKJD 4P4RB 1SY6A 2R2CA 1IEHA 3T2QA 3RQ3A 4NUJA 4I2XB 4M6OH 5CBAA 3U0TA 4RRPA 4LRIC 3D0LB 5D4QA 5HYSG 2NY1D 3QI9C 1HZHH 3QJHB 4J3OC 4M6OL 3VRIB 1J1OH 3CZFA 3GMRA 1A6AA 3JTTA 5C9KA 4PS4H 4GW4B 1VA9A 4UT7L 2CKBH 4NBYB 1S9YA 3LQZB 3L3JB 2J8OA 1JF6A 2DQEH 4PS4L 1QLRB 2VE6B 3M1BA 4X4YA 2DBLH 5IHZB 2CKBL 1LE5A 4DKDC 4OCXL 4G6KL 5IVXA 4HUWA 2DQEL 5BQ7A 4PJGB 1H5BA 2DBLL 4NQDB 1JE6A 1XCTB 1PW3A 1AFVH 2GSGA 4HMEA 4LCWE 3G5ZA 4PJIF 5D7JD 5GSVB 4RGND 1EBAA 3FRUB 2DB8A 3IRZA 3M8OL 4U2YA 3TO4C 5FYKD 3R06A 1AFVL 4JQXA 4XVTH 4GS7B 4XRCA 5DUPH 4WU5B 3PWPD 5TQ2H 2ZJSL 5IW1A 2VR4A 4XVTL 2XTJD 2DTSA 4EOWH 2MWCA 4ODUA 5DUPL 5TQ2L 4EN3D 3DVNA 1JHLH 4EOWL 5IB3B 1MCCA 1AJ7L 2YPLB 4X4ZA 4ZO8A 3ARSA 1JHLL 4HPOH 5EOCH 1XCQA 1G7MB 1U58A 3T65A 3REWB 3L1OH 5F7WC 5IF0A 5EOCL 4KAQH 4MDJA 5GRXG 5E8PA 3HPJA 3VGAC 1NC4B 4JY5L 4BSVA 3L1OL 1ZT1B 3UAJD 7FABL 4S1QH 1S3KH 2I60H 4C83B 3RY6A 3GSNB 4S1QL 5TQ0L 4PY7A 3PGDB 1OL0A 3QDJE 4YUEH 1S7TB 4DN3H 3J8F7 5DD5L 3DXAD 1Y6NR 3BH9B 4YUEL 4QHKI 1YY8A 5D7IE 3R0NA 4DN3L 2ZUUA 3GMOA 4KPHL 4HC1A 4KKLD 5FECA 4XMKL 4QEGA 1T5WA 5CILL 2JE8A 1AP2B 2IPTL 3GNMH 3C8HA 3TZVD 2C26A 3GMPB 3H7LA 3MRQB 4JFFE 4WRLA 2YBRA 4LNVA 3QUKA 4FXKB 4ESKA 1NUNB 2Q87A 3DGGA 1DN0B 1FNAA 2AV7A 4LPUA 1NANI 3TBWA 4ZXBA 32C2B 4K94H 5EZJB 5DRXB 1LHZA 1KOAA 3DX8B 4ZMAT 1IRAY 3MODH 3K0WA 3OJ2C 3QO1B 4OZFG 4NZUH 1NBVH 3WMSA 1JYNA 4Y19A 5DK0B 1SQ2N 3MODL 4DKAA 1NBVL 3ARXA 2JIXB 4JZJA 3PXJA 3RZCD 1FFOB 4KHTH 2MQ0A 3MCG1 3T0DA 3U0WH 1KJMA 3FOMB 5FB8B 4OLVH 4KHTL 4N0YH 1SEBA 3U0WL 2AJZA 4X6EB 4OLVL 1J1XH 1T0MA 3MV8E 4N0YL 3PABB 1G6RH 4U4BA 1X5HA 1KF9B 1J1XL 5ESQB 4BELD 1BEYL 1X6LA 2X4QA 4WI5A 5HDBF 2P8MA 2GSIA 4PUBH 4Z7WA 4E5XB 2P5WB 2VABB 4W4OC 5IM7B 5E9DE 2R23B 4OLXH 4QHLB 3AM8A 3PP4H 3CXDH 4PUBL 3KPQA 5EBLA 4OLXL 4GRMA 3PP4L 1X9QA 3P9MB 1HQ4A 2AV1B 1PYWB 2R2BB 3CXDL 3O6LL 4KFZC 4LLVB 3O4OC 4AT6A 5DO2D 1WFNA 3BRGC 5IMOA 3MJ9H 1ZHLA 4XVUC 1HYSD 4PJIB 2CRYA 1Y0LA 2XQBH 5F3HB 2LAAA 3T09A 1MJ7L 3V7AE 3SKOB 3D0VB 5H94B 3OTTA 1VENA 4MHHI 1JWMB 4IRSD 3VFVA 4HKJA 5JXAH 2XQBL 4MXQC 3V52L 3RVVD 4MXVE 4LFHG 1GZQA 2R1YB 3JV6A 5JXAL 3V4VH 3ARWA 3TH4T 2YRLA 3H9HA 3T1FB 1FNEA 5FKAB 4QGYA 4YXHL 5DMIH 5A3ID 3SJVD 3V4VL 2G5BB 2PYED 4MAYA 1MAMH 2IAMD 5KW9H 5E8EA 5J12C 5GZNC 1GC1L 3G5VA 1CGSH 2VQ1B 3M17A 4HQQH 1MAML 1MH5A 1T03H 4PRPA 3UTSD 1CGSL 1LO4L 3AGVA 1OB1B 2Q6WB 2IBZX 4HQQL 3RDTB 1S7XB 3ZYOA 2VZSA 4TQEL 3RIAF 3DUUA 2I25N 1QNZH 5AYQA 1G9EA 1DEEB 1JGEA 3IDMB 5ESVB 1N2RA 1ITCA 1DFBH 4JREB 5E95B 1WIUA 5EA0H 5HI3C 4ZUVB 5C2BH 4ZSOB 3CC5B 4NQEE 4ELMA 3P77A 1DFBL 4WI4A 5EA0L 2X1WL 1NFDA 2H6PB 1KYOK 4LVHB 1KV3A 3G6JF 3QFJB 1IZJA 3AC0A 4NJAL 4H5SA 3WFHB 4X83A 1TJIH 2A9MH 2VXTL 3VFMA 3UPAA 1MOEA 3KLDA 4P5TA 3WKML 3O4LD 4GG8B 4U0RB 4PRHE 2QR0B 1TJIL 2ZG1A 2A9ML 2EIZA 4EQ3A 4L4TE 1QG3A 3NIFE 3FQRB 4J3UA 3DTXA 4FG6C 4ZAKC 5I71B 3LPFA 3QPQD 4X6FA 2FZ3A 3EYVB 3JUZA 4M1GH 5C0EB 3KYMB 2C3XA 1WTGT 4MD0B 1EAPA 4HZLA 4J3XA 1A3RH 4AEIL 5E24E 4LLUA 3QQ3B 1KJ3L 2KUTA 3GGWB 2X89A 3HI5H 4PJAA 5ISZE 2E7CA 2Z31A 5E2TH 1T2XA 1A3RL 2DQIL 4R7DB 1Q72H 5E2TL 4PLNC 2CO7B 3W9DA 2DTML 4XP1L 2AVGA 1HIMH 5I15H 4A6YL 2EDRA 4EBQH 1IMHC 3L5JA 1CE1H 1R3HA 4QRRD 4AL8H 4AEFA 5JW5B 4N8VG 3MYJA 5I15L 2E6JA 1MFEH 3SE4C 3FKUS 4AL8L 3T4YA 3IETA 4NQDD 1PZ5A 1K2DB 2BOBA 1A8JH 1MFEL 2BY2A 2D0GA 3ARBB 4S10A 3QIBA 2D4FA 1IM3B 2CXKA 4XNXH 2A83A 4JM4H 1OP5H 5DD3L 4Q6IA 1I1FA 1OWRM 2M2DA 3SKNA 4CNIA 1RMFH 4XNXL 4JM4L 4X5WB 5LBSH 4BKLB 1K4CA 5SX5H 1HINH 1KJ2B 3LQAH 4R4NC 4N0UE 5FYLH 5JXEA 2CSPA 4XPAH 4NUGH 3P9LA 5LBSL 2HJKB 3L9RB 2OTUA 4KKCD 1A4KA 1HINL 2ITDB 1T6VN 4PJEA 3WS6C 3LQAL 1DQMH 3B9KB 5BJTA 1ZLUH 3MLSH 4NUGL 4XPAL 4Y4HA 2CDGA 4XT1C 4N5UA 3LRGA 4LPVA 1DQML 2HRLA 4JLRA 1U8QA 3MLSL 5HHQA 3W11C 4F80A 1Z2KA 1WAAA 2IH3A 2EECA 1AKJA 3PHQA 5JPMB 5FOBA 1EO7A 4Y4FC 1JNNL 5E00A 1RSFA 1FN4A 4NNYA 1EHAA 1GAFH 3O6FB 4LOUC 4XPHH 5E8DL 4X7SH 5F1KC 1A22B 2AQ1A 2P49B 1GAFL 3VD9A 2APVA 4XPHL 3IXAB 4X7SL 1SVZA 4KJPD 3OKKA 3BRDA 4XZUA 3QULB 4GJTB 3OXSA 1IAKA 4JDVB 3S96B 3P2TA 3RWIA 2I9LB 2P1YA 4LDLB 4NM4H 3MGAA 5IP4A 5EULV 3HG1B 1G7JB 4J4PC 3TBSB 1IGMH 1AXSB 5F8RC 4PGDB 4NM4L 1HK6A 3T3PE 3SO3C 5GRYA 5TE7H 1IGML 3FQNA 5D7JA 3BPLB 2IMNA 4TOYL 1F3JA 3ULSA 2HVJB 3IFPB 4IMKC 4DFIA 1OGTA 3QHZH 3AS2A 3SGKC 5D7IF 4EI5B 4GG6A 2HYMA 3PWPA 4TNVK 3KLAB 4PJFA 1B0RA 4MQXD 3D1MC 2VN4A 3G6JB 1T21A 3QHZL 3FT4A 2AQ3A 4BM7A 4EN3A 3S36H 2CRZA 2VLMD 4EDXB 4YHIA 1X6NA 3D18B 1UT9A 2H3NA 5T5FL 3S36L 2J88H 1AE6L 1I85A 1QQDB 1PD6A 4D9QE 2JIXD 1EFQA 4Z18A 5GGQL 3PP3H 2ATPB 1JYVA 5DRWB 5HYJD 2H41A 2J88L 4AEEA 4RIRB 4K94C 1KPRB 1T2QH 5FYKU 5KSAB 3T0ED 1BOGA 4OCSL 1HHKB 4LSUH 2Z35B 2F5AL 3MLRH 2AXGA 1KACB 4U1MA 3EO0B 1T2QL 2XQYG 1MAKA 5T3XL 3LKNB 2JCCE 2G75A 3ZKSD 3QA3A 1QBBA 3STLB 3MLRL 1P5VA 2NY2D 5DK3A 2C1OB 3BW9B 3T4AA 2IALA 3KDMB 1R3KB 2P5WD 3HKFA 5GGRA 2YXMA 2J7LA 3D2UD 2B0SH 3DXAA 5D5MA 4G6FB 4MD4A 1JIBA 1NCWL 1SY6H 3EOAA 4R7NB 4EUPB 1JHTA 4AIXA 4F9LA 5GS1B 4NWUH 3V9FA 5FA4A 2B0SL 2HFFB 5L6YH 1SY6L 1QO3A 3QHFL 4U1SB 5C0AD 2H8PA 3TZVA 3EFFA 3ZMRA 4HXBH 3FTGB 1LQSR 3DO7A 1FP5A 4PJ8B 1QBLL 3ZKXC 3HFMH 5EU3A 4X5XA 2AEWA 4HXBL 2ZNXA 5MEOB 4LVEA 4POZC 4S0UC 2ZCLH 2KL6A 4NQUA 3UZQA 3C6SA 2V2WB 2ZCLL 3VG9B 2VXUH 1YN6A 4U2ZA 4LCWB 3C5ZB 2ZOLA 3ALXA 4Z5RA 1FL6A 5D1QB 3GMMB 3UBXB 4XCFH 4WWID 2WWKT 4KWUA 1ZV5A 3IAGC 2A74B 4WV1A 2Q8BH 3FN9A 3QBTB 5I30L 4Q9RL 4XCFL 2H9GB 3VXSB 3EYOB 5D2LE 2IF7A 2I5YH 4LP5A 5TFSH 2VYRE 4H25B 4YAQB 1MLBA 4GAGH 4L9LC 2DD8H 3K8KA 4RMUA 3PL6B 4WO4B 5EUOB 4HFWB 5IFJB 2PXYB 4MWFB 4HUKB 5HHMB 5GGVH 1CU4H 2PO6C 1KGCD 3F7PC 2HJLB 2EDKA 4GAGL 4ZYKB 2A73B 1NL0H 3RX5A 3SGEI 3B6SB 3VD4A 4BH8A 4NYLB 5GGVL 1CU4L 3BPNC 2ARJQ 2FO4B 1I1RA 1TNNA 1J0KA 1NL0L 5EORL 4ONHA 1FYTD 4TTDD 5FIEA 4D0BB 2NY4B 3D3VE 1FFNA 5ITFA 3PQYD 4QKXB 2F74B 4EDWH 3DSNA 2BVPA 4UAOC 3B8YA 2VLJA 4P5KA 3QFJD 1I8MA 2FJFA 4HT1H 3MV9E 4EDWL 4PBXA 3RWEA 4CJ0A 1ZVSB 5I74C 2UYLB 3JBG7 4LMQI 4HT1L 2BJMH 2XXMB 3ZE1E 4M7LH 3TFKD 1JWSB 2J1KA 4HUVB 4RQQA 1I1CA 5DT1L 2BJML 4KVCL 3QQNA 3CH1B 4M7LL 5D7IB 3CPLB 1NPUA 5ESAB 5J6HB 1IC5L 4HC1H 3S97C 2AJUH 4JPWL 2DWDA 1B4JH 4JFDE 4U1GC 3TYGH 4M00A 5E8OA 1MFCL 1U92A 1S7QA 1ZVYA 1K8IA 4ZUTA 4OCNC 4HC1L 3SJVA 1QACA 2AJUL 5I1LB 2PYEA 4PJBF 1H0DA 5CWSB 4G7VH 1B4JL 3TYGL 2IAMA 3NIFF 5A2LH 3SPVB 2R9HD 3IFNL 3MJ7A 3QXVA 4RGOL 3K4DA 1SYVA 2Y5TA 1MCQA 2ORBH 5DDHB 4EVNB 5J1AB 3CFCH 3RY4A 3FT3B 3L5WA 1UQSA 3EHBC 5JLZB 1KEGL 3EDDA 2XWBB 3UTSA 3SDXA 3B9DA 4F7MA 5IFAH 2ORBL 1AIFB 3IJYB 4NO3A 4GKNB 1NUFA 1PKQB 4LSSH 5C0FB 3O3AB 1I3VA 4S2SA 4AQOA 2CRMA 2EXYD 1AGFB 1RZGA 4YWGL 1UM6H 4LSSL 1WFTA 4QLRA 1HNFA 3QSKB 1TVHB 3F65A 1DANU 3QFDA 1UM6L 4UQ2A 4DVRL 1KN2H 1TQCC 2Q3AA 4WI9A 3KXFB 1YEIL 1IGFH 3U9PL 5JDSA 3V7MA 2ZPKH 1KN2L 3MV8B 3E3QE 4Q9QH 3V8OA 1IGFL 1MF2H 4KRPB 3O4LA 4Q9QL 5GRVL 1CXLA 2ITCB 4N0CC 3B9KD 1T83C 1MF2L 5CJOH 1YJDH 5E9DB 2XKSA 4AIZA 5KTEH 1IGYB 1I8LA 3VFGH 1H8OA 1MCSA 2BXYA 5CJOL 1YJDL 2VRAA 3PE9A 2P8LA 1Y18A 4DEPB 4N0RA 3FB8B 5MI0C 4P4RA 3LQAC 4OTXH 5JIIA 1QPPA 2BDNH 2X70B 1B6UA 4FQCH 4I2XA 3O6FD 4OTXL 5IG7A 2CMRH 3D0LA 3I6LE 2HA1A 1I7TB 3QJHA 4FQCL 1K3ZA 2QHRH 3IVKB 4ZNEE 2CMRL 1HKFA 2GFBB 1J0JA 2ILLA 2WLZA 3QDME 1ZT7B 3BIAX 5T1KD 3LQZA 3L3JA 1MCLA 2R2EB 1GGCH 4QRRA 1QLRA 4K7PL 1K6QH 1AQDB 3LKOB 1IQDB 2WP3T 2YRPA 1KCVH 5HHXH 4PJGA 3GMLB 4NQDA 2LU3A 1XCTA 1MCBA 2CH8A 4HBQA 3LVEA 1DUYB 1XF1A 3CFEB 3QEQD 5DD0L 5SX4H 3BQUB 5HDQH 4K7FB 4RAUA 4Z8FH 3FRUA 4YX2H 2Q3ZA 1O7VA 4Y16C 2R8SH 2NNAB 5CEYB 1RUMH 4XXDB 4YH6A 3BGFC 5HDQL 2EC8A 4WU5A 4PJXE 4IHOB 4PGEA 4QRTB 4HXAH 5EO0B 5CEZE 3AMKA 2DQDH 1BX2B 3VFWB 2OP4H 3PJSB 1CTNA 1MJUH 3IDXL 3O3EB 2Y25A 4HXAL 4QRQA 1FSKB 1RJLA 4O9HH 3PV7A 2DQDL 4I48B 2OP4L 1CICC 3BEVA 1QVOB 3CLEH 1IC7H 3LB6C 4O2FB 1TCRB 3T0XA 4O9HL 1HKLH 5BMFH 4ODVL 3NGBB 5IHLB 1C8PA 4Q74A 1DJSA 3MRBB 4YK4B 1AD0B 1IC7L 4QRPD 2C4FT 1N64H 4JO3H 4MB5A 1H8NA 1HKLL 5IQ9A 3CFDA 4JM2D 4NSKB 3QYCA 5E4EB 3L5XH 1T1ZB 3MLWL 4KROD 3BP5B 4NM8H 4YHNB 4PRHB 1ZT1A 3EYUH 1N64L 1DE4A 4PJBB 3U30C 4L4TB 3LKSB 4C83A 4Q97A 1UACH 3L5XL 5E6ID 1I75A 3GSNA 3OXRB 5AAWA 5EWIH 1S7TA 5ICXB 3VFRA 3C6LC 1M1SA 2FL5B 5CZXD 4G6FD 3BH9A 3H0TA 5EWIL 3LH2H 3L3OB 3TT3H 2JCCF 5FO9B 5ISZB 4OSUH 5B38B 2H2PC 3G6DH 3LH2L 4PGJA 4HPYH 3TT3L 3WNKA 2I27N 4HMDA 4PRID 2FIRT 5ELIA 1N6QH 4OSUL 5CSZB 4GXVL 3GMPA 3K3QA 1I4FB 3MRQA 3BUTA 3G6DL 4HPYL 3R8BB 2IPUK 3U6RB 3N0PB 4FXKA 4PJ8D 2J8UE 1A7QL 3UCRA 1W0YT 1OAZH 3AXLA 1RK1B 4GRWH 2FH6A 32C2A 3A6CH 4K3JH 4TVPD 5EZJA 3U4EA 4MXWH 3NMEA 4PLJD 1LEIB 2D2OA 2X9WA 5FYJE 4AZ8A 1K5NB 1OAZL 3DX8A 2BCKB 3A6CL 4WWKB 1KLUB 4K3JL 3KPLB 2EEBA 5IBUB 5J9PA 5HGDB 4YBHA 2IG2H 3C5ZD 4MS8D 2JIXA 2X4SB 4MNHB 1FFOA 1J0IA 2IG2L 1L9NA 5HYJA 3FOMA 4WW2F 5FB8A 1WZMA 3VXSD 3T0EA 3Q6GH 3PWNA 5FCUH 4PJ5E 4N0UB 4I3RH 1J86A 3H6JA 4K71C 4X6EA 2WW8A 3B2VL 3ULUE 1UWXH 4WO4D 3Q6GL 5HHMD 1RPQA 1X3DA 3AAZA 1A7NH 1CDJA 3S7GA 1UXWB 5ESQA 2GK0B 4OFIA 4JQXC 4LSPH 3O0RH 4E5XA 1A7NL 2P5WA 5D2LF 2VABA 4NP4H 5IM7A 2HT4C 2WIIB 1GYAA 3HAEH 4NQSB 3D2UA 2CO6B 4LSPL 2VH5H 2DWEB 4NP4L 4UT6L 2Y6SD 1PX4A 5L2KE 3P9MA 2AV1A 1PYWA 2R2BA 4K8RD 4LLVA 5EIVA 1UEMA 5LGJB 3H3PH 5JZ7D 1NMBH 3WNLA 5GJSH 4Z9KB 2DAVA 4W6YB 2A6DB 3NFSL 3H3PL 1KENH 1NMBL 3D0VA 3MLTB 5GJSL 5KSUB 5KBNC 1JWMA 1IAIH 5CLTA 2FX7H 1KENL 4H1LH 4N90E 1OAXL 2BSED 1CDUA 1FZKB 1ORQB 5ERWB 4KXZI 2OMNA 2FX7L 2W0LA 3K4AA 3OHXB 3T1FA 4MJ2A 1HH6B 3RY6C 5FKAA 3ZE1F 3EJYD 3AU1A 1NCTA 1DBKH 1JV5B 2F53B 3EZ8A 1NGQH 2VQ1A 3LCYA 1NGWB 4FQIH 4X8JB 1I7ZB 1UZ8A 5I75B 1DBKL 3V4PH 3PDDA 5FYKL 3UYRL 3TEUA 1OB1A 4FQIL 2ICWB 2Q6WA 3O45B 3RDTA 1S7XA 2X7LB 5FUCC 1NMAH 3V4PL 2VISB 1E4XL 5DUMH 4IIQC 4UDTB 1DEEA 4KUZH 1NMAL 2WANA 3IDMA 5DUML 2ZG3A 4JZNB 3ZO0A 12E8H 4AIOA 1JPSL 4DVBA 3MV01 4ZSOA 3CC5A 4R9HA 5I73B 4RGMC 1FYTA 2GAZB 3T2PA 1CIUA 3KXFD 2IBBA 2H6PA 2X5PA 2IQ9H 4P5MA 2ZOKB 4BQ6A 1QR1B 3QFJA 2JCCB 5IVZB 5FGCB 3WFHA 2IQ9L 3I2CH 1KLGB 1IJ9A 4GG8A 4JZJC 2BVQB 4CVZA 2QR0A 3TFKA 2Q7YB 3I2CL 5DZLA 4CU6A 1D3CA 3FQRA 2CLRB 4HK3N 5E99H 4JY6B 1EJOH 2VDMH 1P7HL 1ERNA 5E99L 3ZTJH 4XBPB 1EJOL 3EYVA 3KPTA 4QCIB 2VDML 5J13B 5SWSE 5C0EA 5J11B 1YECL 3KJ4B 2DIBA 3GIZH 3MOQA 3O3UN 1MCOH 1CT8B 5F9JB 3QQ3A 4RMVA 3GGWA 1NGYB 4P3DB 1OP5K 5A43C 3QIUD 1YJDC 3GIZL 1MCOL 1WUNT 4ONGL 2FEDD 5FA3B 3AM8C 2I9TB 4R7DA 2YD4A 1T1YA 4U3XA 2XY1A 3N1PC 5SX5K 2ZCKL 3PWJB 3UJIH 4WW2B 3MACH 2E27H 4P2RE 1VADB 1FZOB 5JW5A 4LAQL 3EZJB 1UM4H 2BNRE 3MLZH 2E27L 1ZLUK 3VGEA 3UYOD 1AGEA 4MA8L 1K2DA 1EV2E 3MLZL 2M26A 1E4KA 2NY6C 1NUGA 1IM3A 2HVKB 3BQUD 2AABH 5D2LB 1W8NA 1TJHH 1CD9B 1UGNA 5DXWA 1EO8H