3P4OA

Crystal structure of h2-kb in complex with the mutant np205-lcmv-v3a epitope ytakypnl, an 8-mer modified peptide from the lcmv
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
278
structure length
278
Chain Sequence
b'MGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4oA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3p4oA01
5ESAB 3WFDL 1DN0A 2F19L 2WANA 4NHCH 2Y7QB 2W0LA 1U8QB 1MCHA 1GGCL 2EKSA 4BSJA 4O2EA 4U0QB 4LLDA 1G7MB 4OFYA 1T5XA 3LV3A 3CSGA 5HGAB 1FZKB 1V7NL 1K9TA 1OTSD 5D6DA 2Z91A 3QIWD 3ZDZE 4WW2A 1H8SA 1TMCA 4QRRA 1FPTH 2PXYD 2WLYA 1WBXA 4PD4K 3TO4D 2FRGP 35C8H 3GSUA 3GRWH 2A0LD 2XFXA 3MRPA 2D2OA 1T1ZB 4HS8L 4ZFGL 4MGXA 4X4XB 4M7LL 3OJVC 3HR5B 3W5NA 4YDJB 4KUZL 2K9UA 5DD6A 5BRZB 4UNUA 4NHCL 4R9HA 5EULV 4I2XA 2DQGH 1I8IA 2XQYK 3V9FA 5KG9A 4N0UB 1UQSB 2J6EA 1MEXH 5SWZB 3WN5B 1T2QH 3GK8H 3CVHB 3RTQA 5MEOB 2X9XA 1FQ9C 4G7VH 5IB1B 1TQCB 1FPTL 5BZDB 4F7PA 2APWA 5IBUB 1I4FB 3U0PB 1P4LB 5HSFA 2KUTA 5F7YC 35C8L 1FNEA 4MNQE 4RA3A 5IR1A 3IS0X 4PP2B 2ESVE 2X42A 3P9LA 5I8KL 3S6CA 3GSNH 4AIOA 3RJDA 1QQDA 1FP5A 5DK2B 3CLFH 4JGJA 3QAZC 2HTLC 3THMH 5EIQA 5CZXD 3EIFA 3FCTB 1K4CB 4PGBB 1F6LL 2FGWH 3RU8H 2DQGL 4JFHD 2F74B 1A1MB 2HFFB 3O4LB 3HZKA 1S7WB 2VOTA 3ZHKA 4PJ5B 3X11B 1ZMYA 1CG9B 4PJAA 4QOKA 1LHZA 1QR1B 1MEXL 1T2QL 3FO1B 5IFJA 4YO0A 4DQOH 3MCLH 4KKCC 5JR1L 4G7VL 4XB7A 5FOBB 1SYSA 4NQEE 1DSFH 4PRAA 5AUMB 3FMGH 4R3SA 4L3EA 3VGAB 5E8EB 1FGVH 5SX4H 2YRPA 3CLFL 3IKCB 3THML 3RWDB 4QHNB 2IPUK 1XT5A 3SGEI 1GYAA 4EI5C 1AQDA 1OTUC 1N3NB 3FFCA 2FGWL 3FB7B 3L3GB 2H2PC 3RU8L 3MUJA 3QJHB 4PLKD 3B5TA 1G7PB 1T0NA 3EYOA 1H3VA 4Y2DB 3RL1A 2BVOB 5EOCJ 1RMFH 1MHEB 1KJVB 1BVLB 1XMWA 5JPMB 5LWYH 3WMSA 2BSTA 1UM6H 1ZWIA 5JW5A 3MCLL 3MJ9H 3ARYA 3QDGB 5IJKC 3QPQC 1DSFL 4JZOB 3FMGL 4JHZA 1YEIH 1FGVL 3BKMH 5MERB 1LP9E 5DJ6A 2E7HA 4M6AA 2DQEH 4PJHA 1ZS8B 5FGRA 4XCYA 3T65B 1U93A 4NRXB 2BRQA 1ZVHA 2KZ1B 2IADB 4XBGB 4JRXA 3PWJA 2UWEA 3EJZD 3WHXB 3WN5C 5IOPA 1RMFL 3RY5A 3UPCA 5I2IB 1XGYH 5TDPB 5LWYL 1CS6A 1TQCC 1UM6L 5IFAL 2G5BB 3QXTA 5DRWB 2XTJB 2XKUA 1WWBX 4HLJA 4NQXB 3BEWB 5JORA 3MJ9L 1GGYA 1IVLA 4DOHE 3QDMA 4Z7VE 1XCTB 4A6YH 4PJFA 1WLHA 5KSBA 3C6LD 3LKRB 3SDXB 1YEIL 2R69H 4HQQH 3TCLB 3G5XA 4HZAA 3BKML 4Q6IA 3TF7A 3FFDA 5JOPD 1K5NA 4LCCB 4LSTL 4CMMB 2DQEL 3O2DH 4H20L 4MVBC 5DDHA 2JJTC 4PP1D 2OTWA 4OAWA 4LNVA 5I1EH 1YEDB 2LU3A 3F12A 4D0CB 1QRNA 3NCYS 1L0YA 4PBWD 3JV6A 4ENED 3L3IA 2DB8A 5I73B 3GFUA 3AS0A 3VRLE 1UADC 1XGYL 2RB8A 4X8JA 5D7IF 5F7WC 4HH8A 2OSLB 5T5NF 3ARDA 4U0RB 3WXVH 3VGAC 1S7RA 3DROB 4JZJB 4A6YL 2EZ0C 3MRNA 4JN2A 3OWEA 2R69L 3H0TA 4HQQL 5E2UH 4RNRA 1X4YA 2ZSWA 3O2DL 2Q7YB 5DQ9B 5EUOB 1AKJD 4Y2DC 4EOWH 2V7HB 2OBGA 5I1EL 1FJ1A 4A2LA 4MSWA 1I3RB 3JXAA 3MBED 4WTXA 5HHNB 3F65A 3KYMA 4C83B 2CDEA 2DM4A 3WD5H 2YRLA 1KB5B 4UDUB 2JE8A 3PIQB 4OCSH 3HG1E 2BMKB 1IGYB 2AVGA 3MNZA 5E24E 2CSPA 3L3JA 3SDDA 3L5XH 3L3OA 2V9QA 4LDLB 5I9QB 3I50H 4J3SA 5C09E 3GI9H 3QULB 1VDGA 4MD4A 1XF1A 1NANI 2PO6C 4PGCA 2L0DA 2NXYD 3UTSB 2XYCA 5CMAA 3RAJH 5E2UL 4HK3J 2R39A 1HHKB 1KSRA 1KCUH 2X70B 3K8LA 5T5NG 2EYTB 4EOWL 1HHHB 1IL1A 1D5ZB 1QSFA 4OCYL 2YHGA 1DVFB 1VFAA 3WLBB 2VDOH 4LBEA 2PYED 2XTJC 4TUJA 4ZUUB 2EE6A 3WD5L 1LO5A 2ED8A 2D7PA 3C6SB 2NW3A 1T1WA 5J4MA 1S78C 2WP3T 3O11A 3L5XL 4E9LA 3QIBA 4LVOC 3I50L 4DZ8A 4XI5C 1ZA3A 5INCA 4LPUA 1X6LA 1U8JB 4LCCC 5AZEH 1CTNA 3OGCA 4P2RB 43CAB 1J8HB 3NZ8B 4L4TA 5K9QI 4L8DA 2AJUH 3PP3H 4K7PY 3X3GH 1KCUL 1YMMA 4MYWB 2WINB 3CC5A 5KOMC 4YHNA 5IB4B 2YD6A 1YN7A 1T04B 2FH8A 4HAGA 4UOW1 5T1LB 4QTIL 1JFMA 1ZT4A 1OCWL 4BM7A 5HBBA 2EH8H 5HHPB 5IROC 2DRUA 1S8DB 1PKQB 5EPMA 5C0DA 2MMXA 4Z7UB 3CZJA 1WCBA 1IKNA 4U0RC 5DJXA 1I3GH 1L4IA 4DCQA 3QO0B 4U1GC 3WL9B 1CCZA 1NCAH 4JAMA 5CEYA 5K33A 4U1MA 1N59A 1T4KA 3K1DA 3OXSB 4HKJA 5KSAD 3VXRB 5AZEL 5E2WH 1HH9A 4ELMB 5DMJB 3QUXB 3WXWH 2LVEA 3P0VH 1R5IB 2P24A 3FZUC 3T4AA 2AJUL 3E2HA 3MROA 2CKBH 2YD2A 1DE4A 3M17A 3X3GL 2VUYA 5D7SL 1FFNA 1N7MH 1Q1JH 3FTGA 1S9WB 2BVQB 3X14A 4G8IA 3EGSB 2GY5A 4L8SC 3AS3A 3LKNA 2EH8L 2V5MA 4RWYH 4ZTPH 3LDBB 4QCIA 1T21B 4B53A 2ZSVA 4ODWA 3GMQA 4Z76A 1AGBB 1OAKH 2NZ9C 5I9QC 3W81A 1ACZA 2ZUUA 5J57B 1KXQE 1B6UA 5EBWA 2EDRA 1G0DA 3OL2A 2DM3A 4K3DH 2NTFA 3JZ7A 5EN2B 2ZJSH 4K8RD 3I6GA 1PZ5A 2RJMA 2X4PB 3MCG1 5HD8C 1AE6L 5F1IA 1F3JA 5E2WL 4IDLA 3WXWL 4TSBH 1HIMH 3P0VL 2W59A 4LMQE 5EC1A 3QZWA 5D2LE 3IDUA 2WIMA 2X41A 4R0LA 5D2NC 3W0WB 5GRXG 5GRUH 1N7ML 1Q0XH 3FB8A 3KPLA 5JQ6H 5EU3A 1Q1JL 1DVFC 4H5SB 5EBMA 4EXPX 3X17A 3KPPA 1E4WH 3WS3A 3Q5TA 4RWYL 1F3DH 4ZTPL 1CLZH 1RJLA 2GK2A 4I3SH 2NY5C 2YMXL 1YEJH 4HWZA 4PR5B 1OAKL 3VW3H 5E00B 4YDVB 2PR4H 2NTSP 4JFYA 2A6IA 4XPBH 3RUGB 2E8ZA 1UH3A 4K3DL 3RI5F 2ZJSL 4CU6A 3SGEH 1VHPA 2P1YA 4CMHB 1NJ9B 1PYWA 4OLWH 5D5ME 4FFZH 4P4KD 4IRJB 4TSBL 1HIML 3RGVC 1T6WA 2IANB 1TIUA 3K81A 2DJ4A 3O9WA 1X5HA 4N9OB 4NQSA 4PJIB 3S37H 4Y5YB 2EO9A 3HZYB 2Y5TB 3SKOB 1Q0XL 1AHWB 2A38A 2B2XH 4JM2F 5JQ6L 2AK4A 3PWNA 1U91B 5A2LH 1TNMA 3U0TA 1E4WL 5DJCB 2FJGB 4Z7WB 5DJDB 3P3YA 1CLZL 3GM0A 3ARBA 4I3SL 1YEJL 3VW3L 1CI5A 5ITFA 3HUJF 1F6AB 3D25A 3QI9D 2PR4L 3LQZB 5D7JD 2W60A 4JFZH 4ODXA 1XZ0A 4XPBL 4YX2L 4QRSA 1BJ1J 1CXIA 1NQBA 3QUXC 1IRAY 3FQTA 4TYUA 4P57A 3FB5B 4KKAC 4OLWL 2XG5A 1NBZB 4LPYA 4FFZL 1H5BA 2X10A 3BDBA 1PBYA 3S37L 4OKVA 4U1LA 4EZMA 1UH2A 1ZA6A 4JFXB 3TC9A 2B2XL 3DNKA 3LDBC 1SJHA 4ZUVA 2OYPA 3VGHA 1MWAB 4ZSOE 4GAYA 4XP5H 1NMBH 1CGSH 3B2VH 3MYZA 4PJ8D 5A16B 3S35H 3WIFA 1C5CH 3A6CL 4YFDB 1R3IL 4LHUG 4Q6YA 2HG5A 1NL0H 5ADOH 1PQZB 4JFZL 2VL4A 4LOUC 2CK2A 3LRSB 3AROA 4G8GA 5DR5H 3NIDF 5MHSD 4R97B 2CDGB 2MJWA 2YOCA 3ZKMC 4GKNA 5KOVC 1UG9A 3DETD 4LLYB 3AU1A 2CLVA 1IC4H 5DMIH 1QZ1A 3IFNH 3WFCH 1PEZA 1OAQH 2AV7B 4PGDA 5JW4M 3MLSH 3KR3H 4C59B 5IK3B 1UEMA 2EYSA 2OJZH 5HDLA 5F9WB 1NMBL 1XGUB 3UTZA 1CGSL 3B2VL 3S35L 1JHKH 1C5CL 2DWDA 1H3GA 5CIPA 3SE3C 2K3TA 3QFJD 1NL0L 4YE4H 2ICES 3DGGA 5ADOL 2G2RA 4CMHC 3GIVA 3D2UB 4WJ5A 3DUSA 3VGBA 3MV9A 4ZXBB 3S97C 4IRJC 4NN6B 3TIEB 5DR5L 3UJIL 2FSEB 3KS0H 1QEWB 4Y5YC 3RHWK 3D39D 3DO7B 1KPVA 1DUYB 1AHWC 4U7MA 1QHOA 3LS5L 3ESVF 2IAMD 4NHUA 1IC4L 5EU5A 5DMIL 3UYPA 3IFNL 3Q3GA 3QO1A 3WFCL 2NLJB 4TSCL 1OAQL 1KIQB 3HTLX 4JANB 2PXYB 3MLSL 4LIQH 3KR3L 4U1NB 1S9YB 3CFBA 3TO4B 2OJZL 3OKNB 5E03A 4NM4H 3VXMA 3CVIH 3D39E 3KPTA 1A9EB 3ECBB 5ADPH 4MCYB 4YE4L 1AJ7H 1P6AB 4D9LH 1B2WH 4GG8B 2A74B 1YC8A 5CHNB 3WNKA 3I02B 4D8PA 3HI6H 4OF7A 4QGTA 1KOAA 5IWLA 5LVEA 1R6VA 4MNQB 4OIAA 1KCRH 4DFIA 2ESVB 4XXDA 3C8KB 1WAAE 1GZPA 1HYRC 5JW3H 4BQ6A 3QISA 4UT9H 2VN4A 3BT2H 1CGXA 4H1LA 4LIQL 3U79A 2HFGH 1IARB 2FECL 4XBEH 7FABL 1H9VA 4NM4L 3QG6B 1T6VN 4UOJA 3OXRA 3RWEB 3G04A 5I6XB 3QJFA 4ODTH 2P4AB 1D9KA 5CINH 4FABH 5ADPL 1V7ML 2WK2A 3L9RA 5HHOA 3RBGA 5BOZG 2XIDA 2BOCB 4D9LL 3CSBA 1J0IA 1B2WL 5DD1H 3HUJE 4HIXH 4NC2B 4R97C 4MCZA 3ZLQC 5FYJD 4NQEB 5DLMH 2BFVH 4D0DB 1D5MA 1NFKA 4W6WB 5CWSB 3KDMA 2Z8SA 3FQXB 3TPUA 2EICA 1KCRL 2D7NA 4LLUA 3BRDA 4NKMA 1M1SA 4Z77B 1KPUA 4EUPA 4FQXD 5L2JB 3MRBA 5H2BA 5JW3L 4C57C 1HQRA 5DK0A 4UTAH 4UT9L 4MDJA 2ZZUT 4KKLC 4OZGE 3DBXA 1BFSA 3BT2L 1P7KB 4ZUTB 1QSVA 2HFGL 2Y25A 3VD3A 1TETH 1HQ4B 3DV6A 3PWPA 3QEQE 4U6YA 5DMKA 1FH5H 2FYYA 4N68A 5E2TH 1P84K 4ODTL 1A4KB 3OKLA 5CINL 4FABL 1JPFB 3VRJB 5HYQA 3GI8H 1QOKA 4G59A 4ZXBC 4I0PA 1WCQA 1XF5A 1ZLUK 4XPTH 2X89D 5DD1L 5JLZB 1BOGB 4HIXL 3U36A 3GMLA 5DLML 1Q9OA 4NIKB 2BFVL 3GSWA 2HWZH 3BP5A 3BD3A 4HUWA 4ZFZA 3QIUA 4ISVB 2AJSL 1OAUH 2Z92A 3DECA 4YEFA 1LP9B 2LTQB 1LNUA 1ORSA 1UCTA 4J3XA 4UTAL 2VLMD 4LRIA 1YA5A 4MJ6B 1AGEA 4I77H 1FZOB 5B21A 3ZDYE 1SJXA 1TETL 2W92A 3D1MC 3SDCB 3ULUE 4KU1A 1W0WA 4MB4A 1FH5L 4EN3D 4S10A 1YJDH 3MV7E 3GI8L 2P5WD 4OFPA 5GGUB 2VLME 3BZ4A 3IJYB 4XPTL 1WZKA 5EFIA 4DOHB 4Z7VB 1L9NA 4IMLB 1U92A 3I75A 5IVZA 2HWZL 4FQQB 3SPVA 3H7BB 5IW1B 5C9JA 2L4OA 2WWKO 3KPRA 2QADD 1PLGH 1OAUL 2BNRA 1KIPA 5J06A 1ED3B 1FFOB 3JWOC 4ODHH 1CFQB 2Z4QA 3ZKNC 2CLZB 4KJQD 1FL5B 4WW2F 3QDAA 4I77L 3P4OB 4J3OC 2BSED 5I6XC 4HV8B 3C6LB 1U36A 4Y4KA 1F3RB 3EYQC 4X0KA 4LFHD 3QRGH 5D1XA 1QFWI 1E6JH 1YJDL 3V6OA 5I0ZA 4YZFF 4EXKA 3BPNC 4BQCA 4JQVC 3FJTA 5EA0L 3JUZA 2EXWD 4K2UH 4X4ZA 5DHVB 1ZHKA 4F3FA 1INQB 3LN5A 2A73B 1JMXA 4XWOD 1A6VH 3RVUD 4WTWA 1E4XI 3SKJL 3UBXA 4JO4L 4DKEH 3I3BA 2A1WH 1PLGL 2XZAH 5E5UB 4KUCD 1XF3A 4ODHL 1P7QD 2R2EA 3ARXA 1I1YB 1X5ZA 4CDHA 5F9OH 4U33A 1UT9A 3BH8B 1CGUA 1JN6B 2E6PA 4EBQH 5JO5B 5T1KD 1RIHH 3VG9B 2VLLA 4NCC2 4OCLC 4BK5A 5FXCH 3P9WB 3QRGL 5J12B 1JF6A 1E6JL 2VB5A 4AT6A 5J11C 4Q74A 4OUOA 4POZD 3RZCD 4X6DE 3TZVD 5MENE 2A6DA 4HPOH 4OI9A 3VMNA 4HULB 1CFSB 3ARFC 4K2UL 3RRQA 4PB0H 3BP6A 4OIIH 3A67L 1PX3A 2DQHH 4FTVA 4NUJA 1JPSH 5GXBB 2NY3D 3DIFB 4DKEL 4XNQB 1CE6B 4HKBA 4C4KT 2A1WL 2Z93B 1I7ZB 4TPRH 3CZFA 5CSZA 1I7TB 4PJAF 1QLRA 3FQNB 3MUZ1 3SDCC 5F9OL 5IGXH 1B6DA 3EBAA 3M8OH 3EDEA 3O3EA 2CRIA 2VXTL 1R3JA 1MLCB 4XX1G 3T4YB 2NXYB 1CGVA 4LQFH 2DWEA 5ELIA 5KAQG 3L3DA 4H88H 4EBQL 1RZ8A 1FAKT 1RIHL 2XZZA 1EGJH 4JLRA 3C60A 5E95B 3OGOE 4ZO9A 5IQ9A 4U1HA 5EORL 1EVTC 4L4VE 1CDIA 2PF6A 4HLZG 4HPOL 3JV4A 3D18B 1MCOH 1VFBA 1ZK9A 4PB0L 3O8XC 2YD1A 4NCC1 3SOBL 3TBTB 4NWTH 5B3NA 2DQHL 1LO2H 4L5FH 1PX4A 3TNMA 1JPSL 5D7KD 4KRMB 2H45A 3WIIH 2FR4A 3T0EA 4MDIA 3ROOB 4MJIE 4TPRL 1XGTA 4C56E 4PRHA 3QNYA 5D6CB 2NX5D 5TQ2H 3QYCA 5IGXL 2AXGB 1HWGB 1WBZA 5EBLB 4LL9A 5HJ3B 4LQFL 1KIRA 5C0NC 4JFPA 4CVZA 4YHKH 1EGJL 1OW0C 4AH2A 3S36H 1IT9H 1OT2A 3MTRA 1RUPL 4N0YH 1FSKB 4KROD 5EUKA 1MUJB 5I15H 2ATKB 3KXFD 4OZFH 4QRPA 4JHAH 3FQUA 4PJHF 5GGSA 1MCOL 4BH7A 2W9DL 4NKDB 4WU7B 4MJ5A 3CUPA 1JPGA 4WGWB 4CBPA 3MUGB 4NWTL 4MMZC 3T3MF 1LO2L 4L5FL 3QCTH 4QTHA 2UWEF 3NN8B 1OP3K 2W0KA 3MLTB 2G75A 4G43A 5DJAA 2DOCA 1BZ9B 1MFNA 2ICWA 5TQ2L 3MUY1 4E41E 5FA4A 2DLHA 1NBYA 3VG9C 3G08A 4OZHE 4XHQA 4P46D 2EDTA 3KPNA 5IEHB 5IP4A 4JCMA 5J12C 5KSAB 1VERA 3IJHB 4QRRE 1WIOA 4PJFF 3S5LB 3MUHL 4YHKL 5EZJB 3FT3B 1IT9L 2P44B 4WY7L 1DDHB 4K7PH 4N0YL 4YDKH 3TH3T 3IFPA 5I15L 4WFFE 4JHAL 1NKRA 1RZGB 1OP3H 1P5UA 5HI3C 2VDPH 3BUYB 2VQ1B 4XX1E 1PGRB 1VESA 1NAMB 4S0TD 4BK4A 1AR1D 5EO9B 3RNQA 3QCTL 3MJ7A 3UMTA 2L7UA 5DQDH 3SCMD 5TF1H 5CJBA 3BKYH 4HW6A 3P11H 3BPOC 5I8CA 3MGAA 4HKZA 1JZ5A 4WI7A 4AMKH 1AI1H 5E9DD 5D1ZD 2I07B 1AXSA 4HJ0C 4KC3B 3PF2A 1J7VR 4DKAA 3K4ZA 1K3IA 2C3WA 5C9KA 3GNMH 1I1CA 1OWRM 1NEZB 3G9AB 4QRTB 4YDKL 1FL3A 4RDQF 2BNQE 3TVMD 4GQ9H 3IDXH 1G6RA 5KBNC 3MRRB 2IBGA 1CFBA 2VDPL 4M48H 4N0CD 2DQFB 5BVJB 3H9ZA 4MNHA 3ZZ1A 2ADIA 5D5MB 3V52L 4F7TA 2OX5A 5DQDL 1ZHNB 3TLRA 8FABA 5TF1L 1KLUA 1CVRA 1NUFA 1BM3H 3BKYL 4KZDL 3GKZA 4HGWA 3BVNA 1A6AA 5FHAH 3P11L 5GIRA 3F7YB 1E28A 1I85A 3MYJA 1AI1L 1Z9SA 4PJ9A 4P4KB 1P7HL 5EOQH 1FSKC 3L6FA 3QA3B 1U9KA 1WITA 3GNML 4YH6A 1R5VA 4UT6H 1CDJA 1G7JB 1TZIB 3G6AA 1K8DB 3IDXL 3LEXB 4M43H 5FDWB 5FO7A 1MVUA 3GIZH 3CH8A 3PWUB 4HH9B 4QRUB 4E5XA 5TH2A 4MXQA 4Z7QF 3AREA 4PRNB 5CLTA 12E8H 3CXHJ 4PG2A 2F53A 4BH8B 5CEXA 1LWRA 2EDHA 4FQ1H 4WEBH 3E8UH 1FZJA 1BM3L 1NLBH 1H3WM 2BP3A 5FGBC 4GMTH 3T3PF 5KSAC 4Z0XA 2R0LH 4QWWD 4NYLA 3W9DB 4AK1A 4HX1B 1EJ6A 1R24A 4ZSOB 3QUZC 2X4NB 2C26A 3BZEA 5EOQL 1JL8A 2BCKA 3SKUD 5T3XE 1VACA 3DXAA 4MA1C 5DRXA 2DQDH 4UT6L 1BZ7B 4ZOBA 5ANMB 3RWGB 3IDNA 5HHMA 1A7RH 4GW5A 1DN2A 4QHKI 3BFOA 4UIKH 4M43L 2WLZA 2VAJA 2J7LA 4HKXB 5IF0B 1WGOA 3ES6B 4LSPH 4FFEX 2OL3A 4PJ8B 5GGRY 12E8L 2W9EH 3D0LB 1G7IB 4X4MA 1JWSA 3Q2CA 5K9KB 2VDMH 4BSVA 3NTCH 4AZ8A 1FIGL 4FQ1L 2K7QA 3TN0D 3E8UL 3EO0A 3GSOB 4K8RC 2FDBP 1NLBL 2EC8A 3Q0HA 3WHE0 4GMTL 1QFWH 1WC7B 4K07A 4KQ4H 1SEBB 2R0LL 5BO1H 4TULH 3JV5A 3KYOB 3ESUF 3HRPA 4X6EA 3D0VB 4GAJH 4PJFE 5KSBE 1E4XH 3PNWA 2DQDL 4N1CA 1MIMH 1B4JH 1A7RL 2R4RH 1A6TA 1MI5A 2WW8A 4UIKL 3UPRA 3ZE0F 4XPHH 1H15A 4KGJA 5DMYA 6FABH 4LSPL 4GBXD 3BXNB 2IQ9H 4IDJH 2MSPA 2R9HC 5FYJH 1JCKA 4WNQA 2PYFA 2W0FB 4MAYB 1NGYB 1CIUA 5F1KC 1QRNE 2VDML 3NTCL 2I24N 4OD3H 5KSUA 3GSQB 4PJEB 3EJYC 4YXLH 2M2DA 3TA3B 4UUJA 1QFWL 5BO1L 4HK0B 4TULL 5ALBH 1OSZB 1C5DA 3ULVF 1D6EB 1OB1A 3D39B 5J89A 4XPFH 1TFHA 4GAJL 2APVA 3V5KB 3GJEB 1E4XL 2N7BA 1MIML 1B4JL 2ITDB 3M45A 4XPHL 4MHHI 5F89A 4LKCB 4OM1L 4X99B 3IDMB 4PRBB 2Z31D 4IDJL 1LILA 5FYJL 1IKFH 2V9RA 1AO7D 3NFPB 5CFHA 4QEGA 5JDJA 4TNVK 4WO4A 1LE9B 4X9GA 4OD3L 4LHUB 4WFHE 1L8JA 4YXLL 4OI7A 3C8DA 4HHAB 1JNHB 5FA3A 2FX9H 3FOLA 4PJ7A 3RVVD 5LQBL 1I1RA 1NFDA 4ACPA 4KDWA 5ALBL 1FCGA 2NCMA 4ZUSB 1KG0B 1ES0A 2Q7NA 4XPFL 4P23D 5ESAA 1JV5A 2Y7QA 9CGTA 1U8QA 3ARZA 3OAZH 4LARH 4UQ3B 5ESVA 1WWWX 1KXVC 2X4QB 1XR8B 4F80A 1G7MA 2J2ZA 3H2WA 5HGAA 1FZKA 3C5JB 2VZSA 2HTKD 5LJYH 2NY0B 4Y4HD 1IKFL 5CD3A 5EU6D 2NY4D 1X5IA 1F42A 3K7UA 1CICD 4RISH 4NUGH 3NCCB 4ZNEE 3TJHA 2QL1A 4PJXE 4OZIB 4NWUL 4OZGB 2FX9L 3QZWG 4PDCE 1TNNA 3AM8C 3AAZB 5IJKA 1T1ZA 4IJ3B 2DLGA 4X4XA 4PJCB 2VUOA 1FVEA 1KN2H 2RR3A 3HR5A 4IRSC 4YDJA 5KZCB 2N56A 5BRZA 5L9DH 4N5EA 1IM9B 2VO5A 2BY0A 3GSRB 3B6SA 1JHLH 4UNVA 4LARL 3MRLB 4N0FA 4HEPG 1IE5A 4PB9H 1HOCB 5AAMA 3RWFB 4N0UA 4MAYC 4NZJA 5TQ0H 2YBRB 3WN5A 2ZUYA 3CVHA 2GCYB 3MRCB 3QUYB 1SMOA 3TA3C 5F6HI 3STZB 3EKCA 5IB1A 4JPIB 3LKSB 5BZDA 4GS7B 2HKHL 2C9AA 4RISL 4NUGL 1I4FA 5F9DC 3U0PA 1P4LA 5GGVY 3SDAD 1Z5LB 4FXKB 1FNSH 3QHTC 4PP2A 3LAFA 5DK2A 3OB0H 1KN2L 2HMIC 2JCCF 1UWEH 4XHJD 5L9DL 4CU8A 2E8YA 3VE0B 4PGBA 3MV7B 1UVQB 2GITB 1JHLL 2F74A 2JJTA 1DZBA 1A1MA 1KJ2B 2HFFA 3O4LA 4GH7B 4UAOC 5TDOA 5L6YH 3ZMRA 4H8WC 1HINH 4PB9L 4U1SA 4PJ5A 4OFDA 3X11A 1X5YA 1CG9A 5SV3A 5CCKH 1T7VA 1VB9A 5TQ0L 1QR1A 3FO1A 3AY4C 5M94B 2YWYA 5IG7B 1L6ZA 3N9GH 1P2CB 4EN3B 1MY7A 5FOBA 1W0VB 1ZT1B 4ZO6A 3PHQB 3VGDA 5AUMA 3CCHA 1FNSL 3INUH 1F4YH 5E8EA 3IKCA 5ITBH 1WIUA 3RWDA 4QHNA 2QADB 4K71B 2AGJH 4JRYD 2LV4A 4JGUA 4XRCB 1N3NA 1EK3A 3GRWA 5C92A 3FB7A 3NCFB 4KHTH 3L3GA 3QJHA 2NY0C 4CW1B 4Y2DA 1HINL 2BVOA 1NCDH 1MHEA 1BVLA 4GLRI 5CCKL 2R1YB 3T0AA 5JPMA 2B1HH 1JMZA 5FK9B 3ZO0A 3N9GL 1P5VA 3QDJA 2ENSA 1CBVH 3QDGA 1T2JA 2KDGA 1NFIB 4JZOA 4IJ3C 1DBKL 1NPUA 2X1WL 4U3CA 3NA9H 3INUL 1F4YL 1MAJA 5MERA 32C2A 1VFMA 1OY3B 1ZS8A 5DURD 2AGJL 3WLWC 5H35B 3T65A 4NRXA 2VKXA 4KHTL 5GRYA 2IADA 5FYKH 1BFOA 1P7QB 4X6DB 1H8OA 3GSNA 4XBGA 1M6OB 3ABZA 5MENB 2LAGB 3WHXA 4Z7NF 2AS5M 5C1MB 1NCDL 4CU7A 4OSUL 4V2BA 3QUYC 1A14H 5TDPA 2B1HL 2AK4E 5T1KB 3B9KB 2G5BA 3UTTE 2V2TB 5LGKA 1T20B 1NUDA 4NQXA 1INDL 4P5TD 3BEWA 5HYJD 3UYRH 3QH3B 2BVPB 3TZVB 1XCTA 3ULUC 1V3MA 4ELKB 3LKRA 1IAOB 3SDXA 3NA9L 2XA8H 3TCLA 4LCCA 1NC4D 4CMMA 1F02I 1ITCA 1J86A 2VAAB 1YEDA 3VXPA 3OJ2C 5FYKL 1AP2B 1JGEB 4L4VB 4D0CA 4HWBH 2CRMA 4EJ1C 5JOFB 5E6ID 1WTGT 1IEBB 5ETUB 5IROA 3V4VH 1KYOJ 4EN3C 2OSLA 4FQIL 2YZ8A 2E27H 1MY5A 1A3LH 4MJIB 3ZTNH 3RIFF 4C56B 3UYRL 2DICA 3OZ9H 4JZJA 4LPTA 4ZO8A 2H9GB 2GKIA 3IGAB 2XA8L 3Q6GH 2QADC 4K71C 4FFWD 3VWJD 5DJ2B 3TT1H 1Q8MA 1UCBH 1MELA 4H1LG 4RFEB 1VGKB 1MCKA 2Q7YA 5DQ9A 3L95B 5EUOA 1JZ4A 2V7HA 5I75B 4Q9CA 2NX5B 5ICXB 1I3RA 4HWBL 4U1JB 4GKZB 5HHNA 1UEYA 2VIRB 4DVRH 3ILQD 4UBDD 4MS8D 2JKXA 2F5BH 4MB5A 1KB5A 4UDUA 3PIQA 4I18B 3V4VL 2BMKA 3PXHA 1KCSH 1AFVH 2E27L 2V17L 4JVPA 1A3LL 4NZTH 3ZTNL 4LLDB 1IFHL 1YDPB 3QULA 2XV6B 3TJEH 3MODH 4RGMC 1WBYB 3OZ9L 1BAFH 1SJVA 3TESA 2JLLA 4AYFA 4XWOC 4E41B 3UTSA 4ZG1A 4OZHB 5AZ2H 1P53A 5GS2D 1J0ZA 1X5KA 3Q6GL 4KHXH 3TT1L 1HHKA 3EW3B 4ZFOB 3U9PH 3MV9E 1Y6MR 4XTRD 1SY6H 1DQQB 1CZ8H 2EYTA 4JFFE 1HHHA 2X05A 1D5ZA 1PG7W 3CNKA 2OXGA 4PP8C 2OP4L 1DVFA 3NOIA 2AXHA 1CGYA 2WWMD 3WLBA 3B9KC 4DVRL 4ZUUA 1T7ZA 2F5BL 4P46B 3C6SA 2GJJA 1PDKA 2RFXB 1AFVL 5GGTH 4NZTL 4PRIA 3TZVC 1S7SB 2HA1A 2FL5B 3TJEL 3MODL 1U8PB 4LVHB 1BAFL 1U8JA 5K9JH 4K55A 2WZPD 1OTTC 5AZ2L 4R6UA 43CAA 1J8HA 3NZ8A 3CSPA 4KHXL 1M7DB 2C3VB 5IVXF 2AP2A 4KFZC 3U9PL 1RJYB 4Y1AD 2WINA 5IB4A 3SCMB 1T04A 1SY6L 5T1LA 1CZ8L 2D7MA 5C07D 1JYWA 4X9BA 3WFBH 1B0GB 2BNQB 5HHPA 1S8DA 4DUWA 4KK5D 1PKQA 4FQLH 3ZYJA 1IQDB 4Z7UA 3H9SD 2APTA 3TIDB 2GY7B 2WY3A 2WV3A 3P40A 4R90H 3VXTA 1XGPB 2VXUH 3BDXA 3QO0A 2XWTB 2A9ML 3IT8D 5GGTL 2OLDA 1IGFH 5DVLA 5JA9A 1TVDA 1JUFB 1V8HA 4TVPE 3OXSA 2QHRL 2YR3A 5K9JL 3VXRA 1OM3L 2Y9RT 1Q9KB 5HHOE 4ELMA 5IFJB 2IWGA 3ARSA 4X6CA 5I75C 4UB0H 3BZFB 4YBQC 1B0RB 5C0IB 4PRAB 4XXCC 4M00A 3HE6D 4D94A 1S9WA 3TPUE 1YQ2A 3WFBL 3EGSA 1G9MH 4LVNC 4I18C 4M7JH 1RUAL 3NIGE 1T21A 5DD5H 3WIHL 1AGBA 2QSQA 4RGND 1AQDB 1BVKB 4R90L 5B39B 2VABB 1LMKA 1MFDH 2VXUL 2Y4SA 1SBBA 4XMLH 1RD6A 4GOSA 1IGFL 5EN2A 2OZ4A 1T0NB 5F3BB 4AEHH 3RHWF 3MLWH 3DYMA 2F9BT 4OLXH 5D6DC 3WBDA 1EXUB 3UYOD 4WW2C 2WSKA 3DWTA 4XNUH 3HC4H 2EIBA 1UXWB 3T2OA 5ERWB 3VD9A 1KUMA 1WZ1H 4UB0L 3STBA 3W0WA 1F13A 4H5SA 3KPSE 3HZVB 1G9ML 1N6VA 4M7JL 4CVXB 2MFNA 4N90D 1UA6H 5DD5L 2DLTA 4PR5A 1O7SA 2H2SC 5LBSH 1KF9B 4YDVA 3L7FA 1MFDL 1G9NH 4LVHC 3RUGA 1N5AB 1HWHB 1PG7X 4NBXB 3MLWL 1RZJC 1HK6A 4G9FD 4OLXL 3VFTB 5EO0A 3RTQC 5C8JB 5D70H 1FNLA 4XNUL 3HC4L 4IRJA 2V5SA 5CJXC 2JJUA 2GQHA 4PJIA 5C08D 3SCMC 2DMKA 4PRPE 4Y5YA 4KJWC 4LF3B 3F58H 4MX7B 1WZ1L 1CDHA 2Y5TA 3H42H 3SKOA 2CIKB 2HJLB 1BQLH 3BQUA 4KDVA 4NJ9L 3VFUB 1JZ3A 4JM2D 4JKPH 5DJCA 1B9ZA 3RL2B 2FJGA 4Q6IB 2BNRE 5DJDA 3FFDB 2JB5H 2VDRL 2CKBA 5ACZB 1I3UA 1UA6L 3UP1A 4HUNB 4PY8I 2OTWB 5LBSL 4OF5A 3LQZA 4U31A 1YUHB 5M7QA 4LEOB 2VC2H 5C70A 1W72B 2Q86B 4TTDD 5DUBB 1NBZA 4DJMA 5D70L 3V6OE 3HPJB 3NFSH 3KHOA 3AB0B 1ONQB 1ZXQA 5C0CE 2JK5B 1AIFB 4GBXB 1FO0B 1JGUH 3QQ3B 5JTWA 3EYSH 4JFXA 3H42L 2JIXA 2IMMA 1BQLL 4LLAA 5T3ZE 1MWAA 1DLHB 4V2CB 5CZKA 4RNRB 2JB5L 1ZEAH 2UV3A 4F9PC 1D5BB 2ZUSA 3IU3B 3B2UD 4G6AD 5FFLA 1QBAA 1LQVA 1PQZA 1FE8H 3PV6B 3VXQB 4MSWB 3FO2B 1FORH 2VC2L 3LRSA 4AL8H 2MHAB 4XBPB 4APQD 4HCRH 3PGDB 3MNZB 3L3JB 4P2OD 3NFSL 5SV4A 4AIZB 2FBOJ 4LLYA 3S3PA 2Y6SC 5C6PB 4GKOA 1JGUL 4K9EC 3HRZB 4OLEA 1AO7B 4MD4B 3EYSL 2AV7A 4FTVE 1A2YB 2QQNH 5F7KC 3LH2H 1K2DB 4LQ1A 1NMAH 5IK3A 3DMMD 3RZWA 5ACLA 2R2CA 1XGUA 2F54A 1VSCA 3IKKA 1ZEAL 4M1GH 1JF5A 2YEZB 5FDYA 3PWVB 3MA7B 4P23B 4LEXL 1FE8L 1RUQH 3D2UA 1FORL 3QXWA 4OM0H 5F7DB 4ZXBA 4AL8L 3LMJH 3TIEA 4HUXB 4PJXB 4HCRL 3ZTJH 4ONOA 2FSEA 1QEWA 3ZE1E 4G7YH 2VDNH 3DO7A 1DUYA 4AENB 1EA9C 2DBJA 3DVNB 3MLZL 4XNYH 1WT5A 2NLJA 5INCB 1KIQA 4K3EL 4Q6IC 4MAUL 5FAAA 2PXYA 2QQNL 1V5JA 3LH2L 2NR6C 4U1NA 1NMAL 1S9YA 3HI1B 5TFSH 3TO4A 3SHSA 3C5ZB 3OKNA 2QEJA 4LGRB 1A9EA 3U9UB 3ECBA 4AM0B 5GGRB 1KEMH 1YN7B 1HYSD 1GC1C 4RFNB 5T1DH 1SYVB 2DLEA 3H9HB 4GG8A 2A74A 2AI0H 5CHNA 4XP9H 4OM0L 1KTLB 2Z9TA 2YD5A 4NJAH 4MXVE 4JFOB 1VFUA 3ARDC 2IEPA 4MNQA 3VXOB 5TE7H 4G7YL 4OLYH 2QTEA 2VDNL 1X44A 1BFVH 3C8KA 1RU9L 1JRHL 4U1MB 2M8XA 4XNYL 1CGTA 4U6VH 3VXUD 5DO2C 5ESQB 1CLYH 1HH9B 2GT9B 1JYXA 1PY4A 2M1KA 5TFSL 1XGRB 2AJ3B 3CX5K 3QG6A 3RWEA 3SDAB 1NCUA 2X4TB 1F8TH 4F9LA 2BOCA 1J18A 3CDGB 4I0CC 5T1DL 1K8IB 4RX4D 1V05A 3Q5OA 2AI0L 4XP9L 4CAGA 4RCAA 4NQEA 4KK9D 2ADGB 4D0DA 4JQVA 4NJAL 1YEGL 4HIHB 1O7VA 5BOPA 3TP4A 5CWSA 2ZKHH 1GXEA 4OLYL 4Z77A 1BFVL 2ERJC 2YUXA 3JTSB 5IHUH 1O0VA 2FCBA 3W11D 4QRQB 4ZS6D 2ATPB 3EHBD 4U6VL 3RA7H 1P7KA 2D0HA 4ZUTA 5F1IB 2CUIA 1CLYL 4M61B 1NH6A 3PDOB 1CL7I 1HQ4A 5GGVH 3MA9H 5E08H 4GJTB 1MCQA 1ZANH 4R0LB 1EO5A 3MLUH 3AFLA 1A4KA 4KRPD 1F8TL 1JPFA 3VRJA 3R0MA 2XI9A 1B3JA 5JLZA 3T0VA 4XNMB 2QQQA 3CMGA 1RJLB 1AD0B 1B90A 1HN1A 3QIBC 1DQLH 15C8H 4YDIL 2ZKHL 1D7FA 2GFBB 4HIJB 4GXVH 5B3JF 4ISVA 1K85A 5IHUL 4O9HH 2IQAA 4JFQB 4WI6A 2H3NB 3T77B 4BZ1L 1EBAA 1JZ2A 3C5ZC 2GUOB 5BV7H 3U46B 1WFOA 1A8JH 4MJ6A 4P9HC 1FZOA 1DBJH 3ZDXF 2HT4D 3SDCA 4I4WA 1A7NH 2F8OA 2VWEE 5GGVL 5E08L 3O45A 4NFBA 1MCJA 4OF6A 1ZANL 3S98A 4RFNC 3MLUL 1NFDF 5HVHB 3UTTB 5ACMA 2K7PA 3IJYA 5I74B 1IKNC 1OAYH 4Z7VA 3TFKD 4ZAKD 1PJ9A 4IMLA 5CUSH 5FF6A 3ILPB 1DQLL 15C8L 4FQQA 1GPOH 4QO1A 3H7BA 5IW1A 4GXVL 1DLFH 1M7IB 3MRGA 2P5EE 3VU2A 1QFPA 1ED3A 2HT2D 4O9HL 1FFOA 4OFYD 4J3WA 1H0DB 3IF1A 5GS2H 1MFBH 5LGJB 1CFQA 5BV7L 2CLZA 5HYJB 1FL5A 4AY0A 4M8QB 3E2HC 1YY9D 1JNNH 1DBJL 1H5BB 3P4OA 4O51B 5GS0D 2E9IA 2F53E 5HGHB 1A7NL 3MPCA 3C6LA 4OKVB 4U1LB 4WUUD 4JVWA 1TZHB 1NC4B 4LCIH 2P8PB 4GRWE 3NBNA 1OW0A 2ZG1A 1SJHB 4ZUVB 4K7FB 1OAYL 5DHVA 3P4NB 5CUSL 2A73A 1F00I 1L7TL 3AUVA 4G6FD 3MX0A 3DXAE 2R0KH 4J23A 3TBSB 1BJ8A 5HHME 3F5WB 1NGWB 1QBLH 1I1YA 1MFBL 2NNAB 2V5YA 4MNGA 5IHZB 2FX8H 3BH8A 1KT2B 1JNNL 1T80A 1BD2E 4R0LC 1JN6A 2MQCA 2BOBA 3AU1B 1U3ZA 5JO5A 3ZT6A 5EZLB 2HFTA 1MFAH 4PGDB 4TN9A 1LE5B 4WV1B 4ZQKB 4LCIL 4FRWA 3L1OL 3BE1H 1CFSA 3MLVH 1F97A 1TDQA 3UTZB 3BPCB 2DWDB 3TBWB 1A1OB 2R0KL 4PLOB 3DIFA 4XNQA 1CE6A 3O41B 2Z93A 1I7ZA 3QUMH 1I7TA 5GRVK 1MI5E 2WAHA 4MQ7B 5L2KD 3HFMH 3FQNA 3FT2B 1UZ8B 1MOEA 4JFFB 2FX8L 4YFEA 1JNJA 2BHZA 3NFNB 5JW4N 4KPHH 1MLCA 4ORZC 3T4YA 4QYOB 4XVUC 4TNWK 3C08H 5IVOA 1MFAL 3LOWA 3QO1B 5I74C 5I19H 1HH6B 5E0QA 1YEKL 3P0YH 4L3ED 5KTEH 1C12B 3ARBC 3BE1L 3CFBB 4FG6D 3DRTB 4MA7L 3D18A 1GIGH 2H26B 3QWQB 1KGCE 5E2JA 3TBTA 4RQQB 2ZG3A 1WVZA 3ROOA 5K59E 3DLQR 3RDTB 3QUML 2P7TB 2E9BA 4WDIB 2GSIB 5D6CA 3AXLB 5E7BA 1H5BC 3HFML 4JE4B 2R1XB 5J0BA 3CSYB 2AXGA 3EOTH 5ISZD 3UC0H 4QGYA 3EO9L 5EBLA 4KPHL 4ODBD 5HJ3A 4XXDB 4WHYH 4HWUA 5GSRB 1FG9C 4HUKB 1GZPB 5DMGC 3C08L 4ZDHB 2APXA 5GRZA 3UJTH 1ZVYA 1U8KB 2WM0A 3U48A 3V5DB 5I19L 4GAGH 2LFGA 3P0YL 3G5ZB 4PJ7E 4Y1AB 1BQSA 4PFEA 4J3VA 1RSFA 3CDYA 1MUJA 5KTEL 2ATKA 3WCYA 1GIGL 4NKDA 4WU7A 2H1PH 5D7LD 3MUGA 1EEYB 4WWKB 1D9KB 3P73B 2OCFD 4P3CH 5E8OB 3M07A 3H9SB 1S5HB 4DWHA 4JRXD 4Y7MA 3RIAK 2UVFA 4HS6B 1BZ9A 4XZUB 1RZKC 3HE7D 5FYLE 2A6KB 3EOTL 5CGMA 3UC0L 3S9DB 4NKMB 1BX2B 5FGBA 5IEHA 5KSAA 3O3UN 1X3DA 3S5LA 2FHFA 4IOFC 1LEKB 3QDMD 4MQTB 5EZJA 3SDXF 3FT3A 3UJTL 4GAGL 2MOVA 3DBXB 2Q87A 1DDHA 2B1AH 3QQ9C 4FNLH 4RA0C 3GKWH 1RZGA 2JJWA 2MKWA 4DKDC 3KPOB 3ILQC 2H1PL 3BUYA 1NAMA 2IJ0C 2MPAH 5DFVC 3I84A 4X7TB 1T7YA 3DURA 4P3CL 4CADB 4I0PB 4CJ1A 3EOAA 4RGNB 4H8WL 4R4NC 3BN9C 1OL0A 2FEDD 3DRQB 3QEUB 3KPSB 5AG8A 4G5ZH 4X9IA 5HDBF 1QYGH 1UKTA 1NC2B 2C1OA 4MLIA 3VGGA 3H8NA 3ZHDA 3K8KA 4DGIH 3OAUH 3V6FB 1Z9OA 4FNLL 1NEZA 4QRTA 3BMVA 5CSBA 2AV1B 1KENH 2OQJB 3L5WA 3E0GA 3GKWL 3DPBA 1W0WB 1FYHB 2WWMC 2ZNXA 5EUOF 3T2PA 4GT7A 1DEDA 2DQFA 2MPAL 4TNVF 3RDTC 5BVJA 3CFEA 5D5MA 3VWKB 1CL7H 4QHMB 1ZHNA 4PRPB 5EFIB 2G9HA 2X1PA 3V79C 3LB6D 3U7AA 3CH1B 1F3DJ 5GZND 3O3AB 4H26B 3F7YA 1PG7H 3SDDD 1TJHH 2DI9A 4G9FB 1Y0LB 4YIQA 4OD1H 1EHNA 4G5ZL 3O3DB 4LP4A 3BGFB 1QYGL 4MA3A 1GZQB 4P4KA 3ULUH 3DUUB 3TO2A 2ARWA 3QA3A 5C08B 1U41A 4RRPA 4ERSH 4DGIL 3OAUL 2KL6A 4XB8A 1E4KC 2R1WB 4OZ4B 1G7JA 1QFHA 1TZIA 3WKMH 4WWKC 1D9KC 1K8DA 3LEXA 4BFGA 5FDWA 1B4RA 4LLWB 2GAZB 5IIEB 4PJDE 1AXIB 1K3ZA 4JM2B 3AVEA 3PWUA 4HH9A 4QRUA 3DOSA 1GJIA 1UB5B 4PBVC 1QSFD 5C0CB 4YK4B 4W4OA 1ROWA 1UB6B 4FFVC 3K74B 3EYUH 2D0FA 3CLEH 4HX1A 5GGQH 3W9DA 3PWLB 1PG7L 1TJHL 5D4QA 4LCUB 4ZSOA 4OD1L 3ZSTA 3QDJE 2X4NA 1ZVSB 3QDGE 3ULUL 4MD0B 4RMSA 3HCVB 2R4SH 1WIPA 4X6BB 4HF5H 1X5LA 1BZ7A 5ANMA 5SWSD 3RWGA 4PG9B 4CGTA 2O5XH 3HLAB 4KKBD 3WKML 1HE7A 1J0YA 4KI5E 4HKXA 2ARJB 2AW2A 3IAQA 1KJ2L 43C9B 1YMMD 4I0PC 5I66B 5IF0A 3ES6A 4IS6B 1FG2B 3RY6A 2C1PB 4PJ8A 5LG1A 1FAIL 3D0LA 1G7IA 1T0MB 5D1QB 5K9KA 4Z7UF 4XAKE 2Q6WB 5E1AB 1CT8B 3GSOA 2YPVH 4MJ4A 4FTVB 3QIUC 2HLAB 3IDIB 3HHRB 1WC7A 3EYUL 1SEBA 3VDCA 5GGQL 3CLEL 4NP4H 1UWXH 1DFBL 2XRAH 4RBPK 3CZFB 3KYOA 4LP5A 4Y88A 4JG1H 2BC4B 2AABH 3AM8A 2I9LB 5JQHC 2I9TB 1HNGA 4ELMF 1JTOA 3D0VA 1X5JA 5D8JH 5CBEA 3RKDD 4NPYA 2R4SL 4HBCH 3OG4B 1GGTA 2X9WA 3PDDA 2VQTA 2YPKB 3ROLB 3IU4H 4X7FC 4GXUM 3VWKC 5F8QC 5DQJB 4LPWA 3C60B 5DXWA 2FJFB 1UZ6F 3BXNA 4W70A 1A64A 3LPFA 1NGYA 1JZ7A 1QA9A 5ENWB 4M6NH 3IJSB 4YGAB 3GSQA 4IOIB 1NUNB 3GJFH 4PJEA 4GRLB 2YPVL 3N1MC 3TA3A 3BGFC 4JR9H 4HK0A 3DGCR 2Q3AA 2B39A 4NP4L 2XRAL 2J8UB 1PW3A 1XGTB 1OSZA 2CK0L 1D6EA 1A47A 3D39A 2AABL 1KTDB 4HEME 5DC4B 3FAWA 4Q9BA 1KULA 3ARGD 4EI6B 3ULVD 3MRFB 5D8JL 2VSCA 3GJEA 4E42B 1EERB 2AK1L 3IU4L 1TJIH 2W38A 5CD5C 1KIRB 2ITDA 3V6OC 3I6KB 4LKCA 5F7FA 3IDMA 2CIIB 4PRBA 3VFNB 5CJQH 3ZKXB 4HC1H 3NFPA 1WF5A 1OWWA 1LE9A 3PP4H 4QHLA 1WAAA 5KANG 4M6NL 4XCNB 3EZJB 4TTDC 1U8HA 2V5RA 4HHAA 3EDJA 1JNHA 3RUGF 1G6VK 3FOMB 3DX8B 4JR9L 1X4ZA 2PCPB 5A40E 5I1CH 4ZUSA 1CDGA 2IFGA 1KG0A 1MNUH 2CUMA 4LKXB 5DJAB 1CXFA 4U6TA 3FT4B 3TBVB 1ZT7B 4NQVB 3WHE1 4UQ3A 2A2QT 3G08B 3A6BH 2X4QA 4DGYH 4XCFH 1TJIL 3O9WD 4NNPL 3VXUB 3AGVA 3WS6A 3C5JA 4R96B 5D1QC 4OLVH 4Z7WF 4P49A 5JNYB 4HC1L 5C0BD 3O3BB 2B5IC 4ZOCA 2KPNA 3PP4L 3C8HA 5I1AB 4S0SD 4OZIA 4OZGA 4OGXH 3KLHD 1U95B 3AAZA 2B8OT 3OQ3B 3K8MA 4PRIE 2FHBA 5I1CL 4X98B 4NT6B 4PJCA 3RVXC 3WO4B 1MNUL 1IM9A 3NGBB 3Q48A 4HGKC 5DD0H 1SMAA 1QSEE 3GSRA 4FQXA 4K3GA 3MRLA 4HKZB 3A6BL 1J8HE 4DGYL 3C60C 4XCFL 1J10A 4F7EB 1JNLH 4R7NB 2OR8A 4JPWH 1HOCA 3NCEB 5D96B 4F33B 3RWFA 4B5EA 1U3HB 2YBRA 4OLVL 4S1DD 2QJDA 2GCYA 3MRCA 4GRLC 2ITCB 1FL3B 4G6KL 3STZA 4JPIA 3LKSA 1PKQE 2WBJD 3KJ4B 4XC1H 5E8PB 2WUBH 1IGIH 4LCWE 2X89A 1Z5LA 4FXKA 2ADIB 4BUHA 1QBML 4OGXL 5DZNA 5JIIA 4JFEE 2J6EH 1QG3A 3L5JA 4QXUH 4G8GD 4YHYC 5DD0L 4D9RD 1J0JA 3VE0A 3MV7A 3VXRE 2GITA 5GIRB 4LHQB 2PUQT 4K3HA 5E8NB 1HCFX 5D71H 1JNLL 4XP6H 4JPWL 1RZFH 5K93A 4X6CE 2BXZA 3ZKXC 2YD8A 2O61B 2WBKA 2RQ8A 4V1DD 3MR9B 1A6WH 5IG7A 4DN4H 3D3VD 2P46B 1P2CA 2P5EB 4EN3A 1CYGA 5CJ8A 1W0VA 1ZT1A 3PHQA 3X3FH 4XC1L 1IGIL 1XIWD 1PVHA 1X9QA 1UH4A 1UACH 3ZDZF 4GMSH 5IBLD 1IEAB 4RAVB 3KLAB 4YHOH 1JJUA 2J6EL 2MCPH 4WI8A 1FNGB 4QNPE 4QXUL 3D3VE 2NYYC 2DAVA 3O6MH 5IQ7H 4XRCA 3BESR 4YAQB 2FB4H 4QF1A 4GRWB 3MNWB 5D71L 1N8ZB 4CW1A 1R24B 4JJ5B 4Y19D 4XP6L 4UNTA 1RZFL 3EYFA 1A7BA 3W0WE 2R1YA 1K6QH 1A6WL 1QO3B 4IIQB 4DN4L 3ALPA 5FK9A 4Z7OE 4WUUB 5F1OB 5J6GB 1NGQH 4OV5B 3VXMD 4JREC 5C0AD 3RGHA 5DFWH 3D69B 1NFIA 3X3FL 5CEZD 2FNBA 1WFUA 4M6OH 4Y19E 3D6GA 3WO4C 1UACL 2DMBA 4GMSL 2NXZB 1BD2B 3U6RB 3RUGE 3NGBC 4YHOL 1I8KB 4G6FB 3U4EB 5BZWB 1RHHB 4N9GB 5DUMH 5ID1B 3V0WH 5H35A 3O6ML 5IQ7L 4K94C 2DQCH 2FB4L 1P7QA 3F8UB 3NAAH 4X6DA 4BZ2H 5MENA 1M6OA 5SWQB 4PJIE 5T3XH 1P4BH 1U3HC 4K9EH 3QG7L 2ED9A 3MV01 1JPTH 4LLVB 3DO3A 3VI3E 5EZOH 1K6QL 3TNNA 5T1KA 3B9KA 1QLEH 3KJ4C 2V2TA 1T20A 4U3XA 1NGQL 5CKAA 2IC2A 1A6TB 4AEFA 1GOGA 4JKWA 3QH3A 2AKRB 3RZCA 2BVPA 3U7WH 3TZVA 4YHPB 4L29B 3GB7B 4ELKA 2VWEC 1IAOA 5H94B 4JY6A 2HVKB 1A1NA 1H3PH 1REIA 2AXJA 5DUML 1I85C 3V0WL 2VAAA 2UZIH 2DQCL 5C2BH 1AP2A 1JGEA 2VNCA 3NAAL 4L4VA 1JYVA 4BZ2L 5JOFA 5T3XL 3JTCA 1P4BL 2Q76B 4K9EL 2YUZA 1F4AA 1JPTL 3UTPD 5EZIH 5ETUA 5EZOL 1I1AB 3B83A 4Y5XB 4J3UA 1QLEL 3GMRB 5BVPL 2HLFD 4MJIA 3O6KH 3JWDC 3OHXB 4C56A 3PWPD 3VI4E 3MV8E 4HS3A 3EDDA 2H9GA 2IMNA 1DBMH 1MRFH 1UGNA 1EPFA 4P5MB 1YC7A 1Z9LA 3IGAA 4AIXA 3B9DA 1YECH 3VFOB 5DJ2A 2R2BB 3D48R 4GO6B 4HK3N 4RFEA 1H3PL 3QCVL 1VGKA 3MGTB 3L95A 2JTDA 1LP9F 2UZIL 4KKNA 2NX5A 3ERYA 5ICXA 5C2BL 4PTTB 4U1JA 4GKZA 4BFBD 1F45A 5ISZB 4IIQC 4IM8A 2Q20A 1X5AA 1R3LB 5SX5K 4JM4H 4KUZH 4CVWA 5FEBA 3QRFM 4I18A 5GJTH 5ECJE 2A77H 5GZOD 3GEWB 1VFOA 1JV5B 4NGHL 2NY1C 5ESVB 5DF0A 5F44A 1NUGA 2V7NB 5C0RH 2KBGA 5C86A 1FC2D 3O6KL 2F54E 1YDPA 3VA2C 3SGDI 1WBYA 2GJ6D 2NXZC 2ED7A 4E41A 1DBML 1MRFL 4X9FA 5HVFB 4MA8H 4OZHA 3V6ZB 1VEPA 2OMBA 5CD3B 1YECL 4Z7VF 1T1YB 3FN3A 3LEVH 1DQJB 1YN6A 4ZFOA 4KMTH 1DQQA 1OD7A 5IB2B 4NO0B 5F7NC 2GJ6E 3KPRD 1ADQA 3NIFE 5I8KH 4BKLB 3HE7B 1LD9B 1MCWM 5FKAB 2DMCA 2H32H 1FVEB 4JM4L 4P46A 1S9VB 5IEKB 4Y2OA 5GJTL 2DJUA 5CGYC 2A77L 3B6SB 2RFXA 4PUBH 1ZTXH 5IT2L 5C0RL 5GGSY 2VXSH 4N0FB 3VRLF 1S7SA 2KQMA 2FL5A 3HAEB 1E6OL 4FMFA 4L3CB 1A6ZB 1U8PA 4Y4KD 1CD0A 1OLLA 3O81A 1KB9J 4FOMA 3RWHB 4MA8L 2WQRA 6CGTA 2YPLD 1SBSH 4LGSB 1M7DA 2C3VA 2I26N 2ZUQB 3LEVL 5JR1H 3MLRH 4X7SH 1RJYA 1IMHC 4YXKH 5CJXA 4KMTL 4Y8AA 3SCMA 1Y18B 1A0QH 5FOJA 1OGAD 3MJGX 1GAFH 4R26H 1B0GA 3OG6B 1IC1A 2F8VA 2BNQA 4KY1H 1I1AC 3HNSL 5F97E 1IQDA 2H6PA 2IH1B 3TIDA 4HWEH 5F6IB 3O6FB 2YN5A 1XGPA 3KJ6H 3VFPB 2OI9B 2XWTA 2DM2A 4UOW0 4PUBL 1ZTXL 4RGOL 2VXSL 4J4PD 5TDOB 1OGAE 1JUFA 5HI5D 4U1SB 3UAJC 3CU7A 5K9QG 2F8XC 4WO4C 1Q9KA 4UDTB 1MREH 4N0CA 1S7VB 1SBSL 2VDQH 2HT3C 3MLRL 2AEPH 4X7SL 5CP3A 2BVYA 4YXKL 3BZFA 4JFHE 1B0RA 5C0IA 1DCLA 1A0QL 3CCHB 3ZYOA 2O5YH 4WEMB 3TYFB 3WJLA 5F93C 1GAFL 4R26L 1A7PH 2AJVL 4Z95H 4KY1L 3HC0B 1DANU 3BP4A 3K80A 3PDGA 3ZYZA 4PJDB 3P0GB 4HWEL 1BVKA 1FIEA 2UUDK 3KJ6L 5B39A 2VABA 4F9PA 1I7UB 2DIAA 4RMQA 4LAQH 1KC5L 4ZOAA 5F3BA 5A2FA 1EXUA 2EE2A 2B20A 3N1QC 5IFAH 4LIQE 1MREL 1J11A 2DF3A 1BLNB 3TJHC 3QDJB 1UXWA 3T8XB 2VDQL 5ERWA 1MRDH 2AEPL 3C2SA 2O5YL 1Z3GL 1A7PL 3HZVA 3T0ED 3HMXA 3UROR 5GS3A 3BOVA 3ULVH 4N5EC 4Z95L 32C2B 3U2SB 1GVIA 4CVXA 4QLRA 5FIEA 3UPAA 4PRHD 4LSTH 4H20H 2GTZB 5C0EB 4LPCA 4ONFH 3MLPA 1BFOB 1RUKL 4LAQL 1N5AA 1U42A 3GSNB 4J2XA 5MP6H 1NCBH 4G6JH 3WE6A 2VJXA 5TE4H 3N50A 3VFTA 4OGAC 3W82A 2ZUQC 3CFIC 5C8JA 1BEYL 1TCMA 4QRPD 2AJYH 4XVSL 4CN6A 1MRDL 4LF3A 4MX7A 1N2RA 2OTUA 2CIKA 2HJLA 4U7SA 4LSRH 2OK0H 4NO3B 3BN3B 3VFUA 1J12A 4U1IA 1P1ZB 3ULVL 3RL2A 2VLRD 3O6FC 2OI9C 5ACZA 4ONFL 5JMOC 3PL6D 1QNZL 4WHTB 3VXPB 1YUHA 4U2YA 1HNFA 3VMPA 4LEOA 5HYEA 3UBXI 5MP6L 1NCBL 4G6JL 5TE4L 3E3QA 1W72A 2Q86A 1BQHA 5DUBA 5JOPE 3HPJA 2ADFH 3GMPB 5BW7C 2A6JB 1L7IH 1ONQA 4XPAH 2AJYL 1AIFA 2JK5A 4GBXA 1FO0A 1I9JH 3QQ3A 2DYPD 4NM8L 5FYJU 4LSRL 2OK0L 5EH1A 2QLVB 3I9GH 5D2LF 1C16B 1DLHA 5J13B 1D5BA 3IU3A 4MNGE 3OAYK 3DX6B 1JBJA 1HXYB 1G84A 3ARGB 3PV6A 3CK0H 3VXQA 5T1MA 3O2VH 4OCYH 3FO2A 5F1NB 1SQ2N 1ACYH 4W68A 2MHAA 4XP1H 2V2WB 2VZ1A 4XBPA 4R2GB 1FYTD 3BEVB 1EHLH 3PGDA 4R4BB 2ADFL 3MJ8B 2NY2D 5DJYA 4AIZA 1L7IL 1MLBB 2MTPA 4XPAL 2FECI 5GS1B 1I9JL 4PREB 3C2AH 2P8MB 3HRZA 1AO7A 5D5MF 1A2YA 4N8CH 3CXHK 3NPSB 3MRDB 1K2DA 3S5LG 4KI5C 3I9GL 1Q94A 4MWFB 1FYTE 4M4PA 4NZRH 5C6WH 1HZHH 3AMLA 4M1CC 3BP7B 4UILH 1KCLA 3JV0A 4Y4FB 2YEZA 3BWAB 4A6YB 4QTIH 1OCWH 1J9CT 3PWVA 3MA7A 4P23A 3V2AR 2UZXB 3CK0L 3O2VL 1ACYL 5F7DA 1HILB 4XP1L 3ALXA 4ZNEA 4HUXA 4PJXA 1U2CA 1EHLL 2VN7A 5KN5B 3P4MB 4LU5H 4AENA 2FBJH 2N7AA 3R1GH 4PRIB 5CIPH 5BS0D 5EZIL 2YA1A 3C2AL 3DVNA 4M5YH 5I0DA 1G7QB 3NZHH 1A4JB 4N8CL 3REVB 3OKMB 4MXQD 1QSEB 3ARED 1CICA 1DANT 3ARUA 3K0WA 1ZE3C 2PYEE 5F9AC 3HI1A 3C5ZA 4HFUL 4MLSA 4NZRL 3X12B 1HZHL 3RWCB 5HHQB 4Q58C 4Y16D 2VRAA 4UILL 5D7SH 1NEZG 5GGRA 3SGDH 3U9UA 4AM0A 4IRZH 1UXSA 4P2QD 5EG6C 3RKDC 3DVGB 1MHCB 1U3JA 5I73C 1SYVA 2BJMH 3H9HA 3RJQB 2XNAB 4LRNH 2QSCH 1KTLA 1J1OH 4X80H 4JFOA 4LCWB 5FUCC 3RQ3A 3VXOA 3RVTC 3OR7A 4M02A 3VXTB 3TPKA 5CEZH 4LU5L 4JFEB 2FBJL 4JZJC 2IPKB 3R1GL 3RY4A 3GBLA 4M5YL 1LK2B 3RFZC 3NZHL 1U8LB 5J13C 1AE6H 2EDJA 1MAMH 1ZLVK 5ESQA 2GT9A 2WBJB 3I2CH 2DTML 1XGRA 2AJ3A 1EFXB 4RRPG 3SDAA 3RNKB 4X6CB 5F7EH 2G5RA 2EXYC 2X4TA 3ARGC 4IRZL 3WDIA 1EH9A 2R23B 2CDFB 3OKKB 3CDGA 1LEIB 1K8IA 4R2GC 3PV7A 2BJML 2IGFH 4LRNL 4H1LH 1Y6KR 2JCCB 2QSCL 3UJJH 1HDMB 2SEBB 1J1OL 2J8OA 2ADGA 4X80L 1Q72H 1I8LA 2YMXH 3KYKH 4HIHA 5GS1C 1C08B 5HGDB 5CBAB 4TVPH 1IZKA 4X4YB 3R8QA 1EO8H 5LCVH 1ZLVH 5CEZL 3JTSA 4V1DB 3SE8H 4MQXC 4QRQA 3D3VB 4TTGA 2ATPA 2JB6B 2ORBH 1R3KB 3RIFK 1MAML 4TNWF 4M61A 4S0UC 3PDOA 3I2CL 2NY6B 4PJEF 4Y4FC 1XIWB 3MRIB 4OF3A 4HMCA 5HHXH 2O26U 1VA9A 1NMCB 5F7EL 4EUPH 3FONB 2FZ3B 4NC1E 1NDGB 2VSDA 4JRYA 2IGFL 2ZUTA 2A9NH 3UJJL 2PETA 4XNMA 1AD0A 1A5FH 4QT5B 1Q72L 3KYKL 4Y19B 1A6UH 2HTLD 5E99H 5GSVB 2GFBA 4HIJA 3L7FB 4TVPL 2FEEL 1EO8L 5LCVL 4LSDA 3SE8L 5HI4C 4YX2H 5FHBH 4JFQA 5H37G 3T77A 2H3NA 4WGVB 4W6XB 5GPRA 1OARH 2GUOA 5EO0B 3U46A 1KPRB 2ORBL 5C0AB 5C2UB 1WAAF 3EUUA 1A7OH 2YD3A 4EQ3A 2E3VA 3MRKB 4JY4A 1G7HB 5HHXL 2COQA 1J1PH 4OV6F 5JHLH 4KKCD 3ARRA 5IFHH 2IBZX 3BQUB 2XXMB 1G9EA 3UTTA 5IKCA 4PLJC 2J8HA 2BXYA 2LU4A 4ZOEA 2YA2A 2A9NL 2CKBB 4BFIB 1A5FL 4OFIA 3ILPA 3A6CH 2JJVA 1R3IH 5FYKU 3RIAF 1A6UL 4WFED 5E99L 1M7IA 4EI5D 1OTUD 4OD2B 1T5WB 1MCSA 1H0DA 2YD4A 5FHBL 2H2PD 5J3HC 5FO8B 2WBJC 3OKYA 1OARL 5LGJA 1EHXA 3OX8B 5HYJA 4M8QA 2BHUA 1ETZB 3G6JE 2D4DA 4O51A 1A7OL 3L7EB 5HGHA 4ZUWB 4WFEE 4OZIF 4OZGF 1J1PL 3I85A 5JHLL 2JIXB 1TZHA 1BMGA 5IFHL 1TPXB 1NC4A 3T0DA 2P8PA 2QQKH 5B8CB 3QPQD 1JI1A 4HG4J 4K7FA 2VLKD 3MV8B 3P4NA 1M71B 5BRZD 5A3IC 1A3QA 4QHKJ 3FHAA 5E6IA 2JJSC 5ANME 3TBSA 3P2TA 2HRPH 3F5WA 4WI4A 1NGWA 5J6HB 3EOBB 3ZE2E 4U6XB 3BMWA 2NNAA 4RMRA 1BFTA 2NY6C 5IHZA 3UJIH 5SWZD 1KT2A 1NMCC 3Q5YA 1IM3A 3FRPG 1I8MB 2QR0B 3LS5H 1LDPH 5TGBB 3SQOL 5EZLA 1U8NB 3N1FC 4WVRA 3VWJA 4TSCH 3ZDYF 1MH5B 1LE5A 4WV1A 4ZQKA 3ULUF 2AEIT 1UYWH 2QQKL 4QXGH 2DKSA 4WHCA 3WUZA 5MHSE 2F54B 3BPCA 1MCPH 4KK6C 4YGVB 1TCRB 3TBWA 4AJ0A 1A1OA 5D93B 3KYAA 4MS8A 1KJMB 4MVBD 3O41A 3O4LD 1CXLA 3QWRA 5C7XL 2HRPL 3T0BA 2EDYA 4MQ7A 4PJ5D 3FT2A 1UZ8A 4ESKA 4M3KB 4JFFA 4YHMH 4O58H 3NFNA 2GJ6B 4QYOA 4KJPC 1KLFA 1LDPL 4L9DA 3QFJE 2XY2A 3BQUC 4PJEE 3QIWB 4W81A 3LPWA 1HH6A 2J5LB 1IGML 1UYWL 4QXGL 4P99A 3DI2B 1C12A 5F7HA 4CNIB 3DRTA 2EZ0D 7FABH 2H26A 4M3JA 5BCAA 3VFMB 5KVMC 5HYFA 1MCPL 4RQQA 1EEZA 1B88A 1RY7B 4WCYH 4N8VB 7CGTA 1V7MH 4S1RH 1S7TB 4Y5VB 3RDTA 5E6YA 2P7TA 4Y2DD 1KIUA 4WDIA 2GSIA 3AXLA 1OD9A 2NW2B 3GZKA 5B4MC 3LZFH 5CLWA 2R1XA 3D85D 3CSYA 4YHML 5DVKA 4O58L 4BQBA 4OCRH 3VFSB 5GSRA 3QP3A 1YNLH 1TPXC 3LKQB 4N1EA 5B8CC 4ZDHA 2YPLB 3V5DA 1U8KA 4GG6E 2HJFB 3G5ZA 3S3JA 4WEUD 4Y1AA 5I76B 4B7LA 1HHGB 2PO6D 5JHDD 1XCQB 3O0RH 1EHAA 1OGAB 1E4KA 1ODAA 4DKFH 1HHJB 5C71A 1EEYA 4WWKA 4WCYL 4X6DF 3SJVD 3P73A 5E8OA 3H9SA 4S1RL 1S5HA 1G7LB 1ZLSH 1KN4H 3MXVL 4HS6A 4XZUA 1KYOK 3F7QA 5JHDE 3LZFL 4O2FB 3NH7H 2A6KA 4DGVH 1SHMA 5FM4A 2XTJD 4KXZI 1JGVH 4OCRL 1BX2A 2AJSH 4HWNA 1YNLL 1S78D 3WO3B 1LEKA 2I5YL 4OZIE 1AGCB 3IAGC 5F9WC 2N4IA 4XI5D 2C3HA 1EAJA 1MCDA 3MZGB 5FYJE 3HC3H 3GBMH 5JZ7C 3O0RL 4PJCE 3KPOA 5D93C 4DKFL 1MCBA 2AEQL 5L88H 2XN9D 4LFHG 2CLRB 4X7TA 2MKLC 4Y89A 4CADA 3OMZA 3B8YA 4NN6C 1ZLSL 1KN4L 2B4CC 5JIKA 4L1DA 5F71A 4F37K 5JUEH 3DRQA 3QEUA 3NH7L 3QXAB 5F6HJ 4DGVL 4WWID 3KPSA 1OTSC 4HZLB 2XQBH 1JGVL 1WT5C 3QIWC 2J5LC 4KI1A 1CFNB 2PXYC 1NC2A 2ICEB 2IQAB 5KVDH 4YLQT 1SVCP 3TO4C 3RVWD 3V6FA 2A0LC 4RZCA 4D0BB 4NRYB 1YY8B 2AV1A 2OQJA 3GBML 3HC3L 4HMEA 4I4WB 1UJ3B 2PNDA 5TE6L 2DI8A 1ZLUH 3O45B 3TH4T 5MI0B 5L88L 1MVFA 5CS7A 2WBWB 4P48A 4JB9H 4TUOB 3VWKA 2FIRT 4QHMA 3VCLB 4LCYB 5EA0H 4PRPA 5J1AB 2AJXH 5JUEL 5FF6B 3FN9A 3CH1A 1F4WH 1WV7T 3B5HA 3QFDB 3NACH 1G6RH 1PSKH 4GFTB 3O3AA 4H26A 3SKJH 4JO4H 4G9FA 3MV11 1Y0LA 2XQBL 3MRGB 4JO3H 2NZ9D 4Q97A 3O3DA 3OKOB 1GZQA 3RWIB 5KVDL 5C0JB 3DUUA 3IF1B 2P5WE 2PTUA 4OZHF 5CGTA 5C08A 1G1CA 3VRIB 3UTSD 2BSRB 2R1WA 4OZ4A 1EFQA 5HD8D 1BOYA 3WNPA 4U49A 4LLWA 2GAZA 5IIEA 2Q8AH 4F9LC 4JM2A 4YHIB 2BSSB 4HFWB 5CZXC 1KEGH 2VLRB 4JB9L 1CR9H 1UB5A 2D9CA 2ZG2A 5KS9E 5C0CA 1HEZB 4FHBD 3PL6B 3N1PC 5KAQF 3VXSD 4ODUB 3A67H 1UB6A 2AJXL 1F4WL 3NACL 1G6RL 1PSKL 4HDIB 5F1SA 3PWLA 3QT2A 4O4YL 4I5BB 1XAUA 4LCUA 4JO3L 4BQ8A 5DS8A 2WWKT 1ZVSA 5AG9A 4YC2B 4MD0A 5IB3B 4MNGB 3HCVA 1EDQA 4P2RD 4X6BA 1CU4H 2DYPB 5I8EA 3QQNA 4PG9A 2VXTH 3HLAA 3BYYA 3GMOB 5E8DH 1NGPH 3G6DL 2BOBB 2ARJA 2Q8AL 3VXNB 43C9A 3RGVD 5I66A 4FQPA 1DR9A 3R4DA 1KEGL 5T1LD 4IS6A 1FG2A 1CR9L 2C1PA 2YXMA 3CFCH 5FECB 1DL7L 1FL6B 5EORH 4PLKC 1T0MA 5D1QA 2FLRT 2Q6WA 1AKJB 5DA4A 5E1AA 1CT8A 3SOBH 5CAYB 1A6PA 1RJZB 1C7SA 2W91A 1ZLWK 3WNOA 5FM5O 2HLAA 3MBEB 3IDIA 2LE9A 1I75A 1MPAH 2LTQC 2HJKB 3N1GC 5GRWA 4APQA 4WFGD 1FYTB 2OL3H 3NCJH 1T89A 2BC4A 2I9LA 2NY2B 2I9TA 1O5DT 3CJJA 1F4HA 1UJ3C 2AERT 1CU4L 3QUXD 5MI0C 2YPKA 5E8DL 3ROLA 4KV5E 4KKAD 1NGPL 4OUUB 4F7MB 2GYSA 5DQJA 4M9OA 1T03L 4NN5B 2FJFA 1RUPH 4E0RB 4M62H 3CFCL 5ENWA 3IJSA 3EJZC 1T3FB 2W9DH 4IOIA 5IMMB 2QHLA 4J12A 1JF1B 5C0FB 4GRLA 3WNMA 1F90L 1KV3A 3GMMB 1MPAL 4LLQA 1A7QH 2PYEB 3MLYH 2J8UA 4PIRF 3SY0B 3V5HB 2OL3L 3NCJL 2YN3A 1X5XA 1KTDA 5DVOA 4EI6A 3MRFA 2X1OA 4LOUD 1RULH 4E42A 3C6LC 4BQ9A 3PQYD 1OQXA 4W4NA 5D7KE 4OTXH 4X83A 3I6KA 3BW9A 3DYOA 3ZKMD 5DT1H 2KZWA 5FYKD 3T2QA 3BGAA 2CIIA 4PP1C 3VFNA 4OB5H 4WY7H 4UV7H 4M62L 4Y16B 2NX5E 1MJJB 4MXWL 2XY1A 4P2QB 4ENEC 4XCNA 5HHVH 2FH6A 2ZWLT 3EDFA 3CDFA 2W1NA 4PBXA 3FOMA 2QQLH 3DX8A 1A7QL 2PCPA 2YC1B 3MLYL 5FYKE 1EAPB 2UYLB 5DK3A 4LKXA 3LN4B 3KXFE 3MFFB 4PY7B 3FT4A 3KWWB 3TBVA 1WUNT 1ZT7A 4G42B 4NQVA 1RULL 2PW2B 4OCNC 4IRJD 1RIVH 4MHHG 3EOYG 2IAND 3D9AH 2ZCHH 2ZNWA 3VXUA 4OTXL 5B39G 3EYVB 3GHBH 5KSBF 5DT1L 4R96A 1VKXB 4YHZH 4OB5L 4UV7L 4RMUA 5JNYA 3O3BA 3FL7A 1G1YA 5BJTB 3MBEC 3CFDB 2D3VA 3MACH 5I1AA 5HHVL 2YSSB 4L9LB 1CK0H 1UM5L 3RX8A 3DURB 4ZYKB 2QQLL 3V52H 1U95A 2NY2C 3BO8A 2ZCLL 5FYLH 3EOAB 5DD3H 4X98A 4NT6A 4OCWH 3HPLB 4JFDD 1R5WB 1T1XA 4RMVA 4KZDH 5T5FH 2NXYC 4PJGB 1FVCB 3VFRB 1ZHLB 1V3JA 4Z5RB 1RIVL 3BIBX 1QFUH 4WI5A 3D9AL 2ZCHL 3DVFA 4F7EA 5B38A 4R7NA 3GHBL 4F33A 2C1OB 1TTUA 4OBSA 4LDOB 4YHZL 2HN7B 1U3HA 4UQ2B 1JIBA 4KXZH 4MZ2A 3O4OB 2ITCA 5ICYB 3L5WB 1CGWA 3AS1A 3MACL 3VA6A 4PJBE 1GGUA 3UCRA 5E8PA 1CK0L 5E9DE 5ALCH 1XR9B 3CFEB 1YPZE 2W0PA 2CXKA 3F6IA 3GSVB 5FYLL 5DD3L 4OZFB 4OCWL 3E6HB 3HKFA 1GGIH 3GSXB 3PXJA 2G9HB 1AGDB 1S9KC 3ULSB 5T5FL 1JK8B 1RFDL 1IAIH 3V8CA 3WNLA 4Z18A 4P3DB 1MF2L 2DBLH 5E8NA 1QFUL 2VQUA 4YIQB 2DDQL 5KSVB 4L8BB 5I17A 1A22B 1ZHBB 2O61A 4MA3B 1C5BL 1RURH 2CQVA 4I9WD 3TO2B 4ZPTB 3MR9A 2YS4A 1OLZA 4NQCD 2VKWA 1BQHG 2P5EA 3GMNB 4KKLD 3ZHLA 2GJZB 1ZV5A 2LVCA 1VADB 5JDSB 5ALCL 1IEAA 3G6JB 4RAVA 1MCCA 3KLAA 3D2UD 4MQSB 5F7MC 5F9JB 4PJXF 1FIGH 1FNGA 3GBNH 3QI9B 4NQCE 1GGIL 4ZXBD 3CVHL 5D7JB 3CIQA 4EI5B 1IAIL 4YAQA 4P2CG 1DP0A 2HH0H 3QNZB 2DBLL 3FRUB 3MNWA 1N8ZA 4JJ5A 4F57H 2E7CA 1RURL 4Q2ZB 1N0LA 1QO3A 4IIQA 1N26A 4OFVA 1SVZA 4WUUA 3MNVB 5J6GA 1QFWM 4L9LC 4EQ2A 4OV5A 5FUZH 4ZFFB 1XF4B 3D69A 4ZODA 4P0DA 1FV1B 3C5SB 3BWUC 2VLKB 3KLSA 4GRMB 1BD2A 3U6RA 4ORGB 2FWOB 1I8KA 2PW1B 3U4EA 1UKSA 5BZWA 3GBNL 4NC1C 1RHHA 1ZAGA 3UZQA 5CJ5A 4N9GA 5ID1A 4HUUB 2Y72A 4YBLB 3U82B 2BY3A 2OM5A 4MNQD 2QKIB 3SGKC 2ESVD 2HH0L 1OVZA 5SWQA 3R8BB 4F57L 4F2MB 3WYRA 1JGLH 4LLVA 1IGJB 3O4OC 5CBEB 2AQ3A 4NPYB 1ZKAA 4XH2B 1QKZH 2Q1EA 3ZKND 3GRWL 4L3AA 4PY8J 2E5EA 1DQMH 4J6RH 5FUZL 3PG2A 2RHEA 2AKRA 4OM1H 4YHPA 4B0MM 4L29A 3GB7A 5IMKB 2NMSA 5H94A 1YNKH 5E4IA 3EYQD 4EVNA 2HVKA 1QA9B 3KGRA 2EC9U 3QFJB 4C54A 3B8SA 4NQED 3E3QE 2VTFA 3SO5A 3GGWB 4RMWA 5L2KA 5LQBH 4P4KC 2EDWA 2YUVA 2Q76A 1JGLL 4PGZA 3GK8L 4GXUN 4NZDA 3VFVB 4X9HA 1I1AA 3SGJC 3JTTB 3JVGA 2IAMB 4Y5XA 5J8OA 1QKZL 3GMRA 1F58H 4KJYB 1CDCA 5FKPB 3CFKA 1L6XA 5HVGB 2VXQH 2IALB 4M7KH 3OHXA 1DQML 4J6RL 1MHPH 2GTWB 2EH7H 5DEFB 2WNGA 3GSNL 4P5MA 1TZGH 3VGFA 3G9VA 3QI9C 1YNKL 4W4OC 5D7JC 3VFOA 4OQTA 2R2BA 4QHUB 4QHLB 2X4SB 4AG4H 3MGTA 3Q1SH 4NSKB 1U8HB 4GG6B 3ARFD 4NWUH 4G3YH 1JWUB 3D85B 4PTTA 5ISZA 3JBG7 1Z2KA 1MSPA 1R3LA 4DQOL 2CJUH 1AO7E 4XCCH 1F58L 2V7NA 3SDCD 4KRNA 2VXQL 5HYSG 4M7KL 2P8LB 3RY6C 1MHPL 2X40A 4PJ8C 2EH7L 2PO6B 5JHDB 1LK3H 4DFHA 1TZGL 3V6ZA 4CVUA 5D7LA 1KB5H 3P77B 3V0VB 1RZIA 1T1YA 3MFGB 4YBLC 3T2NH 3ZTJG 3SJVB 3MXWH 1DQJA 4AG4L 2HKHH 5ILTH 1SEQH 3Q1SL 3MJ6A 2HVJA 4AQOA 5IB2A 4G3YL 4NO0A 3O8XD 3BGMB 1QUNA 4HIIA 4BKLA 3HE7A 3DETC 3O2WH 3WV0A 1LD9A 5FKAA 2H41A 2CJUL 5EU6E 1S9VA 4DK6A 5IEKA 5GISH 4X5XB 4FQXB 4XCCL 4LVOB 1CFVH 2YZ1A 3HAEA 1QD0A 4L3CA 1A6ZA 1LK3L 5C0ND 3RWHA 4NO5A 4XNZB 3T04D 1KB5L 2XN9B 3T2NL 1MHHB 3MXWL 3MGOA 4GW1B 4DW2H 3GDBA 5ILTL 1SEQL 2NY5H 3H3BC 5L8JB 1ZSDB 1Y18A 3NA4A 1E27B 4ONHB 5EB9A 3O2WL 5EU4B 5IJVB 1J88A 2IAMC 2CKNA 1XFPA 5CJOH 2IH1A 1OOAA 1XEDA 3O6FA 5GISL 3H7LA 3VFPA 2OI9A 4U1GB 4FFYH 4KWUA 1CFVL 2FO4B 1SJEB 4U1KB 1LO4H 4NNXB 4NBZB 2GI7A 2DLFH 1CIDA 3HG1D 1LEGB 3PJSA 4UDTA 3KPQA 2L7JA 4G8EA 4J1UB 4NQDD 1S7VA 5C09D 4PTUB 1AC0A 4ODVH 4DW2L 2NY5L 3AS2A 5BW7A 2P5WB 4JKMA 4WU5B 1RIUH 1DBKH 3TYFA 5HI3D 3MSPA 1MCIA 4FZ8H 4L8SB 1XF2B 2WP3O 3HC0A 4TRPH 5J1TC 4RWHA 4PJDA 5ICZB 5CJOL 4NQDE 2XT1B 4I8DA 3MMEB 1I7UA 3WXVL 5KS9B 4FQ2H 3MRJB 4QF1B 4FFYL 3WS6C 3OV6A 1LO3H 3MRMB 2W07A 3LSOB 4DUXA 5I1DB 2H32A 1LO4L 3EYFB 4OSUH 4P9MH 3VFWB 2DLFL 4B41A 1X6NA 1G0YR 2EC9T 2FHCA 4HJ0D 2D7QA 2V5TA 1LDSA 2DD8H 2Y23A 3N0PB 4KTEH 4JRYE 1BLNA 1INDH 3T8XA 5EC2B 4ODVL 5D2NB 4QY8B 4Q0XH 3OF6D 4JDZB 3PP3K 1RIUL 5IV2B 3DTXB 2OZ4H 1B0WA 4LLMB 3VXSB 4FZ8L 4OCSL 2UY7A 1AY1H 2ZP0T 3U2SA 1S5IH 3V4UH 4TRPL 4FQXC 2GTZA 1KXTB 3UTOA 5C0EA 2YRZA 3GI9L 3ARTA 3KVQA 4FQ2L 3W5MA 4TVSa 1LO3L 4HSQA 3U83A 3QDHA 3C09B 1BIHA 3EJJX 5SWSA 3S36X 4XNZC 3RAJL 4P9ML 4FQIH 3TNNB 2YUWA 4GS7C 2DD8L 4KTEL 2IH3B 4NCDA 3RGVB 1NCNA 5HPMB 3FO0H 5A2KH 1ITBB 4NBYB 1NAKH 1NGXB 3IS1X 4JDVB 1QBBA 2DQUH 4IMKA 4Q0XL 5HXMA 1FVDB 3RZCB 3H9YA 4IBLT 4YPGB 1DTUA 2OZ4L 4NO3A 4KH2A 1TXKA 1M05B 4KDTC 1PAMA 2VDOL 3S4SG 1U6AH 4G8FB 1P1ZA 4JY6B 1AY1L 2QSVA 5EU7E 1S5IL 3V4UL 2NY3B 1A1NB 1TVHB 1EUTA 2UVEA 1I3VA 3RVWC 5HYJE 4WHTA 1J5OH 3NIGF 3OSKA 5AEAA 1CQKA 4P5KB 4HPYH 3U30B 3QUZD 3IDJB 3OJMB 4K7PX 3GMPA 2V17H 2X2YA 2A6JA 4BJLA 1CXEA 3FO0L 3LHPH 1LO0H 1NAKL 1IFHH 1OSPH 2DQUL 5DHYB 4HS3B 1RI8A 1U6AL 1F5WA 1C16A 2OTPA 3MRHB 4YNYB 5EO1A 1I3GL 4I1NB 3MJ9A 4EDWH 1DBBH 3S96A 1JGDB 4MD5B 5D7IE 1NCAL 3S3SA 4KJQC 3DX6A 1J5OL 1HXYA 2Z8VC 1YMHB 5L7XH 2W9LA 3ARGA 4NOFA 4PLNC 1D6VH 2MQ0A 3CMOH 2OP4H 2X4UB 5F1NA 4HPYL 1JRHI 2V2WA 3L5IA 1CVSC 1S7QA 1MWAH 3PQYB 3BEVA 4R4BA 2CKBL 4S1SH 5M95B 2VLJD 3MJ8A 5MEQB 1MLBA 3ISWA 3OBAA 5GS1A 3LHPL 4PREA 1LO0L 5HGBB 2EXWC 2P8MA 1OSPL 1S3KH 5DRNB 4KROB 5I1LB 5IMLB 3TGXA 3KXFB 3TCXA 5EOTB 3MRDA