3P4OA

Crystal structure of h2-kb in complex with the mutant np205-lcmv-v3a epitope ytakypnl, an 8-mer modified peptide from the lcmv
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
278
structure length
278
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 67
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p4oA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3p4oA01
4HHAA 3KPTA 1RZIB 3GJFA 2UWEF 1S7XB 3ZYIA 2BSTA 3FOLB 3U7WL 5IESL 3HG1D 4G9FD 5FA4A 2BRRH 2D0GA 2GFBB 5A2LH 4MNQB 4B5EA 4GFTB 1YN7A 1GOGA 2D4FA 2OI9A 2X4PA 4AEHH 5B39B 3RVUC 3A6OA 4LPWA 1BREA 4LQFL 3IDJA 2VDPH 3MLXL 3TA3C 3DURB 1NAML 2EEDA 3LMJL 3O0RH 4LU5L 4UAOC 4WW2B 3F58L 4DOHB 1UACL 1WFUA 2IWGA 2Q86B 4WHDA 4XB8A 3NZ8B 5CILH 3P9LB 2VO5A 5I2IB 3LVEA 1HYSC 1UCBH 5E2TH 4K8RH 2XZCL 3RAJH 3R8QA 4MNHB 5BS0D 5E70A 1C08B 4U1NB 3RVVD 2O5YH 4PJGB 5CEXA 1IAOB 4KJQD 5F6HJ 5FGCB 2UWEE 5IB1A 5HDLA 3T4AA 1L9MA 2OTUA 2UY7A 3GM0A 1Z9MA 2NY4B 2G60L 4OKVB 4WW2F 2EYSA 3ESUF 5D7LA 1QFWM 5GGRA 1YECL 1FSKB 1SYVA 2Z8VC 5D1ZC 4HLZG 3KJ6L 4NP4H 5HY9A 5BV7L 4JO4H 4M9OA 3LEYH 3DIFB 1MQKL 2MWCA 3FO9B 5AZEL 1EBAA 1BP3B 4LCUB 3VWJB 4P23A 4HAGA 1JPGA 2FRGP 3TO4B 1LO3L 2CUMA 3VWJA 1A8JH 2NY0D 3IDMA 4KROB 1EVTC 1JFQH 2Z31A 1I9RH 4N5EA 2GY7B 2JB6A 3HAEH 2WQ8A 2WINA 4NJ9L 1KIQB 4I3RH 4I3SH 4M8QB 3RWGA 4WTWA 4HG4J 5DXWA 4P2QB 1CBVH 2A1WL 4PJBF 3PUCA 4HT1H 1CF8L 3U9UB 5D2LE 2JB5H 3WO4C 3PQYE 5CP7A 4ZFOA 1HWGB 2Z92A 5EUOA 2G75A 1U8JA 2VXQL 4OV6F 5IV2A 4PGDA 2H45A 3FOLA 2W0FB 4MLIA 5SX4I 1P4LB 4IMKA 5C0BD 4WU7A 5TFSH 1FZJB 1U91B 4J3WA 4PJ9B 1AP2B 2DQHL 1E6OH 2AV1B 3MLPA 1U91A 5ILTH 5DEZA 2AXFB 1JF1A 5TQ2L 4V1DB 1HINH 5KZCD 4XWOD 3HG1E 2FGWL 4NZRH 1UJ3B 4Z7QE 3GSNB 5I1AA 1I1AB 1X9QA 1TJHH 1I3VA 1UVQA 2HTLD 2W60B 4D9LH 3S9DB 3INUH 4F7EB 1SJHA 3DX6B 2EE2A 1H5BC 5EU7E 4A6YH 3ELAT 4ODHL 1QSFA 3DTXA 3PQYD 1UB5B 5D93C 5A3ID 1MEXH 4LMQE 3PWNB 5IHZB 4OZFH 1E27B 4EVNB 2FO4B 2ATKB 3BO8B 2FGWH 3G6JE 4Z7OF 1QLFA 1BFTA 4O5LH 3RA7L 4LHUD 4KJPC 3BUYA 3DGGA 2XWTA 1FRGH 5HYJD 4NCDA 4J23A 2APBA 2NR6D 3IVKA 5DD1H 3VWKB 1MH5B 4QHNB 3QI9A 3NACH 2B20A 4JN1L 3WDIA 2YPLE 1PJ9A 4M3JA 3D39E 2BMKA 4Z7VF 3IF1A 2GTWB 5EZIL 1MCJA 3KYAA 1K3ZA 1IKFH 1WBZA 4X6DF 4P2OA 3SDDA 5I1JH 1H3PL 3VXME 4PJ7E 3BPOC 3D1MC 4MA3A 3UJTH 2IFFH 4AL8H 2UZIL 2BJML 4U1HB 3HS0A 5C1MB 5J7CC 1NANI 1A7OH 2V6HA 4YHZL 1N5AB 3WXVH 3BW9B 4AZ8A 3KPPA 2V17L 3L3OB 3D18A 3UO1L 3TT3H 5KANI 1LP9A 2P46B 5DJDA 1OD7A 4O00A 4I8DA 4ORGB 1AIFA 5BW7A 2V7HA 4PJ5A 4LSSH 1D5ZA 1HILB 5F44A 4HIHA 1A7OL 1EZVX 4L3AA 2YWYA 5HI4D 1RJZA 4Y4KA 2VYRE 2XZQH 3WJJC 4ODTL 3VWKC 2IPKA 2XPGB 5CBEA 4RIRA 3MBEB 5F89A 3CX5K 4G80A 2R4RL 3U6RB 1LVEA 1QUNA 3EOTH 1BF2A 3GO1L 4NKDB 1XGQA 2K7QA 43CAA 4UU9A 3HE7C 4DUWA 4QKXB 4M7ZB 1I1AA 2DTML 1HHKB 3ULVH 3NFSH 1MCDA 1VFOA 3DXAD 5LXGL 3DPBA 1GOFA 3TH2T 4PP8C 1G7PA 4WHTB 4ZUWA 4DN3H 3BKYL 4YX2L 3WDHA 4AT6B 2BY1A 5EBMB 4ODSL 1MHEA 2PYED 3S88L 4KJPD 1F5WA 4OGXH 3U9PL 4JO2H 5E9DE 3Q6GL 1S7SB 3S34H 1U3ZA 5BCAA 4WU5B 3KXFA 1IC5H 1NBVH 1NUFA 3ABZA 5AZ2H 3UYRH 2NY2D 3E1F1 3VFWA 5CCKH 4OF8A 4LSRL 2F15A 8FABA 3V6FB 4JPWL 4JO4L 5EO9A 5D1XA 1NGXB 4PRPB 4K94L 4Z7VE 4LIQH 1FIGL 4X6CB 1T20A 2D0HA 3EJYC 1TDQA 4B7LA 2HTLC 1CI5A 3RL2B 3LRGA 4U2ZA 3QCVH 1L8JA 3FT4A 1UXSB 2H3NB 3WO4B 5LBSL 5GHWL 3HZMA 2DIJA 5GGTL 1S8DB 3MRJB 4N8CH 1YEEL 2E3VA 1H3UA 4KMLB 3RI5F 3TCLB 3VH8B 5C3LD 4YHIA 4S2SA 3O6LH 3TCLA 3VH8A 5L2KA 4U05A 3VCLA 4W81A 2MTPA 3T0DA 1WFNA 2DLIA 1AI1H 5I1GH 1DE4A 5CBAA 5BZWB 4XH2A 1GIGL 4ZSOE 1YNLH 5IF0A 4FQ1L 4Y16A 5LBSH 2P5ED 3S3PA 1U8KB 4TOYH 4KTDL 5IMOB 1OAYL 5K9QI 2APVA 2GUOB 4FNLH 3EYUH 3GJFK 3LD8B 5LGKA 3QNYA 3ULVD 5ELIA 1MAML 3G5XA 3GJFH 4MQTB 1FVCA 1QFPA 5ILTL 2BERA 4ODTH 2XFXA 4ZFOB 1K3IA 1R3JB 1U8IA 1YQ2A 2ICES 4NQEA 1AR1D 1FP5A 1IEAB 4F33B 3ERYA 4JY4A 1ES0B 5C3TA 1LO4H 4NNPH 1TENA 5F9AC 3ROLA 3AREC 1I1AC 1AP2A 3KDMB 1OAQL 1MY5A 3TO4D 1AXTH 1V3JA 1DLHA 3CDYA 1IGJA 3S7GA 3T0ED 5B8CB 4WHTA 1IM9B 4NBZB 4JDVA 4P57B 3QQ3A 1DLFH 5L6YH 3PNWB 1D3CA 1Q9WA 2F53B 4L3EB 5DRZA 1EMTL 1ZHNA 4IOFD 5GRVL 2CDGA 3ULVC 5FA3A 1HHGA 2C1PA 5E1AA 1JHKH 1WZ1L 4LU5H 3P77B 1DQLL 1W72A 2GJ6E 3IFPA 4M4RA 1DUYB 1YC7A 4ZO9A 1CTOA 1KB5L 3N1FC 3PIQA 2EYSB 4BSVB 1BGXL 4NQCD 3MO1A 3E2HC 3T4AB 3ZDZF 1AD0A 4QXTA 3K8LA 5CHNB 3QCUL 1VFMA 2R4SL 4NYLA 1CLCA 4PG9A 4RFOH 4J4PD 2D7PA 4EQ3A 3PV7A 5D1XB 1KCLA 5C0BB 1MAMH 4PBXA 4LGPB 3V2AR 1AO7B 3G04B 4ODWA 3TT3L 1G7HA 3QUYD 5CD3A 1C1EH 3UYPA 1OSPH 3S4SA 1AXIB 4APQD 5HYSB 1C5BL 1QSFD 2GQHA 3PQYA 4ONFL 2P4AB 2ATPA 3C6LD 1MI5E 4U7MA 1NDGB 2A77H 1ZLVK 5A2KH 3VJ6A 1MPAH 2XA3A 2XZZA 1AD9B 2GEEA 1LP9F 1PY9A 4J4PA 4LLVA 4LMQI 4PJIB 1X5XA 3D85D 3WFDH 1FL5B 1NCAL 1TMCA 3L3DA 5I75C 4OZHE 3BDYL 2APWA 5I1LB 3GMPA 5ACMA 3RVVC 1G9NH 1H3XA 1NAMB 4HS6A 1DQTA 4GQ9H 3VXMA 4WWKC 3UPAA 3BHBA 5CJQH 3T08A 5FYKD 1KLFA 4WO4C 2ZJSH 1E4XH 2VLJE 1AGBB 2IPKB 2XPGA 5CBEB 1A6ZB 3C6LC 4L3ED 3C6LA 4M93C 4G6FD 2D9QB 4LCIL 2VZTA 3OGOE 1MSPA 4NC1E 3IDUA 1YN7B 1ZT4B 3L5HA 1AGCB 1UQSA 3WV0A 4RFNB 3B2UD 1A3LH 3HN3A 3V6BR 3HI1A 5FA4B 3IJYB 2OL3B 4Z7UE 5LVEA 3QWRA 3I6KA 3ISWA 5C07A 1YNTA 1P7QA 4WGVB 5C2BH 3QQ3B 3RL1B 3QSKB 1OAUH 4TSAH 1PKOA 2VTFA 2L0DA 5IVXA 1S7WA 1DLHB 4FZ8L 4P4KB 4UOW1 3RQ3A 3SE4A 5FO9B 2P1YA 3ILPB 1BIHA 4NHCL 3O4LA 1W0VB 1BD2E 2YEZA 3D25A 3EYFB 3I84A 1KN2H 4XVTH 4L8SB 1QBLL 2MNUA 1AY1L 3EO0B 3ZT7A 1FNAA 4X8XA 3NCYS 4FZ8H 1KCUH 4I5BB 4P99A 2J4WH 3W11C 1NFIB 1REIA 3DVNA 4G8GA 4XPBH 3UBXB 4FQCL 4S1RH 1MCIA 1KJVA 3QHFL 2W9DL 1DQJB 1DFBH 2I24N 4OLXH 2JKXA 2JB5L 4LSVL 5IM7B 3RRQA 1HSAB 2X9YA 1MJJA 1H8NA 3IJSA 3V6OE 4JKPL 4M3KB 3WJLA 3GMLA 4GAYB 4UAOB 5DJZB 3V4UL 1KF9B 4PYGA 5GJTH 1Z6JT 3C8HA 3CPLA 3WSQH 2Q6WB 1CFVL 2Y6SC 4NDMB 4CKVX 3SDDD 3C5JA 3VG0H 5K9JL 1MCNA 2E8YA 4LIQE 1KTLB 5TE4H 5FYJD 3VD9A 1C16A 1NCUA 5JNYA 4S2SB 2DAVA 4MVBC 1FDLL 3P30H 1YDPB 2XT1B 1A0QL 3FCTB 5EU3B 1T5XA 4IRZH 3VG0L 1TJHL 3EDJA 4N0FB 3I2CH 4YDIH 3S37L 3NIGF 3EGSA 2VLJD 3U0PA 2GUOA 1CFVH 3V8CA 3U2SA 4DN4H 3GNML 1KEGL 4I0CC 4XPFH 3G6DL 5DD6B 5KSVA 1BVZA 5FUZL 4NQDA 3MBEA 4GW1B 5F89B 4NQXA 4CL7A 5H37H 1UCTA 4Y5YC 3ARPA 4FFZH 1G84A 5FFLA 2COQA 4YAQA 2I5YL 2W0FA 4HEME 5HD8D 4NJAL 3ARWA 3HC3H 4UB0H 3U46A 1XF4B 4IS6B 4IJ3B 3S36L 3SE3C 2F74A 2GSIA 5CMAB 5HGHA 3BWAB 4GAGL 1Q38A 2ZSWB 1LK2A 3M45A 5DMKA 1P4IH 1N0LA 2CD0A 3E0GA 4MXQC 3GRWH 1OTTD 1NGPL 3CFIC 4F3FA 4AIZA 1TTUA 2CO7B 1F4HA 4MX7B 3LSOA 2R39A 3SDXB 3NCCB 5EBMA 4MCZA 1YEFH 1IC4H 4Y4FD 3QXAA 1I9IH 3FTGA 4H8WH 3LV3B 4R96B 2D03L 2XZAH 3I9GL 2RHEA 3N1PC 3PWJB 1KXQE 4DKAA 3DX8B 5I30L 3MNVB 4PDCE 2UZYB 4XPTH 2P24B 1MFCH 3IVKB 2DQJL 3BSZL 1QLEL 3FZUC 3UJJH 2X05A 1YNKH 4PV9A 3MMEA 3RIFK 1T1YB 4AJ0A 1BBJB 2X4TB 3PHOA 2HFEB 4N0CC 1G9EA 2ADJA 3O9WA 3IFOA 4HX1A 3GM8A 1B0WA 3GSVB 3CVHL 2AQ1A 3GGWA 3OAZH 1YNKL 3RTQA 3IAQA 5M94B 1K4DA 1ERNA 5JW5A 4CW1B 1C7SA 1BX2B 5MI0C 4BFIB 3QPQC 1IM3A 3RDTB 2DYPD 3WN5B 4H1LB 3FN0H 3HE7D 2XTJE 5DJ2A 3V7AE 1N5AA 2DYPB 3HRZA 1KCUL 3PWUB 4NO2B 4RMVA 1J1PL 4KGJA 2AI0L 4IJ3C 1F3DH 5FYLE 2VLMD 1A02N 3GBLA 1CXKA 4EDXA 1MIMH 1A0QH 4L3CB 4JZJC 3E6HA 2X7LB 3DUSA 2QKIA 4WFGD 5DVMA 4EN3B 1N6UA 2XG5A 1HYSD 3F8UB 4MQXC 5I1LA 2Q3ZA 3HC0B 3ZYZA 3MRQA 4YHYB 4CN1A 3QCTH 1QSFE 4UI2A 4IHOA 4PGDB 4RGMC 2J8UF 2WBJD 4R97B 4I0PD 1WT5C 4TVPE 5TF0A 2E9JA 3HR5B 3W39B 5HVHC 3MJ7B 4DGIH 3EAKA 3E2HB 5ITFA 2CKBL 4DQOL 4PS4L 5F6IB 1S9XB 1WTLA 2R9HD 4FABH 4CMHC 2OSLB 4U1LB 2ICWJ 5FB8B 3UBXG 3UJJL 3BYTA 4LSTL 5J9PB 4GXVH 4ERSH 2GI7A 1ES0A 3OF6D 4GRWB 2GTZA 4ZFGH 3GMMA 6FABL 2VKXA 3BIKB 4MA1B 2ARJA 2EDXA 1P7HL 5E08H 1UQSB 4YGVA 1NUGA 3QDMB 1FC1A 2CKBB 3OR7A 1BWMA 2X41A 3CJJA 4KRLB 4M61A 3BGFB 4GKSA 4Y5VC 5DI8A 1PSKL 1OB1A 5INCA 1ZT1B 4CU6A 3FB5A 4LLWA 1QPPA 1TCRB 1MFBH 4PG2C 3WS6C 1JZ7A 2E9BA 3GJEB 2DKUA 5E2UL 5CLWA 3UZEA 1ZA6B 5AWNH 1M71A 4ZUSA 3PDOB 3PDDA 3PIQB 1ODAA 5E94B 2V2XA 3QDAA 3UCRA 1ORQA 5J3HD 3BP5A 3GI8L 4F7PB 4L9DA 1J0YA 4NO3A 4PGCA 2YR3A 4H8WC 3ZKMC 2VE6B 2NTFB 5T3ZL 4O9HL 2KQNA 3FQXB 4PP2B 1X5KA 4U1NA 3P0VL 3MUJA 3K1KC 5MEQB 4HSQA 1BGXH 2JJSA 3O2DL 4LAQL 1J86A 4KKBD 3MA7A 4JFZL 3VRLF 5IOPB 4HKBA 4OZHA 1NC4A 1ZANH 3WUWB 5JW3H 3MCLH 1X4YA 4TPRH 4LSQL 5SWZE 2B1HH 1AE6L 4NO2A 3GMLB 4N8VA 5GGTA 3FHQA 1R3HA 3TO4C 1KBGL 4NRXA 3WN5A 4XXDB 4L8DB 1A9BB 3VXTB 4LP5A 1I7RA 1DEDA 1IM9D 2DMKA 5DRXA 3SQOL 1B90A 1EEUA 3MRRB 1VKXA 3FB6A 2XOTA 3OKDB 4IDLA 2VXVL 1OCWL 1C5BH 1UYWH 4L1DA 3SN6N 4WO4B 2IH3B 4YDJA 4E42B 5HHXH 5I8EA 3IKCA 4GW5B 3GB7B 5DJAB 3EDDA 1F58L 3M07A 2DQFA 5GRWA 4XGZB 1OQXA 2VABA 3QDJD 4YHPB 1F2QA 5JUEL 1JGUH 4X98B 1HOCA 1T6WA 4MVBA 1XF4A 4IS6A 1NKOA 5JO5B 1CD1A 4DAGH 3CDFA 5DHVB 1C5CH 2DI9A 1BJ1J 3FQUA 1QRND 4R9HA 4BKLB 3R06A 2ZJSL 2J12B 1IVLA 5JQ6L 3QCUH 3ZKXC 4JGMA 4NKDA 3P9MA 4XNQB 3L3KA 2A73B 2AXFA 4PY7B 1J1OL 3VXPA 1XMWA 2ZUVA 4TSBH 1YMMD 4QXUL 1T4KA 2DQEL 5CJXC 1HIMH 3MGTA 1YEHL 3HHRB 5JIKA 4AIZB 4YFLI 1T1XA 2C3VA 5F97E 3V6ZB 5IBUG 4POYA 3LS5H 1LNUB 3QULB 4X4ME 1VPOH 4LFHD 4JGUA 2JK5A 1ZT7B 3VD3A 4OCSH 5C0JA 1Y6MR 4UDUA 5AD0A 2NW2B 2YD7A 3GMOA 2ICWB 3EFFA 4WW2A 2Q8AL 3V4PL 4N8CL 5D5ME 2GK0A 1DVFB 3MRGA 3VFOA 3QA3A 3TZVA 4LHUB 4FS0A 5FUCE 5A16B 2VQ1A 5HHOA 1F02I 5GS0H 1XGRA 5IM7A 4Y1AB 3MXWL 4RAVA 4PJBA 4JPWH 2KPNA 5IVZA 4JPKL 1I1FA 2HLFD 3MOBH 4N5UA 3NCJH 1J0HA 4XZUB 4BH7A 4YHIB 4Y7MA 2B5IC 2X1QA 5EZJB 1HH6B 4I77H 1AO7A 3A0OA 3MCG1 5IROA 1TVBA 1RMFL 1JGLH 4FNLL 1FRGL 2J8UE 1HYRC 2R0KH 1NFDA 5HYJB 3BP4A 1ZHBA 1OHQA 1FN4A 4IRJA 4NT6A 1CF8H 2AJVH 4WV1B 4GMSH 2Q87A 2XTJC 3IDXH 5AYUL 5A40E 4E42A 4OZIB 4K2UL 3RWEA 1P7KA 1FGVL 2FSEB 4Q9QH 1KJ3L 4N0FA 2P43B 4LP4A 1U95A 3HPLB 1KG0A 1X5FA 4TUJA 4CVXA 4MXVF 2RQ8A 4M6NL 5E5MA 1VHPA 4ZFFB 1N8ZA 3R0NA 3L6FA 5HHVL 4HUVB 1JNLH 5DK3A 3V95A 2G9HB 4JRWA 5KANG 3U9UA 3VFRA 1PVHA 3FQUB 3O81A 4APQA 3SEPA 5EWIH 1DQDL 4LF3A 1Y18B 1JZ3A 4PUBL 1HOCB 3U48A 3D3VD 7FABL 3QUMB 4ZOEA 4UV4H 2VMFA 4NPYA 5ID0B 2PXYC 4DFHA 5ICXB 3HB3D 3IDYC 2OK0L 4HQQL 1YYLH 4XNUH 2QQKH 2YA0A 4TVPH 5IQ7L 5CJ8A 3ARGC 2IAMB 1S7QB 1I8KB 5HHXL 3MV7A 2Y36L 3GI8H 4AYFA 3GIZL 3CSYA 1J18A 2YSSA 4LDEB 2CUIA 4X4XB 5C0CE 3D2UB 4JQVC 1S3KL 1IGYB 3VWKD 3VXOB 4ZFZA 1T66C 4N0CD 1Z5LA 5E2WL 4ZTPH 2OR7A 2VISB 1B2WL 2XQBL 1FFQA 1N5YH 4HLZH 1YPZB 2A6DA 5HJ3B 2WBJA 4XCCL 4JRYE 1TFHA 1S3KH 2ATKA 3SHSA 5DTFA 3DX7B 5KVDH 4PJ9D 3VDBA 1NGWA 2OTWB 4LAJH 4ZO8A 3MV01 3ARDB 1DUZB 1GH7A 4KKLD 4EI6A 1H3WM 5F7FA 1U8MA 3VXNB 1GGBL 3QUZC 4JQXC 4OD3L 3RTQB 5A3IC 3HR6A 3GHEH 3T0BA 4CVUA 5CP3A 2KUTA 4FXKB 2W0KA 4O2CB 3HNSH 3MO1B 4GLRH 4ONGL 3UAJD 4Z7UB 2H26B 1HI6B 1ZTXL 2NNAA 2XKNA 3UTSE 1BPVA 4Y4HC 3MROB 4WUUB 4TVSa 1QNZH 3LN5A 4JAMA 3V0VB 5LG1A 3MLWH 3HE7B 3U7YL 4OCMC 5I16B 1OTTC 2HA1A 2NY7H 3QJFB 5DJ8A 4HD9A 3SKOB 1ZSDB 2YBRB 5FUOL 4G8IA 3SJVE 1YEFL 1P2CA 1GGIL 5HHMB 2XQYG 5F88B 1QNZL 1F4WL 3C5ZA 2W0PA 5ANME 1FV1A 4H5SA 5KBNC 1Y0LB 4FQJH 2X4SB 5JOPD 4P5TD 1RFDL 4DZBA 5MEOA 3VXUA 5H8DA 1RJZB 4AM0B 3HAEG 1PG7H 1VEMA 4X9IA 2EEAA 4TTDC 4PJ5E 1FG2A 3X14A 3QWRD 4YXKH 1S7VB 4DUVA 1NCWL 1I8LC 3F5WB 2B4CL 1S7XA 3PG2A 3GSOB 1MI5A 2K7PA 4ZXBC 3DNKA 1QA9A 4LLUB 3EYUL 4Y5YB 4KMTH 4NC1C 3U0WH 1T66D 1N26A 4JY5H 4OUUB 3AS3A 4JM2C 4PRAB 1T5WA 3N0PB 1QLRB 5DJXB 5IW1A 2EIBA 5C0BE 4YPGA 1RZKH 5EC2A 3LRSB 2O5XL 3IAGC 3IGAA 3NOIA 1NQBA 3UYOD 4OLYH 3NVQA 2Y6SD 4MXVE 3KWWB 3LKOA 4QRUB 3FN3A 4ODHH 2BVOA 4JRYB 4F7CA 1LDSA 3HZVB 3TYFA 5E9DA 1IGCH 1KTDB 3QWOA 5C0ND 2NW2A 3GMOB 2BVQB 4ONHB 1N6QH 4U0QB 4YXLL 2V5RA 3KYNA 3X13B 4EN3D 1IEBA 5E8NB 5C0CB 5SX5H 1JF6A 4JFQA 3AS0A 1QHOA 1MELA 1SM3L 4DKFL 2ESVB 1Z0NA 1FZMB 5ACZB 4MD5A 2I60H 3VFOB 2V2XB 1AD0B 2JELL 3L3GB 4QXTB 4BZ1H 2WBJB 2PYFB 4LBEB 1R6VA 4BSVA 4KK6D 1J0KA 3CH1A 1A6UL 2FO4A 1EEZB 3VXSD 1VACB 3N1MC 1P53A 3L7FB 4WI3A 1IKFL 2AK1L 1ZLVH 2NLJB 5ESQB 2FIKB 3ZTNH 4G8GE 2NTSP 2VR5A 3NCBB 3GMNB 5LCVL 3QHZH 4XXCA 1I7TA 3DSNA 2BMKB 2VKWA 3KYOB 3RX5A 1P1ZA 4N9GA 1Q0YL 1RI8A 1INQA 2FX7H 4KUCD 1VB9A 1CE6B 1RVFH 1FSKC 1YEDA 2BCKB 3IXTA 2P5WE 2WK2A 1UT9A 2KZ1B 5I1DA 5JW4R 4QHMA 3IJHA 32C2A 3NN8A 4M6NH 4QCIA 1JN6B 4YHZH 2VB5A 1BQHG 5DJYA 3GSUA 4Y16B 5MEOB 2KH2B 1EO5A 1W8OA 2X1XR 4WFHD 1T5XB 3MACH 2IBZX 4KROC 2Z8SA 3ZKMD 2F53E 3BIAX 1R0AL 5TPWH 1DL7H 3JWOC 3IB4A 3VFGL 5IQ7H 2VXSH 1D6VH 4G80B 1M05B 4XNMA 1Y6KR 3C6LB 2EKSA 1Q9OB 5EA0L 4F3FB 5F9OH 1UM6L 4JY4B 5LQBL 4Y4FA 5SWSA 1DSFH 4ELKB 1NCWH 2RFXA 1RQ5A 4LARH 4G7VH 4PY7A 5ESAB 3S3SA 3B8SA 3HZYA 4H0IA 1JRHL 2AJXH 2Y06H 5H35B 2CGRH 1UWXK 5BRZA 1MI5B 3PP3H 1JNHB 3PP4H 5F1NA 2OMNA 2Q76A 1QSEB 3R8BB 2CDEA 1XGQB 3QUYC 1IAKA 2HFFB 4QRRA 4RNRB 4WI8A 3QYCA 3EFDL 4HH9A 4PJDB 3B6SA 3H6JA 1TTGA 4FQIL 4JVPA 4P4KD 2DICA 3TM6A 4OF7A 2Z93A 2VITA 3E8UL 2CK0L 4UNUA 1VGEL 4XCNA 2V5YA 4OJFL 3D9AL 1S9WB 2NY0B 4P46B 4MLSA 3H2WA 4JFQB 1BOYA 2ICCA 5F1KC 4N0UB 5EO9B 4PRDB 4X9HA 3RKDD 1WIOA 4XNXL 3O3EA 1FL6A 2M1KA 2XA8H 5AAWA 1UXSA 4H20L 1LQSR 4HW6A 4FFYH 4J8RB 3MXWH 1J9CT 3P0GB 4N8VB 4DWHA 3DMMB 1G9MC 1WCQA 1YUHA 4IMLA 3ARVA 2NX5B 3IFLL 3WUWA 4JM2D 2P5WB 5HVHB 5FEBA 3B3IB 4N90D 2NNAB 2XKNB 1HHIA 4K7PX 4S1RL 3P73A 4Z7WE 2ZG2A 3EKCA 2O61B 4Q97A 1DDHA 4LOUD 1RPQA 4TRPH 2XACC 5E6IA 4NJ9H 4GG8B 4JFOA 4ZOAA 2UVEA 2EIDA 1X3DA 3UXFA 1FPTL 3UTTB 3LOWA 1NLBL 4JRXA 1BZ7A 1G6RH 3QDJE 3ARZA 4LRNL 3VW3H 4RRPA 2IH1A 3PGFL 4QTIH 3DV4A 4I4WA 4NQXB 3WD5H 3E6HB 3KR3H 4HIIA 3QRGL 4CVXB 4LNRA 5AYUH 3AAZB 5D7JD 3LS4L 1RU9H 2BP3A 1BLNA 3V0WH 4JGJA 3QFJE 3QUYB 4DZBB 1CN4A 4XCFL 1A6VH 3RWGB 3ARFB 4MJ5A 5IMKA 5SWSE 3JTTB 3GSRB 2IG2H 4DGYH 1M05A 4XNMB 1BIIA 4DQOH 4JREC 1MIEH 4HS6B 2G75B 3GSWA 5FAAA 4CN4A 1FG2B 4M7KH 2HJFB 3LQAH 5I1EH 1SVCP 4XMLH 2J7LA 3CFCL 4M6OH 3MOBL 4MSWA 1WC7B 4PRHE 5GSVA 4ZDHB 4HMCA 4PJEB 4MJ2A 2C4XA 2BSRB 3KJ4C 1AQDA 1TZIB 3PXJA 4Y4HD 3RWFA 1P4BH 1TXKA 4U1MB 1HWHB 3QH3A 5I9QC 2CKNA 5MP6L 2AEPH 4MXQD 1S7UA 1EJ6A 2FD6L 1NH6A 5HI3C 1CLOH 1ZVYA 1KJMB 4PJAE 4KZEL 4X7SH 4HZLA 4JY6B 1WBXA 3MRFA 3EYSL 1FC2D 1ZMYA 4X0KA 3VFTA 1G7JB 5IFJA 1HHGB 1OF2A 1UVQB 1U8MB 4WCYH 1EAJA 4D2NA 4NO3B 1EFXA 4JG1L 2DTSA 3CK0H 3L95A 5F7MC 4LPYA 2R69H 1E4KA 3MRCA 4HUXB 5B38A 5TJWK 5DJ6B 4P2YA 2H26A 1LO5A 4H88L 5KG9B 2JJTA 3ARBC 1RUPH 4JB9L 1RJCA 5HHNA 2H2SC 2X44D 1K6QH 2CLVB 2C1OB 1MJ7L 3IU3B 3WHXA 4XTRC 3CUPA 2F5BH 4IIQB 3B5HA 5E7FA 3CFEA 1XEDA 4HXAH 3DO7A 5CIPB 5A2JH 4GRLC 4XBEH 4K71B 3BGFC 4Y5VB 1LILA 3IFNH 1FNHA 4B41A 3FO2B 1A6TB 1K4CA 5JIHA 1IGML 1ZVSA 3G6AA 3HE6A 4ODSH 3O3DA 2W9EH 3L9RA 3SKMA 3UO1H 2NY7L 4U31A 4YHML 4N1HB 2PUQT 4GRMA 4QCIB 4QHMB 3MLWL 4RX4D 3FZUD 1MAKA 3KS0H 1PG7X 2YPLA 2BRQA 2R1XB 2BK8A 4EIGB 1QTYT 3ETBF 3KPSD 3DJ9A 4CRPA 2VXVH 5D71L 1P5UA 5KTEL 3LPWA 3NTCL 3MODL 3VRJA 3RY6A 5FO8A 4P5TA 1BBDH 5FHAH 2FJGA 4RMUA 3WFHA 3ES6A 4OF5A 4CN6A 3QQ4B 5MHSE 4R97C 4WFHE 4HULB 5D96B 4JFPB 1MWAL 2VIRB 2Y07L 4F7MA 2FX8H 3ARFA 4MJ5B 5D5MF 4LHJB 3SE8L 1LD9B 3OB8A 2C3GA 1JL8A 2Z0BA 3WLWC 3MGTB 5JZ7D 1VA9A 4RWHA 1BAFH 2ZNWA 5GJSL 4K7FB 5ENWB 4MQ7A 5C9JA 1TETH 4KUZL 2HAZA 4PJXA 4JFED 4KI5F 5IVNA 2DMCA 3BWAA 2QQNH 3TESA 2ITCB 2V5SA 1ITBB 4BZ2L 5DUPH 2XWJB 1CFNB 2NY4C 1ZT7A 3TN0C 2YPVL 1F4AA 1I75A 5AZ2L 3UYRL 1IAIM 4FQ1H 3QIWB 3LQZB 5D6CA 3MCKB 1WBXB 1KCGC 1WGOA 4OCRH 5EC1A 1C5DB 3LEYL 3B2VH 3O6ML 4FQ2L 2XICA 1JF5A 2E6JA 4QLRA 1ACYL 1EERB 1G6VK 3IDJB 3MRCB 3MR9B 1DVFA 4JFXB 5FO9A 1F4YL 2QSTA 3IT8D 3MNWB 5DK0B 2DQCH 4Z5RB 3ARBD 2AEQL 1X4XA 3CLFL 5CEXB 4NN6B 2I27N 2F54D 4XZUA 5GS0L 1LWRA 2FIKA 5D7IF 3VXRD 3QFDA 1CICD 3FO1B 1LMKA 2CXKA 4G6JH 2VQ1B 5HHOB 1WZKA 1SYVB 4D94A 2FX9L 1EXUB 4WFED 3RL2A 3G5ZB 4WWKB 1T20B 5GGVY 1RZJH 3IJSB 5KVDL 1Q8MA 2YS4A 1RIVH 1VFBB 3ZSSA 4CADA 5HHOE 2NY1D 1OL0A 4HH8A 3WJLC 3QEUA 4PJBE 4N0YL 1YYMH 4WY7L 1N0XH 4PRID 1AXSA 3J7HA 4RGOH 1F6FB 1RU9L 3WE6B 4TSCL 1P84K 5KVFH 3UTTA 1U8NA 5IMLA 4AENB 1KXTB 5GJTL 5CKAA 4N1EA 3RWEB 4JHWL 3VJ6B 3VU2A 1S7RA 4HKXB 3PHSA 4XGZA 4RBPH 5FOBA 3LKSA 1IAIH 4BQ8A 5ICXA 5DJAA 3AFLA 5FOBB 3QDGE 5CEZL 4D0CB 1ZXQA 4XX1E 4TYUA 4D9QE 3LPFA 1P4LA 1JWMA 3MYZA 2DQTH 4GAGH 2FBJL 3VRJB 2PO6B 3SGEH 3E6FA 1PYWB 3ZL4L 1G9NC 2HJFA 1OGAA 2VDKL 5HDBE 3RU8L 2QV2A 4Z76A 1FL3B 2NX5D 3WHE1 1Z3GH 3HG1B 3BH9A 2FH8A 2W91A 4JRXE 1IAIL 5INDB 4JFYB 3OKEA 3ZL4H 4PP1C 3QZWA 2ENYA 3FQRA 4HWUA 2G2RB 4K07A 3RZCC 1GHFL 3RZCA 3S5LB 3T4YB 3JBG7 4I3RL 4I3SL 3OGCA 1T7VA 4KKBC 5TE7H 3WKMH 5EN2A 4S0UC 2Q1EA 4CVZA 4RGNC 1TJGH 5BS0E 5T1MA 4UDUB 4K3JH 1SYSA 2C26A 3C8DA 5H94A 1NKRA 1ND0B 1KN4H 1X5LA 2XWBB 3MLVL 1IBGH 5F8QC 3BZ4B 2AJYL 4OIBA 1IZKA 4NP4L 1MY7A 3BDXA 5EORH 2YMXH 5GRUL 4KUZH 1HXYA 4RAVB 5TE6H 2R4SH 1G0DA 1QLFB 4E5XB 2OTUB 2NYYD 3BZEB 3W0WD 4UIMB 5D7IB 1AGDA 3QHFH 5HHPA 3W0WB 5FM5M 2NMSA 4U1SB 1JMZA 2OR8A 5L7XL 2A6KA 3RUGA 1I8MA 1GRWA 4G8EB 4ODUA 2Y4SA 5J56B 3QT2A 2AQ3A 5EU6A 1HH9A 4L3CA 3VFVA 2ID5A 5CIPH 3P73B 4MNGE 3HPLA 4DUXA 1GXEA 4TRPL 2EXWD 4XP5L 2VLKD 4OV5B 4M6AA 4G6FB 3RNQA 1NPUA 4KGLA 4L8CB 2A38A 5DJYB 3HE6D 5JORA 3LKSB 2WLYA 4JZOB 3X11B 5K9JH 1A6AB 4M1CD 5CJ5A 3P4NA 1S9VA 1JGLL 2CDFA 3MV9D 1CU4L 1BZ9A 2J2ZA 3IU4L 2NY3C 3O6LL 1W8NA 4WGWB 3TIEA 5T1KA 4IHOB 3G5XB 1LP9B 5AYQA 2DQHH 2R2CA 3TIEB 2VOTA 1FZOB 5FK9A 1RZ8B 1XF3B 5TFSL 2ERJB 5J9PA 1VADA 1QKZL 5CZKA 4CMHB 3RWIB 2RFXB 2D7NA 1GYAA 4NQVA 2AKRB 2SEBA 5D5MB 3T0AA 1RZGA 1XGYL 5D9SB 3ZKXB 3QIBB 4MB4A 4BK4A 1YN6A 1DEEB 2PXYA 5EU6E 4F33A 3QUXD 1IC7L 4L9LB 3FQWB 4JM2B 2L7JA 1DQDH 2DMBA 3MXVH 3MBXH 4H26A 4XTRD 3TNMA 1UA6L 3DX9A 1C8PA 4ZXBB 4NZUL 1GC1H 1MHCB 4ZXBD 4XHJD 2EC8A 1PAMA 5SWSD 2PW1B 2FR4A 1KENL 2FEDD 1FVDA 1YPZF 1KC5L 4YXLH 3QFJD 4NSKB 4CNIA 4F7CB 1ZA6A 3O2WL 1GOHA 3FFCA 2B0SL 1ZEAH 2E5EA 4DTGH 5GXBB 3MR9A 1EJOH 4Q9RH 4FFYL 3LN9A 4R7NA 1A6PA 1MRDL 1W72B 5F72S 2BOBB 1Q0YH 3LCYA 4KI5E 2BRRL 1JZ8A 4M7LH 3ARDD 2GJZA 3NIFF 3RGVA 1JJUA 4ZOBA 4EN3C 1NFIA 3CLEH 4MAYC 5DMYA 5I1JL 1YEKH 3VD4A 2G60H 2HFEA 1ONQA 4XPTL 2JJUA 4FG6D 4Y1AA 2X4NA 2HFGH 1JYVA 5FKAB 4LSDA 4OCXL 1VFAA 1XFPA 3ILQC 5FYLD 5JQHC 2EE9A 5D7LB 5JOEA 3MLSH 1RUPL 1TQCC 4MS8C 2V9TA 4M6MH 4Y4HB 4YDIL 5L88H 3WDJA 1O7SA 2P8PB 3BP6A 1WZMA 3WD5L 3RY5A 1KIUA 1XGUA 4PGEB 3KYOA 2A6IA 3A6BH 3R1GL 1FO0A 4AQOA 1RURH 5IG7A 3OKMB 4R4BA 3OJDA 4OCYL 1CGXA 1GIGH 2WIIA 3HFMH 4QOKA 4QRRE 3T09A 3SCMB 5DC4B 4F37K 4ZFFA 3X11A 5ALBL 2IADB 1RURL 1X5GA 3DRQA 2O5ZL 2EDJA 1U95B 3WXVL 1AD9A 4FFEX 1NL0H 3O8XB 3RWDA 4NQDB 1NCBL 3OAYH 4LNRB 5BZDB 3EOAB 1U8KA 3NABL 4NQVB 4NQDD 3U1SL 4WU7B 2D7OA 1CGYA 4XVSL 3HR5A 1SQ2N 3U0TA 4LCYA 1T89A 1T89C 3S37X 1WLHA 4PJXE 2H6PA 2NY2C 3I6LD 3CVIL 4BKLA 4YE4L 4OCWL 2WP3O 1HHJA 4G8FA 3O6FA 4JM4H 4JN1H 4MD0A 1MFEH 4PTUB 5D93B 4OJFH 3H9HB 4HPYH 3STBA 3UEZA 1W72H 3UTQA 2F58L 1BD2B 1A6VL 2IANE 3TYGH 2E7LA 4P4KA 4E41E 5ANMB 1HKLH 4TUKL 3F12B 4FQIH 4W4OC 4JEGB 4EVNA 2I25N 2J6EH 4KI5D 1DUYA 4BFBD 3D2UA 4NQTA 4A6YL 3K8KA 5C0JB 2HT3D 3BKYH 4YX2H 4RISL 4NWUL 4N0UA 3KYNB 1MCOL 3CX5J 4NHUE 5BO1L 1OF2B 2CDGB 1S9WA 3TNNA 3ULSA 4YXHH 3PABB 4F9LA 1SJEA 4UDTB 4MXWH 3H9YA 4K23L 1XCTA 4KDWA 5GS0D 1MJJB 3ARQA 2IPUK 3FFCD 5TDOA 3GUTB 2QHRL 4Z7UA 1YEKL 4GKZA 2PYEB 4OLVH 3HZKB 3WIFB 4JQXA 1OTSD 1ZWIA 3WFEL 2HH0H 3OXSA 2ZUQB 3ZDYF 3P0VH 3BEVB 2I07A 3SDDC 5DJCA 5HYQB 5I71C 4LRIC 3STLA 1P7QD 3ARGB 2EH7H 1A7PL 1IGFL 5KS9F 3DBXB 1ZOXA 5EOQH 3TBSB 2L4OA 4D8PA 2WIIB 1Q94B 2YC1B 2C4FU 3RKDC 3EOYG 3W0WE 2OYPA 3HE7A 1QEWB 4X99B 1FO0B 2BJMH 4ONFH 1T7ZA 1A6WH 2YWZA 4LPXA 5JORB 5LAXA 3TH3T 1BEYH 4P46C 1FCCA 1DANT 3EO1A 2VN4A 4X9BA 4G43B 4WV1C 4N0YH 4WY7H 3EYQC 3QG7H 2O93L 1YEEH 3O3BA 4PGBA 4E0RA 1I85C 5I8OH 5BW7C 4M1CC 1BZQK 4HK3J 4QHKI 2JF1A 1H3PH 5DHVA 5DGQA 6FABH 5E8OA 3QIWD 2QR0B 4ZYKA 1IL1B 1XGYH 1NCDL 2A6JB 3MTRA 1CGSL 5FV2A 2CSPA 4HLJA 3U0TB 2R0ZL 2H41A 1SEBA 2DM3A 4OZFB 2X70A 4F7TA 4K23H 2BDNL 2V2WB 4LEXH 5ADPH 1FORL 5BJTA 2OK0H 4PJ9A 1MF2L 1ZLWK 1T1ZA 5ITFB 2XKSA 3E2HA 2XTJD 3WFCH 3QFJA 1NCDH 4PB0L 2AJ3A 2JJWA 2R56L 3HI6L 3ZMRA 5C7XL 3OF6A 1VDGA 3CC5A 1EHLL 5SV4A 1C12A 3OKLB 5ERWB 5D6DA 3UTOA 1BJMA 3B9KA 1I9JL 4OFIA 4R26H 3U82B 2HRPH 1OT1A 4LRIA 4JY6A 4WTXA 1PLGL 3THML 3Q6FA 5L8KB 2DQDH 5E00A 3DX7A 1TNMA 4F9PA 3D25B 3EYFA 2ZOKA 4HFUH 3S34L 5F93C 4RDQG 2B1AH 1KACB 1IKNC 4X7EC 4N0RA 1BFOB 4ZFZB 3VXRE 5IHUL 3I3DA 5C70A 3OB0H 4U0RC 1M1SA 1N2RB 1OGAE 3BN9D 4PJHF 1EV2E 2PYEE 4WIQA 3KPMB 3IRPX 1H3GA 3PJSA 1R24B 4OAWB 4P3DB 1KBGH 4JRYD 3RGVB 5AAMA 2ZOLA 4HUWA 2QJDA 3DIFA 3FO9A 5KVEL 3RGVD 3M1BA 4WENB 2EXWC 4X9FA 4PR5B 1A1NA 1YMMA 3DMMD 5DLML 2R2EA 3NH7L 3RZCD 3QEHB 4GMTH 4ZUUB 1DCLA 4Z78B 4AEEA 4LLQA 2R2EB 4OT1H 1YEDB 25C8H 3HFML 2WWMC 4OI8A 1JPFB 2DDQL 4N9GB 2AP2A 3VXMD 5C0EB 3BKMH 3RUGF 3FCTA 4QNPE 5FUOH 4ZNCD 3UDWC 4RQQA 5AZEH 2AEIT 5GZNC 1A47A 4Z6AT 3HMWH 4JANA 3EOAA 3U7YH 3EYVB 4G7VL 3IKCB 4FOMA 4HBCL 2MMXA 5K9QG 1XR8A 2YPKB 4AMKH 1RIVL 4HCRH 4KJQC 5IMOA 3N50A 5MERA 1UEMA 3ULVL 1MFAH 4APQB 3G9AB 3O2DA 4XX1G 1MWAH 2EO9A 3HCVA 2A73A 2ZCHH 5HVWA 3WFHB 2R0ZH 4RSVA 4GSDL 5C0DB 3I85A 1XZ0A 3QDME 4WJ5A 3DX9B 2VUYA 1LK3L 4PUBH 4PJ8C 5HHQB 1QLEH 3CSPA 5IB5B 4L5FH 1TCMA 5I76B 4JHAH 1MCKA 5DMGC 3LMJH 3O0RL 3KPQA 3O2VL 2UUDH 1F42A 1W0WA 4MWFA 2AJ3B 1SBBA 1L7IH 5CUSL 5CILL 4GG6E 1S7UB 1I8IA 2MFNA 4MWFB 3VGFA 4R8WH 4DN4L 1T5WB 3X3GH 4G9DB 1GAFL 3NCEB 2LU7A 2R0LL 3P77A 1S7WB 2F5AL 2WP3T 3GBML 4U6XA 4LLWB 4PLJD 3VGAB 2J1KA 5MHSD 2AK4A 5J6GB 3PWNA 5IFJB 5C86A 4X80L 1S78D 5D1QC 4L3EA 1S5HB 1RUQL 5CGMA 4PGCB 3ZYJA 4CDGC 3V6FA 4C56E 4WHCA 1N2RA 1CT8B 3GHBL 2AJSL 2VLRA 5HHNB 3FT3A 3W9EB 3SDXF 3BXNB 4OZIF 4OLVL 1BBJA 5C0RL 1LO5B 5KG9A 3TWCL 3K2UL 3MRKB 3RPIA 3N9GL 4FZEH 4HXBH 5HPMA 5CJQL 2PW2B 4GKOA 1V7NL 5EPMA 2HN7A 1ADQA 1QFWH 4OIIL 2JJTC 5BXFB 5I8KL 1A1OB 3VGGA 3AY4A 1HXMB 5FGBA 4HJJH 2IBZY 3OKMA 3HI5H 4HJGA 3QG7L 1B6DA 3UROR 4N90E 4YHLH 2X2YA 3PV6A 4JZNA 4CU7A 5F96H 2R1XA 3HTLX 4NZUH 4XP1H 3REWA 3T0EE 4ZS7H 3O2VH 3W2DH 3WIIH 5J06A 2Y7QB 3AROA 3WIHA 2VZUA 4X83A 1NBQA 5E6IC 4DFIA 4QY8B 5LCVH 4RMWA 4M8QA 2J88H 1BZ7B 2EYTA 4YPJA 8CGTA 1X5ZA 2CR3A 4JANB 2NCMA 5DUBA 3MFFA 3ZE1E 1CD8A 4JPVL 1D5ZB 4BH8A 4E41A 4QTHB 3CCHA 1A4KB 1ZS8B 5EUOB 4NN6C 5KAQG 5FYKU 1GHFH 3CCHB 3F62A 5GPRA 2DQFB 4QRPE 2N56A 1QBML 3QNYB 4GRWE 2O26U 5C07D 3SY0A 2EC9T 4Y5XB 1I7UB 3SCMC 2OBGA 4R0LA 4EEEA 2N7BA 5SV3A 4MAUH 4JHBA 4OLXL 3OAUH 3NFNA 4K55A 1V5JA 2HYMA 2VZ1A 3HRPA 4R3SB 1C7TA 1K8IA 2NZIA 4OM0L 3UX9B 4O51A 4M48L 5E5UB 2YMXL 2DM7A 1J0JA 3MV7B 2IJ0C 4HCRA 3W5NA 2XWBA 4BFGA 4Z7QF 5L2KE 1Q9LB 1SYSB 2JIXD 4HZLB 3PWLA 1UACH 4OGZA 1I8IB 3TBVA 2Z93B 1OWWA 4NQED 1CXLA 1X6LA 5T3XD 4X7TA 1OAZL 1AHWA 1NAMH 4XPHH 3B6SB 2HJLB 4P9HH 3D48R 5KSAC 4K7PL 3N85H 3PWJA 1WAAA 1QYGH 4AH2B 4Y8DC 4KK6C 1URLA 3BZ4A 4BUHA 4XMKH 1MCRA 2CLRB 5ACZA 1VCAA 2WLZA 4JREB 4HEPG 5E1HB 4KPHH 1OP3H 8FABB 4XNXH 3O9WC 3TWCH 5D2LF 1AGEB 1I4FA 2DM4A 3H9ZA 5GGUA 4KI1A 2QHRH 2OJEB 1ED3A 1FNLA 4MHHG 2A9NH 3ARBA 2P8PA 2DS4A 5IEHA 4XCYA 2V17H 1EJOL 3BPOB 4X80H 3VFSA 1HH9B 3VFVB 1K2DB 1NCCL 4OTXH 4X99A 5HDOA 2HVKB 1ITCA 1UKSA 5DYOA 1NL0L 3TBSA 1AHWC 5HD8C 35C8L 2LFGA 2MPAH 5CGYD 1BFVL 1WF5A 3MFFB 3L5XH 4XP9L 4XPGH 2H9GB 3MRQB 3O9WD 3MREB 3MUGB 1EAPB 1T0MA 5HGAA 4N68A 1U8LB 1F3RB 2FATL 4BQBA 3VFNA 1LEIA 4P2OC 3T2QA 1WT5A 5KOVC 1MREH 3RWDB 3GO1H 3NPSC 3E3QA 1DANU 3BQUD 4BQCA 4KAQH 5DFVC 3WS3A 2J5LC 2EDOA 4K94H 1U8PA 3T8XA 5L2JA 1AQKL 4GBXB 2JIXB 1P84J 3BP7B 4JJ5B 3DVFA 3FB7A 4YDKL 5FGCE 3V4VL 1U93B 3CZFB 3I3EA 1OAKH 3I6GB 5GGQH 2ITCA 3MBEC 1CDJA 2VDOH 5JHLH 3P4MA 4RFNC 1ZGLB 4GRWF 2DLEA 5CSGA 4QHLB 3K80A 5IUSA 5ID1B 3MOQA 4R4FH 3STZB 3TCXA 5E7BA 2F5AH 3S5LA 5FUZH 1ZKAA 2PO6D 4NGHL 1E27A 3PWPE 3Q6FB 1T7XA 4Y2OA 1DLFL 5L6YL 3NIGE 2XKUA 4YQXL 1I9JH 4R26L 3TNNB 1L0YA 2AK4B 5J6GA 1D9KD 4K3GA 4OLEA 4ZS6D 1C08A 4Z7WF 3BE1L 3Q3GB 4Z5RA 2X42A 1AE6H 2ADJB 1B88A 2IQ9L 3M17A 4JFXA 4O58L 1P6AB 1NGWB 2MHAB 4V3EB 3TZVB 3CH1B 2P24A 1V7NH 5J11B 4WUUE 4QF1A 5K9KA 4JKMA 4P9HC 2P5EB 1CGSH 3HMXA 3U4BH 1G1CA 3CDCA 5JLZB 1HSAA 1WK0A 3FJTA 1JGDB 1MJ7H 2M8XA 5DURB 3S4SG 1ED3B 1I3GL 4NCC2 3DXAE 4Y5VA 1IRAY 2CRYA 3OHXA 5DURD 5B4MC 2O5ZH 4J1UB 1MHHA 1PZ5B 2CIIA 1X7QA 1C16B 2ADGB 2X9XA 5GGRY 1I8MB 1H8SA 4LLDA 3C60B 2IG2L 4DGYL 3O11B 1MJUL 4TOYL 1CXEA 3FRUA 2VDQH 4GMSL 3UTSD 3VXTA 2IMNA 5DVKA 4HKJB 4I0PA 2N7AA 1CDBA 1YJDL 1NDGA 2DDQH 4WO4D 4ZD3L 3MV11 4KJYB 4RGMB 4AG4H 1KIQA 1RSFA 5CEYA 3WNOA 3HC4H 1V7MH 1UFUA 5F88A 4ZQKB 3RI5K 5KVGL 1NGYB 5CZXC 5F21B 2H9GA 1S9YA 4QWWC 5GGTH 1MCEA 3OJVC 4JPKH 3TEUA 5IV2B 2Y07H 4N5ED 2LVEA 3JUYA 3A6CH 5GRJH 5D7IE 2XYCA 3C09C 3F7QA 5KW9H 5LQBH 1NBYA 1ZGLM 3NABH 2PO6C 2Z4QB 2WMPA 4UV7H 3OAUL 3BRFA 5IJKC 4JLRA 2VAJA 1F8TL 2ZCHL 3CFDB 4RIRB 3AS2A 3ZDXF 4Y2DB 2GJ6A 4OD2A 4QRPB 5E03A 5D71H 2DB8A 4PB9H 1OP5H 5HGDA 3STZA 4MNGB 5EBWA 1MIEL 3AREB 5CJXA 1JTTA 3VFUB 2W9LA 3BEWA 3GK8L 3ARED 3OKEB 4LCCA 1U93A 2X1WL 1KIRB 3BIBX 3CZFA 5DI8B 3MRPA 5KSBE 1MVUA 3HNVL 1ZLUK 3SE9H 3I9GH 4G9FE 4PV8A 4LCCB 3FMGH 4JRXD 4K8RC 2AK4E 5FM8A 3RKPA 3D9AH 4G3YH 2DWDA 4OZGB 3S35X 2J6EL 2H1PL 5F1NB 1LE9B 3QUMH 5D7KE 4S1DC 3HKFA 4NFCA 3HNVH 3O41B 1INEH 2HJLA 4G9DA 4DGVL 1MJ8H 5JHDA 4FTVA 1X6NA 3CFBB 2YD1A 4LL9A 5ACLA 5C6PB 2YEZB 2R56H 3HI6H 2XY1A 5BV7H 4V3DB 4M43H 4NO5A 4P59L 4XVUD 5IB1B 2VDOL 4P2RA 1ZA3B 2EECA 4PYHA 3CVHH 5E08L 4NWTH 5T3XE 1S5IH 3UTSB 3DVNB 4G8GB 1FJ1B 4PJ7A 1AR2A 1FL6B 4KI5C 3TJEL 1XF2B 1J05A 3CFKB 2J4WL 3BMVA 1MHHB 1PZ5A 2CIIB 2AERT 3JVGA 3QCVL 5B3JF 2XIDA 2M2DA 3G08B 1J8HD 2OMBA 5LJYH 4FQQB 3V5DA 3BGMB 3VFSB 4PRIE 5F3BB 3D87B 5JLZA 3TO2B 3D3VA 2W65A 3BKCL 5IEHB 4POZD 2DQUL 4UT9L 1YUHB 4IMLB 1QRKA 4WHYG 5KZCB 2E6QA 3T0EC 5DD0L 1BM3L 2BY3A 3G6JA 4ODUB 3PWPA 3DV4B 4PD4J 4LLDB 3MRRA 5DR5L 3ARXA 5EBGA 2ZPKL 5CBAB 4ZOCA 1EAPA 1T0MB 4FQPA 4P9ML 3WIIL 1OM3L 5TE4L 4QXWA 2AVGA 5GGVL 3QDGD 3RVXD 2UWEB 5IMKB 3TPUE 1J8HA 4AIOA 3P4NB 4GMTL 3VXSA 3TFKC 4ELME 1OAKL 5GGQL 2BNQE 5BZDA 5TDNB 1ZK9A 3EIFA 5I8EB 2Q7YA 1Q9OA 1LE5A 1II4E 4QHUB 1GGTA 1O5DT 4HDIA 5AUMB 2IBGA 5JA9A 1U92A 1HKFA 4O2FB 2BDNH 1OLZA 2DWEB 4NJAH 1KCKA 4NRZA 4LSVH 5AG8A 2N4IA 3MA9L 1U3HB 1NJ9B 3NPSB 4FFZL 4LVNB 4XHQA 4I48B 4HXBL 5BQ7A 3WXWL 1PX4A 2X4UA 5J12C 5EIQA 2ZSVB 5EB9A 1MVUB 4AK1A 1ACZA 1BQHA 2X4UB 3QNXB 3PGCB 2K3TA 5CEZH 3O6FB 4EI5A 1JHTA 1F45A 2D7TL 3F12A 3BFOA 4HCRL 5EBWB 2C3VB 4OD1L 3O41A 4M5ZL 3T2NL 4P2QE 1AHWB 4YHLL 4OLWL 4B0MM 5FHBL 1VFUA 1G7IA 1BQLL 4Z18A 5B39A 4PV8B 4KRPB 1I7ZB 3TF7C 3W11D 5IFHH 15C8H 1UWEH 2C1PB 2VC2L 3FQXA 4PP2A 1I3GH 4HX1B 1C1EL 3V4UH 1KJ2H 1FQ9C 5DZOA 4F2MB 5SWQB 3SKNA 4R7NB 4YH6A 1MRCL 3ZHKA 1MCCA 4NWTL 4EXKA 2EDWA 2LU4A 3DGGB 3V52H 5JDJA 3SE4C 1KGCE 4XHJC 3QEQD 3CZJA 4ETQA 3MLRH 1YMHA 1KIPA 4HBQA 4LPVA 3LHPH 3BGMA 3M1BB 3UTTE 3BDYH 1KEMH 3SJVB 3FB8A 2K9UA 4KWUA 5J1AB 3KG5A 2HVKA 1MCSA 4MAYD 5IG7B 2VNCA 2O61A 5E5MB 4JZOA 3QEUB 3VDAA 2VLLA 2YRLA 4NQCE 2FSEA 3SGEI 1YMME 5KJRL 4OV5A 1OOAA 2PXYD 4PRNA 5IJVB 1FGVH 2YPKA 2PTTB 1WWAX 4XNZB 4HFWB 3MYJB 4WO4A 3QEQA 5FOJA 4XVUC 3GMQB 1DJSA 2WANA 4PJ5B 9CGTA 1R5VA 4NKOB 4HS3B 3MC0A 1RIUH 1F00I 3HPJA 1CFSA 1XIWD 4HUUA 5I66A 4R7DA 4FHBD 1DQQB 1BWWA 4X98A 5IBTL 1PKQB 2BFVL 4MAYA 1H5BA 2QADD 4KPHL 4N1CA 5EO0A 4DVRH 1JI1A 4CJ1A 3S3JA 1QSEE 3MRMB 4HF5L 1AQKH 4XCFH 4FQLH 4J3XA 3SKUD 4K8RL 1N7MH 3KPQB 4HUNB 5HI3D 5I17B 5ID1A 4JPVH 1JHTB 4K3DH 5HHVH 1FHGA 1OP9A 4OZGA 1R3LA 4JKKA 4YK4C 2GKIA 1WCBB 4L4TE 4NO0A 2YUXA 3QDMA 3NZHH 1LHZA 1MCPL 3BP5B 3DX6A 4N9OB 4NUGH 1QBLH 2Y1VA 4ODVH 2C4FT 1O0VA 5GS3A 3EYSH 5EZLA 3GJEA 4K3DL 1FVDB 4HUXA 4G6JL 1A4JB 4K94C 4Z7UF 3WXWH 2ESVA 5T33L 4UTAL 5D7KD 1CLYH 1KLGA 2GHWB 1ULVA 4QRQB 5HGBA 5EOQL 3MPCA 2WWKT 4LARL 3NCJL 4PJ7F 3GHBH 5L8LB 4H20H 2D9CA 1S78C 4TNVK 1IAOA 1MFNA 3RBGA 1JUFA 3C5SA 1XR9B 2DIAA 2W9DH 4NM8L 3RWHA 5GIRB 2Q8BH 1H9VA 4HJGB 4UINL 4OZFG 1UWGH 4JO3L 3RVXC 3A67L 4ONGH 3OKNB 5TE6L 1IT9L 1KIPB 1FNSL 4QHNA 3HZKA 3DHMA 1K2DA 1TJIL 4L3EE 3QDHA 1KT2B 1R5WA 1OAYH 5JMRA 3L9RB 3SKMB 1U8HA 3TJHC 3G6JF 5LAXB 4POZC 4Z7OE 4ONOA 1MJUH 4HIXL 3WNMA 3O11A 4P3CL 2VJXA 3RHWK 1IFHL 5HHMA 4QNPF 3WCYA 3LKPA 4KXZI 1CGWA 5EOTA 5EOCJ 5KSBF 1D9KA 5EIVA 1QD0A 4E0RB 5DJDB 4Z7VB 1OARL 1IKNA 4YDLC 2X4OA 4G43A 4KV5F 3L3OA 3WFCL 2Y5EA 4QY8A 1JRHH 4RMTA 3MJ9L 5CEZD 1PZUB 3MZTA 4XWGH 5DMIL 5T5FH 1Y0LA 1MRFL 3MJ8A 4HIIB 5C6TL 2GJ6B 4UQ2A 1TIUA 3TA3B 3MRMA 3MJ7A 3G5VB 1L0QA 2MQCA 2DN7A 3TJHD 3FOMB 3KJ6H 5GGSA 4U6HB 1C5CL 4X8JA 5EH1A 4Z76B 4OCWH 5DHYB 4JPIA 4Q9BA 4Z0BH 3TC9A 1AR1C 1C12B 1QO3A 3O4LE 1YEGL 4CMMA 4XT1C 3QULA 1LO0H 5IHUH 3SO3B 3ECBB 1KB5H 4D0BA 1TZHA 5CWSB 3AREA 4M8VA 3Q6GH 2PNDA 4FTVB 4P2RE 4YLQT 2YUZA 3OKKB 1C5DA 3QH3B 5DEGB 2DLFH 2E8ZA 4NSKA 4UT6H 4CNIB 5T3ZD 1EUTA 2G5RA 4HXAL 4JHZA 3TJHA 5IHZA 5DFTA 2DWDB 5AD0B 4KHTH 3IFPB 4HIXH 4KU1A 3DTXB 4MXQA 1DUZA 1DQJA 5JHDD 1ZTXH 2DD8L 2D7QA 2IALA 4AL8L 1U8OA 1JPSH 5J3HC 4EUPB 4EBQL 3MGOB 2VSDA 5DEFB 4OFVA 3U7AA 3T0WA 2P8LA 4KQ4L 3UPRA 3RVUD 3UBXI 2FZ3A 2ZUXA 2VL5B 3MRGB 5K9KB 4U1JB 5E2VH 1PQZA 4G6AC 2VXSL 4BELD 5FF6A 5EZOH 3QB7C 1YC8A 2BVUA 2E7LE 1BBDL 5FHAL 1Q94A 5EA0H 1TVBB 4LDLB 3CLEL 1O7VA 2OJEA 5L2KB 1DBML 1HH6A 4LCWE 4NKIL 4TULH 4O2EA 5EOTB 4JR9L 5D8JL 2Y23A 1NAKH 5DYOB 4R4BB 3MZGB 2FEEI 2Y7QA 5EU6D 5CEYB 5I19L 4C56B 3MYJA 1FFPB 1VGKA 5DR5H 4KK8C 1YNLL 4HKXA 4Q9QL 3FO0H 4M7JL 4PRNB 1NAKL 3CVHA 1JBJA 2R2BB 1KJ2A 2H2PD 1FFPA 4BZ2H 3MUHL 4GAJH 4AENA 3B9KD 4YBLC 5GRXG 3JWDL 4HIHB 2FH6A 3VFRB 1LK3H 2YA2A 5IF0B 1ZLWH 1EHXA 4XBPB 1U8LA 5JPMA 4QWWD 4HUVA 1T21B 3ZDYE 1AO7E 3H3KA 3R06B 1FVCB 2HP4A 2B4CH 3DLQR 4PRHB 5BQ7B 1MF2H 3O4LD 1ZVHA 4FFVD 4JN2B 1CD1B 1HHHB 2FEEL 4NZJA 1NC2B 3TBYA 4OCXH 5CJOH 3QIUA 1QR1A 1D9KC 4ZS6C 2CKBH 1EA9C 5F1IB 5CSBA 4A6YB 2F9BT 2WAHA 4YO0B 4Y2DA 5TQ0H 4D0BB 1ZE3C 3MRIA 2SEBB 5D5MA 3BE1H 4YO0A 4GRWH 1L9NA 3F6LA 1WWWX 4KVNL 1U8QB 2KQMA 1A2YB 1PDKA 3RWFB 5I76A 5T3ZH 2BX5A 3ARFD 5FA3B 2YD4A 1IAII 4NN5C 3V0AC 3RTQD 3GMRB 2RB8A 3HUJF 2DI8A 1PLGH 1ZEAL 2DLFL 4ZXBA 3O8XC 5TE7L 4NKIH 3WKML 3NZ8A 1EO8H 4M5YL 3TIDB 5DTFB 5E4EB 1W0VA 4JDTL 3WBDA 3BUYB 2G5BB 1J1OH 2WUCH 1KULA 2W38A 5JR1L 4MMZC 2BC4A 4UTBH 4BK5A 1JYWA 1YEHH 4X4YA 3ZT5A 5B22A 4GUPB 4DK3A 2GY5A 2FNBA 4JG0L 4L4VD 3QEGL 2X40A 4F37F 2HT3C 4F15C 3I02A 1N3NB 1NMAH 1ZANL 3QNZA 5FYJE 4H25A 4NUJA 1XGPB 3FQTB 1M4KA 1QYGL 2O5YL 2VR9A 5E6IB 5T1KD 3TV3L 4Z78A 4Y0GA 4WUUA 5ADOH 3BZDA 2PTTA 2YKLL 5MENA 3QQ9D 4Z77B 2QSCL 4J6RL 2R2HB 5CGTA 3DRQB 4U33A 4XI5C 2EEBA 5J8OA 1UJTA 2ZKHL 1JFQL 2HLAB 1KEML 5GS1A 3HMXL 4X6BA 1CD0A 3TV3H 5FHBH 3LKRA 2GW5A 1GGIH 1KOAA 2J5LB 4P5MA 5B3JE 1A6AA 1DSFL 1YEIL 3QJHB 3SKJH 2V9QA 3TVMA 4Z0BL 2OZ4L 1HIML 1HZHL 4MJID 2PCPB 4XVSH 5H2BA 2ARWA 4JM4L 1LGVA 3D69B 3KYKH 3KLSA 4S10A 4PLJC 4XWOC 2VLRE 5DUML 3V5HA 4F15B 1W2KT 2GSGB 1A7BA 3KNBA 4JFDA 5EDXA 5KW9L 1BQHB 3VI4F 3NIFE 1WSST 3MRPB 3SGJC 3LZFH 1JHLL 3DSFH 4KZDL 4W6WB 5F9WC 3EDKA 1OAZH 3D39D 3KHQA 3FQNA 4KHTL 3IRZA 4XPHL 5DWUL 3ILQD 2P8MB 2QSQA 3FQWA 3GSNA 1A2YA 1GAFH 1F3DJ 4Y89A 1J8KA 3KWWA 4NM4H 4GT7A 4OLYL 5E94A 5E00B 5DT1L 3FFCB 1INEL 3NGBC 4DGVH 3MCKA 3PABA 4KDTC 4PJGA 4YEFA 4S1DD 2NTFA 3SJVD 1I9RL 4URTB 3U4EB 3IFLH 2F54B 4L29A 1WIPA 1CR9L 1D5MA 4C55A 3U36A 1MH5A 3U30C 1WFTA 1JMXA 4HK0B 4IOIB 5CHNA 5IW6A 4PJHB 3IFOB 4I3GA 3OTTA 5IB3A 5BMFL 4MHHI 3PHQA 1K5NB 5FYKH 1A1MB 4PV9B 5I74C 2HH0L 1CD9B 1WZLA 1JGEB 4GXUN 3G5ZA 3ZT6A 1R5WB 2OI9C 2GYSA 1LO2L 2OS7A 2HFTA 5HI5C 3GSQB 3LEVH 2F8XC 3GBNL 1RZFH 1JNLL 1INQB 1FE8H 3MLYH 4M4PA 3SOBH 1T2QL 5I19H 5EWIL 2I07B 4P5KA 1EMTH 4DKEL 3O4OC 4HV8B 2R2HA 2AXGB 3LDBB 3OX8B 4R2GB 3WE6A 3MRLA 4CGTA 5FYKE 4XPFL 2AQ2A 3A6BL 4OQ1A 3X3FL 5C8JA 3GB7A 1NBZA 4L8BB 3S37H 1IFHH 3HUJE 1KJ3H 2VH5L 3QUMA 1XR8B 3EZ8A 3TP4A 3EHBC 5FKPA 5EFIB 2Z35A 3KXFD 3OXRB 2ZUWA 2XNAA 2OJZL 1EFXD 4XP4L 4LASL 3KLHC 2Z92B 3ESVF 4KTEH 1IGIL 4HMEA 1XCQB 5I1KL 4U1KB 3ULUF 1EK3A 4Z0XB 1MLBB 2GSGA 1U3HA 1U3HC 2ED7A 4LCCC 3KYMA 5ENWA 1NCBH 2R1WA 3MNZA 2ZUYA 1MI5D 3KYMB 2DQDL 4PPTA 3VGBA 3RWCA 3H9SE 2YRZA 4NQCB 3QZWB 3NAAH 4QXGL 3I6GA 1FCGA 1LK2B 3RVTC 1NCTA 4FXGB 5E2TL 4BJLA 3FRPG 4U6TA 4YGVB 2QQLH 5EO1B 4YC2B 1R3LB 1IC4L 1MPAL 5C9KA 2NXYC 1B4JH 5H94B 4OB5L 2XTLA 4WU5A 3V7MA 3UTPD 3B83A 5EOCH 1I7ZA 3T2NH 3VH8G 5I2IA 4DKEH 2IGFH 5DHVH 4EZMA 2DQEH 4UOJA 1HDMB 1CXFA 5FUCC 4FQLL 3PXHA 5E99H 3R1GH 1YPZA 2NR6C 2AEWA 1FNGB 5LGJB 2IBBA 5L7XH 4GW4B 2CJUH 3L3GA 3T77A 4KZDH 2VQTA 5HVFB 4RFEA 3Q2CA 3WIHH 4XBEL 2AV7A 5IB3B 4EBQH 3SPVB 5EORL 4EUPA 3O6FD 2B7DT 2HMID 2DD8H 3GMNA 1MRCH 3QXDA 2XA8L 1CWVA 3LN4A 5F70A 1UEYA 4Z8FH 2FBJH 1PGRB 5KSBB 2X5PA 4IRJC 4J3VA 4RWYH 1U36A 1XGUB 1AGDB 4JVWA 4F57L 4PGEA 1P69B 4L8DA 5T3XH 3U1SH 1SM3H 3VI3F 4DKFH 2DQJH 1CU4H 4YDLB 5BRZD 3L3IA 5DMGD 4JAMB 4OLZH 1YEIH 2HT2D 2I9TA 3HLAA 3HS0B 5C8JB 3NTCH 1J1PH 5D2NE 5DZLA 1MUJA 2NXYB 3BQUC 3HE6B 3P11L 4LHUG 5HGAB 3SDYL 1CIUA 3ZYOA 4RQQB 4P5KB 3ZE2E 5IMLB 4ZAKB 4LSUH 1Z0MA 3BYYA 5DFVD 2R29H 3RGVC 2EYRA 3L6FB 4OM0H 3O3BB 2P5EE 4P3WA 4QT5A 4JKWA 5KSVB 3F6IA 3PWPD 4YFDB 4HGKC 1JHLH 3G5VA 4GW5A 2VXTL 3MBXL 4LSTH 2DQIH 3DOSA 1G1YA 1AGBA 2YD3A 4GS7B 3QQ9C 2FWOA 3L5JA 5DRWB 5ESVB 3H3PH 5IQ9B 2V5MA 2VDKH 3MSPA 1T83A 3BHBB 1RUAL 2Y5TA 1T04B 2XG4A 3K8MA 4IMKC 2GJJA 4Y5XA 5GSRB 4M1DL 5INDA 4D0DA 1I1YA 4JFDD 2CO6B 1WCBA 4O51B 2VDNL 4OKDA 1BJ8A 1UB6A 4B50A 1KN2L 4CVZB 1MHPL 1ZHKB 3VG9B 2UZXB 3VFTB 1F4YH 2YD8A 1X44A 1RUQH 5K93A 4JRYA 1CFQA 4NIKB 3QXVA 3JSSA 2ZOKB 3QG6A 3O4OB 4MD5B 1BQSA 3VXOA 3TBVB 2FJHB 5F6IC 3Q5YA 2DKSA 5CEZE 5C0CA 4TUOA 5E5RB 5JIIA 3CU1A 1IT9H 5KSAD 1LE9A 5TQ2H 4Z7WA 1KJVB 2BSSA 4XP5H 3O3AA 4L29B 1FFNB 2E6PA 3LB6D 4XI5D 1HQ4B 1RUMH 1SY6L 4MJIB 3KAAA 2ZG3A 3RWHB 4DOHE 3QO1B 1RULH 1QQDA 3P9LA 4QO1A 1ORQB 4ALAH 2FX9H 4H0GA 4NO5B 3WIHL 3VXUE 4UTAH 5C2UB 4BQ9A 1JWSB 4TPRL 2PF6A 3MROA 3QUKA 5B38G 1H0DA 2IPTL 4Y4KC 2FZ3B 2R69L 3B3IA 4KRPD 5F7NC 1F13A 5KOMC 5EULV 4JQIH 1M7IA 2MCG1 1QACA 3H9SA 3RDTC 1Q1JH 1FO0H 3BPCA 5IFAL 4O9HH 4JHWH 4D8PB 3LKPB 3FB8B 4NZTH 1MCBA 1TPXC 1RZ7H 1UH4A 4DW2H 2YXFA 3MJ6A 5D7LE 3GZKA 2D03H 3I2CL 3GI9L 1N59A 3OL2A 4JFOB 4Q0XH 4XXDA 4Y1AD 1FH5L 4AIXA 5L88L 3RNQB 1CVSC 4NQDE 3OSKA 1UH3A 2BVEA 1Q1JL 1TVHA 3O8XD 4YHOL 5I1CH 1S9KC 1FH5H 3JWDC 2D3VA 2EDFA 5DJ0B 4NHUA 1NGQL 4JDZA 2EDDA 2ARJQ 4QT5B 5IW3A 1JGVH 4AQ1B 4MAYB 4F57H 4YFEA 1BOGB 1E28A 4ZSOA 2V7NA 2A9ML 3V5KB 5C0IA 1D5XA 1JGUL 2M26A 1EDQA 5F9WB 1DQQA 4Z7NE 5DS8A 2XFXB 1UM4L 1JPTL 3UZQA 5FECA 4NRZB 5FYLH 5GHWH 1IAMA 4DEPC 4Q6YA 3FB7B 4Z95L 3FN9A 5GSRA 3MRIB 4CJ0A 1IGJB 3B2UC 1PD6A 2DQGL 4GRLD 1NDMA 2R1WB 4XCCH 3QAZB 2A9MH 2P8MA 3LQZA 3QIBA 4Q7DA 3TBTB 5MEND 3FQRB 1SMAA 3GKWH 4RDQF 4JJHA 3H9HA 2NY5H 3VGDA 1U6AL 4WCYL 3T1FA 2D2OA 1D6EA 1CFNA 3FMGL 2J8UB 2Q20A 1IAKB 3IDGA 3H7BB 1SJVA 3B8YA 3MV9A 4X0KB 4KJWD 1R5IB 4I5BA 2YPVH 3BZFB 3OZ9H 4F7PA 1HE7A 4KKCC 3KPSB 1FZKA 1G7QA 1X4ZA 2OQJB 3GI9H 4PLNC 1K6QL 2FBOJ 4WEBH 4LHUA 1T7YA 5FGBC 1F6AB 5IT2H 5DVLA 1XGTA 4RWYL 4U1JA 5FF6B 1F6AA 3UTZA 2R8SL 5FDWA 3DX8A 2RCSL 4PGJA 3F7RA 3EFFB 3M17B 2LABA 3VXRB 1LEGA 1B3JA 3QZWG 3CDGB 4ELMB 2EE3A 3ZE0F 2QEJA 3CFEB 3DO7B 2BNUA 3QUZA 4O58H 1F90H 1QPXA 2FIRT 1ZWIB 4Y8AA 2HN7B 3AUVA 4PJ8D 5D2NC 3HLAB 5A2FA 3CK0L 2R29L 4PJFE 3CPLB 5T5NG 1ADQL 3QUXA 2ZPKH 1E4XI 4AEFA 5I1IL 2VQUA 5JIPA 1YPZE 1DBBH 3FO2A 2VLLB 4HPOL 2X09A 4M7LT 4XP9H 1SY6A 4XPGL 4C56A 5GZOD 3ROOB 4J2XA 3SCMA 4PTTA 4DKDC 1JYNA 3GMPB 4R0LC 2NY2B 3DGCR 4L4TB 5I18H 3U4AA 4NRYA 4NN5B 5KS9A 4ZPVA 1BZ9B 1RVFL 1FGNL 1KPVA 1BAFL 1FLRL 1CQYA 2VAAB 2IEPA 5DD5L 2ICEA 5F9JA 1JNNL 3ZDZE 5JOPE 1NANH 2X89D 4XNUL 5C09D 2ICEB 5F9JB 3DWTA 1QFUH 5F1IA 5I1KH 4K8RD 2EXYC 4QHLA 5GGVH 1HHJB 4G8FB 4LASH 3T2OA 1UB6B 2ZG1A 1FGNH 4Z0XA 4JPIB 4EQ2A 5EO1A 2VLJA 1D6EB 5BRZB 4I48A 3D5OF 4OFYA 3BIKA 2NY5L 3G5YA 3TYFB 4UUJB 2BVPA 1ETZB 5HHOD 1Q9KB 1OAQH 3DURA 3SO5A 5ISZD 2QQLL 5IMMB 4U1GB 4YQXH 5F71A 4P2OD 3QIWA 5D6CB 3GIVA 4KZEH 4X7SL 1AY1H 4OGXL 2PW1A 2FR4B 2WV3A 4D9QD 4KKNA 2VDMH 4X4XA 2A0LC 3WNNA 4GS7C 3C9NA 3UJIL 3U36B 1EZVY 5K33A 5IHLB 4WEUD 1XH3A 3O6KL 3UBXA 4Y16C 5JW3L 3KXFB 1U58B 5C0AD 3QHTC 2AV7B 2IMMA 4Y19E 1JTOA 5BVPH 5DK2B 2WM0A 5IB2A 1IGIH 4W68A 3MUY1 5MENE 3LN5B 2XN9A 2PW2A 1QVOB 4NC0B 3ZKQD 1GPOH 5C08E 3DETD 4CADB 1B0GB 2MCPH 1J5OL 5FKAA 3HE6C 1JTPA 1YY9C 1ZVSB 2NX5A 3G6AB 2VC2H 43C9B 2HWZL 2X4RB 3OKNA 4H25B 3OG4B 5KSBA 1IQWH 1D5BA 4OCNC 2EDQA 1AFVH 4RBPK 1FDLH 3P30L 3JV4B 2JJVA 1S9VB 4YNYB 1ZSDA 2QKIB 3C5JB 4OCSL 1J87A 4PJFF 5C0EA 3VD5A 5KS9E 2WQRA 3QJFA 5DJ8B 3EO1B 4ENED 1UKQA 1V3KA 4UMGA 3SDYH 4G59A 2NPLX 1BLNB 3FRPA 3AB0C 3NCMA 1F6LL 5F1SA 2NYYC 2E9IA 1FV1B 1TETL 2H8PB 4H5SB 5ICYA 3NIDE 1IQWL 1UKTA 4MCYB 2F19H 4WI6A 4PRBB 3LD8C 3IDIA 3Q5OA 4KROD 3V8OA 3GIZH 3TLRA 4U1KA 3RBSA 2CQVA 1QFWL 2E7CA 5I1HL 5BS0A 4YE4H 3ZLQC 4ZPVB 3EOTL 1ZS8A 3C5ZD 2F8OA 3CAFA 4WJ5B 5CP7B 1PYWA 4DGIL 4LEXL 4LHQB 3I50H 2ZZUT 5KSUA 4X9GA 3LS4H 3V0WL 1ACYH 5DVNA 5A2IH 2VLRD 2PTUA 1AC0A 4EUPG 1CFQB 4PRAA 1VGEH 1ETZA 4IRZL 3GRWA 4KTDH 1MJ8L 3H42L 5HI5D 4OZGF 4GAFB 4RNRA 4Q9CA 1FAKT 2KDGA 3FB5B 3EO9L 3S8WA 2OR9L 3B9AA 4PLOB 2Q76B 4GKSB 2BXZA 4TTDD 4R4FL 1IEBB 5E8NA 4I18A 2NZ9C 1ZLSH 1H3VA 2VXUH 2YK1H 1KIRA 2Z31D 4AEIH 4LPTA 2QADC 2BVQA 3IETA 5I6XB 3U0WL 2IQAB 3FN0L 3HZVA 5DT1H 5T3ZE 2PR4H 5DK0A 2GK2A 1RZJL 2FD6H 3MX0A 5JPNA 3PL6B 4POUB 5KN5A 1H0DB 1CFTB 5JXAL 3QPXL 2XN9B 1KPRB 1VFAB 5IKCB 1BVLB 1FLTX 3BWUC 3QDJA 3FO1A 2X4QB 1QSVA 4YZFE 1WQVT 1HEZA 5C0NC 5TH2A 3STLB 3QPQD 5CIPA 1FJ1A 3N1QC 3RGHA 4UIMA 5D7IA 1X7QB 2X4RA 1OP5K 5MENB 1CS6A 4W6XB 3FT2B 3TT1H 4X7DC 2X89A 5C09A 1JN6A 3FFCE 4EDXB 4NDMA 2HRLA 4GRMB 3OKYA 4PJ8A 4L4VB 1CE6A 4XCYB 4LNVA 3D3VB 2EDNA 4NKMB 5DJ2B 4JZJB 3VDCA 5JW4Q 4RGOL 3BP4B 1QZ1A 5IIEB 2G9HA 3TVMC 4F80A 5EBLB 5T5NF 4P5TB 2APTA 3L3DB 5KSAB 5I1EL 5SX4H 1FAIL 5EBLA 3HUJA 3GRWL 4YAQB 1YYLL 1GGUA 5CGYC 1F97A 4XRCA 1E0OB 3DYMA 4XAWL 4PJEF 1UXWA 3SQBA 3SY0B 3KPRD 4RA3A 5FYLL 3VXPB 4WRLA 5E8DL 3MJGX 5CMAA 2VLJB 1OARH 1QR1B 5TPWL 4HC1A 4MNQA 4OQTA 3MRDA 1W0YT 3B9KB 1JHKL 1WZ1H 4JDTH 5DC0A 2YD2A 2J8UA 2MPAL 1CLYL 3S96B 4UU9B 4FXGA 3GKZA 3SBWC 4WUKH 4KDTA 1A7NH 2HKFH 1ZV5A 2MQ3A 3L3HA 2VDPL 4NQCA 2Q86A 2X6MA 3NAAL 4QXGH 1TZGH 5E8EA 5J6HB 3E8UH 3TT1L 3ILPA 1NUDA 1OPGL 3OGCB 5I9QB 4ZTOL 4HIEB 5IB4A 4FA8A 3BISA 1A7NL 2HKFL 2O5XH 3MLXH 3KPRA 1CVRA 2H32A 4G42A 5C07E 4QRRD 5IEKB 1FBIH 4XMPL 3OKOA 4CBPA 1KLUA 2E7HA 1K8DB 2HJKB 4I2XB 5IEKA 1R3IH 4DCQB 3K4ZA 1XF2A 4IRSC 5EPMB 3I75A 2OP4L 3O45A 3OXSB 2CLVA 3ARFC 4DVBB 4KK9D 1YECH 2X10A 2A83A 1B0GA 3RTQC 1JPTH 4WWKA 5F7DB 3V4PH 3FFDB 2IAND 4ZUUA 5TDOB 5J1TC 1KB9J 4PLKD 4AEIL 1SEQH 3CIQA 3SGDI 3MJ9H 4I0PB 3QUZB 4HT1L 4HV8A 3SJVA 2YBRA 5CD3B 5L0QC 2PR4L 4HGWA 3NZHL 3DVGB 3QDMD 5JNYB 3ORJA 5DHXB 2MJWA 3MLUH 4R6UA 1G7LB 3BN9C 4EN3A 7CGTA 3G6JB 3H0TB 4NN7C 5CS7A 5DFWH 4IBLT 2AW2A 4G6KH 3AU1A 3HB3C 4PJGE 1SEQL 2AJXL 2EICA 3MUZ1 4HWEH 5E2JA 2GT9B 4UT9H 5ETUA 1KYOK 4U3XA 1DR9A 4CU8A 4IRSA 2X4SA 2J6EA 2IH3A 1E6OL 5J12B 3SDAA 4I4WB 4TULL 2X4OB 4X6DB 4KDVA 2UZIH 1XIWC 2LU3A 2V5TA 4JHAL 4OSUH 3LB6C 4YR6B 1JZ6A 1I1YB 4JJ5A 2XRAH 5DS8B 3ZTNL 1RUAH 5E56A 5JPMB 3WNLA 2Q8AH 3GEWB 5I17A 2C5DC 4M03A 1MRFH 1U8QA 2OM5A 4U6HA 4WWID 4TN9A 3ARTA 1NCNA 4MZ2A 2ENSA 3CFDA 1T4KB 3ECBA 1G9ML 4NHCH 4QOKE 1G7PB 3HC4L 2BSRA 1OP3K 5I6XC 3EUUA 1QFWI 1ZHKA 1J8HE 3BX7C 4ODVL 3NPZB 1KTDA 1KXVC 3OPZH 3TN0A 4ZPTA 1NCCH 1MEXL 1SJXA 5B3NA 4FFVC 5ISZA 1AJ7L 4GG6B 1FYTA 1LO0L 4NOFA 5F7KC 3MLUL 5BOZG 3C9NB 2KBGA 3MV8D 4GUPA 1PSKH 3L7EB 1FNEA 3BUTA 1RUKL 3WEXA 4ZUVA 4EOWH 3ZTJG 1FNSH 3BO8A 1UWXH 4GW4A 3RHWF 3VFMA 5EU4B 2Q8BL 3W9EA 1X5JA 4UINH 5IVOA 3VMPA 3MGOA 4FQQA 1SHMA 3DROB 4HK0A 4IOIA 1GGBH 1D7FA 4OD3H 2X9WA 4I1NB 3DRTA 3QXDB 4O02L 1K4DB 1D5BB 4HGWB 4JG1H 2XZCH 2A6IB 3RAJL 3TO4A 2IQ9H 3GGWB 1A7QH 1HXMA 5IK3B 1R3HB 2J88L 1MUJB 3G6DH 3GSUB 3DUSB 2BY2A 1XT5A 2EIEA 2Z91A 4NKQB 5ADOL 1CLZH 3L3JB 2X1PA 1QEWA 1IC1A 4K2UH 1KNOB 4JZNB 3LKQA 3MLTA 4HKJA 4H0HB 4P9MH 2HTKC 2DJSA 2JTDA 3CFJB 1JP5A 4ZAKD 3HC0A 4UIKL 1AIFB 4RCAA 4HKZB 5D7JB 5BS0B 4L4TA 3F7VA 5I73B 5E8DH 3GFUA 4JKLA 5B39G 4K3EH 1T22B 4OBRA 1INDH 1R5VB 2CMRH 4X6FB 4OF0A 2NY6B 1EHLH 4ELKA 4MD4A 1UM6H 1RJLB 3IDNA 3H7LA 1PG7L 3V6OA 1IGTA 4QRPA 1LD9A 2CMRL 1A21A 3PP3K 1HHHA 4PJFB 2NQCA 5KSUB 4CMMB 5EO0B 5GZND 2AGJL 1GJIA 5BO1H 3C60D 4Y5YA 3BP7A 2EXYD 4M00A 3MRDB 5ITBL 5DHYA 2APXA 2VDML 4U6XB 5ERWA 5IWLC 4M5ZH 5GGSY 3QRFM 4R96A 5J57B 3Q1SL 5J0BA 4F8QA 4P57A 2FB4H 5T1MB 4EIZC 2LAGB 4R2GC 3S88H 1BD2A 3GKWL 4S0SD 4R8WL 5F8RC 4F9LC 1LP9E 2UV3A 4W6YB 4LLYB 5TF1H 4FQ2H 3MNVA 4B53A 5IVXE 2VXUL 5D70H 4MJ4A 5DO2C 4YHYC 3KVQA 1CLOL 4G3YL 4NUGL 3IXAB 4JFFE 1EVUA 1UA6H 4ERSL 5KVEH 1U58A 4MQXD 2RBLA 5E4IA 1I9EA 2IQAA 2JCCB 4KKCD 4MQSB 5GZOC 1D5MB 2HJKA 1WAAE 2CRMA 2Z8RA 2DBLH 3TN0D 1OVZA 2E7LC 4GXUM 3X12B 1FIGH 1KCSL 4NNYA 3DV6A 4GKZB 3UTSA 5CAYB 4M43L 1HHIB 1VACA 5E24E 4ETQB 2ZWLT 3QUXB 3B9VA 5JW4M 1T03H 3AMLA 4J8RA 1NC4B 2YHGA 5GISH 3T0VA 2YUWA 3OJDB 3RUGB 4JRXB 3LEXA 4PJGF 2DBJA 2DJUA 1OM3H 1IE5A 4LRNH 2FLBT 1WJ3A 3EO9H 4PJIA 5J13C 3S6CA 4XB7A 1SVZA 5J1SC 4MGXA 1TQCB 4HPOH 2HG5A 4ZS7L 3EJZC 1SMOA