3P4SB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with a 3-nitropropionate adduct
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
total genus 62
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4sB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4sB01
1WYGA 1QLBB 3AEFB 4YTPB 1SB3C 1FFUA 1QOGA 3AEAB 1YJIA 2CJNA 1NENB 2G1EA 1TKYA 2BT6A 2L83A 2E3TA 2K5PA 1GAQB 3NVWA 1YQ4B 5H92C 5EE9A 4C80A 2DBYA 3AEDB 1QOFA 1QOAA 2PVGC 2W3SA 1UWMA 4WQMA 1V97A 1E10A 2WDVB 5C3JB 3P4QB 4JX1C 2K9XA 1KRHA 4JWSC 4C7ZA 5C2TB 3VRAB 3B2FA 3AE3B 1QT9A 1XLNA 2JX5A 1T3QA 3ABVB 3CF4A 1I7HA 1ZP0B 4YXDB 3L4PA 4US9A 1GT8A 1E0ZA 3AECB 3AE6B 2AX5A 5EE3A 2LEKA 3LB8C 1N60A 4N59A 3AH7A 3DWGC 3P4SB 1VLBA 1FO4A 4A9AA 2EKIA 1PUTA 3VR9B 3FC4A 4WWMA 4ZHPA 1N62A 2Y5CA 1H7WA 1VJKA 2BS2B 1WXQA 1YJJA 1H7XA 3VR8B 1A70A 2MH7A 3B2GA 2OHFA 1PDXA 3ZYYX 1F0ZA 5AUIA 2QIEB 2B76B 1J7BA 1NYRA 1B9RA 1E6EB 3AE1B 3HUIA 3WCQA 1KF6B 3AE9B 2Q5WD 3NVZA 1OQRA 4N6EB 2H88B 4YT0B 1SF0A 3AMZA 1NI3A 1FXAA 1XLOA 2PVOD 4N58A 1JW9D 4LTUA 1EWYC 5AUKA 5G5GA 2ACZB 3AEEB 3AE5B 1IUEA 1GTEA 3HVZA 1J7CA 5MPOA 1KFYB 1DOIA 1JROA 2N0SB 2JQRB 4YSZB 4C7YA 2WDQB 1FIQA 1NVID 1RWSA 3HRDD 3NVYA 4HROA 1RM6C 3AE8B 1CJEA 1L0VB 1FXIA 3NVVA 1OQQA 1NEKB 5H8YE 1JRPA 3CIRB 2PIAA 5GXGB 1XLPA 1N5XA 1L5PA 1JQ4A 1L6VA 1J7AA 1VDVA 3LXFA 3AM9A 2WS3B 2FBWB 1L6UA 2KAJA 1TKEA 2MJDA 1E7PB 1E9MA 1V8CA 1PFDA 2W55A 1CZPA 1FRRA 2W3RA 3EUB2 3FAHA 3W5VB 2H89B 1QOBA 2HTME 4YTMB 3AE7B 2PKOA 1TJEA 1XO3A 2WLBA 2WDRB 3SFEB 3KWLA 1FM0D 1N63A 4YSXB 3AE4B 1N5WA 3CWIA 1YQ3B 2L52A 3AE2B 1TKGA 1NYQA 4HRSA 3P4PB 1FFVA 5EE0A 2BS4B 1ROEA 2WP9B 2QJLA 3W5UB 5G5HA 2KMMA 2M56B 3AB5A 3DWMA 4US8A 4ZHOA 1DOXA 3AEGB 1ZOYB 1RFKA 1QF6A 1AYFA 1WWTA 1TYGB 1JWBD 3NRZA 1GTHA 1FRDA 3P63A 3B9JA 3SR6A 1JWAD 1WGKA 4ITKA 2M19A 1JALA 1AWDA 2BS3B 2K22A 3BIID 1DOYA 3VRBB 1OFFA 1RYJA 1XLQA 3NS1A 1DGJA 2CJOA 4YSYB 3SFDB 2WU2B 5EE1A 3PO0A 2DWQA 4KX6B 4IDIA 3P4RB 3AV8A 1ZXIA 4JWUC 4YTNB 3AN1A 2WU5B 1GPXA 2W54A 2CU3A 1SIJA 2MJ3A 1R7SA 4P6VF 4FXCA 1FMAD 1ZUD2 3P1MA 3AEBB 1N61A 2MJEA 4USAA 2WQYB 4ZOHC 3W9CB 1WRIA 3RPFC 3ETRA
chains in the Genus database with same CATH superfamily
3V6EB 2DNFA 1KLGD 1SB3C 3RMKC 1WJ6A 1GAQB 1WF9A 2KZRA 4JIOU 4WQMA 5D3IB 1EU3A 4W9FA 3P4QB 3TL5A 1X1MA 1UGJA 4TMAB 2KDFB 1AARA 3RULA 1CQVA 2V3NA 4BBNF 3DWGC 3TBLD 2EKIA 1H7WA 2BS2B 1WXQA 4CO7A 4GLSC 2N4FA 3M95A 2OHFA 2XNAC 4KGSA 3MHZA 3VXWA 3ZLZA 1A5RA 2AL3A 3RD2A 2PVOD 1ET9A 3AEEB 1IUEA 5HHDG 4GDLB 4P1CC 4W9KA 2XN9C 1NVID 2WNMA 4MACA 2QSDA 2JF5A 2KACA 2RDHA 5G55A 1JQ4A 3LDZE 2EMTA 3EFCA 4L23A 1SJED 2RSUA 1FNWA 2KX0A 4MM3B 2VZKD 2ZZPB 3V61A 3MC0B 3KW5B 2KFKB 3KQ4A 1M4VA 1NDDA 3UQBA 4HJGE 3WALA 1K50A 1TS2A 2GBRA 3W5UB 4AJWA 2KTRB 2LASA 2KLGA 1KM7A 2ZEQA 2D10A 5JZEB 4RGOS 1RFKA 1ZOYB 3ZJUA 2X38A 2PE6B 1EO6A 4IWQA 4MJSB 5JXVA 2KQ4X 2ICIA 3IFWB 5FR6A 5EE1A 1WIAA 4FADA 5DCNA 4JLCA 3RNGC 4FXCA 3UINB 3W1SC 1DYQA 1Z5SB 1YN5A 4HJKA 1L2NA 4N9F4 2WX1A 3NVWA 2FIFA 3H6NA 1I4RA 1WXVA 2W3SA 3Q8AA 1UWMA 5CHVC 4AJYB 4KIKB 1L0XB 4IM0A 2MRPA 4LLGM 4TQ0A 3L4PA 2QCZA 3AE6B 4OVUA 4KGTA 1V1OA 3OJ4B 4EZKA 4ARCA 2NTTA 2FAZA 1GOZA 4E71A 1ZXHA 1J7BA 1XXGA 1NYRA 1E6EB 4GGQA 4N6EB 1FCLA 4A3PA 2Y5BB 4EFOA 3QARA 2LGYA 2K25A 1T0YA 2N0SB 4YSZB 3HRDD 4K7SA 4C4VB 4DHJD 4HXDA 4NAWA 5IA7A 2DZIA 4NNJB 1SJHD 1HTOA 4BKTA 3FILB 4YL8A 3L17A 2WDRB 1YMHE 2N9LA 2ZVOA 3WA0A 3DBSA 4IM2A 3WAMA 1MFWA 2QJLA 4J6IA 4NY0A 2BYFA 3AI5A 2NPTA 2D3BA 3W2DA 1I4QA 1E8XA 2KT7A 3S2AA 2RGFA 2IGGA 2XK5B 3BIID 1I35A 3ZXRA 1ESFA 2VRRB 4RH6A 4K7UA 4WIPA 3APFA 2WDTB 1FMAD 1N61A 1MI0A 1WRIA 2WYQA 1FXTB 1QOGA 1V5TA 5E6NA 3U52E 4P1BC 4S17A 1YN4A 1KRHA 2D3GA 3A1QB 3A33B 1WI0A 3AE3B 3IAS1 4LDTD 1MPEA 2IO0B 4EOYA 2LEKA 2CKHB 1E7UA 4TSSA 2PPHA 5IKCM 1H7XA 4KSKC 2UYZB 4LNKA 5IN7A 2KANA 2JUOA 2B76B 4IW0A 3PPAA 2LUMA 2JYEA 4EZJA 1XLOA 2MBBB 2D3AA 3Q8FA 5AUKA 2X8XX 4G0NB 3HVZA 2GOWA 2M4NA 4CQNA 1FCCC 2MWSB 3X0WA 4LCDE 5DPSA 4IM3A 4NAWB 2GBJA 2ZPYA 4BKGA 1HXYD 1HEZE 1JMLA 3L54A 3VTUA 1E7PB 2IO1B 5LNK1 2K8HA 2W3RA 3FAHA 2KWDA 1QOBA 4YTMB 2WLBA 1UD7A 2WX0A 4GB9A 5L83A 3CWIA 2WXHA 5CTRC 1V5OA 4DHZE 2N7EA 3P42A 3JVZX 4E3CA 2KMMA 1WR6E 1DOXA 5IP4D 1AYFA 3O13A 4WH4A 1TS4A 4G50A 2WHIA 1STEA 3R7RA 4W9LA 3VVWB 2PE9A 2OEDA 4RGTA 3I5JC 4K1RB 1IPGA 4KDLB 1LFDA 3WAPA 3HVDA 4WAAA 2PVGC 1MHXA 1YIWA 3B1LX 3I63C 1U4AA 3Q3JA 1ZPSA 4JL9A 4HVBA 3B2FA 3N9YC 4FJZA 3MC8A 4KDIC 1XLNA 4BVUC 4ZYNA 2ZVNA 1WE7A 1R4MB 2AX5A 4W9HA 2BKRB 2G9HD 5LXIB 1R4MI 1SSNA 5KHOA 3VR9B 1KOTA 3FC4A 4FBJB 5AUIA 4AQ7A 4WWOA 4M02A 3L08A 3U4EG 1KF6B 4KZ0A 4MGKE 2JRIB 3OAWA 1K8RB 2INDC 5IO9A 5MPOA 1KFYB 2KVZA 2Z8LA 4LNNA 3H7SA 3GZNI 2HJ1A 3GE3C 3VFKA 1F9JA 3DVGY 1PYWD 3DVGX 1T0RC 4BOZB 1GB4A 4ZRQA 2D07B 3GB1A 4ANVA 2N1WA 1C78A 1PFDA 2W55A 5E6JA 3W5VB 4HPMB 1EU4A 3E56A 3MJ5A 1WGYA 2FNJB 3Q6BA 2RDBC 3EHVA 1VZ8A 1FD6A 1FFVA 3QAQA 3ECIA 3URYA 3T8MA 2N9XA 4TV3A 3IT4B 4HWIB 2I1KA 3IT6B 3AB5A 4US8A 3VUXA 4RCOA 1ET6A 1JWBD 4GDKA 4AUQC 4ITKA 1T6BX 1FEHA 2K22A 3QJZA 3BK1A 3DQVA 1RAXA 2FUHB 3PO0A 2CU1A 4KX6B 4B0MA 3U8ZA 1HTQA 1OGWA 2ZJDA 3Q2AC 3V6CB 1CK1A 2LXAA 2GB1A 4EZLA 1WYGA 2KMAA 1FFUA 3IXSA 2RPQA 3ZKJC 4EE2A 3ZGZA 2LRWA 4A55A 2EKEC 2JY6A 5EDSA 2L00B 3QIJA 3QK0A 2LHEA 1GT8A 1N60A 4WQOB 2V4LA 3ZTDA 1NBFC 2K3UA 4XC2A 4ASWC 3ZRCA 3H7PB 3PHWB 2ZW1A 1WJ4A 5BYRA 2KC1A 4KGRA 1HZ5A 2KK8A 1EM7A 1C3TA 4IWOA 1WR1A 4A3OA 2C9WB 1GJZA 3EECA 3QWZB 4IUMB 2KFJA 4FN2A 5LXHA 1TTNA 1OQQA 1XCTL 2BYTA 2DZMA 1J0GA 3AM9A 5FK9C 3IAM1 1V8CA 1Y56A 4C56C 4TUUA 3E9SA 2PKOA 4IKGA 3KWLA 3PLVA 3NUHB 2KTFA 2NCNA 3BVZA 2QMTA 3L16A 3U2SC 2SAKA 4GDLA 3RNBC 2WXOA 1F1HA 1M94A 2VH1A 5AEKB 4ZHOA 1XEEA 1EUVB 2V0GA 2BKFA 2HDEA 3VRBB 4MM3A 3RNCC 2NS5A 2KFKA 5BYQA 4ICVA 2ONQA 3KUZA 3DBRI 1I4GA 4HK2A 3ML9A 2KTRA 4FLHA 3D32A 3ZNGC 1OEYJ 4B9KA 2C7NB 1GG3A 4MJSA 1WGRA 1C76A 4C7ZA 4M00A 1T3QA 1WM3A 1KTKA 4XE0A 2JSVX 3NZUA 5CHFA 1Y8RC 2G45B 2MH7A 1YNTE 4MELA 3VR8B 2NBUA 2QIEB 4MGZE 1V2YA 1GUAB 3VQIA 4LNIA 2K8CA 3LYYA 3AE9B 2Q5WD 4KIKA 3VTWA 1WM2A 4RM8A 4PYZA 2QHOA 2LGDA 4I6NB 3TEXA 2J42A 1Q0WB 1WGDA 2I38A 2KNBA 2QDFA 4W9JA 1L6VA 2WXPA 3ML8A 1XD3B 2N9KA 3A4SC 5JHBA 3PS6A 4HDQA 4PS7A 1WXSA 2H89B 2FCSA 5TSSA 3MHSD 1H4RA 1N63A 4OZAA 2JRHA 3PZ7A 3KH0A 3R2TA 4REZA 3GS2A 3PLUA 1H8CA 2J0JA 1TS3A 3AU5A 5G5HA 3T9LA 2WXRA 4C4VA 1WRDB 4GN1A 4M0WB 3RNFC 2QC8A 4WJPA 3FILA 4PK1A 2KN4A 3W1SA 4MEMA 3DHHC 1QQRA 3P4RB 4IDIA 2N1VA 1V9JA 3OJ3A 1GPXA 2MBHA 3N1XC 3BINA 1MVKA 4USAA 1T0QC 2MP2B 1KH0A 4HKQA 4RFBA 4G11A 1S1QB 3N20C 3PVLA 3OWEB 1LGRA 1JWSD 2O6VB 2WXNA 2PW9A 2V3PA 1QOFA 2XK5A 4KKJA 4IOIE 1QT9A 4WWNA 5CX3A 1ZDVA 1D5XC 1Z2MA 2D3CA 4URKA 1PUTA 4RGMA 1XF5L 4ZHPA 1OEYA 4W9DA 2BWFA 2V3SA 1L7YA 4BFRA 2O2VB 3JSVB 2MW5A 4W9EA 4MT5A 2CHWA 2K1FA 3A1QA 4LNOA 2ACZB 2JZZA 3KWVA 1F77A 2WDQB 2KOXA 2GBKA 4ICUA 2IYDB 1FXIA 2WXQA 1XLPA 1ZW7A 3JYUA 1VDVA 1LXDA 2HE7A 2LJ5A 2WXJA 3EUB2 3N30A 2Y5PA 2WXMA 2BQQA 4FHJA 1TJEA 3V62A 3RFZB 1Q1OA 3Q8BA 4HRSA 2INNE 4A8XC 1V49A 4GMVA 2RR9A 4RGNA 3SEBA 3NG0A 3SR6A 4DWFA 3A4RA 1VR9A 1P98A 1RYJA 4JGHB 3HM3A 2INCC 1N6ZA 3IVFA 4HCPB 1IBXB 2M8SA 2ON8A 4GSWA 3C19A 4R3DA 2KJ6A 3VUYA 1TZ1A 3AEBB 4ZRKA 3VAWA 3PZ8A 4EUTA 4S0RA 4DK5A 2C5LC 4YTPB 2E3TA 2K8BA 4KKIA 2L0FA 4A90A 2HD5B 5EE9A 3HM6X 3ZUNA 2ZNVC 4EEWA 1BXTA 3TEYA 2PTLA 3C8YA 1WX8A 2FIDA 2KWCA 3ZW3A 1I7HA 4X57B 3ZNID 1IP9A 4BZAA 1PGBA 1N62A 4ZYSA 1A70A 1PDXA 2KXJA 2BYEA 2Z0EB 2MBOA 1ACCA 2Z59B 2MX2A 1LM8B 2PLPA 1JW9D 3M3JA 2LHDA 2HJ8A 3OLMD 2J53A 3A9KB 1J7CA 3KUCB 3EC8A 1UBIA 3RUIB 4D2KA 2GMIC 4K3BA 4OZCA 2D2QA 1L5PA 4NZLB 2SEBD 5BMIA 2C60A 1WX9A 4NQLB 4RM9A 3IG3A 4DDGD 2E6XA 1T0SC 1OTRB 3ALBA 3PTFC 3U7DA 3N1YC 1SE9A 4MSQB 2BF8B 2KDEB 3L13A 2ZNVB 3DBLI 2DENB 1VCBA 1YX5B 2DYOA 1UWXA 1WWTA 2IO2B 3B9JA 3MFGA 2G4DB 3WANA 3SHQA 3HHMA 2KWUB 1OFFA 2L3ZA 3CSFA 1C4AA 1D5MC 4ARIA 3R66C 2AQ3B 1ISNA 3J9CA 2M0AA 1TT5B 3R3MA 1WZ3A 2MJEA 4ANWA 2FCMA 3V05A 2A4ZA 1WE6A 3AU4A 1ZE3D 3AEAB 1YD8U 1YJIA 2CS4A 1P1AA 4JPSA 3AEDB 1QOAA 3VH3B 5DPTA 4GXBA 1UGMA 4JX1C 1GC7A 5D2MB 2KDMA 3R2IA 4US9A 3AH7A 3P4SB 1WSPA 2LZ6A 4WWMA 2N9PC 2MA9B 2Y5CA 5C23A 1C1YB 2DYBA 1SXTA 1LQBA 3NOBA 4WURA 3DPDA 2BB5A 3Q3MC 4FHKA 1OQRA 4RF0A 4TKNA 2Y3AA 1WMHB 2KQSA 1WXAA 1Q10A 2GLSA 2LWPA 2IY1B 4HROA 3HK0A 1WJNA 4P7IA 3VUWA 2BW2A 1CJEA 1T5XD 3TCAA 3ZQ4A 2K6DB 3U30A 3H7PA 3R7QA 2KJRA 2KAJA 3PRPB 2BPSA 1F52A 2MEKA 3KYCD 3SFEB 1WX7A 1UUPA 3TUOA 4YSXB 3BVGA 1YQ3B 1WFYA 2BGFA 1NYQA 3GZNB 2KKCA 5EE0A 4XX5A 3W1YA 2WXKA 2BWES 3P2BA 3NRZA 3UIPB 3Q8CA 1UZXB 3EA6A 2O6VD 4OVVA 1NI2A 3TSSA 4ANUA 1XLQA 5D94A 2CJOA 1IGDA 2NVUI 4M01A 1I4PA 4YTNB 4F1SA 2MBQA 1HQRD 2KDBA 1C4CA 1YJ1A 2A5UA 3TIXA 2WQYB 3ETRA 3M63B 2GBNA 3Q14C 2NMQA 2C7HA 2J0KA 1KLVA 2L83A 3KLSX 2JXXA 1V81A 3X23A 2NBVB 2NR2A 2KQ7A 5AZGA 2WDVB 2LD9A 5C2TB 4HDOA 1SBBB 2YVCA 3QQ8B 3LB8C 3BZDB 4A9AA 4II2B 1VJKA 5BYSA 2DHZA 2D5GA 2B3AA 1F0ZA 1ZKHA 5I4DA 1SIFA 3PSEB 1Q5WB 1WXMA 1FNVA 4LTUA 4MH0E 1R4NI 2V4IB 5FR3A 1OQYA 2IGHA 2IZVB 4PYUA 1IYFA 4DHJB 4BKSD 1L6UA 2FBWB 4AOFA 4LJOB 2ASQA 3PT2B 1JWUD 2ZPNA 2DAFA 4YWGG 2JT4B 2C7MB 3RI7C 4O1NA 5JHAA 2INPE 3ZTCA 4NPNA 1ROEA 3SDLC 3APDA 3ZO5B 5HFYA 1RLFA 2UU7A 2LGXA 1YX6B 1SE4A 3AEGB 3M62B 3ZNHB 1FRDA 2KD0A 2BS3B 2REXA 2KDIA 4L2YA 4L1BA 4YSYB 3U7ZA 2DWQA 4ANXA 3UI3A 4P6VF 4RF1A 1UF0A 3W9CB 5DPWA 3NS8A 1B1ZA 4XYCA 2G1EA 2CJNA 1PGXA 3MTNB 1HE8A 4M0WA 2K9XA 3Q3NC 2FE8A 1GC6A 4K3CA 3TEWA 3EFUA 3DBRB 4WJNA 5EE3A 1AW7A 1VLBA 5TR5A 3ZIMA 2MP2A 1JWMD 2TSSA 2WXGA 2PJHA 5DPRA 2JVCA 1QZEA 2LFIA 1YQBA 3AE1B 2O6VA 4H2AA 2MCNB 2H88B 1SEBD 1QILA 2MHJA 4FA6A 3DVNU 1VD2A 2V9HA 4WJQA 1GTEA 2UWQA 1WH3A 1FIQA 2J7QB 4CHKA 3NVYA 1C9FA 4IG7B 2RD0A 1L0VB 4XGAB 5GXGB 2JXTA 1J7AA 3NHEB 4B95A 1V80A 4GU2A 2O2VA 3JSVA 3UGBB 4KVGB 2N7JA 3ZVVA 1FM0D 3AE4B 1I4XA 2KVRA 2PMVA 3AE2B 2OOBB 4M8NA 5AZHA 4NJ6A 2DAJA 2NTSA 1P9DU 3PRMB 3K9OB 2IBIB 4QAYA 2LMCA 1QF6A 1WGGA 3GE8C 1JWAD 2W9NA 1JALA 1AWDA 1DGJA 2WU2B 1HZ6A 4GOCA 3VHTC 3BK2A 3AN1A 2W54A 2MJ3A 1R7SA 3UQAA 2R2QA 3DHIC 2R61A 3ZDMC 4BKSA 4DQOC 2L8JA 1TBEA 2K5PA 1YQ4B 2L7RA 4C80A 2DBYA 1YOVB 3KYDD 1E10A 2LVOA 3Q3OC 4LNFA 3VRAB 3PRZA 3ABVB 3RYTA 2ZW0A 1ZP0B 2IY0B 3ZRFA 4XZ4A 3Q8EA 4HEA1 1IBXA 3VH4B 1FO4A 4HLEA 3WIMA 3JW0X 1YJJA 2KN5A 2MBEA 2RPVA 1SGHA 1L4DB 5GMVA 3NVZA 3VTVA 4DHZB 1D5ZC 1SF0A 4KV2A 2N7DA 2JZPA 3UIOB 3AE5B 2JPHA 1TY2A 3GP7A 4C7YA 1EF1A 1I4HA 2KO3A 1NEKB 3ONSA 1BUIC 1N5XA 1YN3A 4FJYA 2J4XA 3AXCA 4KSLC 3I9V1 2MJDA 2XEWA 1TGZB 2W82A 2HTME 3QA8A 4MSMB 2ZCCA 2EELA 2YEPF 4ZRIA 4DXFA 5J2RA 1TKGA 1XCQL 1RFAA 3IHPC 1BMLC 3A9KA 4NQKE 2LI5A 1E8YA 2WXFA 3NJTA 2K39A 4BBNC 3DWMA 1GTHA 5C1ZA 1WGKA 2CHXA 5D7GA 1TS5A 3ZDTA 1MG4A 2L76A 4WJOA 2K0PA 5L95C 3L10B 4DXAB 1SIJA 4M8MA 5HI1A 1UELA 1ENFA 3V60A 3K9PB 4EKUA 2IDYA 1F2RC 4JQWC 3RCZA 4WAFA 1E8WA 1QLBB 3NY5A 1I42A 1ZDXA 2WXIA 2BTEA 1V97A 3Q3FA 1AN8A 1UNSA 1HA5A 3N1ZC 1SE3A 2GRIA 4AWJA 5D6JB 4N59A 2I1JA 3GOEA 4XWWA 2LJIA 4ZRPA 2I2YA 2EMSA 2FUG1 1GB1A 3DBHB 4LK0M 3HUIA 3WCQA 1D3ZA 3QHTA 2L05A 3DBHI 2VH2A 3CF6E 4G3XB 5HKHA 3AMZA 1NI3A 4I6PA 5J18A 1DOIA 2FCNA 2LUEA 4OHJA 1RM6C 1G6JA 5H8YE 1VRAB 4OVZA 3BVMA 3DVNV 3LXFA 1UH6A 3MP9A 1L0YB 1VZ6A 1E9MA 2CR5A 2RMMA 2ZCBA 2DZKA 4LJPB 1CZPA 1LO5D 4PT5A 4MH8A 2IO3B 3BWUD 3IBEA 1WMHA 4I6LB 1F2RI 3SD5A 3QX1A 1MHHE 3RZFA 1VZ7A 2BS4B 2WXLA 3MC9A 2RDGA 2LVQA 4OW0A 3WAOA 3UF8A 3HIZA 4IWPA 1TYGB 3ENEA 2MSED 3P63A 1KJTA 3CSTA 3PREA 2M19A 1DOYA 4HKZE 2N9EB 2MQJA 3R8BA 3NS1A 2LXCA 1E90A 1QKZA 4JWUC 3DBLB 5E6PA 5J17A 4ZRJA 2M17A 4XDDA 2KX3A 3ZXVA 4F8CB 1WYWB 1P3QU 2WWZA 4ACFA 5D3DA 1E8ZA 1NENB 1TKYA 2BT6A 5BMGA 1WZ0A 5H92C 3BYTB 2G4SA 5C3JB 2YEPB 3BY4B 1E7VA 3RN9C 5IAAC 3ZJTA 2HTHA 2FCQA 1TIFA 3PGEA 4PS3A 2QEJC 2JU6X 3H9DA 3O65B 1MJDA 5E6OA 2LVPA 1B9RA 1JRUA 1PQSA 2KYWA 3Q69A 2Z0DB 2DLBA 5JH5C 4NAMA 4N58A 5G5GA 4NJCA 4K7WA 4CYEA 4FULA 2OJRA 3B0AA 2NPTB 2PIAA 1C77A 2WS3B 3QCAA 2NBWB 3KUDB 1TZOA 2KJHB 3AE7B 5KHQA 1J8CA 1P7FA 4MDKE 1N5WA 5BMHA 4GIVA 2LGSA 3T3OA 1RRBA 3B08A 3A9JA 4TQ1A 2JWUA 2GBMA 3PV1A 2K6QA 2BBCA 4C00A 1BT0A 5IOIA 2BB6A 1WJUA 1KLUD 5CHWA 1D6EC 4HPLB 2VZKB 3RNAC 2J52A 3N3KB 2AQ2B 4XDCA 2WU5B 3RNEC 3TMPB 4W9CA 3RPFC 3PHXB 1XT9B 1D4BA 2G3QB 2BVCA 1WGHA 3AULA 1SE2A 3BYYB 4P16A 2AQ1B 2KLCA 1TY0A 5HG2A 2JX5A 3H8HA 2JWZA 2L1AA 4BOSC 2KC2A 1EF5A 2DYMA 3MJWA 3EGRA 2DZJA 2KHWB 1WY8A 2IGDA 3QC8B 5T8IA 3V3XA 2LRUA 3C0RB 4KZCA 5BO4B 1UBQA 1CMXB 3OG5A 3DCGA 4WWPA 1FXAA 2XBBC 2L32A 2M1MA 1PGAA 2AEHA 1RWSA 1V6EA 3AE8B 4W9IA 2L0TA 3I3TB 3NVVA 4E74A 2QILA 4UDUC 4AS1A 2MLBA 1C4PA 4II3B 3TEZA 2M0XA 3RT3B 1JCKB 5FKAC 1XO3A 4B6WA 3TJPA 2D11A 1R4NB 4B0EA 2L52A 3A9JB 1GNUA 3T3NA 3N32A 2WP9B 1K51A 3H1UA 5LLIA 2M56B 3SU8X 4ZDVA 1L4ZB 4PS8A 4OZBA 1V1PA 4Q2JA 2AWTA 1XQQA 3AV8A 2CU3A 1K52A 2BYVE 1ZUD2 3P1MA 3CMMB 4FJVB 2YLMA 4K81A 3NZ3A 2AL6A 3AEFB 2JYTA 4BAXA 3VDZA 2JZ3B 1S3SG 4JWSC 4HCNB 4A6QA 4MGYE 3CF4A 4YXDB 1E0ZA 3AECB 1EWCA 2V1YA 4DDID 3RZWC 2R2OA 1FNUA 5G2NA 2IJ0A 3FKYA 3B2GA 3NZSA 4J3OD 1K53A 3ZYYX 2AYOB 3DHGC 4AP4C 4A20A 4DXGA 2KWVB 1IGCA 3LJ3A 2PEAA 4YT0B 3I57A 3PZDA 4LDTB 1EWYC 1V86A 1FPYA 1JROA 2JQRB 1ZGUB 1JRPA 3CIRB 4GDKB 2KMCA 4F7ZA 4JE3B 1TKEA 4XWTA 1J19A 1FRRA 3DDCB 3KVFB 3DOWA 3P4PB 1MG8A 3ZNZB 1P0RA 4NJ7A 4RMAA 2DX5B 2OJWA 2GI9A 4W9GA 3ZJVA 2IPKD 1V1PB 4RNAA 2CHZA 3L0WB 4MGIE 2WGSA 3SFDB 1P7EA 2LGIA 2J0MA 1E5WA 1ZXIA 4IC7B 4HPPA 1C79A 5AZFA 4ZOHC 3APCA 4DBGA
chains in the Genus database with same CATH topology
3V05A 1WYGA 1QLBB 1KLGD 1SB3C 1FFUA 1ZE3D 3AEAB 1YJIA 3IXSA 1GAQB 4EE2A 1ZDXA 2WXIA 4JPSA 3AEDB 1QOAA 3ZGZA 4A55A 4WQMA 2BTEA 1V97A 5D3IB 1EU3A 4JX1C 3P4QB 1AN8A 1UNSA 1HA5A 1UGJA 4TMAB 2KDMA 1SE3A 2LHEA 3R2IA 1CQVA 2GRIA 1GT8A 4US9A 2V3NA 1N60A 4N59A 3AH7A 3DWGC 3P4SB 4XWWA 2LJIA 1WSPA 2EKIA 2K3UA 4WWMA 4ZRPA 2I2YA 2Y5CA 1H7WA 2BS2B 1WXQA 4GLSC 2OHFA 2XNAC 2ZW1A 2FUG1 1GB1A 4KGSA 1SXTA 3MHZA 4LK0M 5BYRA 4KGRA 1HZ5A 3HUIA 3WCQA 4WURA 2BB5A 4RF0A 1EM7A 1OQRA 2Y3AA 3AMZA 1NI3A 2PVOD 1Q10A 1ET9A 3AEEB 1IUEA 5HHDG 4GDLB 1DOIA 2XN9C 1NVID 4HROA 4OHJA 1RM6C 2BW2A 2WNMA 4MACA 1CJEA 2QSDA 1OQQA 1T5XD 2KACA 5H8YE 1VRAB 1XCTL 2RDHA 2BYTA 4OVZA 3BVMA 1JQ4A 3ZQ4A 3LXFA 3AM9A 4L23A 3MP9A 1L0YB 5FK9C 3IAM1 1VZ6A 1SJED 2KAJA 1E9MA 1V8CA 1Y56A 2RMMA 4C56C 1CZPA 1FNWA 4MM3B 1LO5D 4PT5A 2VZKD 3E9SA 4MH8A 2PKOA 3MC0B 3BWUD 2MEKA 4IKGA 3SFEB 3KWLA 3TUOA 1UUPA 3NUHB 4YSXB 3BVZA 3KQ4A 1F2RI 1M4VA 1YQ3B 3BVGA 2QMTA 1MHHE 4HJGE 1NYQA 3U2SC 1VZ7A 2SAKA 1K50A 5EE0A 2BS4B 2WXLA 1TS2A 2RDGA 2WXOA 4OW0A 3W5UB 2WXKA 4ZHOA 4RGOS 1RFKA 1ZOYB 3ZJUA 2X38A 1TYGB 3NRZA 3Q8CA 3P63A 1XEEA 3EA6A 2M19A 5JXVA 1DOYA 4HKZE 3TSSA 2V0GA 2HDEA 3VRBB 3R8BA 1XLQA 2KQ4X 3NS1A 2ICIA 2CJOA 5EE1A 1IGDA 1QKZA 1I4PA 4JWUC 4YTNB 5BYQA 1HQRD 1C4CA 4FXCA 2ONQA 2WQYB 4XDDA 1I4GA 3ETRA 1DYQA 1YN5A 2NMQA 2L83A 5D3DA 1NENB 3KLSX 1TKYA 2BT6A 3NVWA 5BMGA 5H92C 1I4RA 3Q8AA 2W3SA 3BYTB 1UWMA 2WDVB 5C3JB 2YEPB 1L0XB 1C76A 4C7ZA 5C2TB 3ZJTA 1T3QA 1SBBB 4LLGM 4TQ0A 3L4PA 2QEJC 1KTKA 3AE6B 3LB8C 2JU6X 3BZDB 4XE0A 4KGTA 1V1OA 4A9AA 2JSVX 4ARCA 2NTTA 1VJKA 2MH7A 1GOZA 1YNTE 5BYSA 3VR8B 2D5GA 1F0ZA 2QIEB 1ZXHA 1J7BA 1XXGA 1NYRA 5I4DA 1B9RA 1E6EB 3VQIA 3LYYA 3AE9B 3Q69A 2Q5WD 4N6EB 1FCLA 2DLBA 1FNVA 4NAMA 4N58A 5G5GA 4LTUA 4NJCA 2V4IB 5FR3A 3TEXA 2J42A 2N0SB 4YSZB 2IGHA 3HRDD 2I38A 2PIAA 1L6VA 2WXPA 1C77A 2N9KA 2WS3B 2FBWB 1L6UA 1SJHD 1JWUD 4YWGG 1TZOA 2H89B 3FILB 5TSSA 3AE7B 2WDRB 1YMHE 2N9LA 4O1NA 1P7FA 1N63A 4OZAA 1N5WA 5BMHA 2INPE 3T3OA 3PZ7A 3R2TA 4REZA 4TQ1A 3GS2A 1ROEA 2JWUA 2BBCA 2QJLA 1TS3A 5G5HA 5HFYA 2BB6A 1SE4A 2WXRA 3W2DA 3AEGB 1I4QA 1KLUD 1D6EC 1FRDA 2VZKB 2IGGA 3BIID 2BS3B 2J52A 1ESFA 3FILA 4L2YA 2KN4A 4YSYB 4L1BA 4RH6A 3U7ZA 3W1SA 2DWQA 1QQRA 3P4RB 2AQ2B 4IDIA 4WIPA 4XDCA 2WU5B 1GPXA 3UI3A 4P6VF 1FMAD 4RF1A 1MVKA 1N61A 4USAA 3W9CB 1KH0A 1MI0A 1WRIA 3RPFC 4HKQA 4RFBA 1B1ZA 1D4BA 1QOGA 2G1EA 2CJNA 3OWEB 1JWSD 1SE2A 2WXNA 2PW9A 1PGXA 1QOFA 2V3PA 3U52E 3BYYB 4P16A 4M0WA 1YN4A 1KRHA 2AQ1B 2K9XA 4KKJA 4IOIE 3AE3B 1QT9A 2FE8A 1TY0A 3IAS1 2JX5A 1MPEA 5HG2A 3H8HA 2L1AA 3TEWA 1ZDVA 1D5XC 2DYMA 5EE3A 1AW7A 2LEKA 3EGRA 4TSSA 1VLBA 1PUTA 4RGMA 1XF5L 4ZHPA 1JWMD 1H7XA 2IGDA 2TSSA 2WXGA 2B76B 2LFIA 5T8IA 3V3XA 3AE1B 4H2AA 4MT5A 2H88B 2LUMA 1SEBD 1FXAA 2JYEA 1XLOA 3Q8FA 1QILA 5AUKA 2ACZB 1GTEA 2L32A 3HVZA 3KWVA 1F77A 1PGAA 2WDQB 1FIQA 1RWSA 3NVYA 1C9FA 4CQNA 3AE8B 1FCCC 1L0VB 1FXIA 3NVVA 2QILA 4UDUC 5GXGB 2WXQA 1XLPA 4AS1A 2JXTA 4NAWB 1C4PA 1J7AA 1VDVA 3TEZA 1HXYD 1HEZE 1JMLA 1E7PB 5LNK1 2WXJA 1JCKB 2W3RA 3EUB2 2Y5PA 2WXMA 3FAHA 2KWDA 1QOBA 5FKAC 4YTMB 2WLBA 1TJEA 1XO3A 2N7JA 1FM0D 3CWIA 3AE4B 1I4XA 2WXHA 2PMVA 4B0EA 2L52A 3AE2B 3RFZB 3Q8BA 4HRSA 3T3NA 2WP9B 3P42A 2NTSA 1K51A 2INNE 2KMMA 4A8XC 2M56B 2LMCA 1DOXA 1QF6A 1AYFA 1L4ZB 4RGNA 3O13A 4WH4A 3SEBA 3SR6A 1TS4A 1JWAD 1VR9A 4OZBA 1JALA 1AWDA 1V1PA 1STEA 1RYJA 1DGJA 4Q2JA 2WU2B 1HZ6A 3AV8A 3BK2A 3AN1A 1IBXB 2W54A 2ON8A 4R3DA 2CU3A 1K52A 1R7SA 2MJ3A 1ZUD2 3P1MA 3AEBB 2OEDA 3PZ8A 4RGTA 3NZ3A 2R61A 3AEFB 4YTPB 2E3TA 2JYTA 4DQOC 4KKIA 4A90A 2K5PA 1YQ4B 3HVDA 5EE9A 4C80A 2DBYA 2PVGC 1MHXA 1BXTA 1E10A 3TEYA 2PTLA 3C8YA 1ZPSA 4JWSC 4A6QA 3VRAB 3B2FA 3N9YC 1XLNA 3ABVB 3CF4A 2ZW0A 1I7HA 1ZP0B 4YXDB 1E0ZA 3AECB 1EWCA 2AX5A 3Q8EA 4HEA1 2G9HD 1IBXA 1PGBA 1SSNA 1FO4A 1FNUA 3VR9B 2IJ0A 3FC4A 1N62A 4ZYSA 3B2GA 1YJJA 1A70A 4J3OD 1K53A 3ZYYX 1PDXA 5AUIA 4AQ7A 2RPVA 4DXGA 1IGCA 3U4EG 1KF6B 1ACCA 1L4DB 3NVZA 4YT0B 1D5ZC 3I57A 1SF0A 2PLPA 1JW9D 1EWYC 2JZPA 2LHDA 3AE5B 2J53A 1TY2A 1J7CA 3GP7A 1KFYB 1JROA 5MPOA 2JQRB 4C7YA 4D2KA 2Z8LA 1I4HA 1NEKB 1BUIC 1JRPA 3CIRB 4OZCA 1PYWD 1N5XA 1L5PA 4NZLB 1GB4A 1YN3A 2SEBD 5BMIA 4GDKB 4ZRQA 2J4XA 4JE3B 3GB1A 1TKEA 3I9V1 2MJDA 4XWTA 1C78A 1PFDA 2W55A 1FRRA 5E6JA 2E6XA 3W5VB 2W82A 2HTME 1EU4A 3E56A 2EELA 3MJ5A 2YEPF 4DXFA 1TKGA 1XCQL 1VZ8A 1FD6A 3P4PB 1FFVA 1BMLC 2WXFA 3URYA 2DYOA 3IT4B 1UWXA 2GI9A 3IT6B 3AB5A 3DWMA 4US8A 4RCOA 3ZJVA 1WWTA 1ET6A 1JWBD 1GTHA 3B9JA 1WGKA 1T6BX 1FEHA 1V1PB 2IPKD 3MFGA 1TS5A 2K22A 4ITKA 4RNAA 5D7GA 3BK1A 1OFFA 4ARIA 1C4AA 1D5MC 3SFDB 1P7EA 3PO0A 2LGIA 4KX6B 2AQ3B 4B0MA 2K0PA 1ZXIA 3J9CA 1SIJA 5HI1A 1CK1A 1ENFA 2M0AA 1C79A 2IDYA 2MJEA 1F2RC 4ZOHC 2GB1A 4WAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYG A;  1QLB B;  3AEF B;  4YTP B;  1SB3 C;  1FFU A;  1QOG A;  3AEA B;  1YJI A;  2CJN A;  1NEN B;  2G1E A;  1TKY A;  2BT6 A;  2L83 A;  2E3T A;  2K5P A;  1GAQ B;  3NVW A;  1YQ4 B;  5H92 C;  5EE9 A;  4C80 A;  2DBY A;  3AED B;  1QOF A;  1QOA A;  2PVG C;  2W3S A;  1UWM A;  4WQM A;  1V97 A;  1E10 A;  2WDV B;  5C3J B;  3P4Q B;  4JX1 C;  2K9X A;  1KRH A;  4JWS C;  4C7Z A;  5C2T B;  3VRA B;  3B2F A;  3AE3 B;  1QT9 A;  1XLN A;  2JX5 A;  1T3Q A;  3ABV B;  3CF4 A;  1I7H A;  1ZP0 B;  4YXD B;  3L4P A;  4US9 A;  1GT8 A;  1E0Z A;  3AEC B;  3AE6 B;  2AX5 A;  5EE3 A;  2LEK A;  3LB8 C;  1N60 A;  4N59 A;  3AH7 A;  3DWG C;  3P4S B;  1VLB A;  1FO4 A;  4A9A A;  2EKI A;  1PUT A;  3VR9 B;  3FC4 A;  4WWM A;  4ZHP A;  1N62 A;  2Y5C A;  1H7W A;  1VJK A;  2BS2 B;  1WXQ A;  1YJJ A;  1H7X A;  3VR8 B;  1A70 A;  2MH7 A;  3B2G A;  2OHF A;  1PDX A;  3ZYY X;  1F0Z A;  5AUI A;  2QIE B;  2B76 B;  1J7B A;  1NYR A;  1B9R A;  1E6E B;  3AE1 B;  3HUI A;  3WCQ A;  1KF6 B;  3AE9 B;  2Q5W D;  3NVZ A;  1OQR A;  4N6E B;  2H88 B;  4YT0 B;  1SF0 A;  3AMZ A;  1NI3 A;  1FXA A;  1XLO A;  2PVO D;  4N58 A;  1JW9 D;  4LTU A;  1EWY C;  5AUK A;  5G5G A;  2ACZ B;  3AEE B;  3AE5 B;  1IUE A;  1GTE A;  3HVZ A;  1J7C A;  5MPO A;  1KFY B;  1DOI A;  1JRO A;  2N0S B;  2JQR B;  4YSZ B;  4C7Y A;  2WDQ B;  1FIQ A;  1NVI D;  1RWS A;  3HRD D;  3NVY A;  4HRO A;  1RM6 C;  3AE8 B;  1CJE A;  1L0V B;  1FXI A;  3NVV A;  1OQQ A;  1NEK B;  5H8Y E;  1JRP A;  3CIR B;  2PIA A;  5GXG B;  1XLP A;  1N5X A;  1L5P A;  1JQ4 A;  1L6V A;  1J7A A;  1VDV A;  3LXF A;  3AM9 A;  2WS3 B;  2FBW B;  1L6U A;  2KAJ A;  1TKE A;  2MJD A;  1E7P B;  1E9M A;  1V8C A;  1PFD A;  2W55 A;  1CZP A;  1FRR A;  2W3R A;  3EUB 2;  3FAH A;  3W5V B;  2H89 B;  1QOB A;  2HTM E;  4YTM B;  3AE7 B;  2PKO A;  1TJE A;  1XO3 A;  2WLB A;  2WDR B;  3SFE B;  3KWL A;  1FM0 D;  1N63 A;  4YSX B;  3AE4 B;  1N5W A;  3CWI A;  1YQ3 B;  2L52 A;  3AE2 B;  1TKG A;  1NYQ A;  4HRS A;  3P4P B;  1FFV A;  5EE0 A;  2BS4 B;  1ROE A;  2WP9 B;  2QJL A;  3W5U B;  5G5H A;  2KMM A;  2M56 B;  3AB5 A;  3DWM A;  4US8 A;  4ZHO A;  1DOX A;  3AEG B;  1ZOY B;  1RFK A;  1QF6 A;  1AYF A;  1WWT A;  1TYG B;  1JWB D;  3NRZ A;  1GTH A;  1FRD A;  3P63 A;  3B9J A;  3SR6 A;  1JWA D;  1WGK A;  4ITK A;  2M19 A;  1JAL A;  1AWD A;  2BS3 B;  2K22 A;  3BII D;  1DOY A;  3VRB B;  1OFF A;  1RYJ A;  1XLQ A;  3NS1 A;  1DGJ A;  2CJO A;  4YSY B;  3SFD B;  2WU2 B;  5EE1 A;  3PO0 A;  2DWQ A;  4KX6 B;  4IDI A;  3P4R B;  3AV8 A;  1ZXI A;  4JWU C;  4YTN B;  3AN1 A;  2WU5 B;  1GPX A;  2W54 A;  2CU3 A;  1SIJ A;  2MJ3 A;  1R7S A;  4P6V F;  4FXC A;  1FMA D;  1ZUD 2;  3P1M A;  3AEB B;  1N61 A;  2MJE A;  4USA A;  2WQY B;  4ZOH C;  3W9C B;  1WRI A;  3RPF C;  3ETR A; 
#chains in the Genus database with same CATH topology
 3V6E B;  2DNF A;  1KLG D;  1SB3 C;  3RMK C;  1WJ6 A;  1GAQ B;  1WF9 A;  2KZR A;  4JIO U;  4WQM A;  5D3I B;  1EU3 A;  4W9F A;  3P4Q B;  3TL5 A;  1X1M A;  1UGJ A;  4TMA B;  2KDF B;  1AAR A;  3RUL A;  1CQV A;  2V3N A;  4BBN F;  3DWG C;  3TBL D;  2EKI A;  1H7W A;  2BS2 B;  1WXQ A;  4CO7 A;  4GLS C;  2N4F A;  3M95 A;  2OHF A;  2XNA C;  4KGS A;  3MHZ A;  3VXW A;  3ZLZ A;  1A5R A;  2AL3 A;  3RD2 A;  2PVO D;  1ET9 A;  3AEE B;  1IUE A;  5HHD G;  4GDL B;  4P1C C;  4W9K A;  2XN9 C;  1NVI D;  2WNM A;  4MAC A;  2QSD A;  2JF5 A;  2KAC A;  2RDH A;  5G55 A;  1JQ4 A;  3LDZ E;  2EMT A;  3EFC A;  4L23 A;  1SJE D;  2RSU A;  1FNW A;  2KX0 A;  4MM3 B;  2VZK D;  2ZZP B;  3V61 A;  3MC0 B;  3KW5 B;  2KFK B;  3KQ4 A;  1M4V A;  1NDD A;  3UQB A;  4HJG E;  3WAL A;  1K50 A;  1TS2 A;  2GBR A;  3W5U B;  4AJW A;  2KTR B;  2LAS A;  2KLG A;  1KM7 A;  2ZEQ A;  2D10 A;  5JZE B;  4RGO S;  1RFK A;  1ZOY B;  3ZJU A;  2X38 A;  2PE6 B;  1EO6 A;  4IWQ A;  4MJS B;  5JXV A;  2KQ4 X;  2ICI A;  3IFW B;  5FR6 A;  5EE1 A;  1WIA A;  4FAD A;  5DCN A;  4JLC A;  3RNG C;  4FXC A;  3UIN B;  3W1S C;  1DYQ A;  1Z5S B;  1YN5 A;  4HJK A;  1L2N A;  4N9F 4;  2WX1 A;  3NVW A;  2FIF A;  3H6N A;  1I4R A;  1WXV A;  2W3S A;  3Q8A A;  1UWM A;  5CHV C;  4AJY B;  4KIK B;  1L0X B;  4IM0 A;  2MRP A;  4LLG M;  4TQ0 A;  3L4P A;  2QCZ A;  3AE6 B;  4OVU A;  4KGT A;  1V1O A;  3OJ4 B;  4EZK A;  4ARC A;  2NTT A;  2FAZ A;  1GOZ A;  4E71 A;  1ZXH A;  1J7B A;  1XXG A;  1NYR A;  1E6E B;  4GGQ A;  4N6E B;  1FCL A;  4A3P A;  2Y5B B;  4EFO A;  3QAR A;  2LGY A;  2K25 A;  1T0Y A;  2N0S B;  4YSZ B;  3HRD D;  4K7S A;  4C4V B;  4DHJ D;  4HXD A;  4NAW A;  5IA7 A;  2DZI A;  4NNJ B;  1SJH D;  1HTO A;  4BKT A;  3FIL B;  4YL8 A;  3L17 A;  2WDR B;  1YMH E;  2N9L A;  2ZVO A;  3WA0 A;  3DBS A;  4IM2 A;  3WAM A;  1MFW A;  2QJL A;  4J6I A;  4NY0 A;  2BYF A;  3AI5 A;  2NPT A;  2D3B A;  3W2D A;  1I4Q A;  1E8X A;  2KT7 A;  3S2A A;  2RGF A;  2IGG A;  2XK5 B;  3BII D;  1I35 A;  3ZXR A;  1ESF A;  2VRR B;  4RH6 A;  4K7U A;  4WIP A;  3APF A;  2WDT B;  1FMA D;  1N61 A;  1MI0 A;  1WRI A;  2WYQ A;  1FXT B;  1QOG A;  1V5T A;  5E6N A;  3U52 E;  4P1B C;  4S17 A;  1YN4 A;  1KRH A;  2D3G A;  3A1Q B;  3A33 B;  1WI0 A;  3AE3 B;  3IAS 1;  4LDT D;  1MPE A;  2IO0 B;  4EOY A;  2LEK A;  2CKH B;  1E7U A;  4TSS A;  2PPH A;  5IKC M;  1H7X A;  4KSK C;  2UYZ B;  4LNK A;  5IN7 A;  2KAN A;  2JUO A;  2B76 B;  4IW0 A;  3PPA A;  2LUM A;  2JYE A;  4EZJ A;  1XLO A;  2MBB B;  2D3A A;  3Q8F A;  5AUK A;  2X8X X;  4G0N B;  3HVZ A;  2GOW A;  2M4N A;  4CQN A;  1FCC C;  2MWS B;  3X0W A;  4LCD E;  5DPS A;  4IM3 A;  4NAW B;  2GBJ A;  2ZPY A;  4BKG A;  1HXY D;  1HEZ E;  1JML A;  3L54 A;  3VTU A;  1E7P B;  2IO1 B;  5LNK 1;  2K8H A;  2W3R A;  3FAH A;  2KWD A;  1QOB A;  4YTM B;  2WLB A;  1UD7 A;  2WX0 A;  4GB9 A;  5L83 A;  3CWI A;  2WXH A;  5CTR C;  1V5O A;  4DHZ E;  2N7E A;  3P42 A;  3JVZ X;  4E3C A;  2KMM A;  1WR6 E;  1DOX A;  5IP4 D;  1AYF A;  3O13 A;  4WH4 A;  1TS4 A;  4G50 A;  2WHI A;  1STE A;  3R7R A;  4W9L A;  3VVW B;  2PE9 A;  2OED A;  4RGT A;  3I5J C;  4K1R B;  1IPG A;  4KDL B;  1LFD A;  3WAP A;  3HVD A;  4WAA A;  2PVG C;  1MHX A;  1YIW A;  3B1L X;  3I63 C;  1U4A A;  3Q3J A;  1ZPS A;  4JL9 A;  4HVB A;  3B2F A;  3N9Y C;  4FJZ A;  3MC8 A;  4KDI C;  1XLN A;  4BVU C;  4ZYN A;  2ZVN A;  1WE7 A;  1R4M B;  2AX5 A;  4W9H A;  2BKR B;  2G9H D;  5LXI B;  1R4M I;  1SSN A;  5KHO A;  3VR9 B;  1KOT A;  3FC4 A;  4FBJ B;  5AUI A;  4AQ7 A;  4WWO A;  4M02 A;  3L08 A;  3U4E G;  1KF6 B;  4KZ0 A;  4MGK E;  2JRI B;  3OAW A;  1K8R B;  2IND C;  5IO9 A;  5MPO A;  1KFY B;  2KVZ A;  2Z8L A;  4LNN A;  3H7S A;  3GZN I;  2HJ1 A;  3GE3 C;  3VFK A;  1F9J A;  3DVG Y;  1PYW D;  3DVG X;  1T0R C;  4BOZ B;  1GB4 A;  4ZRQ A;  2D07 B;  3GB1 A;  4ANV A;  2N1W A;  1C78 A;  1PFD A;  2W55 A;  5E6J A;  3W5V B;  4HPM B;  1EU4 A;  3E56 A;  3MJ5 A;  1WGY A;  2FNJ B;  3Q6B A;  2RDB C;  3EHV A;  1VZ8 A;  1FD6 A;  1FFV A;  3QAQ A;  3ECI A;  3URY A;  3T8M A;  2N9X A;  4TV3 A;  3IT4 B;  4HWI B;  2I1K A;  3IT6 B;  3AB5 A;  4US8 A;  3VUX A;  4RCO A;  1ET6 A;  1JWB D;  4GDK A;  4AUQ C;  4ITK A;  1T6B X;  1FEH A;  2K22 A;  3QJZ A;  3BK1 A;  3DQV A;  1RAX A;  2FUH B;  3PO0 A;  2CU1 A;  4KX6 B;  4B0M A;  3U8Z A;  1HTQ A;  1OGW A;  2ZJD A;  3Q2A C;  3V6C B;  1CK1 A;  2LXA A;  2GB1 A;  4EZL A;  1WYG A;  2KMA A;  1FFU A;  3IXS A;  2RPQ A;  3ZKJ C;  4EE2 A;  3ZGZ A;  2LRW A;  4A55 A;  2EKE C;  2JY6 A;  5EDS A;  2L00 B;  3QIJ A;  3QK0 A;  2LHE A;  1GT8 A;  1N60 A;  4WQO B;  2V4L A;  3ZTD A;  1NBF C;  2K3U A;  4XC2 A;  4ASW C;  3ZRC A;  3H7P B;  3PHW B;  2ZW1 A;  1WJ4 A;  5BYR A;  2KC1 A;  4KGR A;  1HZ5 A;  2KK8 A;  1EM7 A;  1C3T A;  4IWO A;  1WR1 A;  4A3O A;  2C9W B;  1GJZ A;  3EEC A;  3QWZ B;  4IUM B;  2KFJ A;  4FN2 A;  5LXH A;  1TTN A;  1OQQ A;  1XCT L;  2BYT A;  2DZM A;  1J0G A;  3AM9 A;  5FK9 C;  3IAM 1;  1V8C A;  1Y56 A;  4C56 C;  4TUU A;  3E9S A;  2PKO A;  4IKG A;  3KWL A;  3PLV A;  3NUH B;  2KTF A;  2NCN A;  3BVZ A;  2QMT A;  3L16 A;  3U2S C;  2SAK A;  4GDL A;  3RNB C;  2WXO A;  1F1H A;  1M94 A;  2VH1 A;  5AEK B;  4ZHO A;  1XEE A;  1EUV B;  2V0G A;  2BKF A;  2HDE A;  3VRB B;  4MM3 A;  3RNC C;  2NS5 A;  2KFK A;  5BYQ A;  4ICV A;  2ONQ A;  3KUZ A;  3DBR I;  1I4G A;  4HK2 A;  3ML9 A;  2KTR A;  4FLH A;  3D32 A;  3ZNG C;  1OEY J;  4B9K A;  2C7N B;  1GG3 A;  4MJS A;  1WGR A;  1C76 A;  4C7Z A;  4M00 A;  1T3Q A;  1WM3 A;  1KTK A;  4XE0 A;  2JSV X;  3NZU A;  5CHF A;  1Y8R C;  2G45 B;  2MH7 A;  1YNT E;  4MEL A;  3VR8 B;  2NBU A;  2QIE B;  4MGZ E;  1V2Y A;  1GUA B;  3VQI A;  4LNI A;  2K8C A;  3LYY A;  3AE9 B;  2Q5W D;  4KIK A;  3VTW A;  1WM2 A;  4RM8 A;  4PYZ A;  2QHO A;  2LGD A;  4I6N B;  3TEX A;  2J42 A;  1Q0W B;  1WGD A;  2I38 A;  2KNB A;  2QDF A;  4W9J A;  1L6V A;  2WXP A;  3ML8 A;  1XD3 B;  2N9K A;  3A4S C;  5JHB A;  3PS6 A;  4HDQ A;  4PS7 A;  1WXS A;  2H89 B;  2FCS A;  5TSS A;  3MHS D;  1H4R A;  1N63 A;  4OZA A;  2JRH A;  3PZ7 A;  3KH0 A;  3R2T A;  4REZ A;  3GS2 A;  3PLU A;  1H8C A;  2J0J A;  1TS3 A;  3AU5 A;  5G5H A;  3T9L A;  2WXR A;  4C4V A;  1WRD B;  4GN1 A;  4M0W B;  3RNF C;  2QC8 A;  4WJP A;  3FIL A;  4PK1 A;  2KN4 A;  3W1S A;  4MEM A;  3DHH C;  1QQR A;  3P4R B;  4IDI A;  2N1V A;  1V9J A;  3OJ3 A;  1GPX A;  2MBH A;  3N1X C;  3BIN A;  1MVK A;  4USA A;  1T0Q C;  2MP2 B;  1KH0 A;  4HKQ A;  4RFB A;  4G11 A;  1S1Q B;  3N20 C;  3PVL A;  3OWE B;  1LGR A;  1JWS D;  2O6V B;  2WXN A;  2PW9 A;  2V3P A;  1QOF A;  2XK5 A;  4KKJ A;  4IOI E;  1QT9 A;  4WWN A;  5CX3 A;  1ZDV A;  1D5X C;  1Z2M A;  2D3C A;  4URK A;  1PUT A;  4RGM A;  1XF5 L;  4ZHP A;  1OEY A;  4W9D A;  2BWF A;  2V3S A;  1L7Y A;  4BFR A;  2O2V B;  3JSV B;  2MW5 A;  4W9E A;  4MT5 A;  2CHW A;  2K1F A;  3A1Q A;  4LNO A;  2ACZ B;  2JZZ A;  3KWV A;  1F77 A;  2WDQ B;  2KOX A;  2GBK A;  4ICU A;  2IYD B;  1FXI A;  2WXQ A;  1XLP A;  1ZW7 A;  3JYU A;  1VDV A;  1LXD A;  2HE7 A;  2LJ5 A;  2WXJ A;  3EUB 2;  3N30 A;  2Y5P A;  2WXM A;  2BQQ A;  4FHJ A;  1TJE A;  3V62 A;  3RFZ B;  1Q1O A;  3Q8B A;  4HRS A;  2INN E;  4A8X C;  1V49 A;  4GMV A;  2RR9 A;  4RGN A;  3SEB A;  3NG0 A;  3SR6 A;  4DWF A;  3A4R A;  1VR9 A;  1P98 A;  1RYJ A;  4JGH B;  3HM3 A;  2INC C;  1N6Z A;  3IVF A;  4HCP B;  1IBX B;  2M8S A;  2ON8 A;  4GSW A;  3C19 A;  4R3D A;  2KJ6 A;  3VUY A;  1TZ1 A;  3AEB B;  4ZRK A;  3VAW A;  3PZ8 A;  4EUT A;  4S0R A;  4DK5 A;  2C5L C;  4YTP B;  2E3T A;  2K8B A;  4KKI A;  2L0F A;  4A90 A;  2HD5 B;  5EE9 A;  3HM6 X;  3ZUN A;  2ZNV C;  4EEW A;  1BXT A;  3TEY A;  2PTL A;  3C8Y A;  1WX8 A;  2FID A;  2KWC A;  3ZW3 A;  1I7H A;  4X57 B;  3ZNI D;  1IP9 A;  4BZA A;  1PGB A;  1N62 A;  4ZYS A;  1A70 A;  1PDX A;  2KXJ A;  2BYE A;  2Z0E B;  2MBO A;  1ACC A;  2Z59 B;  2MX2 A;  1LM8 B;  2PLP A;  1JW9 D;  3M3J A;  2LHD A;  2HJ8 A;  3OLM D;  2J53 A;  3A9K B;  1J7C A;  3KUC B;  3EC8 A;  1UBI A;  3RUI B;  4D2K A;  2GMI C;  4K3B A;  4OZC A;  2D2Q A;  1L5P A;  4NZL B;  2SEB D;  5BMI A;  2C60 A;  1WX9 A;  4NQL B;  4RM9 A;  3IG3 A;  4DDG D;  2E6X A;  1T0S C;  1OTR B;  3ALB A;  3PTF C;  3U7D A;  3N1Y C;  1SE9 A;  4MSQ B;  2BF8 B;  2KDE B;  3L13 A;  2ZNV B;  3DBL I;  2DEN B;  1VCB A;  1YX5 B;  2DYO A;  1UWX A;  1WWT A;  2IO2 B;  3B9J A;  3MFG A;  2G4D B;  3WAN A;  3SHQ A;  3HHM A;  2KWU B;  1OFF A;  2L3Z A;  3CSF A;  1C4A A;  1D5M C;  4ARI A;  3R66 C;  2AQ3 B;  1ISN A;  3J9C A;  2M0A A;  1TT5 B;  3R3M A;  1WZ3 A;  2MJE A;  4ANW A;  2FCM A;  3V05 A;  2A4Z A;  1WE6 A;  3AU4 A;  1ZE3 D;  3AEA B;  1YD8 U;  1YJI A;  2CS4 A;  1P1A A;  4JPS A;  3AED B;  1QOA A;  3VH3 B;  5DPT A;  4GXB A;  1UGM A;  4JX1 C;  1GC7 A;  5D2M B;  2KDM A;  3R2I A;  4US9 A;  3AH7 A;  3P4S B;  1WSP A;  2LZ6 A;  4WWM A;  2N9P C;  2MA9 B;  2Y5C A;  5C23 A;  1C1Y B;  2DYB A;  1SXT A;  1LQB A;  3NOB A;  4WUR A;  3DPD A;  2BB5 A;  3Q3M C;  4FHK A;  1OQR A;  4RF0 A;  4TKN A;  2Y3A A;  1WMH B;  2KQS A;  1WXA A;  1Q10 A;  2GLS A;  2LWP A;  2IY1 B;  4HRO A;  3HK0 A;  1WJN A;  4P7I A;  3VUW A;  2BW2 A;  1CJE A;  1T5X D;  3TCA A;  3ZQ4 A;  2K6D B;  3U30 A;  3H7P A;  3R7Q A;  2KJR A;  2KAJ A;  3PRP B;  2BPS A;  1F52 A;  2MEK A;  3KYC D;  3SFE B;  1WX7 A;  1UUP A;  3TUO A;  4YSX B;  3BVG A;  1YQ3 B;  1WFY A;  2BGF A;  1NYQ A;  3GZN B;  2KKC A;  5EE0 A;  4XX5 A;  3W1Y A;  2WXK A;  2BWE S;  3P2B A;  3NRZ A;  3UIP B;  3Q8C A;  1UZX B;  3EA6 A;  2O6V D;  4OVV A;  1NI2 A;  3TSS A;  4ANU A;  1XLQ A;  5D94 A;  2CJO A;  1IGD A;  2NVU I;  4M01 A;  1I4P A;  4YTN B;  4F1S A;  2MBQ A;  1HQR D;  2KDB A;  1C4C A;  1YJ1 A;  2A5U A;  3TIX A;  2WQY B;  3ETR A;  3M63 B;  2GBN A;  3Q14 C;  2NMQ A;  2C7H A;  2J0K A;  1KLV A;  2L83 A;  3KLS X;  2JXX A;  1V81 A;  3X23 A;  2NBV B;  2NR2 A;  2KQ7 A;  5AZG A;  2WDV B;  2LD9 A;  5C2T B;  4HDO A;  1SBB B;  2YVC A;  3QQ8 B;  3LB8 C;  3BZD B;  4A9A A;  4II2 B;  1VJK A;  5BYS A;  2DHZ A;  2D5G A;  2B3A A;  1F0Z A;  1ZKH A;  5I4D A;  1SIF A;  3PSE B;  1Q5W B;  1WXM A;  1FNV A;  4LTU A;  4MH0 E;  1R4N I;  2V4I B;  5FR3 A;  1OQY A;  2IGH A;  2IZV B;  4PYU A;  1IYF A;  4DHJ B;  4BKS D;  1L6U A;  2FBW B;  4AOF A;  4LJO B;  2ASQ A;  3PT2 B;  1JWU D;  2ZPN A;  2DAF A;  4YWG G;  2JT4 B;  2C7M B;  3RI7 C;  4O1N A;  5JHA A;  2INP E;  3ZTC A;  4NPN A;  1ROE A;  3SDL C;  3APD A;  3ZO5 B;  5HFY A;  1RLF A;  2UU7 A;  2LGX A;  1YX6 B;  1SE4 A;  3AEG B;  3M62 B;  3ZNH B;  1FRD A;  2KD0 A;  2BS3 B;  2REX A;  2KDI A;  4L2Y A;  4L1B A;  4YSY B;  3U7Z A;  2DWQ A;  4ANX A;  3UI3 A;  4P6V F;  4RF1 A;  1UF0 A;  3W9C B;  5DPW A;  3NS8 A;  1B1Z A;  4XYC A;  2G1E A;  2CJN A;  1PGX A;  3MTN B;  1HE8 A;  4M0W A;  2K9X A;  3Q3N C;  2FE8 A;  1GC6 A;  4K3C A;  3TEW A;  3EFU A;  3DBR B;  4WJN A;  5EE3 A;  1AW7 A;  1VLB A;  5TR5 A;  3ZIM A;  2MP2 A;  1JWM D;  2TSS A;  2WXG A;  2PJH A;  5DPR A;  2JVC A;  1QZE A;  2LFI A;  1YQB A;  3AE1 B;  2O6V A;  4H2A A;  2MCN B;  2H88 B;  1SEB D;  1QIL A;  2MHJ A;  4FA6 A;  3DVN U;  1VD2 A;  2V9H A;  4WJQ A;  1GTE A;  2UWQ A;  1WH3 A;  1FIQ A;  2J7Q B;  4CHK A;  3NVY A;  1C9F A;  4IG7 B;  2RD0 A;  1L0V B;  4XGA B;  5GXG B;  2JXT A;  1J7A A;  3NHE B;  4B95 A;  1V80 A;  4GU2 A;  2O2V A;  3JSV A;  3UGB B;  4KVG B;  2N7J A;  3ZVV A;  1FM0 D;  3AE4 B;  1I4X A;  2KVR A;  2PMV A;  3AE2 B;  2OOB B;  4M8N A;  5AZH A;  4NJ6 A;  2DAJ A;  2NTS A;  1P9D U;  3PRM B;  3K9O B;  2IBI B;  4QAY A;  2LMC A;  1QF6 A;  1WGG A;  3GE8 C;  1JWA D;  2W9N A;  1JAL A;  1AWD A;  1DGJ A;  2WU2 B;  1HZ6 A;  4GOC A;  3VHT C;  3BK2 A;  3AN1 A;  2W54 A;  2MJ3 A;  1R7S A;  3UQA A;  2R2Q A;  3DHI C;  2R61 A;  3ZDM C;  4BKS A;  4DQO C;  2L8J A;  1TBE A;  2K5P A;  1YQ4 B;  2L7R A;  4C80 A;  2DBY A;  1YOV B;  3KYD D;  1E10 A;  2LVO A;  3Q3O C;  4LNF A;  3VRA B;  3PRZ A;  3ABV B;  3RYT A;  2ZW0 A;  1ZP0 B;  2IY0 B;  3ZRF A;  4XZ4 A;  3Q8E A;  4HEA 1;  1IBX A;  3VH4 B;  1FO4 A;  4HLE A;  3WIM A;  3JW0 X;  1YJJ A;  2KN5 A;  2MBE A;  2RPV A;  1SGH A;  1L4D B;  5GMV A;  3NVZ A;  3VTV A;  4DHZ B;  1D5Z C;  1SF0 A;  4KV2 A;  2N7D A;  2JZP A;  3UIO B;  3AE5 B;  2JPH A;  1TY2 A;  3GP7 A;  4C7Y A;  1EF1 A;  1I4H A;  2KO3 A;  1NEK B;  3ONS A;  1BUI C;  1N5X A;  1YN3 A;  4FJY A;  2J4X A;  3AXC A;  4KSL C;  3I9V 1;  2MJD A;  2XEW A;  1TGZ B;  2W82 A;  2HTM E;  3QA8 A;  4MSM B;  2ZCC A;  2EEL A;  2YEP F;  4ZRI A;  4DXF A;  5J2R A;  1TKG A;  1XCQ L;  1RFA A;  3IHP C;  1BML C;  3A9K A;  4NQK E;  2LI5 A;  1E8Y A;  2WXF A;  3NJT A;  2K39 A;  4BBN C;  3DWM A;  1GTH A;  5C1Z A;  1WGK A;  2CHX A;  5D7G A;  1TS5 A;  3ZDT A;  1MG4 A;  2L76 A;  4WJO A;  2K0P A;  5L95 C;  3L10 B;  4DXA B;  1SIJ A;  4M8M A;  5HI1 A;  1UEL A;  1ENF A;  3V60 A;  3K9P B;  4EKU A;  2IDY A;  1F2R C;  4JQW C;  3RCZ A;  4WAF A;  1E8W A;  1QLB B;  3NY5 A;  1I42 A;  1ZDX A;  2WXI A;  2BTE A;  1V97 A;  3Q3F A;  1AN8 A;  1UNS A;  1HA5 A;  3N1Z C;  1SE3 A;  2GRI A;  4AWJ A;  5D6J B;  4N59 A;  2I1J A;  3GOE A;  4XWW A;  2LJI A;  4ZRP A;  2I2Y A;  2EMS A;  2FUG 1;  1GB1 A;  3DBH B;  4LK0 M;  3HUI A;  3WCQ A;  1D3Z A;  3QHT A;  2L05 A;  3DBH I;  2VH2 A;  3CF6 E;  4G3X B;  5HKH A;  3AMZ A;  1NI3 A;  4I6P A;  5J18 A;  1DOI A;  2FCN A;  2LUE A;  4OHJ A;  1RM6 C;  1G6J A;  5H8Y E;  1VRA B;  4OVZ A;  3BVM A;  3DVN V;  3LXF A;  1UH6 A;  3MP9 A;  1L0Y B;  1VZ6 A;  1E9M A;  2CR5 A;  2RMM A;  2ZCB A;  2DZK A;  4LJP B;  1CZP A;  1LO5 D;  4PT5 A;  4MH8 A;  2IO3 B;  3BWU D;  3IBE A;  1WMH A;  4I6L B;  1F2R I;  3SD5 A;  3QX1 A;  1MHH E;  3RZF A;  1VZ7 A;  2BS4 B;  2WXL A;  3MC9 A;  2RDG A;  2LVQ A;  4OW0 A;  3WAO A;  3UF8 A;  3HIZ A;  4IWP A;  1TYG B;  3ENE A;  2MSE D;  3P63 A;  1KJT A;  3CST A;  3PRE A;  2M19 A;  1DOY A;  4HKZ E;  2N9E B;  2MQJ A;  3R8B A;  3NS1 A;  2LXC A;  1E90 A;  1QKZ A;  4JWU C;  3DBL B;  5E6P A;  5J17 A;  4ZRJ A;  2M17 A;  4XDD A;  2KX3 A;  3ZXV A;  4F8C B;  1WYW B;  1P3Q U;  2WWZ A;  4ACF A;  5D3D A;  1E8Z A;  1NEN B;  1TKY A;  2BT6 A;  5BMG A;  1WZ0 A;  5H92 C;  3BYT B;  2G4S A;  5C3J B;  2YEP B;  3BY4 B;  1E7V A;  3RN9 C;  5IAA C;  3ZJT A;  2HTH A;  2FCQ A;  1TIF A;  3PGE A;  4PS3 A;  2QEJ C;  2JU6 X;  3H9D A;  3O65 B;  1MJD A;  5E6O A;  2LVP A;  1B9R A;  1JRU A;  1PQS A;  2KYW A;  3Q69 A;  2Z0D B;  2DLB A;  5JH5 C;  4NAM A;  4N58 A;  5G5G A;  4NJC A;  4K7W A;  4CYE A;  4FUL A;  2OJR A;  3B0A A;  2NPT B;  2PIA A;  1C77 A;  2WS3 B;  3QCA A;  2NBW B;  3KUD B;  1TZO A;  2KJH B;  3AE7 B;  5KHQ A;  1J8C A;  1P7F A;  4MDK E;  1N5W A;  5BMH A;  4GIV A;  2LGS A;  3T3O A;  1RRB A;  3B08 A;  3A9J A;  4TQ1 A;  2JWU A;  2GBM A;  3PV1 A;  2K6Q A;  2BBC A;  4C00 A;  1BT0 A;  5IOI A;  2BB6 A;  1WJU A;  1KLU D;  5CHW A;  1D6E C;  4HPL B;  2VZK B;  3RNA C;  2J52 A;  3N3K B;  2AQ2 B;  4XDC A;  2WU5 B;  3RNE C;  3TMP B;  4W9C A;  3RPF C;  3PHX B;  1XT9 B;  1D4B A;  2G3Q B;  2BVC A;  1WGH A;  3AUL A;  1SE2 A;  3BYY B;  4P16 A;  2AQ1 B;  2KLC A;  1TY0 A;  5HG2 A;  2JX5 A;  3H8H A;  2JWZ A;  2L1A A;  4BOS C;  2KC2 A;  1EF5 A;  2DYM A;  3MJW A;  3EGR A;  2DZJ A;  2KHW B;  1WY8 A;  2IGD A;  3QC8 B;  5T8I A;  3V3X A;  2LRU A;  3C0R B;  4KZC A;  5BO4 B;  1UBQ A;  1CMX B;  3OG5 A;  3DCG A;  4WWP A;  1FXA A;  2XBB C;  2L32 A;  2M1M A;  1PGA A;  2AEH A;  1RWS A;  1V6E A;  3AE8 B;  4W9I A;  2L0T A;  3I3T B;  3NVV A;  4E74 A;  2QIL A;  4UDU C;  4AS1 A;  2MLB A;  1C4P A;  4II3 B;  3TEZ A;  2M0X A;  3RT3 B;  1JCK B;  5FKA C;  1XO3 A;  4B6W A;  3TJP A;  2D11 A;  1R4N B;  4B0E A;  2L52 A;  3A9J B;  1GNU A;  3T3N A;  3N32 A;  2WP9 B;  1K51 A;  3H1U A;  5LLI A;  2M56 B;  3SU8 X;  4ZDV A;  1L4Z B;  4PS8 A;  4OZB A;  1V1P A;  4Q2J A;  2AWT A;  1XQQ A;  3AV8 A;  2CU3 A;  1K52 A;  2BYV E;  1ZUD 2;  3P1M A;  3CMM B;  4FJV B;  2YLM A;  4K81 A;  3NZ3 A;  2AL6 A;  3AEF B;  2JYT A;  4BAX A;  3VDZ A;  2JZ3 B;  1S3S G;  4JWS C;  4HCN B;  4A6Q A;  4MGY E;  3CF4 A;  4YXD B;  1E0Z A;  3AEC B;  1EWC A;  2V1Y A;  4DDI D;  3RZW C;  2R2O A;  1FNU A;  5G2N A;  2IJ0 A;  3FKY A;  3B2G A;  3NZS A;  4J3O D;  1K53 A;  3ZYY X;  2AYO B;  3DHG C;  4AP4 C;  4A20 A;  4DXG A;  2KWV B;  1IGC A;  3LJ3 A;  2PEA A;  4YT0 B;  3I57 A;  3PZD A;  4LDT B;  1EWY C;  1V86 A;  1FPY A;  1JRO A;  2JQR B;  1ZGU B;  1JRP A;  3CIR B;  4GDK B;  2KMC A;  4F7Z A;  4JE3 B;  1TKE A;  4XWT A;  1J19 A;  1FRR A;  3DDC B;  3KVF B;  3DOW A;  3P4P B;  1MG8 A;  3ZNZ B;  1P0R A;  4NJ7 A;  4RMA A;  2DX5 B;  2OJW A;  2GI9 A;  4W9G A;  3ZJV A;  2IPK D;  1V1P B;  4RNA A;  2CHZ A;  3L0W B;  4MGI E;  2WGS A;  3SFD B;  1P7E A;  2LGI A;  2J0M A;  1E5W A;  1ZXI A;  4IC7 B;  4HPP A;  1C79 A;  5AZF A;  4ZOH C;  3APC A;  4DBG A; 
#chains in the Genus database with same CATH homology
 3V05 A;  1WYG A;  1QLB B;  1KLG D;  1SB3 C;  1FFU A;  1ZE3 D;  3AEA B;  1YJI A;  3IXS A;  1GAQ B;  4EE2 A;  1ZDX A;  2WXI A;  4JPS A;  3AED B;  1QOA A;  3ZGZ A;  4A55 A;  4WQM A;  2BTE A;  1V97 A;  5D3I B;  1EU3 A;  4JX1 C;  3P4Q B;  1AN8 A;  1UNS A;  1HA5 A;  1UGJ A;  4TMA B;  2KDM A;  1SE3 A;  2LHE A;  3R2I A;  1CQV A;  2GRI A;  1GT8 A;  4US9 A;  2V3N A;  1N60 A;  4N59 A;  3AH7 A;  3DWG C;  3P4S B;  4XWW A;  2LJI A;  1WSP A;  2EKI A;  2K3U A;  4WWM A;  4ZRP A;  2I2Y A;  2Y5C A;  1H7W A;  2BS2 B;  1WXQ A;  4GLS C;  2OHF A;  2XNA C;  2ZW1 A;  2FUG 1;  1GB1 A;  4KGS A;  1SXT A;  3MHZ A;  4LK0 M;  5BYR A;  4KGR A;  1HZ5 A;  3HUI A;  3WCQ A;  4WUR A;  2BB5 A;  4RF0 A;  1EM7 A;  1OQR A;  2Y3A A;  3AMZ A;  1NI3 A;  2PVO D;  1Q10 A;  1ET9 A;  3AEE B;  1IUE A;  5HHD G;  4GDL B;  1DOI A;  2XN9 C;  1NVI D;  4HRO A;  4OHJ A;  1RM6 C;  2BW2 A;  2WNM A;  4MAC A;  1CJE A;  2QSD A;  1OQQ A;  1T5X D;  2KAC A;  5H8Y E;  1VRA B;  1XCT L;  2RDH A;  2BYT A;  4OVZ A;  3BVM A;  1JQ4 A;  3ZQ4 A;  3LXF A;  3AM9 A;  4L23 A;  3MP9 A;  1L0Y B;  5FK9 C;  3IAM 1;  1VZ6 A;  1SJE D;  2KAJ A;  1E9M A;  1V8C A;  1Y56 A;  2RMM A;  4C56 C;  1CZP A;  1FNW A;  4MM3 B;  1LO5 D;  4PT5 A;  2VZK D;  3E9S A;  4MH8 A;  2PKO A;  3MC0 B;  3BWU D;  2MEK A;  4IKG A;  3SFE B;  3KWL A;  3TUO A;  1UUP A;  3NUH B;  4YSX B;  3BVZ A;  3KQ4 A;  1F2R I;  1M4V A;  1YQ3 B;  3BVG A;  2QMT A;  1MHH E;  4HJG E;  1NYQ A;  3U2S C;  1VZ7 A;  2SAK A;  1K50 A;  5EE0 A;  2BS4 B;  2WXL A;  1TS2 A;  2RDG A;  2WXO A;  4OW0 A;  3W5U B;  2WXK A;  4ZHO A;  4RGO S;  1RFK A;  1ZOY B;  3ZJU A;  2X38 A;  1TYG B;  3NRZ A;  3Q8C A;  3P63 A;  1XEE A;  3EA6 A;  2M19 A;  5JXV A;  1DOY A;  4HKZ E;  3TSS A;  2V0G A;  2HDE A;  3VRB B;  3R8B A;  1XLQ A;  2KQ4 X;  3NS1 A;  2ICI A;  2CJO A;  5EE1 A;  1IGD A;  1QKZ A;  1I4P A;  4JWU C;  4YTN B;  5BYQ A;  1HQR D;  1C4C A;  4FXC A;  2ONQ A;  2WQY B;  4XDD A;  1I4G A;  3ETR A;  1DYQ A;  1YN5 A;  2NMQ A;  2L83 A;  5D3D A;  1NEN B;  3KLS X;  1TKY A;  2BT6 A;  3NVW A;  5BMG A;  5H92 C;  1I4R A;  3Q8A A;  2W3S A;  3BYT B;  1UWM A;  2WDV B;  5C3J B;  2YEP B;  1L0X B;  1C76 A;  4C7Z A;  5C2T B;  3ZJT A;  1T3Q A;  1SBB B;  4LLG M;  4TQ0 A;  3L4P A;  2QEJ C;  1KTK A;  3AE6 B;  3LB8 C;  2JU6 X;  3BZD B;  4XE0 A;  4KGT A;  1V1O A;  4A9A A;  2JSV X;  4ARC A;  2NTT A;  1VJK A;  2MH7 A;  1GOZ A;  1YNT E;  5BYS A;  3VR8 B;  2D5G A;  1F0Z A;  2QIE B;  1ZXH A;  1J7B A;  1XXG A;  1NYR A;  5I4D A;  1B9R A;  1E6E B;  3VQI A;  3LYY A;  3AE9 B;  3Q69 A;  2Q5W D;  4N6E B;  1FCL A;  2DLB A;  1FNV A;  4NAM A;  4N58 A;  5G5G A;  4LTU A;  4NJC A;  2V4I B;  5FR3 A;  3TEX A;  2J42 A;  2N0S B;  4YSZ B;  2IGH A;  3HRD D;  2I38 A;  2PIA A;  1L6V A;  2WXP A;  1C77 A;  2N9K A;  2WS3 B;  2FBW B;  1L6U A;  1SJH D;  1JWU D;  4YWG G;  1TZO A;  2H89 B;  3FIL B;  5TSS A;  3AE7 B;  2WDR B;  1YMH E;  2N9L A;  4O1N A;  1P7F A;  1N63 A;  4OZA A;  1N5W A;  5BMH A;  2INP E;  3T3O A;  3PZ7 A;  3R2T A;  4REZ A;  4TQ1 A;  3GS2 A;  1ROE A;  2JWU A;  2BBC A;  2QJL A;  1TS3 A;  5G5H A;  5HFY A;  2BB6 A;  1SE4 A;  2WXR A;  3W2D A;  3AEG B;  1I4Q A;  1KLU D;  1D6E C;  1FRD A;  2VZK B;  2IGG A;  3BII D;  2BS3 B;  2J52 A;  1ESF A;  3FIL A;  4L2Y A;  2KN4 A;  4YSY B;  4L1B A;  4RH6 A;  3U7Z A;  3W1S A;  2DWQ A;  1QQR A;  3P4R B;  2AQ2 B;  4IDI A;  4WIP A;  4XDC A;  2WU5 B;  1GPX A;  3UI3 A;  4P6V F;  1FMA D;  4RF1 A;  1MVK A;  1N61 A;  4USA A;  3W9C B;  1KH0 A;  1MI0 A;  1WRI A;  3RPF C;  4HKQ A;  4RFB A;  1B1Z A;  1D4B A;  1QOG A;  2G1E A;  2CJN A;  3OWE B;  1JWS D;  1SE2 A;  2WXN A;  2PW9 A;  1PGX A;  1QOF A;  2V3P A;  3U52 E;  3BYY B;  4P16 A;  4M0W A;  1YN4 A;  1KRH A;  2AQ1 B;  2K9X A;  4KKJ A;  4IOI E;  3AE3 B;  1QT9 A;  2FE8 A;  1TY0 A;  3IAS 1;  2JX5 A;  1MPE A;  5HG2 A;  3H8H A;  2L1A A;  3TEW A;  1ZDV A;  1D5X C;  2DYM A;  5EE3 A;  1AW7 A;  2LEK A;  3EGR A;  4TSS A;  1VLB A;  1PUT A;  4RGM A;  1XF5 L;  4ZHP A;  1JWM D;  1H7X A;  2IGD A;  2TSS A;  2WXG A;  2B76 B;  2LFI A;  5T8I A;  3V3X A;  3AE1 B;  4H2A A;  4MT5 A;  2H88 B;  2LUM A;  1SEB D;  1FXA A;  2JYE A;  1XLO A;  3Q8F A;  1QIL A;  5AUK A;  2ACZ B;  1GTE A;  2L32 A;  3HVZ A;  3KWV A;  1F77 A;  1PGA A;  2WDQ B;  1FIQ A;  1RWS A;  3NVY A;  1C9F A;  4CQN A;  3AE8 B;  1FCC C;  1L0V B;  1FXI A;  3NVV A;  2QIL A;  4UDU C;  5GXG B;  2WXQ A;  1XLP A;  4AS1 A;  2JXT A;  4NAW B;  1C4P A;  1J7A A;  1VDV A;  3TEZ A;  1HXY D;  1HEZ E;  1JML A;  1E7P B;  5LNK 1;  2WXJ A;  1JCK B;  2W3R A;  3EUB 2;  2Y5P A;  2WXM A;  3FAH A;  2KWD A;  1QOB A;  5FKA C;  4YTM B;  2WLB A;  1TJE A;  1XO3 A;  2N7J A;  1FM0 D;  3CWI A;  3AE4 B;  1I4X A;  2WXH A;  2PMV A;  4B0E A;  2L52 A;  3AE2 B;  3RFZ B;  3Q8B A;  4HRS A;  3T3N A;  2WP9 B;  3P42 A;  2NTS A;  1K51 A;  2INN E;  2KMM A;  4A8X C;  2M56 B;  2LMC A;  1DOX A;  1QF6 A;  1AYF A;  1L4Z B;  4RGN A;  3O13 A;  4WH4 A;  3SEB A;  3SR6 A;  1TS4 A;  1JWA D;  1VR9 A;  4OZB A;  1JAL A;  1AWD A;  1V1P A;  1STE A;  1RYJ A;  1DGJ A;  4Q2J A;  2WU2 B;  1HZ6 A;  3AV8 A;  3BK2 A;  3AN1 A;  1IBX B;  2W54 A;  2ON8 A;  4R3D A;  2CU3 A;  1K52 A;  1R7S A;  2MJ3 A;  1ZUD 2;  3P1M A;  3AEB B;  2OED A;  3PZ8 A;  4RGT A;  3NZ3 A;  2R61 A;  3AEF B;  4YTP B;  2E3T A;  2JYT A;  4DQO C;  4KKI A;  4A90 A;  2K5P A;  1YQ4 B;  3HVD A;  5EE9 A;  4C80 A;  2DBY A;  2PVG C;  1MHX A;  1BXT A;  1E10 A;  3TEY A;  2PTL A;  3C8Y A;  1ZPS A;  4JWS C;  4A6Q A;  3VRA B;  3B2F A;  3N9Y C;  1XLN A;  3ABV B;  3CF4 A;  2ZW0 A;  1I7H A;  1ZP0 B;  4YXD B;  1E0Z A;  3AEC B;  1EWC A;  2AX5 A;  3Q8E A;  4HEA 1;  2G9H D;  1IBX A;  1PGB A;  1SSN A;  1FO4 A;  1FNU A;  3VR9 B;  2IJ0 A;  3FC4 A;  1N62 A;  4ZYS A;  3B2G A;  1YJJ A;  1A70 A;  4J3O D;  1K53 A;  3ZYY X;  1PDX A;  5AUI A;  4AQ7 A;  2RPV A;  4DXG A;  1IGC A;  3U4E G;  1KF6 B;  1ACC A;  1L4D B;  3NVZ A;  4YT0 B;  1D5Z C;  3I57 A;  1SF0 A;  2PLP A;  1JW9 D;  1EWY C;  2JZP A;  2LHD A;  3AE5 B;  2J53 A;  1TY2 A;  1J7C A;  3GP7 A;  1KFY B;  1JRO A;  5MPO A;  2JQR B;  4C7Y A;  4D2K A;  2Z8L A;  1I4H A;  1NEK B;  1BUI C;  1JRP A;  3CIR B;  4OZC A;  1PYW D;  1N5X A;  1L5P A;  4NZL B;  1GB4 A;  1YN3 A;  2SEB D;  5BMI A;  4GDK B;  4ZRQ A;  2J4X A;  4JE3 B;  3GB1 A;  1TKE A;  3I9V 1;  2MJD A;  4XWT A;  1C78 A;  1PFD A;  2W55 A;  1FRR A;  5E6J A;  2E6X A;  3W5V B;  2W82 A;  2HTM E;  1EU4 A;  3E56 A;  2EEL A;  3MJ5 A;  2YEP F;  4DXF A;  1TKG A;  1XCQ L;  1VZ8 A;  1FD6 A;  3P4P B;  1FFV A;  1BML C;  2WXF A;  3URY A;  2DYO A;  3IT4 B;  1UWX A;  2GI9 A;  3IT6 B;  3AB5 A;  3DWM A;  4US8 A;  4RCO A;  3ZJV A;  1WWT A;  1ET6 A;  1JWB D;  1GTH A;  3B9J A;  1WGK A;  1T6B X;  1FEH A;  1V1P B;  2IPK D;  3MFG A;  1TS5 A;  2K22 A;  4ITK A;  4RNA A;  5D7G A;  3BK1 A;  1OFF A;  4ARI A;  1C4A A;  1D5M C;  3SFD B;  1P7E A;  3PO0 A;  2LGI A;  4KX6 B;  2AQ3 B;  4B0M A;  2K0P A;  1ZXI A;  3J9C A;  1SIJ A;  5HI1 A;  1CK1 A;  1ENF A;  2M0A A;  1C79 A;  2IDY A;  2MJE A;  1F2R C;  4ZOH C;  2GB1 A;  4WAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...