3P4SB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with a 3-nitropropionate adduct
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
total genus 62
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4sB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4sB01
1XLOA 3P4RB 2OHFA 3L4PA 5G5HA 3RPFC 3B9JA 2WU5B 2BS2B 1R7SA 1WGKA 4US8A 1PUTA 1DOIA 2L52A 1GTEA 4N6EB 4HROA 4P6VF 1ZUD2 2M19A 1B9RA 4YSZB 1SIJA 3NVZA 2KAJA 5C3JB 1IUEA 3VR8B 2WDRB 1YQ4B 1FXAA 4YXDB 1V97A 4FXCA 3NRZA 5C2TB 2HTME 4US9A 3AE3B 1J7BA 1E9MA 2DWQA 1FO4A 3AE6B 4ZHOA 3CIRB 1FXIA 1WWTA 1JW9D 1E0ZA 4YTPB 1DOXA 3AE9B 3SFEB 1WXQA 4ZHPA 1E6EB 3LB8C 1CZPA 1L5PA 2QJLA 1JWAD 4YTNB 1AWDA 1RWSA 2AX5A 2KMMA 1FIQA 2M56B 5AUKA 1L6UA 2Y5CA 5EE3A 1QLBB 1JWBD 3AEAB 2CJNA 1E7PB 2MJ3A 1TKGA 2PIAA 1RM6C 2H88B 3AE4B 3AE1B 1OQQA 4IDIA 3AEFB 1FM0D 3P4PB 3AB5A 2WDQB 2WLBA 3NVVA 1GT8A 1H7WA 3AE5B 3EUB2 4LTUA 5EE9A 5EE1A 1YQ3B 2W54A 2PKOA 1TKYA 1VJKA 2G1EA 1NVID 1NI3A 3P4SB 3VRBB 4HRSA 1DOYA 2K9XA 4N59A 2BS4B 4YSXB 1XLPA 4YTMB 1PDXA 2CU3A 1ZOYB 1FRDA 1N60A 1V8CA 1TKEA 1QOGA 3P4QB 1ZXIA 1CJEA 3AE2B 3AEEB 2DBYA 3AEBB 1OFFA 1H7XA 3FC4A 3DWMA 1RYJA 4WQMA 1ZP0B 1FMAD 3SR6A 4C7ZA 4C80A 3AE7B 2BT6A 1JQ4A 3VRAB 2CJOA 3VR9B 1WYGA 2W3SA 3NVWA 2WU2B 1I7HA 3P63A 1GTHA 4WWMA 4C7YA 4YT0B 1FFVA 3AV8A 2K5PA 5H92C 3PO0A 3AECB 5AUIA 4N58A 3CF4A 3SFDB 2PVOD 3CWIA 1L0VB 2H89B 4A9AA 1PFDA 1J7AA 2L83A 3BIID 1JALA 4JWUC 3ZYYX 1N61A 2LEKA 3AMZA 5EE0A 3ABVB 1NYRA 1AYFA 3DWGC 2BS3B 1ROEA 1TYGB 3HUIA 1OQRA 1NENB 1UWMA 3B2FA 3HRDD 3WCQA 5MPOA 1QOAA 1WRIA 1QOBA 4ZOHC 5GXGB 1L6VA 2E3TA 2FBWB 3B2GA 2JX5A 1TJEA 2K22A 3AM9A 3LXFA 1JRPA 2N0SB 3AH7A 3FAHA 4YSYB 1KF6B 1E10A 3AEDB 1NYQA 2EKIA 1QF6A 1YJJA 1VLBA 1N63A 2MH7A 1FFUA 2WQYB 3HVZA 2Q5WD 3P1MA 1DGJA 1EWYC 3KWLA 5G5GA 1GPXA 1N5XA 1QOFA 1SF0A 2WP9B 1N62A 4ITKA 1YJIA 1FRRA 1NEKB 5H8YE 1F0ZA 1SB3C 3W5VB 2ACZB 1QT9A 3AEGB 1KRHA 1XLQA 2PVGC 1A70A 3NVYA 1JROA 3AN1A 2WDVB 4JX1C 4JWSC 3W5UB 1GAQB 1KFYB 1J7CA 1XLNA 4KX6B 2MJDA 2MJEA 2JQRB 1XO3A 3ETRA 2QIEB 3AE8B 3NS1A 4USAA 3W9CB 2W3RA 1T3QA 2WS3B 1VDVA 1RFKA 1N5WA 2W55A 2B76B
chains in the Genus database with same CATH superfamily
3PSEB 2NTSA 4K1RB 4P16A 5HHDG 4MH8A 2BYFA 4P6VF 3O65B 3H1UA 3ZVVA 4F7ZA 4IM2A 1E8WA 1V97A 3KW5B 1EM7A 4WWNA 2PE9A 5JH5C 2INCC 2D3GA 2AL3A 1I4PA 1WJNA 3DBLI 4YTPB 2WXKA 4DK5A 3LB8C 3N32A 1WJ4A 2AX5A 3JW0X 4C00A 2LVPA 1Y8RC 2BPSA 1JWBD 4OZAA 2M4NA 5CHFA 1AARA 3AE4B 3QQ8B 3VH4B 1FCLA 1WX7A 2KTRB 1YMHE 4XYCA 1ISNA 3VQIA 4K3BA 2L0TA 2GLSA 1WX8A 2JZPA 1I4HA 1WXSA 4OVZA 1SBBB 1SJED 5JHBA 4MH0E 2DYOA 3DQVA 1L0YB 3DVGX 3HK0A 1I4XA 4K7SA 2KHWB 3QWZB 4NQKE 4PS7A 3AU5A 4RGTA 3CWIA 2NR2A 3RCZA 4I6LB 3RNFC 1YN3A 4FN2A 1CK1A 3A9JA 4LNFA 1QZEA 2JZZA 1L6VA 4ICVA 2K22A 1IGDA 3RYTA 3M95A 2FCNA 2KC1A 2KLGA 3P1MA 5G5GA 1NEKB 4MSMB 2L32A 1WGHA 1KFYB 5BO4B 4BVUC 3VHTC 4ACFA 4NJCA 3VTWA 4ZRPA 4HPLB 4N6EB 2K8BA 4YSZB 3HHMA 3NVZA 3ZW3A 4FXCA 2ZCBA 1J7BA 4WJOA 1FO4A 5BYSA 3Q3NC 1TS3A 2KTFA 3VUWA 2D10A 2IGHA 1T5XD 1L6UA 2KQSA 1JMLA 4A90A 1LGRA 4H2AA 1WI0A 3NY5A 4ARIA 3ML9A 3RFZB 2IO0B 1BT0A 1SE4A 3Q14C 1JWUD 4ZYSA 1NVID 1V1PB 2R2QA 3TMPB 4FHKA 2L3ZA 4N59A 1IBXB 2ON8A 1K8RB 5CHVC 1QOGA 1YIWA 2IZVB 3AE2B 3ZO5B 4C4VB 4LNIA 1FMAD 2WXFA 1C4PA 3Q8BA 2W3SA 3NVWA 5E6NA 2V4IB 4C7YA 4IUMB 2L8JA 2K5PA 2V3NA 3NHEB 4ANXA 4DHZB 1WRDB 3A4SC 4W9KA 4ZRKA 4AOFA 2B3AA 1WJUA 4F8CB 2ASQA 5MPOA 2FCSA 2DHZA 3JSVB 2FBWB 2O2VB 2EKIA 3HVZA 3RI7C 4AUQC 3DHHC 4G11A 3DCGA 4OZCA 4HJKA 2Y3AA 2KT7A 2YVCA 1KRHA 2D11A 2D3BA 3V62A 3AE8B 3QCAA 3VAWA 5DPWA 2OJRA 3IBEA 1WR6E 1F52A 1KH0A 4A6QA 3TEYA 3V60A 1SEBD 2DYMA 2LGXA 4W9DA 2N1WA 3MC9A 3AE6B 1FEHA 1E7UA 1UNSA 4A3PA 1HE8A 2MRPA 1RLFA 1CZPA 1L5PA 1WGDA 2INDC 2FCMA 1YX5B 3IG3A 5FK9C 1E7PB 1MJDA 1FM0D 2WWZA 4LTUA 3HM3A 3QIJA 1SE3A 2LJ5A 5HI1A 1GJZA 1JWMD 1XLPA 2X38A 3DBLB 4TKNA 2BWES 3L10B 2K39A 2ZW1A 1ZXIA 3FC4A 1JRUA 3Q8FA 1MFWA 3NOBA 3PTFC 2YLMA 1FNVA 1EU4A 1UF0A 3TEZA 2KMAA 3O13A 4A9AA 1PFDA 2J42A 3KLSX 4MELA 4EOYA 5EE0A 1NYRA 2XN9C 2AQ3B 3DWGC 3MHZA 1BXTA 1WH3A 3UIOB 5BYQA 4ZOHC 4IWOA 5IAAC 4B95A 2CR5A 1S3SG 2JX5A 3U8ZA 4DWFA 2BGFA 3ML8A 2FIDA 3TJPA 2MH7A 2KVZA 1N63A 2PJHA 4MSQB 3VTVA 1V49A 3VVWB 3B1LX 4CO7A 1OQYA 1UBQA 1F0ZA 1A70A 2MJDA 2L0FA 4P1CC 1XO3A 4MEMA 4BOSC 2O6VB 2W3RA 1T3QA 1IP9A 4LDTB 1RFKA 4A20A 4GDKB 2OHFA 5G5HA 4KZ0A 4J3OD 3ZJVA 2BS2B 3X23A 2L52A 4KSKC 2BW2A 1ZUD2 4NNJB 3HM6X 4GB9A 2IGGA 2WDRB 5D3DA 4QAYA 3LDZE 4KVGB 1SSNA 2N9LA 3E9SA 1D4BA 3N9YC 4GOCA 2EMTA 2LGIA 1WYWB 4RGMA 2E6XA 2YEPB 2GBJA 5G2NA 2J0KA 4WIPA 1OQQA 1HQRD 1UZXB 3ZDTA 4PS8A 2KO3A 2MHJA 3PHWB 4AJWA 1F9JA 1XXGA 2KDBA 1TKYA 5D2MB 1WIAA 3V3XA 3KH0A 3BY4B 1T0RC 2Y5PA 2GOWA 4XZ4A 1OFFA 3BVMA 4WAAA 2QHOA 1UH6A 4NZLB 2KDEB 1YOVB 1I4GA 2PEAA 3QC8B 5AUIA 3CF4A 2JWUA 2HDEA 1NBFC 4BKSD 3EECA 3W1SA 3PT2B 3OAWA 1UWMA 3B2FA 2D5GA 2EKEC 4WH4A 5HG2A 2FNJB 3I5JC 5CTRC 4DDID 2GRIA 4R3DA 3UQBA 3HVDA 1SXTA 4HLEA 1OEYA 2X8XX 1QOFA 3JYUA 3UI3A 1FRRA 2FIFA 4FHJA 3V6CB 1WGGA 2LUEA 1IGCA 3QX1A 1GAQB 1K50A 3V05A 3W9CB 2WS3B 4G50A 1TIFA 3H7PB 2M0XA 3AU4A 2WXGA 4HROA 3X0WA 1M4VA 3VR8B 4MGKE 2GI9A 2C7MB 1FXIA 1CMXB 1WF9A 2Z0EB 2EELA 1TKGA 5DPTA 1OGWA 3P4PB 2WLBA 1GB1A 1YQ3B 4OZBA 5C1ZA 2L1AA 4NAWA 5BMHA 3PZDA 2LZ6A 3KQ4A 2J0MA 2BKRB 1WYGA 3Q8EA 2KMCA 1QQRA 3AV8A 4JPSA 1P3QU 2Z59B 4NJ7A 2G3QB 2DAFA 3IHPC 2KYWA 1MI0A 2D3AA 3L08A 4DXFA 3RZWC 1F2RC 2HE7A 3GOEA 4JLCA 3KWVA 3DBHB 4HKQA 1NYQA 2LJIA 2G45B 3RNEC 4ICUA 3ZNID 1J0GA 1C4AA 3WAOA 2WP9B 3QARA 2ACZB 3GS2A 4BKTA 2WYQA 3ZRFA 3EGRA 2V9HA 4RGNA 3MHSD 1KLVA 1K52A 4FLHA 1HZ6A 2ZPYA 4KSLC 3M3JA 1NDDA 2HD5B 4NAMA 5L83A 1STEA 5C2TB 4W9JA 5FKAC 3AE3B 4AQ7A 3ZTDA 2OEDA 1E8ZA 2KJHB 4YTNB 1KM7A 2REXA 1QLBB 2QSDA 4AP4C 3FKYA 2BYTA 1V5OA 4DBGA 1YJ1A 3BYYB 2WDQB 1GNUA 1B1ZA 2MBEA 2LHDA 1QKZA 2DENB 2G1EA 3BK2A 2WXPA 2INNE 3VUXA 5JHAA 4OVVA 2YEPF 1JQ4A 4C80A 4C7ZA 4EKUA 1PQSA 4MJSB 4UDUC 2MBQA 2ZZPB 2L7RA 4X57B 2NMQA 1TGZB 1VCBA 4W9FA 2WXJA 5GXGB 2DZJA 1UD7A 4K3CA 2OOBB 3AEDB 1WSPA 4WQOB 5CHWA 1R4MI 1RRBA 4L1BA 2KOXA 3PPAA 2XK5A 3A9KB 5LXHA 1VZ6A 3OWEB 1ESFA 2K6QA 2PVGC 5I4DA 4ANVA 1XF5L 1V5TA 2KK8A 1V9JA 2KZRA 2VZKB 1GG3A 1PUTA 4RMAA 2MP2A 2AQ2B 4BBNC 3WA0A 3DBSA 3N3KB 4XDDA 2RPQA 1TT5B 4DXAB 3NUHB 2KWDA 4A8XC 3RNCC 3TSSA 4MM3A 4RM8A 1WMHA 3N1ZC 3IVFA 2A4ZA 1EU3A 1Q0WB 4HPPA 4LCDE 1UWXA 2MBHA 4RF1A 2RSUA 1XD3B 2WNMA 3PLVA 1GT8A 4M0WA 1EUVB 3P4SB 1ZE3D 2IDYA 2K9XA 2BS4B 3OLMD 1PDXA 2LXCA 1FRDA 4EFOA 2C7HA 1SGHA 3MJ5A 1XEEA 1WY8A 1T0SC 1RYJA 2BT6A 2CJOA 1GC6A 4W9GA 2UWQA 1C78A 3A1QA 3R8BA 1GOZA 4EZJA 2L83A 1E8YA 2MCNB 4MT5A 1WR1A 4WJQA 3TL5A 3QA8A 3U7ZA 1ROEA 3HUIA 1OQRA 1CQVA 2PW9A 2R61A 4XDCA 3NJTA 2UU7A 4NJ6A 4Q2JA 4YL8A 5IP4D 2WGSA 4J6IA 1SE2A 3SEBA 3LXFA 1TJEA 4ZRJA 3FAHA 4YSYB 2Y5BB 3T9LA 2KWUB 1VLBA 2BTEA 4ZYNA 3DOWA 2C5LC 2KKCA 3E56A 3SU8X 1GC7A 4JX1C 2EMSA 1FCCC 3ETRA 1C9FA 3BZDB 1KLUD 2SAKA 2CHZA 2K3UA 2MBOA 1V81A 4FJVB 2VZKD 1YN5A 2CKHB 3P42A 4XWTA 3B9JA 2KX0A 4US8A 4ARCA 3TUOA 1B9RA 4RH6A 3B0AA 2WXNA 1L4DB 3SDLC 2ONQA 4YXDB 3I9V1 2WX0A 2KTRA 3MC8A 4EZKA 2JRHA 2GB1A 5AZGA 3CIRB 1ZW7A 1LO5D 3ZUNA 3IAM1 1WXQA 4BFRA 3VTUA 1HTQA 1RWSA 2KFJA 4KIKA 1TZOA 2CJNA 4WAFA 2JF5A 2JT4B 4WWOA 3I57A 3NVVA 1WM2A 3KVFB 2NPTB 3IAS1 3V6EB 2BQQA 1LM8B 2IO1B 4KGRA 1ZOYB 4PS3A 3OJ4B 4BAXA 2DBYA 4EUTA 2NBWB 3WALA 3Q3JA 4WWPA 3WAPA 2N7JA 5IOIA 3ENEA 1Q10A 2WU2B 2V1YA 4N9F4 4WWMA 1SJHD 1MPEA 3PO0A 2K0PA 2PVOD 1J7AA 3BIID 2KACA 4WURA 3N20C 4XC2A 3ZXVA 4DHZE 1WXAA 2IJ0A 4HVBA 3ZRCA 4GGQA 2AQ1B 1Y56A 2C7NB 5TSSA 3APDA 3Q3OC 2RDHA 1KF6B 3TEXA 4RFBA 2JRIB 1V80A 1YJJA 1D5MC 2VH2A 4GDLA 5JXVA 3RZFA 4G3XB 3KUDB 4NY0A 2JPHA 3W5UB 1KTKA 4GMVA 3CSFA 5HKHA 1E0ZA 2IGDA 3GE8C 4M8NA 2LI5A 3RPFC 1XQQA 1DOIA 4ASWC 2KFKA 1IUEA 2DNFA 2V3PA 5E6JA 1TY2A 2WXMA 4FA6A 3CF6E 1V1PA 1PYWD 2BYVE 4E3CA 2GBNA 3RMKC 4K7UA 1FNWA 4PT5A 3AEAB 3RULA 4GSWA 4ANWA 2MQJA 3AE1B 4F1SA 3DVNU 3QJZA 4EE2A 2N9XA 3EUB2 2I2YA 1YNTE 2QMTA 4CYEA 2W54A 1H8CA 2PKOA 4W9LA 1VJKA 2ZVNA 2PMVA 5FR6A 4O1NA 4YTMB 1X1MA 3OJ3A 1N60A 3EA6A 1V8CA 5GMVA 2BWFA 1CJEA 3URYA 5AEKB 1WFYA 5J2RA 3JSVA 2O2VA 3BK1A 5FR3A 1IYFA 1YX6B 3KYDD 3QAQA 2IY0B 4B6WA 1V6EA 2LEKA 2NTTA 3AMZA 3TCAA 3ABVB 2MX2A 2NBVB 3ZIMA 4REZA 1WE6A 3DPDA 2D2QA 3ECIA 5T8IA 1NI2A 4II3B 5TR5A 3PHXB 2MWSB 4OW0A 1MHXA 1E5WA 1GPXA 3R7RA 1P7FA 4KZCA 1YN4A 1HXYD 2AYOB 3C8YA 2KX3A 3NZ3A 2N9KA 4ZRQA 4G0NB 4JL9A 1UGJA 2N4FA 2W82A 4IOIE 4AJYB 3U52E 2RDBC 2PLPA 2NS5A 2WXHA 1WZ3A 2QDFA 4ZHPA 4XE0A 1E8XA 3TIXA 3L4PA 3PZ7A 2K8CA 5IA7A 3BINA 5G55A 1IPGA 4HK2A 1S1QB 1YQ4B 1I4QA 4IKGA 3VXWA 2N1VA 2HJ8A 2LGYA 1DOXA 1JWAD 2M56B 3AXCA 2JZ3B 2KQ7A 2MW5A 2ZEQA 3OG5A 1WE7A 3FILA 1WX9A 4EZLA 1U4AA 3VRBB 3MTNB 2LASA 2KVRA 3P2BA 4MGIE 1ZGUB 2BB6A 4XGAB 4BKSA 2LRWA 3P4QB 3AEEB 4HEA1 3DWMA 2N9EB 4DXGA 1ACCA 1FXTB 3VRAB 2KQ4X 1YQBA 3A4RA 4IC7B 3DDCB 2DX5B 4K81A 3S2AA 3DBRI 2J53A 5AZHA 5H92C 1D6EC 5E6PA 2INPE 3RNAC 5IKCM 3RNGC 4XWWA 2J4XA 2FE8A 2I38A 2KANA 4AS1A 3HRDD 3NZSA 5LNK1 2LWPA 1KJTA 3HIZA 2AWTA 2O6VA 1JCKB 4B0MA 4ANUA 4GDKA 1FFUA 4K7WA 5DPSA 3DVGY 4HDQA 1QILA 2QEJC 5C23A 1N62A 2K6DB 3NVYA 2XBBC 3A9JB 1JROA 5DPRA 5HFYA 4JWSC 1UUPA 3UIPB 1XLNA 2JQRB 2LMCA 2WXLA 3AULA 4XX5A 3ZKJC 1XLOA 1V86A 2V3SA 4CHKA 2MP2B 1EF5A 1VD2A 2WU5B 1WGKA 2SEBD 3QK0A 2R2OA 2TSSA 2ZVOA 3VDZA 4WJPA 1ET9A 3NRZA 4L23A 4ZHOA 3PRZA 1WMHB 1JW9D 1FPYA 3NS8A 1HZ5A 2PE6B 1FIQA 5EE3A 1D5ZC 1C79A 4HWIB 5IO9A 2MJ3A 1AN8A 4M0WB 4IDIA 4LK0M 3ONSA 3AE5B 5EE9A 1VZ8A 2IO3B 1DOYA 3ZQ4A 2I1KA 1PGAA 4BBNF 1HTOA 1ZXHA 4WJNA 1K51A 2WHIA 4S17A 2GMIC 1M94A 2ZNVC 3IFWB 1V1OA 2J52A 3UQAA 2UYZB 3SFDB 3DVNV 1KLGD 1R4NI 4M00A 1N61A 1JWSD 1ET6A 1TYGB 5L95C 2CHXA 4B0EA 4S0RA 3LJ3A 3CMMB 4GU2A 3W1SC 1Z5SB 4URKA 3AH7A 1WGYA 3H7PA 2WQYB 3IT6B 1EWYC 1N5XA 5AZFA 3KYCD 4ZDVA 5H8YE 1AW7A 4I6NB 4DHJB 2M0AA 1SB3C 3AEGB 1E7VA 1XLQA 3ZNHB 3AN1A 2M8SA 1WZ0A 4BKGA 3Q8CA 5EDSA 2JVCA 2QIEB 2CS4A 2L00B 3NG0A 1R7SA 2BBCA 2MLBA 2N7DA 4RGOS 4CQNA 2PTLA 1ZDXA 2RD0A 1FXAA 4KDLB 3GZNI 2GBMA 4D2KA 3RT3B 1Q1OA 2K8HA 4GLSC 3I63C 4KIKB 5D7GA 1L0XB 2QJLA 2Y5CA 2ZPNA 3MFGA 3SHQA 1WM3A 2G9HD 4HKZE 3Q6BA 3UINB 3WIMA 3AEFB 4KDIC 1BMLC 2Z8LA 3Q8AA 1DYQA 3M62B 5BMGA 3AEBB 3VFKA 1H7XA 2KC2A 3KUZA 2OJWA 5IN7A 3ZJTA 2LFIA 3TBLD 1ENFA 1C76A 2KNBA 4A55A 1L0VB 2H89B 3EFUA 1JALA 2I1JA 1HA5A 2M1MA 2XEWA 2BS3B 2JXTA 3WCQA 1TBEA 3W2DA 2NBUA 3ZLZA 3T3NA 3B2GA 1JRPA 3DBRB 1KOTA 5KHOA 4TQ0A 4GDLB 1J19A 1MHHE 3L13A 3R3MA 2D07B 4HXDA 4GIVA 2A5UA 2N7EA 2ZCCA 3ZNZB 4DHJD 2LXAA 3NZUA 3L0WB 1QT9A 4YWGG 2WXQA 3GP7A 3H7SA 3IT4B 4PYUA 1T0QC 3ZGZA 2RGFA 5D3IB 1WXMA 3T8MA 3APFA 1LXDA 2RR9A 2J7QB 2KFKB 1TS2A 2KD0A 3RD2A 2LGSA 2JU6X 4BZAA 1C77A 1PGBA 1VR9A 4KKIA 1ZDVA 1TY0A 1WJ6A 1L2NA 3BVZA 2RMMA 1E9MA 1OTRB 3PREA 2VRRB 5D94A 2JYTA 1WWTA 3AE9B 2RPVA 3SFEB 2FUHB 2BYEA 4P7IA 3K9OB 4LNOA 5LXIB 2HJ1A 2PIAA 4JE3B 3T3OA 4FJZA 1EF1A 4MJSA 1PGXA 5J17A 2C60A 1P7EA 2HTHA 4E71A 2KLCA 3GB1A 1XT9B 2QILA 3ZJUA 3C0RB 4ZRIA 1WXVA 3Q69A 4WQMA 1ZP0B 4HCPB 1H4RA 3ZNGC 1I7HA 3BYTB 5BMIA 4NPNA 4W9IA 4JWUC 3ZYYX 1D5XC 3UGBB 3U7DA 4MACA 2ZNVB 2L76A 2MSED 1AYFA 3A9KA 2LUMA 3I3TB 1TS5A 5DCNA 1NENB 3LYYA 1MVKA 3N1YC 4LNKA 1QOBA 2PPHA 2WX1A 2N0SB 1G6JA 4C56C 1QF6A 4A3OA 2JY6A 1DGJA 1R4NB 2MBBB 4RF0A 1UBIA 4DQOC 4KGSA 4ITKA 2AEHA 1P98A 1VZ7A 3APCA 2DAJA 3PLUA 2JYEA 2BVCA 1N5WA 2W55A 3P4RB 2QC8A 1GTEA 3N30A 4FJYA 2FAZA 4GXBA 4US9A 4OHJA 3PRMB 2DWQA 3U4EG 1FNUA 1J8CA 4L2YA 4IWPA 2LVOA 3Q3FA 1E6EB 3EFCA 2AL6A 1AWDA 2KMMA 3DBHI 3FILB 1RAXA 1R4MB 2FCQA 1RM6C 3AB5A 3ZTCA 4LLGM 2D3CA 2JSVX 3GZNB 1NI3A 4TSSA 4YSXB 4I6PA 3TEWA 1TS4A 2BF8B 2KWCA 2C9WB 4GN1A 2G4DB 2KJRA 2LRUA 1IBXA 2GBKA 1YD8U 3SR6A 4IM0A 1TZ1A 4C4VA 1UELA 3U2SC 3P63A 3Q3MC 2KDMA 2W9NA 1GUAB 1F77A 3J9CA 1L4ZB 4NAWB 3B08A 1XCQL 4JGHB 2DYBA 1FD6A 3UF8A 3R2IA 2G4SA 1P0RA 4TV3A 1QOAA 2KN4A 2K25A 3EC8A 3KUCB 1EWCA 3V61A 3WAMA 2CHWA 2KDIA 2NCNA 4HCNB 2Q5WD 4JQWC 4FADA 2RDGA 1YJIA 2V0GA 2BB5A 4HJGE 3CSTA 5CX3A 2WDVB 3L54A 3IXSA 1J7CA 1SE9A 1E90A 3EHVA 2MJEA 1XCTL 1GB4A 2LGDA 2LD9A 2LVQA 3W5VB 2B76B 3ALBA 1WGRA 3L17A 4KKJA 2M19A 2VH1A 1SIJA 2DZIA 4KGTA 2DLBA 2N9PC 1C4CA 2NPTA 2DZKA 2XNAC 3PZ8A 1Q5WB 3Q2AC 3K9PB 4TMAB 1MG8A 2JWZA 4DDGD 3MP9A 2KWVB 5AUKA 5JZEB 1F1HA 4W9CA 1Z2MA 1V2YA 5E6OA 3R66C 5BYRA 1H7WA 4HDOA 2NVUI 5EE1A 3RN9C 1P9DU 1ZKHA 3DHIC 3L16A 4IG7B 4M8MA 2QCZA 3RUIB 3BVGA 3PRPB 5J18A 2CU3A 3MC0B 4JIOU 4B9KA 3MJWA 4LNNA 1LFDA 3DHGC 3AE7B 4FULA 3VR9B 2JUOA 2KXJA 2WXRA 4FBJB 1OEYJ 4M02A 5D6JB 4N58A 3RNBC 1SIFA 3VUYA 4IW0A 1TTNA 2WXOA 4MGYE 2ZJDA 4BOZB 2O6VD 1T6BX 1WRIA 4LDTD 1I42A 2K1FA 2E3TA 2V4LA 2IO2B 2MA9B 2IYDB 4PYZA 1E10A 2WXIA 3SD5A 1MG4A 3PVLA 3GE3C 1N6ZA 3PV1A 4IWQA 1UGMA 1SF0A 4M01A 2CU1A 4HRSA 1K53A 3D32A 4KX6B 3NS1A 1VDVA 1L7YA 3ZXRA 4E74A 2FUG1 3R7QA 2XK5B 1C3TA 3W1YA 2KAJA 5C3JB 2KDFB 2ZW0A 4IM3A 2HTME 3N1XC 4TQ1A 3H6NA 2MEKA 1D3ZA 1VRAB 3M63B 3C19A 4OVUA 4TUUA 5KHQA 2L05A 1LQBA 3H9DA 3QHTA 4KV2A 2H88B 4RCOA 4AWJA 3VH3B 4EEWA 4PK1A 1I35A 1F2RI 2KN5A 1BUIC 2LHEA 1P1AA 4MM3B 1TKEA 4LJPB 2KJ6A 4RM9A 1A5RA 2GBRA 2IY1B 2JXXA 3AI5A 3BWUD 1GTHA 1I4RA 1T0YA 4YT0B 1FFVA 5LLIA 3AECB 2IPKD 3A33B 3PGEA 3PS6A 4MGZE 3R2TA 1C1YB 2J0JA 3WANA 3AM9A 2BKFA 2DZMA 3A1QB 4LJOB 2ICIA 2IBIB 3KWLA 3U30A 2M17A 3JVZX 3ZDMC 4NQLB 4RNAA 4W9EA 4HPMB 1RFAA 4II2B 4P1BC 4MDKE 4W9HA 1ZPSA 4USAA 2WDTB 1HEZE 2Z0DB 1EO6A 3H8HA
chains in the Genus database with same CATH topology
2NTSA 4P16A 5HHDG 3RPFC 4MH8A 1DOIA 4P6VF 2WXGA 1TS2A 4HROA 2JU6X 1C77A 1PGBA 1M4VA 1IUEA 1VR9A 3VR8B 2V3PA 1TY2A 4KKIA 1V97A 1ZDVA 1EM7A 5E6JA 1TY0A 2GI9A 2WXMA 3BVZA 2RMMA 1E9MA 1I4PA 1V1PA 2JYTA 1FXIA 1PYWD 1WWTA 4YTPB 2WXKA 3AE9B 2RPVA 3SFEB 3LB8C 2AX5A 2EELA 1FNWA 1JWBD 3AEAB 4OZAA 4PT5A 4JE3B 1TKGA 2PIAA 3AE1B 3AE4B 3T3OA 3P4PB 2WLBA 4EE2A 3EUB2 1PGXA 1FCLA 1GB1A 2I2YA 1YNTE 2QMTA 1YMHE 1YQ3B 2W54A 1P7EA 4OZBA 2PKOA 1VJKA 2L1AA 3VQIA 2PMVA 4O1NA 4YTMB 2JZPA 3GB1A 1I4HA 1N60A 3EA6A 1V8CA 2QILA 1SBBB 1SJED 4OVZA 3ZJUA 1CJEA 3URYA 5BMHA 2DYOA 1L0YB 3Q69A 4WQMA 1I4XA 1ZP0B 3KQ4A 1WYGA 3BK1A 3Q8EA 5FR3A 1I7HA 3BYTB 1QQRA 3AV8A 5BMIA 4RGTA 4JPSA 3CWIA 4JWUC 3ZYYX 1D5XC 2LEKA 2NTTA 4MACA 1YN3A 3AMZA 3ABVB 1AYFA 2LUMA 1TS5A 1MI0A 1NENB 3LYYA 4REZA 1CK1A 1MVKA 1QOBA 4DXFA 1F2RC 5T8IA 1L6VA 2K22A 1IGDA 3KWVA 2N0SB 4HKQA 1NYQA 2LJIA 4C56C 1QF6A 4OW0A 1MHXA 3P1MA 1GPXA 1DGJA 1P7FA 5G5GA 1YN4A 4RF0A 1HXYD 1C4AA 2WP9B 3C8YA 4DQOC 4KGSA 4ITKA 1NEKB 3NZ3A 2ACZB 1VZ7A 2N9KA 2L32A 3GS2A 4ZRQA 1UGJA 2W82A 1KFYB 4IOIE 3U52E 2PLPA 3EGRA 2JYEA 2WXHA 4RGNA 1K52A 4ZHPA 1N5WA 2W55A 4XE0A 4NJCA 1HZ6A 3P4RB 4ZRPA 3L4PA 3PZ7A 1GTEA 4N6EB 4YSZB 3NVZA 4NAMA 1YQ4B 1I4QA 4FXCA 1STEA 5C2TB 4IKGA 5FKAC 4US9A 4OHJA 3AE3B 1J7BA 4AQ7A 2DWQA 3U4EG 1FO4A 1FNUA 5BYSA 4L2YA 1TS3A 2OEDA 1DOXA 1E6EB 2IGHA 1JWAD 4YTNB 1AWDA 1T5XD 2KMMA 2M56B 1L6UA 1JMLA 1QLBB 3FILB 2QSDA 4A90A 1RM6C 2BYTA 4H2AA 3BYYB 3AB5A 2WDQB 3FILA 1B1ZA 4ARIA 4LLGM 2LHDA 3RFZB 2JSVX 1SE4A 1QKZA 1JWUD 4ZYSA 2G1EA 1NVID 1NI3A 3VRBB 1V1PB 4TSSA 3BK2A 4N59A 4YSXB 3TEWA 1IBXB 2WXPA 1TS4A 2BB6A 2INNE 2ON8A 1QOGA 3P4QB 3AE2B 3AEEB 1IBXA 2YEPF 4HEA1 3DWMA 1FMAD 3SR6A 1ACCA 4DXGA 4C7ZA 4C80A 1JQ4A 2WXFA 3VRAB 2KQ4X 1C4PA 3Q8BA 2W3SA 3NVWA 3U2SC 2V4IB 3P63A 4C7YA 2J53A 5H92C 2K5PA 1D6EC 2V3NA 2KDMA 4UDUC 2INPE 1F77A 3J9CA 4XWWA 1L4ZB 4NAWB 2J4XA 1XCQL 2NMQA 1FD6A 2FE8A 2I38A 3R2IA 4AS1A 5MPOA 3HRDD 5LNK1 1QOAA 2KN4A 2WXJA 5GXGB 2FBWB 1JCKB 3AEDB 1EWCA 2EKIA 1WSPA 4B0MA 1FFUA 4L1BA 3HVZA 2Q5WD 1QILA 2QEJC 4OZCA 2RDGA 1N62A 1YJIA 2V0GA 2BB5A 2Y3AA 1VZ6A 3OWEB 1ESFA 1KRHA 2PVGC 3NVYA 4HJGE 1JROA 2WDVB 5HFYA 4JWSC 1UUPA 3IXSA 1J7CA 1XLNA 5I4DA 2MJEA 3ZJTA 2JQRB 2LMCA 2WXLA 1XF5L 3AE8B 1XCTL 1GB4A 3W5VB 2B76B 1XLOA 2VZKB 2WU5B 1WGKA 1PUTA 4KKJA 1KH0A 2SEBD 4A6QA 3TEYA 2AQ2B 2M19A 1SIJA 2TSSA 1SEBD 4KGTA 2DLBA 2DYMA 1C4CA 1ET9A 4XDDA 3NRZA 4L23A 2XNAC 3NUHB 2KWDA 3PZ8A 4A8XC 3AE6B 4ZHOA 1FEHA 1UNSA 4TMAB 1JW9D 3TSSA 1CZPA 1L5PA 3MP9A 1HZ5A 1EU3A 1FIQA 5AUKA 5EE3A 1D5ZC 1C79A 1UWXA 5FK9C 1E7PB 1AN8A 2MJ3A 4RF1A 4IDIA 5BYRA 1FM0D 4LK0M 2WNMA 1GT8A 1H7WA 3AE5B 4LTUA 4M0WA 5EE9A 5EE1A 1VZ8A 1SE3A 3P4SB 5HI1A 1ZE3D 2IDYA 2K9XA 3ZQ4A 1DOYA 1PGAA 2BS4B 1JWMD 3BVGA 1XLPA 2X38A 1PDXA 2CU3A 1ZXHA 1FRDA 3MC0B 2ZW1A 1K51A 1ZXIA 3FC4A 3MJ5A 1XEEA 3Q8FA 1RYJA 3AE7B 2BT6A 2CJOA 3VR9B 1V1OA 1FNVA 1EU4A 2J52A 2WXRA 3TEZA 3O13A 1C78A 3R8BA 4N58A 3SFDB 1GOZA 1KLGD 4A9AA 1PFDA 2J42A 2L83A 3KLSX 1N61A 4MT5A 2WXOA 1JWSD 5EE0A 1NYRA 2XN9C 1ET6A 2AQ3B 3DWGC 3MHZA 1BXTA 3U7ZA 1ROEA 3HUIA 1TYGB 1OQRA 1CQVA 2PW9A 2R61A 4XDCA 5BYQA 4B0EA 1T6BX 1WRIA 4ZOHC 4Q2JA 2E3TA 1SE2A 3SEBA 2JX5A 1TJEA 3LXFA 3AH7A 3FAHA 4YSYB 2WXIA 1E10A 2MH7A 1VLBA 1N63A 2BTEA 2WQYB 3IT6B 1EWYC 1N5XA 1SF0A 5H8YE 1AW7A 3E56A 2M0AA 1SB3C 1F0ZA 4HRSA 3AEGB 1XLQA 1K53A 1A70A 3AN1A 4JX1C 2MJDA 4KX6B 3Q8CA 1FCCC 1XO3A 3ETRA 2QIEB 3NS1A 1C9FA 3BZDB 1KLUD 2W3RA 1T3QA 2SAKA 1VDVA 3H8HA 1RFKA 2K3UA 4GDKB 2VZKD 1YN5A 2OHFA 3P42A 5G5HA 2FUG1 3B9JA 4J3OD 4XWTA 2BS2B 1R7SA 4US8A 3ZJVA 4ARCA 2BBCA 2L52A 2BW2A 1ZUD2 4RGOS 3TUOA 4CQNA 1B9RA 4RH6A 2PTLA 1ZDXA 2KAJA 2IGGA 5C3JB 2WXNA 2WDRB 1L4DB 1FXAA 2ONQA 4YXDB 2ZW0A 3I9V1 4D2KA 2HTME 5D3DA 2GB1A 4TQ1A 3CIRB 1LO5D 1SSNA 4GLSC 2MEKA 2N9LA 3E9SA 1D4BA 3N9YC 3IAM1 5D7GA 1VRAB 1WXQA 1L0XB 2LGIA 2QJLA 4RGMA 1RWSA 2E6XA 2Y5CA 1TZOA 3MFGA 2G9HD 2YEPB 2CJNA 4HKZE 4WAFA 4WIPA 2H88B 4RCOA 1OQQA 1HQRD 3AEFB 3I57A 3NVVA 1BMLC 2Z8LA 1F2RI 1XXGA 3Q8AA 3IAS1 1DYQA 1BUIC 1TKYA 5BMGA 2LHEA 3V3XA 4KGRA 1ZOYB 4MM3B 1TKEA 2Y5PA 2DBYA 3AEBB 1OFFA 1H7XA 3BVMA 2N7JA 1Q10A 2WU2B 4NZLB 3BWUD 2LFIA 4WWMA 1GTHA 1I4RA 1MPEA 4YT0B 1FFVA 1SJHD 1ENFA 3PO0A 3AECB 1C76A 4A55A 1I4GA 5AUIA 2K0PA 3CF4A 2PVOD 2JWUA 1L0VB 2IPKD 2H89B 1J7AA 2HDEA 3BIID 1JALA 2KACA 4WURA 1HA5A 3R2TA 3W1SA 2BS3B 1UWMA 2JXTA 2D5GA 3B2FA 4WH4A 5HG2A 2IJ0A 3WCQA 3W2DA 2AQ1B 2GRIA 3T3NA 3B2GA 3AM9A 1Y56A 4R3DA 5TSSA 1JRPA 2RDHA 1KF6B 3HVDA 3TEXA 4TQ0A 4RFBA 4GDLB 1SXTA 1MHHE 1YJJA 1D5MC 2ICIA 3KWLA 5JXVA 1QOFA 4RNAA 3UI3A 1FRRA 4YWGG 1QT9A 2WXQA 3GP7A 1IGCA 3W5UB 1GAQB 3IT4B 1KTKA 1K50A 1ZPSA 3ZGZA 3V05A 4USAA 3W9CB 5D3IB 2WS3B 1HEZE 1E0ZA 2IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLO A;  3P4R B;  2OHF A;  3L4P A;  5G5H A;  3RPF C;  3B9J A;  2WU5 B;  2BS2 B;  1R7S A;  1WGK A;  4US8 A;  1PUT A;  1DOI A;  2L52 A;  1GTE A;  4N6E B;  4HRO A;  4P6V F;  1ZUD 2;  2M19 A;  1B9R A;  4YSZ B;  1SIJ A;  3NVZ A;  2KAJ A;  5C3J B;  1IUE A;  3VR8 B;  2WDR B;  1YQ4 B;  1FXA A;  4YXD B;  1V97 A;  4FXC A;  3NRZ A;  5C2T B;  2HTM E;  4US9 A;  3AE3 B;  1J7B A;  1E9M A;  2DWQ A;  1FO4 A;  3AE6 B;  4ZHO A;  3CIR B;  1FXI A;  1WWT A;  1JW9 D;  1E0Z A;  4YTP B;  1DOX A;  3AE9 B;  3SFE B;  1WXQ A;  4ZHP A;  1E6E B;  3LB8 C;  1CZP A;  1L5P A;  2QJL A;  1JWA D;  4YTN B;  1AWD A;  1RWS A;  2AX5 A;  2KMM A;  1FIQ A;  2M56 B;  5AUK A;  1L6U A;  2Y5C A;  5EE3 A;  1QLB B;  1JWB D;  3AEA B;  2CJN A;  1E7P B;  2MJ3 A;  1TKG A;  2PIA A;  1RM6 C;  2H88 B;  3AE4 B;  3AE1 B;  1OQQ A;  4IDI A;  3AEF B;  1FM0 D;  3P4P B;  3AB5 A;  2WDQ B;  2WLB A;  3NVV A;  1GT8 A;  1H7W A;  3AE5 B;  3EUB 2;  4LTU A;  5EE9 A;  5EE1 A;  1YQ3 B;  2W54 A;  2PKO A;  1TKY A;  1VJK A;  2G1E A;  1NVI D;  1NI3 A;  3P4S B;  3VRB B;  4HRS A;  1DOY A;  2K9X A;  4N59 A;  2BS4 B;  4YSX B;  1XLP A;  4YTM B;  1PDX A;  2CU3 A;  1ZOY B;  1FRD A;  1N60 A;  1V8C A;  1TKE A;  1QOG A;  3P4Q B;  1ZXI A;  1CJE A;  3AE2 B;  3AEE B;  2DBY A;  3AEB B;  1OFF A;  1H7X A;  3FC4 A;  3DWM A;  1RYJ A;  4WQM A;  1ZP0 B;  1FMA D;  3SR6 A;  4C7Z A;  4C80 A;  3AE7 B;  2BT6 A;  1JQ4 A;  3VRA B;  2CJO A;  3VR9 B;  1WYG A;  2W3S A;  3NVW A;  2WU2 B;  1I7H A;  3P63 A;  1GTH A;  4WWM A;  4C7Y A;  4YT0 B;  1FFV A;  3AV8 A;  2K5P A;  5H92 C;  3PO0 A;  3AEC B;  5AUI A;  4N58 A;  3CF4 A;  3SFD B;  2PVO D;  3CWI A;  1L0V B;  2H89 B;  4A9A A;  1PFD A;  1J7A A;  2L83 A;  3BII D;  1JAL A;  4JWU C;  3ZYY X;  1N61 A;  2LEK A;  3AMZ A;  5EE0 A;  3ABV B;  1NYR A;  1AYF A;  3DWG C;  2BS3 B;  1ROE A;  1TYG B;  3HUI A;  1OQR A;  1NEN B;  1UWM A;  3B2F A;  3HRD D;  3WCQ A;  5MPO A;  1QOA A;  1WRI A;  1QOB A;  4ZOH C;  5GXG B;  1L6V A;  2E3T A;  2FBW B;  3B2G A;  2JX5 A;  1TJE A;  2K22 A;  3AM9 A;  3LXF A;  1JRP A;  2N0S B;  3AH7 A;  3FAH A;  4YSY B;  1KF6 B;  1E10 A;  3AED B;  1NYQ A;  2EKI A;  1QF6 A;  1YJJ A;  1VLB A;  1N63 A;  2MH7 A;  1FFU A;  2WQY B;  3HVZ A;  2Q5W D;  3P1M A;  1DGJ A;  1EWY C;  3KWL A;  5G5G A;  1GPX A;  1N5X A;  1QOF A;  1SF0 A;  2WP9 B;  1N62 A;  4ITK A;  1YJI A;  1FRR A;  1NEK B;  5H8Y E;  1F0Z A;  1SB3 C;  3W5V B;  2ACZ B;  1QT9 A;  3AEG B;  1KRH A;  1XLQ A;  2PVG C;  1A70 A;  3NVY A;  1JRO A;  3AN1 A;  2WDV B;  4JX1 C;  4JWS C;  3W5U B;  1GAQ B;  1KFY B;  1J7C A;  1XLN A;  4KX6 B;  2MJD A;  2MJE A;  2JQR B;  1XO3 A;  3ETR A;  2QIE B;  3AE8 B;  3NS1 A;  4USA A;  3W9C B;  2W3R A;  1T3Q A;  2WS3 B;  1VDV A;  1RFK A;  1N5W A;  2W55 A;  2B76 B; 
#chains in the Genus database with same CATH topology
 3PSE B;  2NTS A;  4K1R B;  4P16 A;  5HHD G;  4MH8 A;  2BYF A;  4P6V F;  3O65 B;  3H1U A;  3ZVV A;  4F7Z A;  4IM2 A;  1E8W A;  1V97 A;  3KW5 B;  1EM7 A;  4WWN A;  2PE9 A;  5JH5 C;  2INC C;  2D3G A;  2AL3 A;  1I4P A;  1WJN A;  3DBL I;  4YTP B;  2WXK A;  4DK5 A;  3LB8 C;  3N32 A;  1WJ4 A;  2AX5 A;  3JW0 X;  4C00 A;  2LVP A;  1Y8R C;  2BPS A;  1JWB D;  4OZA A;  2M4N A;  5CHF A;  1AAR A;  3AE4 B;  3QQ8 B;  3VH4 B;  1FCL A;  1WX7 A;  2KTR B;  1YMH E;  4XYC A;  1ISN A;  3VQI A;  4K3B A;  2L0T A;  2GLS A;  1WX8 A;  2JZP A;  1I4H A;  1WXS A;  4OVZ A;  1SBB B;  1SJE D;  5JHB A;  4MH0 E;  2DYO A;  3DQV A;  1L0Y B;  3DVG X;  3HK0 A;  1I4X A;  4K7S A;  2KHW B;  3QWZ B;  4NQK E;  4PS7 A;  3AU5 A;  4RGT A;  3CWI A;  2NR2 A;  3RCZ A;  4I6L B;  3RNF C;  1YN3 A;  4FN2 A;  1CK1 A;  3A9J A;  4LNF A;  1QZE A;  2JZZ A;  1L6V A;  4ICV A;  2K22 A;  1IGD A;  3RYT A;  3M95 A;  2FCN A;  2KC1 A;  2KLG A;  3P1M A;  5G5G A;  1NEK B;  4MSM B;  2L32 A;  1WGH A;  1KFY B;  5BO4 B;  4BVU C;  3VHT C;  4ACF A;  4NJC A;  3VTW A;  4ZRP A;  4HPL B;  4N6E B;  2K8B A;  4YSZ B;  3HHM A;  3NVZ A;  3ZW3 A;  4FXC A;  2ZCB A;  1J7B A;  4WJO A;  1FO4 A;  5BYS A;  3Q3N C;  1TS3 A;  2KTF A;  3VUW A;  2D10 A;  2IGH A;  1T5X D;  1L6U A;  2KQS A;  1JML A;  4A90 A;  1LGR A;  4H2A A;  1WI0 A;  3NY5 A;  4ARI A;  3ML9 A;  3RFZ B;  2IO0 B;  1BT0 A;  1SE4 A;  3Q14 C;  1JWU D;  4ZYS A;  1NVI D;  1V1P B;  2R2Q A;  3TMP B;  4FHK A;  2L3Z A;  4N59 A;  1IBX B;  2ON8 A;  1K8R B;  5CHV C;  1QOG A;  1YIW A;  2IZV B;  3AE2 B;  3ZO5 B;  4C4V B;  4LNI A;  1FMA D;  2WXF A;  1C4P A;  3Q8B A;  2W3S A;  3NVW A;  5E6N A;  2V4I B;  4C7Y A;  4IUM B;  2L8J A;  2K5P A;  2V3N A;  3NHE B;  4ANX A;  4DHZ B;  1WRD B;  3A4S C;  4W9K A;  4ZRK A;  4AOF A;  2B3A A;  1WJU A;  4F8C B;  2ASQ A;  5MPO A;  2FCS A;  2DHZ A;  3JSV B;  2FBW B;  2O2V B;  2EKI A;  3HVZ A;  3RI7 C;  4AUQ C;  3DHH C;  4G11 A;  3DCG A;  4OZC A;  4HJK A;  2Y3A A;  2KT7 A;  2YVC A;  1KRH A;  2D11 A;  2D3B A;  3V62 A;  3AE8 B;  3QCA A;  3VAW A;  5DPW A;  2OJR A;  3IBE A;  1WR6 E;  1F52 A;  1KH0 A;  4A6Q A;  3TEY A;  3V60 A;  1SEB D;  2DYM A;  2LGX A;  4W9D A;  2N1W A;  3MC9 A;  3AE6 B;  1FEH A;  1E7U A;  1UNS A;  4A3P A;  1HE8 A;  2MRP A;  1RLF A;  1CZP A;  1L5P A;  1WGD A;  2IND C;  2FCM A;  1YX5 B;  3IG3 A;  5FK9 C;  1E7P B;  1MJD A;  1FM0 D;  2WWZ A;  4LTU A;  3HM3 A;  3QIJ A;  1SE3 A;  2LJ5 A;  5HI1 A;  1GJZ A;  1JWM D;  1XLP A;  2X38 A;  3DBL B;  4TKN A;  2BWE S;  3L10 B;  2K39 A;  2ZW1 A;  1ZXI A;  3FC4 A;  1JRU A;  3Q8F A;  1MFW A;  3NOB A;  3PTF C;  2YLM A;  1FNV A;  1EU4 A;  1UF0 A;  3TEZ A;  2KMA A;  3O13 A;  4A9A A;  1PFD A;  2J42 A;  3KLS X;  4MEL A;  4EOY A;  5EE0 A;  1NYR A;  2XN9 C;  2AQ3 B;  3DWG C;  3MHZ A;  1BXT A;  1WH3 A;  3UIO B;  5BYQ A;  4ZOH C;  4IWO A;  5IAA C;  4B95 A;  2CR5 A;  1S3S G;  2JX5 A;  3U8Z A;  4DWF A;  2BGF A;  3ML8 A;  2FID A;  3TJP A;  2MH7 A;  2KVZ A;  1N63 A;  2PJH A;  4MSQ B;  3VTV A;  1V49 A;  3VVW B;  3B1L X;  4CO7 A;  1OQY A;  1UBQ A;  1F0Z A;  1A70 A;  2MJD A;  2L0F A;  4P1C C;  1XO3 A;  4MEM A;  4BOS C;  2O6V B;  2W3R A;  1T3Q A;  1IP9 A;  4LDT B;  1RFK A;  4A20 A;  4GDK B;  2OHF A;  5G5H A;  4KZ0 A;  4J3O D;  3ZJV A;  2BS2 B;  3X23 A;  2L52 A;  4KSK C;  2BW2 A;  1ZUD 2;  4NNJ B;  3HM6 X;  4GB9 A;  2IGG A;  2WDR B;  5D3D A;  4QAY A;  3LDZ E;  4KVG B;  1SSN A;  2N9L A;  3E9S A;  1D4B A;  3N9Y C;  4GOC A;  2EMT A;  2LGI A;  1WYW B;  4RGM A;  2E6X A;  2YEP B;  2GBJ A;  5G2N A;  2J0K A;  4WIP A;  1OQQ A;  1HQR D;  1UZX B;  3ZDT A;  4PS8 A;  2KO3 A;  2MHJ A;  3PHW B;  4AJW A;  1F9J A;  1XXG A;  2KDB A;  1TKY A;  5D2M B;  1WIA A;  3V3X A;  3KH0 A;  3BY4 B;  1T0R C;  2Y5P A;  2GOW A;  4XZ4 A;  1OFF A;  3BVM A;  4WAA A;  2QHO A;  1UH6 A;  4NZL B;  2KDE B;  1YOV B;  1I4G A;  2PEA A;  3QC8 B;  5AUI A;  3CF4 A;  2JWU A;  2HDE A;  1NBF C;  4BKS D;  3EEC A;  3W1S A;  3PT2 B;  3OAW A;  1UWM A;  3B2F A;  2D5G A;  2EKE C;  4WH4 A;  5HG2 A;  2FNJ B;  3I5J C;  5CTR C;  4DDI D;  2GRI A;  4R3D A;  3UQB A;  3HVD A;  1SXT A;  4HLE A;  1OEY A;  2X8X X;  1QOF A;  3JYU A;  3UI3 A;  1FRR A;  2FIF A;  4FHJ A;  3V6C B;  1WGG A;  2LUE A;  1IGC A;  3QX1 A;  1GAQ B;  1K50 A;  3V05 A;  3W9C B;  2WS3 B;  4G50 A;  1TIF A;  3H7P B;  2M0X A;  3AU4 A;  2WXG A;  4HRO A;  3X0W A;  1M4V A;  3VR8 B;  4MGK E;  2GI9 A;  2C7M B;  1FXI A;  1CMX B;  1WF9 A;  2Z0E B;  2EEL A;  1TKG A;  5DPT A;  1OGW A;  3P4P B;  2WLB A;  1GB1 A;  1YQ3 B;  4OZB A;  5C1Z A;  2L1A A;  4NAW A;  5BMH A;  3PZD A;  2LZ6 A;  3KQ4 A;  2J0M A;  2BKR B;  1WYG A;  3Q8E A;  2KMC A;  1QQR A;  3AV8 A;  4JPS A;  1P3Q U;  2Z59 B;  4NJ7 A;  2G3Q B;  2DAF A;  3IHP C;  2KYW A;  1MI0 A;  2D3A A;  3L08 A;  4DXF A;  3RZW C;  1F2R C;  2HE7 A;  3GOE A;  4JLC A;  3KWV A;  3DBH B;  4HKQ A;  1NYQ A;  2LJI A;  2G45 B;  3RNE C;  4ICU A;  3ZNI D;  1J0G A;  1C4A A;  3WAO A;  2WP9 B;  3QAR A;  2ACZ B;  3GS2 A;  4BKT A;  2WYQ A;  3ZRF A;  3EGR A;  2V9H A;  4RGN A;  3MHS D;  1KLV A;  1K52 A;  4FLH A;  1HZ6 A;  2ZPY A;  4KSL C;  3M3J A;  1NDD A;  2HD5 B;  4NAM A;  5L83 A;  1STE A;  5C2T B;  4W9J A;  5FKA C;  3AE3 B;  4AQ7 A;  3ZTD A;  2OED A;  1E8Z A;  2KJH B;  4YTN B;  1KM7 A;  2REX A;  1QLB B;  2QSD A;  4AP4 C;  3FKY A;  2BYT A;  1V5O A;  4DBG A;  1YJ1 A;  3BYY B;  2WDQ B;  1GNU A;  1B1Z A;  2MBE A;  2LHD A;  1QKZ A;  2DEN B;  2G1E A;  3BK2 A;  2WXP A;  2INN E;  3VUX A;  5JHA A;  4OVV A;  2YEP F;  1JQ4 A;  4C80 A;  4C7Z A;  4EKU A;  1PQS A;  4MJS B;  4UDU C;  2MBQ A;  2ZZP B;  2L7R A;  4X57 B;  2NMQ A;  1TGZ B;  1VCB A;  4W9F A;  2WXJ A;  5GXG B;  2DZJ A;  1UD7 A;  4K3C A;  2OOB B;  3AED B;  1WSP A;  4WQO B;  5CHW A;  1R4M I;  1RRB A;  4L1B A;  2KOX A;  3PPA A;  2XK5 A;  3A9K B;  5LXH A;  1VZ6 A;  3OWE B;  1ESF A;  2K6Q A;  2PVG C;  5I4D A;  4ANV A;  1XF5 L;  1V5T A;  2KK8 A;  1V9J A;  2KZR A;  2VZK B;  1GG3 A;  1PUT A;  4RMA A;  2MP2 A;  2AQ2 B;  4BBN C;  3WA0 A;  3DBS A;  3N3K B;  4XDD A;  2RPQ A;  1TT5 B;  4DXA B;  3NUH B;  2KWD A;  4A8X C;  3RNC C;  3TSS A;  4MM3 A;  4RM8 A;  1WMH A;  3N1Z C;  3IVF A;  2A4Z A;  1EU3 A;  1Q0W B;  4HPP A;  4LCD E;  1UWX A;  2MBH A;  4RF1 A;  2RSU A;  1XD3 B;  2WNM A;  3PLV A;  1GT8 A;  4M0W A;  1EUV B;  3P4S B;  1ZE3 D;  2IDY A;  2K9X A;  2BS4 B;  3OLM D;  1PDX A;  2LXC A;  1FRD A;  4EFO A;  2C7H A;  1SGH A;  3MJ5 A;  1XEE A;  1WY8 A;  1T0S C;  1RYJ A;  2BT6 A;  2CJO A;  1GC6 A;  4W9G A;  2UWQ A;  1C78 A;  3A1Q A;  3R8B A;  1GOZ A;  4EZJ A;  2L83 A;  1E8Y A;  2MCN B;  4MT5 A;  1WR1 A;  4WJQ A;  3TL5 A;  3QA8 A;  3U7Z A;  1ROE A;  3HUI A;  1OQR A;  1CQV A;  2PW9 A;  2R61 A;  4XDC A;  3NJT A;  2UU7 A;  4NJ6 A;  4Q2J A;  4YL8 A;  5IP4 D;  2WGS A;  4J6I A;  1SE2 A;  3SEB A;  3LXF A;  1TJE A;  4ZRJ A;  3FAH A;  4YSY B;  2Y5B B;  3T9L A;  2KWU B;  1VLB A;  2BTE A;  4ZYN A;  3DOW A;  2C5L C;  2KKC A;  3E56 A;  3SU8 X;  1GC7 A;  4JX1 C;  2EMS A;  1FCC C;  3ETR A;  1C9F A;  3BZD B;  1KLU D;  2SAK A;  2CHZ A;  2K3U A;  2MBO A;  1V81 A;  4FJV B;  2VZK D;  1YN5 A;  2CKH B;  3P42 A;  4XWT A;  3B9J A;  2KX0 A;  4US8 A;  4ARC A;  3TUO A;  1B9R A;  4RH6 A;  3B0A A;  2WXN A;  1L4D B;  3SDL C;  2ONQ A;  4YXD B;  3I9V 1;  2WX0 A;  2KTR A;  3MC8 A;  4EZK A;  2JRH A;  2GB1 A;  5AZG A;  3CIR B;  1ZW7 A;  1LO5 D;  3ZUN A;  3IAM 1;  1WXQ A;  4BFR A;  3VTU A;  1HTQ A;  1RWS A;  2KFJ A;  4KIK A;  1TZO A;  2CJN A;  4WAF A;  2JF5 A;  2JT4 B;  4WWO A;  3I57 A;  3NVV A;  1WM2 A;  3KVF B;  2NPT B;  3IAS 1;  3V6E B;  2BQQ A;  1LM8 B;  2IO1 B;  4KGR A;  1ZOY B;  4PS3 A;  3OJ4 B;  4BAX A;  2DBY A;  4EUT A;  2NBW B;  3WAL A;  3Q3J A;  4WWP A;  3WAP A;  2N7J A;  5IOI A;  3ENE A;  1Q10 A;  2WU2 B;  2V1Y A;  4N9F 4;  4WWM A;  1SJH D;  1MPE A;  3PO0 A;  2K0P A;  2PVO D;  1J7A A;  3BII D;  2KAC A;  4WUR A;  3N20 C;  4XC2 A;  3ZXV A;  4DHZ E;  1WXA A;  2IJ0 A;  4HVB A;  3ZRC A;  4GGQ A;  2AQ1 B;  1Y56 A;  2C7N B;  5TSS A;  3APD A;  3Q3O C;  2RDH A;  1KF6 B;  3TEX A;  4RFB A;  2JRI B;  1V80 A;  1YJJ A;  1D5M C;  2VH2 A;  4GDL A;  5JXV A;  3RZF A;  4G3X B;  3KUD B;  4NY0 A;  2JPH A;  3W5U B;  1KTK A;  4GMV A;  3CSF A;  5HKH A;  1E0Z A;  2IGD A;  3GE8 C;  4M8N A;  2LI5 A;  3RPF C;  1XQQ A;  1DOI A;  4ASW C;  2KFK A;  1IUE A;  2DNF A;  2V3P A;  5E6J A;  1TY2 A;  2WXM A;  4FA6 A;  3CF6 E;  1V1P A;  1PYW D;  2BYV E;  4E3C A;  2GBN A;  3RMK C;  4K7U A;  1FNW A;  4PT5 A;  3AEA B;  3RUL A;  4GSW A;  4ANW A;  2MQJ A;  3AE1 B;  4F1S A;  3DVN U;  3QJZ A;  4EE2 A;  2N9X A;  3EUB 2;  2I2Y A;  1YNT E;  2QMT A;  4CYE A;  2W54 A;  1H8C A;  2PKO A;  4W9L A;  1VJK A;  2ZVN A;  2PMV A;  5FR6 A;  4O1N A;  4YTM B;  1X1M A;  3OJ3 A;  1N60 A;  3EA6 A;  1V8C A;  5GMV A;  2BWF A;  1CJE A;  3URY A;  5AEK B;  1WFY A;  5J2R A;  3JSV A;  2O2V A;  3BK1 A;  5FR3 A;  1IYF A;  1YX6 B;  3KYD D;  3QAQ A;  2IY0 B;  4B6W A;  1V6E A;  2LEK A;  2NTT A;  3AMZ A;  3TCA A;  3ABV B;  2MX2 A;  2NBV B;  3ZIM A;  4REZ A;  1WE6 A;  3DPD A;  2D2Q A;  3ECI A;  5T8I A;  1NI2 A;  4II3 B;  5TR5 A;  3PHX B;  2MWS B;  4OW0 A;  1MHX A;  1E5W A;  1GPX A;  3R7R A;  1P7F A;  4KZC A;  1YN4 A;  1HXY D;  2AYO B;  3C8Y A;  2KX3 A;  3NZ3 A;  2N9K A;  4ZRQ A;  4G0N B;  4JL9 A;  1UGJ A;  2N4F A;  2W82 A;  4IOI E;  4AJY B;  3U52 E;  2RDB C;  2PLP A;  2NS5 A;  2WXH A;  1WZ3 A;  2QDF A;  4ZHP A;  4XE0 A;  1E8X A;  3TIX A;  3L4P A;  3PZ7 A;  2K8C A;  5IA7 A;  3BIN A;  5G55 A;  1IPG A;  4HK2 A;  1S1Q B;  1YQ4 B;  1I4Q A;  4IKG A;  3VXW A;  2N1V A;  2HJ8 A;  2LGY A;  1DOX A;  1JWA D;  2M56 B;  3AXC A;  2JZ3 B;  2KQ7 A;  2MW5 A;  2ZEQ A;  3OG5 A;  1WE7 A;  3FIL A;  1WX9 A;  4EZL A;  1U4A A;  3VRB B;  3MTN B;  2LAS A;  2KVR A;  3P2B A;  4MGI E;  1ZGU B;  2BB6 A;  4XGA B;  4BKS A;  2LRW A;  3P4Q B;  3AEE B;  4HEA 1;  3DWM A;  2N9E B;  4DXG A;  1ACC A;  1FXT B;  3VRA B;  2KQ4 X;  1YQB A;  3A4R A;  4IC7 B;  3DDC B;  2DX5 B;  4K81 A;  3S2A A;  3DBR I;  2J53 A;  5AZH A;  5H92 C;  1D6E C;  5E6P A;  2INP E;  3RNA C;  5IKC M;  3RNG C;  4XWW A;  2J4X A;  2FE8 A;  2I38 A;  2KAN A;  4AS1 A;  3HRD D;  3NZS A;  5LNK 1;  2LWP A;  1KJT A;  3HIZ A;  2AWT A;  2O6V A;  1JCK B;  4B0M A;  4ANU A;  4GDK A;  1FFU A;  4K7W A;  5DPS A;  3DVG Y;  4HDQ A;  1QIL A;  2QEJ C;  5C23 A;  1N62 A;  2K6D B;  3NVY A;  2XBB C;  3A9J B;  1JRO A;  5DPR A;  5HFY A;  4JWS C;  1UUP A;  3UIP B;  1XLN A;  2JQR B;  2LMC A;  2WXL A;  3AUL A;  4XX5 A;  3ZKJ C;  1XLO A;  1V86 A;  2V3S A;  4CHK A;  2MP2 B;  1EF5 A;  1VD2 A;  2WU5 B;  1WGK A;  2SEB D;  3QK0 A;  2R2O A;  2TSS A;  2ZVO A;  3VDZ A;  4WJP A;  1ET9 A;  3NRZ A;  4L23 A;  4ZHO A;  3PRZ A;  1WMH B;  1JW9 D;  1FPY A;  3NS8 A;  1HZ5 A;  2PE6 B;  1FIQ A;  5EE3 A;  1D5Z C;  1C79 A;  4HWI B;  5IO9 A;  2MJ3 A;  1AN8 A;  4M0W B;  4IDI A;  4LK0 M;  3ONS A;  3AE5 B;  5EE9 A;  1VZ8 A;  2IO3 B;  1DOY A;  3ZQ4 A;  2I1K A;  1PGA A;  4BBN F;  1HTO A;  1ZXH A;  4WJN A;  1K51 A;  2WHI A;  4S17 A;  2GMI C;  1M94 A;  2ZNV C;  3IFW B;  1V1O A;  2J52 A;  3UQA A;  2UYZ B;  3SFD B;  3DVN V;  1KLG D;  1R4N I;  4M00 A;  1N61 A;  1JWS D;  1ET6 A;  1TYG B;  5L95 C;  2CHX A;  4B0E A;  4S0R A;  3LJ3 A;  3CMM B;  4GU2 A;  3W1S C;  1Z5S B;  4URK A;  3AH7 A;  1WGY A;  3H7P A;  2WQY B;  3IT6 B;  1EWY C;  1N5X A;  5AZF A;  3KYC D;  4ZDV A;  5H8Y E;  1AW7 A;  4I6N B;  4DHJ B;  2M0A A;  1SB3 C;  3AEG B;  1E7V A;  1XLQ A;  3ZNH B;  3AN1 A;  2M8S A;  1WZ0 A;  4BKG A;  3Q8C A;  5EDS A;  2JVC A;  2QIE B;  2CS4 A;  2L00 B;  3NG0 A;  1R7S A;  2BBC A;  2MLB A;  2N7D A;  4RGO S;  4CQN A;  2PTL A;  1ZDX A;  2RD0 A;  1FXA A;  4KDL B;  3GZN I;  2GBM A;  4D2K A;  3RT3 B;  1Q1O A;  2K8H A;  4GLS C;  3I63 C;  4KIK B;  5D7G A;  1L0X B;  2QJL A;  2Y5C A;  2ZPN A;  3MFG A;  3SHQ A;  1WM3 A;  2G9H D;  4HKZ E;  3Q6B A;  3UIN B;  3WIM A;  3AEF B;  4KDI C;  1BML C;  2Z8L A;  3Q8A A;  1DYQ A;  3M62 B;  5BMG A;  3AEB B;  3VFK A;  1H7X A;  2KC2 A;  3KUZ A;  2OJW A;  5IN7 A;  3ZJT A;  2LFI A;  3TBL D;  1ENF A;  1C76 A;  2KNB A;  4A55 A;  1L0V B;  2H89 B;  3EFU A;  1JAL A;  2I1J A;  1HA5 A;  2M1M A;  2XEW A;  2BS3 B;  2JXT A;  3WCQ A;  1TBE A;  3W2D A;  2NBU A;  3ZLZ A;  3T3N A;  3B2G A;  1JRP A;  3DBR B;  1KOT A;  5KHO A;  4TQ0 A;  4GDL B;  1J19 A;  1MHH E;  3L13 A;  3R3M A;  2D07 B;  4HXD A;  4GIV A;  2A5U A;  2N7E A;  2ZCC A;  3ZNZ B;  4DHJ D;  2LXA A;  3NZU A;  3L0W B;  1QT9 A;  4YWG G;  2WXQ A;  3GP7 A;  3H7S A;  3IT4 B;  4PYU A;  1T0Q C;  3ZGZ A;  2RGF A;  5D3I B;  1WXM A;  3T8M A;  3APF A;  1LXD A;  2RR9 A;  2J7Q B;  2KFK B;  1TS2 A;  2KD0 A;  3RD2 A;  2LGS A;  2JU6 X;  4BZA A;  1C77 A;  1PGB A;  1VR9 A;  4KKI A;  1ZDV A;  1TY0 A;  1WJ6 A;  1L2N A;  3BVZ A;  2RMM A;  1E9M A;  1OTR B;  3PRE A;  2VRR B;  5D94 A;  2JYT A;  1WWT A;  3AE9 B;  2RPV A;  3SFE B;  2FUH B;  2BYE A;  4P7I A;  3K9O B;  4LNO A;  5LXI B;  2HJ1 A;  2PIA A;  4JE3 B;  3T3O A;  4FJZ A;  1EF1 A;  4MJS A;  1PGX A;  5J17 A;  2C60 A;  1P7E A;  2HTH A;  4E71 A;  2KLC A;  3GB1 A;  1XT9 B;  2QIL A;  3ZJU A;  3C0R B;  4ZRI A;  1WXV A;  3Q69 A;  4WQM A;  1ZP0 B;  4HCP B;  1H4R A;  3ZNG C;  1I7H A;  3BYT B;  5BMI A;  4NPN A;  4W9I A;  4JWU C;  3ZYY X;  1D5X C;  3UGB B;  3U7D A;  4MAC A;  2ZNV B;  2L76 A;  2MSE D;  1AYF A;  3A9K A;  2LUM A;  3I3T B;  1TS5 A;  5DCN A;  1NEN B;  3LYY A;  1MVK A;  3N1Y C;  4LNK A;  1QOB A;  2PPH A;  2WX1 A;  2N0S B;  1G6J A;  4C56 C;  1QF6 A;  4A3O A;  2JY6 A;  1DGJ A;  1R4N B;  2MBB B;  4RF0 A;  1UBI A;  4DQO C;  4KGS A;  4ITK A;  2AEH A;  1P98 A;  1VZ7 A;  3APC A;  2DAJ A;  3PLU A;  2JYE A;  2BVC A;  1N5W A;  2W55 A;  3P4R B;  2QC8 A;  1GTE A;  3N30 A;  4FJY A;  2FAZ A;  4GXB A;  4US9 A;  4OHJ A;  3PRM B;  2DWQ A;  3U4E G;  1FNU A;  1J8C A;  4L2Y A;  4IWP A;  2LVO A;  3Q3F A;  1E6E B;  3EFC A;  2AL6 A;  1AWD A;  2KMM A;  3DBH I;  3FIL B;  1RAX A;  1R4M B;  2FCQ A;  1RM6 C;  3AB5 A;  3ZTC A;  4LLG M;  2D3C A;  2JSV X;  3GZN B;  1NI3 A;  4TSS A;  4YSX B;  4I6P A;  3TEW A;  1TS4 A;  2BF8 B;  2KWC A;  2C9W B;  4GN1 A;  2G4D B;  2KJR A;  2LRU A;  1IBX A;  2GBK A;  1YD8 U;  3SR6 A;  4IM0 A;  1TZ1 A;  4C4V A;  1UEL A;  3U2S C;  3P63 A;  3Q3M C;  2KDM A;  2W9N A;  1GUA B;  1F77 A;  3J9C A;  1L4Z B;  4NAW B;  3B08 A;  1XCQ L;  4JGH B;  2DYB A;  1FD6 A;  3UF8 A;  3R2I A;  2G4S A;  1P0R A;  4TV3 A;  1QOA A;  2KN4 A;  2K25 A;  3EC8 A;  3KUC B;  1EWC A;  3V61 A;  3WAM A;  2CHW A;  2KDI A;  2NCN A;  4HCN B;  2Q5W D;  4JQW C;  4FAD A;  2RDG A;  1YJI A;  2V0G A;  2BB5 A;  4HJG E;  3CST A;  5CX3 A;  2WDV B;  3L54 A;  3IXS A;  1J7C A;  1SE9 A;  1E90 A;  3EHV A;  2MJE A;  1XCT L;  1GB4 A;  2LGD A;  2LD9 A;  2LVQ A;  3W5V B;  2B76 B;  3ALB A;  1WGR A;  3L17 A;  4KKJ A;  2M19 A;  2VH1 A;  1SIJ A;  2DZI A;  4KGT A;  2DLB A;  2N9P C;  1C4C A;  2NPT A;  2DZK A;  2XNA C;  3PZ8 A;  1Q5W B;  3Q2A C;  3K9P B;  4TMA B;  1MG8 A;  2JWZ A;  4DDG D;  3MP9 A;  2KWV B;  5AUK A;  5JZE B;  1F1H A;  4W9C A;  1Z2M A;  1V2Y A;  5E6O A;  3R66 C;  5BYR A;  1H7W A;  4HDO A;  2NVU I;  5EE1 A;  3RN9 C;  1P9D U;  1ZKH A;  3DHI C;  3L16 A;  4IG7 B;  4M8M A;  2QCZ A;  3RUI B;  3BVG A;  3PRP B;  5J18 A;  2CU3 A;  3MC0 B;  4JIO U;  4B9K A;  3MJW A;  4LNN A;  1LFD A;  3DHG C;  3AE7 B;  4FUL A;  3VR9 B;  2JUO A;  2KXJ A;  2WXR A;  4FBJ B;  1OEY J;  4M02 A;  5D6J B;  4N58 A;  3RNB C;  1SIF A;  3VUY A;  4IW0 A;  1TTN A;  2WXO A;  4MGY E;  2ZJD A;  4BOZ B;  2O6V D;  1T6B X;  1WRI A;  4LDT D;  1I42 A;  2K1F A;  2E3T A;  2V4L A;  2IO2 B;  2MA9 B;  2IYD B;  4PYZ A;  1E10 A;  2WXI A;  3SD5 A;  1MG4 A;  3PVL A;  3GE3 C;  1N6Z A;  3PV1 A;  4IWQ A;  1UGM A;  1SF0 A;  4M01 A;  2CU1 A;  4HRS A;  1K53 A;  3D32 A;  4KX6 B;  3NS1 A;  1VDV A;  1L7Y A;  3ZXR A;  4E74 A;  2FUG 1;  3R7Q A;  2XK5 B;  1C3T A;  3W1Y A;  2KAJ A;  5C3J B;  2KDF B;  2ZW0 A;  4IM3 A;  2HTM E;  3N1X C;  4TQ1 A;  3H6N A;  2MEK A;  1D3Z A;  1VRA B;  3M63 B;  3C19 A;  4OVU A;  4TUU A;  5KHQ A;  2L05 A;  1LQB A;  3H9D A;  3QHT A;  4KV2 A;  2H88 B;  4RCO A;  4AWJ A;  3VH3 B;  4EEW A;  4PK1 A;  1I35 A;  1F2R I;  2KN5 A;  1BUI C;  2LHE A;  1P1A A;  4MM3 B;  1TKE A;  4LJP B;  2KJ6 A;  4RM9 A;  1A5R A;  2GBR A;  2IY1 B;  2JXX A;  3AI5 A;  3BWU D;  1GTH A;  1I4R A;  1T0Y A;  4YT0 B;  1FFV A;  5LLI A;  3AEC B;  2IPK D;  3A33 B;  3PGE A;  3PS6 A;  4MGZ E;  3R2T A;  1C1Y B;  2J0J A;  3WAN A;  3AM9 A;  2BKF A;  2DZM A;  3A1Q B;  4LJO B;  2ICI A;  2IBI B;  3KWL A;  3U30 A;  2M17 A;  3JVZ X;  3ZDM C;  4NQL B;  4RNA A;  4W9E A;  4HPM B;  1RFA A;  4II2 B;  4P1B C;  4MDK E;  4W9H A;  1ZPS A;  4USA A;  2WDT B;  1HEZ E;  2Z0D B;  1EO6 A;  3H8H A; 
#chains in the Genus database with same CATH homology
 2NTS A;  4P16 A;  5HHD G;  3RPF C;  4MH8 A;  1DOI A;  4P6V F;  2WXG A;  1TS2 A;  4HRO A;  2JU6 X;  1C77 A;  1PGB A;  1M4V A;  1IUE A;  1VR9 A;  3VR8 B;  2V3P A;  1TY2 A;  4KKI A;  1V97 A;  1ZDV A;  1EM7 A;  5E6J A;  1TY0 A;  2GI9 A;  2WXM A;  3BVZ A;  2RMM A;  1E9M A;  1I4P A;  1V1P A;  2JYT A;  1FXI A;  1PYW D;  1WWT A;  4YTP B;  2WXK A;  3AE9 B;  2RPV A;  3SFE B;  3LB8 C;  2AX5 A;  2EEL A;  1FNW A;  1JWB D;  3AEA B;  4OZA A;  4PT5 A;  4JE3 B;  1TKG A;  2PIA A;  3AE1 B;  3AE4 B;  3T3O A;  3P4P B;  2WLB A;  4EE2 A;  3EUB 2;  1PGX A;  1FCL A;  1GB1 A;  2I2Y A;  1YNT E;  2QMT A;  1YMH E;  1YQ3 B;  2W54 A;  1P7E A;  4OZB A;  2PKO A;  1VJK A;  2L1A A;  3VQI A;  2PMV A;  4O1N A;  4YTM B;  2JZP A;  3GB1 A;  1I4H A;  1N60 A;  3EA6 A;  1V8C A;  2QIL A;  1SBB B;  1SJE D;  4OVZ A;  3ZJU A;  1CJE A;  3URY A;  5BMH A;  2DYO A;  1L0Y B;  3Q69 A;  4WQM A;  1I4X A;  1ZP0 B;  3KQ4 A;  1WYG A;  3BK1 A;  3Q8E A;  5FR3 A;  1I7H A;  3BYT B;  1QQR A;  3AV8 A;  5BMI A;  4RGT A;  4JPS A;  3CWI A;  4JWU C;  3ZYY X;  1D5X C;  2LEK A;  2NTT A;  4MAC A;  1YN3 A;  3AMZ A;  3ABV B;  1AYF A;  2LUM A;  1TS5 A;  1MI0 A;  1NEN B;  3LYY A;  4REZ A;  1CK1 A;  1MVK A;  1QOB A;  4DXF A;  1F2R C;  5T8I A;  1L6V A;  2K22 A;  1IGD A;  3KWV A;  2N0S B;  4HKQ A;  1NYQ A;  2LJI A;  4C56 C;  1QF6 A;  4OW0 A;  1MHX A;  3P1M A;  1GPX A;  1DGJ A;  1P7F A;  5G5G A;  1YN4 A;  4RF0 A;  1HXY D;  1C4A A;  2WP9 B;  3C8Y A;  4DQO C;  4KGS A;  4ITK A;  1NEK B;  3NZ3 A;  2ACZ B;  1VZ7 A;  2N9K A;  2L32 A;  3GS2 A;  4ZRQ A;  1UGJ A;  2W82 A;  1KFY B;  4IOI E;  3U52 E;  2PLP A;  3EGR A;  2JYE A;  2WXH A;  4RGN A;  1K52 A;  4ZHP A;  1N5W A;  2W55 A;  4XE0 A;  4NJC A;  1HZ6 A;  3P4R B;  4ZRP A;  3L4P A;  3PZ7 A;  1GTE A;  4N6E B;  4YSZ B;  3NVZ A;  4NAM A;  1YQ4 B;  1I4Q A;  4FXC A;  1STE A;  5C2T B;  4IKG A;  5FKA C;  4US9 A;  4OHJ A;  3AE3 B;  1J7B A;  4AQ7 A;  2DWQ A;  3U4E G;  1FO4 A;  1FNU A;  5BYS A;  4L2Y A;  1TS3 A;  2OED A;  1DOX A;  1E6E B;  2IGH A;  1JWA D;  4YTN B;  1AWD A;  1T5X D;  2KMM A;  2M56 B;  1L6U A;  1JML A;  1QLB B;  3FIL B;  2QSD A;  4A90 A;  1RM6 C;  2BYT A;  4H2A A;  3BYY B;  3AB5 A;  2WDQ B;  3FIL A;  1B1Z A;  4ARI A;  4LLG M;  2LHD A;  3RFZ B;  2JSV X;  1SE4 A;  1QKZ A;  1JWU D;  4ZYS A;  2G1E A;  1NVI D;  1NI3 A;  3VRB B;  1V1P B;  4TSS A;  3BK2 A;  4N59 A;  4YSX B;  3TEW A;  1IBX B;  2WXP A;  1TS4 A;  2BB6 A;  2INN E;  2ON8 A;  1QOG A;  3P4Q B;  3AE2 B;  3AEE B;  1IBX A;  2YEP F;  4HEA 1;  3DWM A;  1FMA D;  3SR6 A;  1ACC A;  4DXG A;  4C7Z A;  4C80 A;  1JQ4 A;  2WXF A;  3VRA B;  2KQ4 X;  1C4P A;  3Q8B A;  2W3S A;  3NVW A;  3U2S C;  2V4I B;  3P63 A;  4C7Y A;  2J53 A;  5H92 C;  2K5P A;  1D6E C;  2V3N A;  2KDM A;  4UDU C;  2INP E;  1F77 A;  3J9C A;  4XWW A;  1L4Z B;  4NAW B;  2J4X A;  1XCQ L;  2NMQ A;  1FD6 A;  2FE8 A;  2I38 A;  3R2I A;  4AS1 A;  5MPO A;  3HRD D;  5LNK 1;  1QOA A;  2KN4 A;  2WXJ A;  5GXG B;  2FBW B;  1JCK B;  3AED B;  1EWC A;  2EKI A;  1WSP A;  4B0M A;  1FFU A;  4L1B A;  3HVZ A;  2Q5W D;  1QIL A;  2QEJ C;  4OZC A;  2RDG A;  1N62 A;  1YJI A;  2V0G A;  2BB5 A;  2Y3A A;  1VZ6 A;  3OWE B;  1ESF A;  1KRH A;  2PVG C;  3NVY A;  4HJG E;  1JRO A;  2WDV B;  5HFY A;  4JWS C;  1UUP A;  3IXS A;  1J7C A;  1XLN A;  5I4D A;  2MJE A;  3ZJT A;  2JQR B;  2LMC A;  2WXL A;  1XF5 L;  3AE8 B;  1XCT L;  1GB4 A;  3W5V B;  2B76 B;  1XLO A;  2VZK B;  2WU5 B;  1WGK A;  1PUT A;  4KKJ A;  1KH0 A;  2SEB D;  4A6Q A;  3TEY A;  2AQ2 B;  2M19 A;  1SIJ A;  2TSS A;  1SEB D;  4KGT A;  2DLB A;  2DYM A;  1C4C A;  1ET9 A;  4XDD A;  3NRZ A;  4L23 A;  2XNA C;  3NUH B;  2KWD A;  3PZ8 A;  4A8X C;  3AE6 B;  4ZHO A;  1FEH A;  1UNS A;  4TMA B;  1JW9 D;  3TSS A;  1CZP A;  1L5P A;  3MP9 A;  1HZ5 A;  1EU3 A;  1FIQ A;  5AUK A;  5EE3 A;  1D5Z C;  1C79 A;  1UWX A;  5FK9 C;  1E7P B;  1AN8 A;  2MJ3 A;  4RF1 A;  4IDI A;  5BYR A;  1FM0 D;  4LK0 M;  2WNM A;  1GT8 A;  1H7W A;  3AE5 B;  4LTU A;  4M0W A;  5EE9 A;  5EE1 A;  1VZ8 A;  1SE3 A;  3P4S B;  5HI1 A;  1ZE3 D;  2IDY A;  2K9X A;  3ZQ4 A;  1DOY A;  1PGA A;  2BS4 B;  1JWM D;  3BVG A;  1XLP A;  2X38 A;  1PDX A;  2CU3 A;  1ZXH A;  1FRD A;  3MC0 B;  2ZW1 A;  1K51 A;  1ZXI A;  3FC4 A;  3MJ5 A;  1XEE A;  3Q8F A;  1RYJ A;  3AE7 B;  2BT6 A;  2CJO A;  3VR9 B;  1V1O A;  1FNV A;  1EU4 A;  2J52 A;  2WXR A;  3TEZ A;  3O13 A;  1C78 A;  3R8B A;  4N58 A;  3SFD B;  1GOZ A;  1KLG D;  4A9A A;  1PFD A;  2J42 A;  2L83 A;  3KLS X;  1N61 A;  4MT5 A;  2WXO A;  1JWS D;  5EE0 A;  1NYR A;  2XN9 C;  1ET6 A;  2AQ3 B;  3DWG C;  3MHZ A;  1BXT A;  3U7Z A;  1ROE A;  3HUI A;  1TYG B;  1OQR A;  1CQV A;  2PW9 A;  2R61 A;  4XDC A;  5BYQ A;  4B0E A;  1T6B X;  1WRI A;  4ZOH C;  4Q2J A;  2E3T A;  1SE2 A;  3SEB A;  2JX5 A;  1TJE A;  3LXF A;  3AH7 A;  3FAH A;  4YSY B;  2WXI A;  1E10 A;  2MH7 A;  1VLB A;  1N63 A;  2BTE A;  2WQY B;  3IT6 B;  1EWY C;  1N5X A;  1SF0 A;  5H8Y E;  1AW7 A;  3E56 A;  2M0A A;  1SB3 C;  1F0Z A;  4HRS A;  3AEG B;  1XLQ A;  1K53 A;  1A70 A;  3AN1 A;  4JX1 C;  2MJD A;  4KX6 B;  3Q8C A;  1FCC C;  1XO3 A;  3ETR A;  2QIE B;  3NS1 A;  1C9F A;  3BZD B;  1KLU D;  2W3R A;  1T3Q A;  2SAK A;  1VDV A;  3H8H A;  1RFK A;  2K3U A;  4GDK B;  2VZK D;  1YN5 A;  2OHF A;  3P42 A;  5G5H A;  2FUG 1;  3B9J A;  4J3O D;  4XWT A;  2BS2 B;  1R7S A;  4US8 A;  3ZJV A;  4ARC A;  2BBC A;  2L52 A;  2BW2 A;  1ZUD 2;  4RGO S;  3TUO A;  4CQN A;  1B9R A;  4RH6 A;  2PTL A;  1ZDX A;  2KAJ A;  2IGG A;  5C3J B;  2WXN A;  2WDR B;  1L4D B;  1FXA A;  2ONQ A;  4YXD B;  2ZW0 A;  3I9V 1;  4D2K A;  2HTM E;  5D3D A;  2GB1 A;  4TQ1 A;  3CIR B;  1LO5 D;  1SSN A;  4GLS C;  2MEK A;  2N9L A;  3E9S A;  1D4B A;  3N9Y C;  3IAM 1;  5D7G A;  1VRA B;  1WXQ A;  1L0X B;  2LGI A;  2QJL A;  4RGM A;  1RWS A;  2E6X A;  2Y5C A;  1TZO A;  3MFG A;  2G9H D;  2YEP B;  2CJN A;  4HKZ E;  4WAF A;  4WIP A;  2H88 B;  4RCO A;  1OQQ A;  1HQR D;  3AEF B;  3I57 A;  3NVV A;  1BML C;  2Z8L A;  1F2R I;  1XXG A;  3Q8A A;  3IAS 1;  1DYQ A;  1BUI C;  1TKY A;  5BMG A;  2LHE A;  3V3X A;  4KGR A;  1ZOY B;  4MM3 B;  1TKE A;  2Y5P A;  2DBY A;  3AEB B;  1OFF A;  1H7X A;  3BVM A;  2N7J A;  1Q10 A;  2WU2 B;  4NZL B;  3BWU D;  2LFI A;  4WWM A;  1GTH A;  1I4R A;  1MPE A;  4YT0 B;  1FFV A;  1SJH D;  1ENF A;  3PO0 A;  3AEC B;  1C76 A;  4A55 A;  1I4G A;  5AUI A;  2K0P A;  3CF4 A;  2PVO D;  2JWU A;  1L0V B;  2IPK D;  2H89 B;  1J7A A;  2HDE A;  3BII D;  1JAL A;  2KAC A;  4WUR A;  1HA5 A;  3R2T A;  3W1S A;  2BS3 B;  1UWM A;  2JXT A;  2D5G A;  3B2F A;  4WH4 A;  5HG2 A;  2IJ0 A;  3WCQ A;  3W2D A;  2AQ1 B;  2GRI A;  3T3N A;  3B2G A;  3AM9 A;  1Y56 A;  4R3D A;  5TSS A;  1JRP A;  2RDH A;  1KF6 B;  3HVD A;  3TEX A;  4TQ0 A;  4RFB A;  4GDL B;  1SXT A;  1MHH E;  1YJJ A;  1D5M C;  2ICI A;  3KWL A;  5JXV A;  1QOF A;  4RNA A;  3UI3 A;  1FRR A;  4YWG G;  1QT9 A;  2WXQ A;  3GP7 A;  1IGC A;  3W5U B;  1GAQ B;  3IT4 B;  1KTK A;  1K50 A;  1ZPS A;  3ZGZ A;  3V05 A;  4USA A;  3W9C B;  5D3I B;  2WS3 B;  1HEZ E;  1E0Z A;  2IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...