3P4SB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with a 3-nitropropionate adduct
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
243
structure length
243
Chain Sequence
b'AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
molecule keywords Fumarate reductase flavoprotein subunit
source organism Escherichia coli 042
molecule tags Oxidoreductase
total genus 62
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4sB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4sB01
1J7CA 1T3QA 2PVOD 4YTMB 1NENB 2WDRB 1A70A 2WQYB 5MPOA 1DOYA 2M19A 3CF4A 3AE9B 1DOIA 3P4SB 1EWYC 1PFDA 3LB8C 1H7WA 1FO4A 2W3SA 4YXDB 3P4QB 1GAQB 4N59A 4YSZB 1OQRA 1RFKA 1JRPA 2LEKA 1N60A 1XLPA 4HRSA 1N5WA 1FXIA 1IUEA 1DOXA 4US9A 3CIRB 3AEFB 3P4RB 1SB3C 2EKIA 5EE1A 1DGJA 1L6UA 4WWMA 1FRRA 3W5VB 1F0ZA 2PIAA 3NVYA 3P1MA 5AUIA 5GXGB 2G1EA 2CJOA 3DWMA 4N58A 3FAHA 2KAJA 4C80A 2K9XA 3HRDD 1JWAD 1RWSA 1N5XA 1FFVA 4JWUC 2MJ3A 4ZHPA 3NS1A 1N61A 2DWQA 2HTME 2WU5B 1GPXA 1J7BA 1WYGA 3AV8A 1ROEA 4HROA 1WWTA 1TKEA 2B76B 4LTUA 3AECB 2JX5A 2N0SB 1NEKB 5G5GA 5H8YE 1FRDA 1L0VB 3P63A 1QT9A 3VRBB 4C7ZA 5EE0A 1VLBA 1L5PA 4YTPB 3AH7A 3KWLA 1V8CA 3AEGB 1KRHA 1NYQA 4USAA 3W5UB 1JW9D 1KF6B 1ZXIA 1UWMA 2W54A 3B2FA 1JWBD 2BS2B 2WLBA 2MH7A 3HUIA 1FMAD 4JWSC 2K22A 3NVZA 5H92C 4C7YA 1NYRA 1E7PB 1AWDA 1WXQA 1N63A 2WDQB 1CJEA 1R7SA 2W3RA 3VR9B 4IDIA 3AM9A 2L52A 1KFYB 1YQ3B 1RYJA 1XLNA 3AE6B 1SIJA 1NVID 1TYGB 2DBYA 1CZPA 3L4PA 4YSYB 3P4PB 2BS4B 1PUTA 1ZP0B 1XLOA 1YJIA 1H7XA 2H89B 1FM0D 1TKYA 3AE3B 2W55A 3EUB2 3ZYYX 2FBWB 1GT8A 1WRIA 1YJJA 5EE3A 4JX1C 3AE7B 1J7AA 1E6EB 2PKOA 4FXCA 1XO3A 3VRAB 2BT6A 5C2TB 2CJNA 2Y5CA 3VR8B 3BIID 1AYFA 4ZHOA 1E9MA 1VDVA 1N62A 5G5HA 2WU2B 2MJEA 2OHFA 4US8A 2WP9B 1FFUA 2CU3A 2M56B 3CWIA 3LXFA 3NVWA 4ITKA 5EE9A 1V97A 3PO0A 5AUKA 1E10A 1TJEA 3B2GA 1RM6C 3AN1A 3RPFC 1JROA 1QOFA 4YSXB 1OQQA 1JQ4A 2PVGC 1YQ4B 3ETRA 2Q5WD 3SFDB 2QIEB 1QOGA 3W9CB 3B9JA 3ABVB 4A9AA 1ZOYB 4WQMA 1PDXA 3AE5B 2BS3B 1WGKA 3AEBB 3AEDB 2K5PA 1B9RA 4KX6B 1FIQA 1XLQA 1SF0A 3FC4A 1I7HA 4N6EB 3WCQA 2WDVB 3AE4B 3AEAB 1L6VA 1GTEA 4YT0B 2WS3B 1OFFA 1ZUD2 1TKGA 1QOAA 1QF6A 1NI3A 2KMMA 2E3TA 1E0ZA 3AE8B 1QLBB 2AX5A 2H88B 3SFEB 2MJDA 2JQRB 3AE1B 3NRZA 3AE2B 5C3JB 1FXAA 3AEEB 2L83A 3HVZA 3AMZA 2QJLA 3SR6A 4YTNB 1JALA 1QOBA 3DWGC 4ZOHC 3NVVA 1VJKA 1GTHA 3AB5A 4P6VF 2ACZB
chains in the Genus database with same CATH superfamily
3ZKJC 1TS2A 2WDRB 2BBCA 4WAAA 1DOYA 4NNJB 3P4SB 1PFDA 3H7PB 2ZJDA 1V49A 3J9CA 2BWFA 2N9XA 4ZRIA 1OQRA 1AW7A 1TY2A 4A55A 1N60A 1FXIA 1SXTA 4US9A 4GDKB 2NPTA 3WALA 3P1MA 2KVRA 3VH4B 1UUPA 1V9JA 2MJ3A 2IO0B 2M1MA 2ZVNA 2ZPYA 2WU5B 2MCNB 3Q2AC 4IG7B 3PZ7A 2MSED 2B76B 3R7RA 3NOBA 4NJ7A 3Q69A 2KYWA 2IO1B 5L83A 3HUIA 1VCBA 1ZDXA 2MH7A 4URKA 2K22A 2ZCCA 1E7PB 4MSMB 3ZDMC 4GSWA 4MGKE 1NVID 1VZ8A 4YSYB 2L76A 2XK5B 2KHWB 4HDOA 1BUIC 2H89B 4C00A 4TSSA 4DXFA 4EZJA 3RNBC 3N1ZC 3TEZA 1UH6A 3ZJVA 4W9GA 3A33B 1ZPSA 3RMKC 4RGTA 2M8SA 4RMAA 1NI2A 2K39A 3B2GA 3V05A 1FNVA 1KTKA 2M17A 3AE5B 2O2VB 3RD2A 4B0EA 3MJWA 1YNTE 3IT6B 2WS3B 1ZDVA 1S1QB 2RMMA 2MJDA 2L1AA 2WXPA 4MGZE 2LHEA 3LYYA 2PMVA 2FIFA 4ZOHC 1VJKA 4DWFA 1YJ1A 2I2YA 3DBRI 1I4XA 3NY5A 4MH8A 1Q5WB 4G50A 5C1ZA 3OLMD 1R4MB 2AQ1B 3GB1A 4MACA 4W9LA 1P7EA 4ZRQA 3UIOB 2PIAA 1L4ZB 3ZRCA 3VUYA 4ZDVA 1C79A 2MW5A 1WXVA 4RF1A 2UYZB 2K6QA 3FKYA 4FHJA 2KX0A 4MJSB 3ZGZA 5G5GA 1NEKB 4GN1A 1D3ZA 4B6WA 2LGDA 2KN5A 2BS2B 4C7YA 2LFIA 4GOCA 4IDIA 4OVZA 1HXYD 2LVOA 3B0AA 2JZZA 3DOWA 2WXJA 1D5XC 1T0YA 1L4DB 2JVCA 1YQ3B 4KSKC 3O13A 4FA6A 3SDLC 3TEXA 3RNAC 3ZNID 3BWUD 4FXCA 5AEKB 3KH0A 2Y5CA 1P98A 5IA7A 3QARA 4L23A 4NZLB 1C4PA 1UELA 4XWTA 2NR2A 2KDFB 3CSFA 3RUIB 1V97A 1JROA 1JQ4A 4XWWA 3H7PA 3B9JA 5IO9A 1F1HA 5BMIA 4W9IA 2LMCA 4GDKA 1QF6A 1NI3A 3DHGC 1K53A 2VH1A 4W9KA 2RPVA 2QJLA 2K6DB 1WJ6A 1T5XD 2ACZB 2B3AA 2PEAA 5CX3A 4HDQA 3TEYA 5TR5A 5AZHA 2N1VA 1LGRA 2XEWA 1TIFA 1SJED 3C19A 4XDCA 5IP4D 1DOXA 1N6ZA 2LGYA 5EE1A 3E9SA 1RLFA 2GBRA 2INCC 4N58A 4I6PA 3WAPA 1UGJA 4BBNF 2W82A 4IM2A 2XK5A 2JYTA 1X1MA 2KTRB 1C1YB 3IAS1 1FPYA 3FILB 1H8CA 5BYQA 3L54A 3VRBB 4GU2A 2C7HA 1L5PA 1HEZE 3PZDA 3AH7A 4KDIC 2N9KA 4L2YA 2DYOA 2N9PC 2RD0A 2N7JA 1IP9A 4I6NB 2DX5B 2O2VA 3APDA 4GMVA 3DVGX 2MLBA 1PUTA 1WZ0A 4DHZB 4YWGG 3PV1A 3AE7B 1MG8A 5HI1A 2M0XA 5G5HA 2BYFA 2E6XA 3CF6E 4NY0A 3M63B 3DVGY 3CSTA 1VRAB 3PT2B 2LWPA 1GTEA 1WX7A 5JXVA 2IO2B 2N9EB 4JE3B 2UU7A 2WHIA 2LGXA 1PYWD 3N9YC 4YTNB 1GTHA 2AQ2B 2QMTA 4MJSA 3GE8C 3MHZA 3WAOA 1GC6A 2JU6X 3RNEC 1LFDA 4K3CA 1NDDA 2R2OA 1TS3A 2LEKA 3UIPB 2BKRB 2D11A 3BVGA 4NPNA 4FN2A 1XCQL 4F8CB 3JVZX 1LXDA 3LJ3A 1FFVA 2D3AA 2M0AA 2KKCA 1C76A 1PGBA 3Q8CA 2LASA 1E7UA 2BB6A 3VDZA 1JWUD 4NAMA 4IM3A 2FCMA 3GS2A 2OOBB 2JRHA 4JWSC 1SE9A 1FMAD 5H92C 3KVFB 4BKSD 2BWES 2CKHB 2O6VD 2RGFA 3OWEB 2KZRA 1F77A 1YQBA 1WGDA 5LNK1 3RYTA 1XLOA 3T3OA 2ONQA 3BIID 2CJNA 4A3PA 3V60A 3Q6BA 2JWZA 4II3B 2OHFA 2M56B 3NVWA 2KFKB 3T3NA 4ICUA 2CU1A 1HE8A 2LHDA 4A6QA 1YX5B 2WXFA 1F52A 2RDGA 2K5PA 4DQOC 4B95A 3GOEA 2PTLA 4ANVA 1E0ZA 2E3TA 3SFEB 4XE0A 2KX3A 1SSNA 3FILA 4C4VB 4W9JA 4KKIA 2HDEA 1FNWA 1R4MI 2IY1B 4YTMB 4G0NB 3IHPC 1PGAA 1EWYC 3N1XC 1WM2A 2KN4A 1JRPA 2KWCA 1VZ6A 1FXTB 1N5WA 2BYVE 2Z59B 3Q8FA 4NJCA 2L00B 3QX1A 2IDYA 2MBBB 1TZ1A 2L05A 4KGSA 1E8ZA 2O6VB 2WNMA 3RNFC 2JZ3B 4A90A 4PK1A 2REXA 1Q1OA 1TKEA 2ZVOA 3TSSA 1RAXA 1E8XA 2GB1A 2QSDA 1C4AA 4LNFA 2DZMA 3SD5A 2L7RA 2LZ6A 3EC8A 1KRHA 4N9F4 3W2DA 1JW9D 1TY0A 2IZVB 1AWDA 1J0GA 4RM9A 4ACFA 3VR9B 2YLMA 3AM9A 4TMAB 3Q8AA 1XQQA 2IGGA 1XLNA 2RSUA 2DBYA 3P4PB 2D10A 5KHOA 2LRWA 2NBVB 4JGHB 2WDTB 3D32A 4RF0A 3EA6A 2DZJA 2L0TA 3N30A 1VDVA 1N62A 5FR3A 2KQSA 2WP9B 1FFUA 3LXFA 1UZXB 4TUUA 2G3QB 1LO5D 3JSVA 3SFDB 1V5TA 3IXSA 5HG2A 3UF8A 2BS3B 2FCSA 3MC9A 1B9RA 2AWTA 4YT0B 3SHQA 4AJYB 4QAYA 4BOZB 2ZNVC 1EO6A 3DVNU 3Q3JA 2L83A 3JYUA 4P7IA 3NHEB 2ICIA 1IPGA 4LLGM 4UDUC 4HXDA 4ARIA 4GIVA 4S0RA 3PPAA 1ET6A 4N59A 4FBJB 2KNBA 2MRPA 2Z0EB 1F9JA 1PQSA 2I38A 3NS8A 4WWPA 3ZRFA 2X8XX 2L3ZA 2DYMA 1JWAD 4KGTA 3C8YA 4FJYA 1WWTA 3RN9C 3AECB 1WR6E 2FAZA 3P63A 2LJ5A 3ZW3A 2ZW0A 4WWOA 3ENEA 5IKCM 1K8RB 2JSVX 2KFKA 4YL8A 1T6BX 1N63A 3TUOA 2RR9A 1MI0A 2MX2A 1OEYA 1CZPA 3L4PA 2BS4B 3ZNHB 1CK1A 2TSSA 3PVLA 3NZ3A 4JX1C 4W9HA 1FD6A 1OTRB 1ZGUB 3U52E 1XO3A 3K9OB 1AYFA 2KWUB 2EELA 2BKFA 3C0RB 5D3IB 2MP2B 4C4VA 4P1BC 1UF0A 5J17A 3RFZB 3S2AA 4ITKA 4ANXA 1RRBA 3L0WB 3AN1A 1NBFC 2N7DA 4HLEA 1HZ6A 1GJZA 4X57B 1ZOYB 3AEDB 4ICVA 1L6VA 4WAFA 4IWOA 2PJHA 4RCOA 1GB1A 3PS6A 4E71A 3W1SA 4KKJA 4BKSA 2JQRB 5G2NA 2O6VA 4IOIE 3AMZA 3U2SC 4KV2A 3DHHC 3AU5A 3PRZA 1NENB 1A70A 3ML9A 3QIJA 1GUAB 2DYBA 2IY0B 4OZBA 4W9DA 4YSZB 4EUTA 4FHKA 2LVPA 5HHDG 2EKIA 2WWZA 1R4NB 4J6IA 3ML8A 3N1YC 3H9DA 2KLGA 4ZRPA 3VVWB 2G45B 2C7NB 2I1KA 3TMPB 1MJDA 1WY8A 3W1YA 4LTUA 1B1ZA 3A4RA 3UINB 3UGBB 3VTVA 2KANA 4ZRJA 1TS5A 4YTPB 3KWLA 2D2QA 3I5JC 4USAA 1F2RI 3VTWA 3B2FA 2V3NA 1JWBD 3RNCC 2EMTA 1D4BA 2K3UA 2D3CA 1EWCA 1SBBB 3ZDTA 3NG0A 2RDHA 1KLUD 3R8BA 4PYUA 2WYQA 2FBWB 2FCQA 2PE6B 2OJWA 2BT6A 5DPWA 3QK0A 1E9MA 1L0YB 1YX6B 3CWIA 1QKZA 2BB5A 1BMLC 4GDLB 3ETRA 1QOGA 4A9AA 2Y3AA 1SF0A 3FC4A 2AYOB 2KMMA 4BKTA 5IOIA 4B0MA 2XNAC 1FXAA 4KZCA 2MA9B 3SR6A 3Q3OC 2GBMA 3MFGA 4BOSC 3HIZA 4II2B 2LGSA 1J7CA 2PVOD 5MPOA 1TTNA 2LUEA 5T8IA 4PS8A 1H7WA 4EEWA 2C5LC 2HE7A 4HRSA 1WFYA 1RFAA 1SB3C 2MHJA 5DPTA 1LM8B 5GXGB 1LQBA 4NAWB 2NBWB 2KXJA 3DDCB 3HRDD 1RWSA 4JL9A 3ZVVA 1HA5A 3DBSA 4DDID 1P3QU 2K0PA 2ZPNA 5FKAC 2FCNA 3R66C 4NQLB 5H8YE 3PRMB 1ACCA 4ANWA 2W9NA 1EU4A 3GZNB 2MP2A 2IGDA 1JMLA 2JXXA 4HEA1 3W5UB 1SIFA 4WJOA 2JZPA 1WGRA 4E3CA 3APCA 1WXQA 2KMAA 3WAMA 3NUHB 3MP9A 5EDSA 3H1UA 2Z0DB 2KJHB 1YJIA 1GOZA 1H7XA 4M8MA 5DPSA 2V4LA 3TIXA 1WRIA 4AS1A 4IWQA 1ENFA 3A9JB 5C2TB 2MBEA 3RZFA 1UWXA 1EF5A 1WYWB 2GRIA 2DHZA 1G6JA 1VR9A 4EFOA 4IWPA 3PSEB 2QEJC 4I6LB 3OAWA 2QIEB 3ABVB 2WXNA 1E5WA 1V86A 1TT5B 1YD8U 3IG3A 3N32A 2K8BA 3PHXB 1OFFA 2LUMA 1I4QA 1STEA 4JQWC 2PW9A 1L2NA 2CS4A 1ET9A 3AE1B 2GBJA 2CHZA 1UNSA 1Y56A 5HKHA 4DXGA 2A4ZA 1WZ3A 3ZNZB 2M4NA 4YXDB 3KQ4A 3U4EG 4EKUA 3NJTA 1D6EC 1V5OA 1EF1A 2V3SA 3ZXRA 3CIRB 2MQJA 4WWMA 2WGSA 1XF5L 3EECA 3FAHA 4A8XC 2D3BA 1WSPA 1ISNA 2UWQA 1E8WA 4OVVA 3ZXVA 1YN3A 3PLUA 1L0VB 4RGOS 1KOTA 1WR1A 3QC8B 3A9KB 4IW0A 2QC8A 3M62B 5BMGA 1KF6B 1UWMA 4GDLA 2GOWA 1CJEA 1C77A 3N3KB 2V0GA 1KFYB 1RYJA 3PRPB 4OZAA 1MPEA 3OJ3A 1I42A 4Q2JA 3QAQA 2GLSA 4L1BA 3T9LA 1SEBD 5DCNA 3IFWB 2LXAA 3V6CB 2LXCA 2OEDA 4EZKA 1ZW7A 4JPSA 1WRDB 1JWSD 3JW0X 2G4SA 1K50A 2BF8B 2CHWA 3U8ZA 1FCLA 2OJRA 2WDVB 2K25A 1Q10A 4MT5A 2BQQA 1QLBB 2MBOA 4NAWA 1HTQA 4FJZA 3VQIA 3NRZA 3L13A 5CHFA 4CQNA 3AEEB 4BKGA 2K1FA 3DWGC 3HM6X 2VRRB 2MBQA 4F1SA 1XD3B 2LVQA 5C23A 3W9CB 1WF9A 3SU8X 1IBXB 4HKQA 3I9V1 1WH3A 1R4NI 3R2TA 1FO4A 2SEBD 2CR5A 4G3XB 1RFKA 1SE4A 4K1RB 1ESFA 4M02A 2WXKA 3ZTCA 4MH0E 1S3SG 3WANA 2Y5PA 1JRUA 1SE3A 2NBUA 4DBGA 1MG4A 2BVCA 2KTRA 1OQYA 1V2YA 2G9HD 5J18A 1ROEA 3TCAA 5E6PA 5D3DA 2JX5A 4P1CC 3A9JA 4EOYA 1QT9A 2YEPF 4TQ0A 3M95A 5FR6A 4DDGD 1V8CA 3AEGB 2DZIA 4KIKB 1ZXIA 3GE3C 4ZRKA 3AXCA 1E7VA 2W3RA 2L32A 2L52A 4IM0A 4B9KA 3L16A 3UQAA 2IBIB 4PS7A 4D2KA 4TV3A 4XZ4A 2KC1A 3EUB2 3VUWA 2C7MB 4KVGB 1F2RC 1WXSA 3QHTA 3VR8B 1V1PB 1P9DU 1P0RA 2ZCBA 2FUG1 3HK0A 1EM7A 3KUDB 3DBLB 5LXIB 2JWUA 2MBHA 3P2BA 2PVGC 2Q5WD 4M0WB 3VHTC 5LLIA 2KDIA 2LI5A 1FIQA 4ZYSA 2DZKA 1H4RA 3AEAB 1TZOA 1ZE3D 2KMCA 3M3JA 2FUHB 4WQOB 2AQ3B 2H88B 2I1JA 3ZIMA 2INDC 2J42A 3IBEA 3AB5A 1Q0WB 4H2AA 3ONSA 4MEMA 5AZFA 4DXAB 3TBLD 2GBNA 4NQKE 3AE9B 3ZQ4A 3A9KA 1KM7A 1CQVA 4LJOB 3VAWA 3DBHB 2NTSA 1WM3A 5D2MB 3W5VB 3VH3B 3DWMA 2KD0A 3A4SC 4C80A 2J0JA 4HKZE 3L08A 4RGMA 4BFRA 2ASQA 1J19A 3GZNI 4RGNA 2DWQA 2KLCA 3R2IA 5IAAC 3W1SC 2FNJB 4XGAB 4C7ZA 4MSQB 3WA0A 1NYQA 3I57A 3URYA 1XXGA 1WE7A 2QILA 4AP4C 1M94A 4MGYE 5D6JB 1WX9A 3U7DA 4OZCA 4F7ZA 4W9CA 1QZEA 2KACA 4GB9A 2JXTA 5HFYA 3VRAB 1MFWA 1U4AA 2WU2B 3KW5B 3HVDA 2HJ8A 5EE9A 4AQ7A 1IBXA 1RM6C 4XDDA 2GI9A 1PDXA 2KJ6A 2CHXA 2PLPA 2KT7A 4N6EB 4LCDE 4M01A 4HPLB 4HCPB 4LK0M 4K7WA 1OGWA 3DQVA 3NVVA 2R2QA 3K9PB 3U30A 2BPSA 1D5MC 1XCTL 3LB8C 2BYTA 4IKGA 4KIKA 4A3OA 3R3MA 2VZKD 3AEFB 2LRUA 1UBIA 3GP7A 2KFJA 2K8CA 3NVYA 3U7ZA 3L17A 2KWDA 3PREA 2KAJA 2IYDB 2MEKA 1I4GA 2IGHA 4WWNA 3A1QB 3BY4B 2J0KA 2JT4B 1FRDA 1OEYJ 1WE6A 1V1PA 1WI0A 3H7SA 2N4FA 4OHJA 1IGCA 1YIWA 1A5RA 2JYEA 2ZEQA 2C60A 3MTNB 2QCZA 4HVBA 2W54A 4GXBA 3EFCA 4M0WA 2WDQB 5D94A 1C3TA 2RPQA 4C56C 2BTEA 1HTOA 1SIJA 5G55A 2HD5B 1HQRD 1FM0D 3ZUNA 3ZJTA 2W55A 2NTTA 5EE3A 1E6EB 3IT4B 4LNIA 3HHMA 4TKNA 1BT0A 4WIPA 2CU3A 2KQ4X 4DHZE 3LDZE 2PPHA 1QOFA 1OQQA 4IUMB 3KLSX 3IVFA 4ARCA 1M4VA 4IC7B 2RDBC 1I7HA 3Q8BA 3AE4B 1ZUD2 1YMHE 4WJQA 1TKGA 1V80A 4LNNA 1T0QC 2VZKB 2YVCA 4P16A 1MVKA 1QOBA 4PS3A 3KUZA 3BYTB 1T3QA 1Y8RC 3H6NA 3L10B 2J7QB 2WXGA 3V61A 2M19A 1GC7A 1YOVB 3DHIC 2W3SA 1GAQB 3P4QB 1SE2A 2VH2A 4K81A 1GG3A 4WURA 3KWVA 3PLVA 1L6UA 1FRRA 2L8JA 1F0ZA 2MWSB 3Q8EA 2WXQA 4TQ1A 3NS1A 4FADA 1IGDA 3RULA 4ASWC 4MGIE 1JCKB 1XEEA 2XN9C 5EE0A 2DENB 1EUVB 5IN7A 2WX0A 2WLBA 1QILA 2WXHA 2DLBA 3RZWC 3VTUA 5AZGA 1KJTA 3QWZB 3P42A 2K8HA 3AE6B 1TYGB 3V3XA 1FEHA 2QDFA 3KUCB 4E74A 1YJJA 5JH5C 2AEHA 4FJVB 3DVNV 3DBLI 3MC8A 1SJHD 4ZHOA 3ZNGC 2J53A 2EMSA 1WIAA 2DNFA 1ZXHA 1VZ7A 2G4DB 5I4DA 5BO4B 3Q3MC 2AL6A 3RPFC 1BXTA 1E8YA 3BK1A 1WMHB 1C9FA 1WXMA 4WQMA 1WJNA 3NZSA 4MDKE 1WGKA 4XC2A 1IYFA 4LDTD 3WCQA 3QCAA 2R61A 1YN5A 3AU4A 5DPRA 3R7QA 1JALA 3A1QA 4MM3B 4LNKA 3B08A 2FE8A 2BYEA 4P6VF 2QHOA 3MC0B 4W9EA 3APFA 1UD7A 1L0XB 3DBHI 1HZ5A 2INPE 3V6EB 1XLPA 3E56A 4M00A 2WX1A 3CMMB 2DAFA 2N9LA 4WJPA 2LGIA 3VXWA 2J0MA 1N5XA 2HTHA 4JWUC 4ZHPA 1N61A 1WYGA 2N0SB 4OVUA 4XX5A 4KZ0A 4GGQA 2KDBA 1VLBA 3VFKA 4RM8A 2NVUI 2KDMA 3QJZA 5JHAA 3O65B 3NVZA 3BYYB 4HWIB 2IO3B 3QA8A 4O1NA 4BZAA 4FULA 2A5UA 2JF5A 1T0RC 5BMHA 1MHXA 2D3GA 1WGYA 3KYDD 1AARA 1TKYA 4LDTB 4EE2A 4K7SA 1GT8A 1KH0A 3T8MA 5JZEB 2IJ0A 1TS4A 3X0WA 2BGFA 3PZ8A 2FIDA 2GMIC 4AWJA 4J3OD 2INNE 2DAJA 5GMVA 1WGHA 1UBQA 3OJ4B 3Q3FA 1C78A 3SEBA 3JSVB 4BAXA 2BW2A 4BBNC 2N7EA 5TSSA 3PTFC 3I3TB 4R3DA 2D07B 1YN4A 1FCCC 1QOAA 2J52A 4CHKA 3AE8B 2NCNA 2ZZPB 2HJ1A 5C3JB 3I63C 1C4CA 1ZKHA 3HVZA 5KHQA 3Q14C 3PHWB 4GLSC 3V62A 1Z2MA 3CF4A 3DPDA 5L95C 2PE9A 1WGGA 2C9WB 2J4XA 3Q3NC 4WJNA 4REZA 5E6NA 2N1WA 1J8CA 3DBRB 4M8NA 2KK8A 3P4RB 3TJPA 2EKEC 3PGEA 1V6EA 2CJOA 2V9HA 2K9XA 5CTRC 4HCNB 3VUXA 2HTME 3BINA 4DK5A 4OW0A 5LXHA 2NS5A 3OG5A 3QQ8B 3ZLZA 4DHJD 2IPKD 2ZW1A 1WMHA 3RCZA 3MJ5A 2NPTB 4HK2A 4G11A 2LD9A 4EZLA 3TEWA 3AI5A 1P1AA 4KSLC 3EGRA 4ANUA 1E90A 3ZYYX 3ALBA 4K3BA 2XBBC 2Z8LA 2PKOA 2KTFA 4RH6A 1K51A 1I35A 4HJGE 1AN8A 4MM3A 2MJEA 2WXMA 4US8A 4S17A 4CO7A 1TJEA 3BVMA 1TGZB 4YSXB 1YQ4B 2ZNVB 2D5GA 3AEBB 1I4HA 2JUOA 4KX6B 2KDEB 2YEPB 2AL3A 3KYCD 4JLCA 5CHVC 2KQ7A 4KDLB 2V4IB 2KJRA 3N20C 3ZJUA 1SGHA 1Z5SB 2V1YA 3ZO5B 4RFBA 1GNUA 4K7UA 5JHBA 4CYEA 3RNGC 5E6OA 2NMQA 2WXRA 2KOXA 4PYZA 3WIMA 3ZTDA 4JIOU 4AOFA 5CHWA 2WQYB 3BVZA 1MHHE 1DOIA 1KLGD 1CMXB 2SAKA 4HJKA 3UQBA 1QQRA 1EU3A 2KO3A 3HM3A 4FLHA 3H8HA 1IUEA 3TL5A 1DGJA 5AUIA 2G1EA 4DHJB 1L7YA 2KVZA 2Y5BB 5FK9C 3RI7C 2X38A 4BVUC 2GBKA 1GPXA 1J7BA 1VD2A 3AV8A 4HROA 4LNOA 1I4RA 4KGRA 2JPHA 1T0SC 3AULA 1XT9B 4HPPA 1V1OA 3IAM1 1WXAA 1FNUA 3BZDB 2WXLA 4HPMB 3NZUA 2L0FA 4LJPB 4NJ6A 1NYRA 2ON8A 3DCGA 5BYSA 1R7SA 4A20A 1KLVA 2KWVB 4W9FA 1GB4A 1WJUA 1ZP0B 1PGXA 2WXIA 3B1LX 4PT5A 3AE3B 4AJWA 2V3PA 3MHSD 3EHVA 3X23A 1J7AA 1JWMD 3EFUA 3UI3A 1I4PA 3BK2A 1V81A 3PO0A 5AUKA 1E10A 5E6JA 4XYCA 5J2RA 3ECIA 1WX8A 1UGMA 5BYRA 1XLQA 4RNAA 4AUQC 1D5ZC 3RT3B 2JRIB 1WJ4A 2AX5A 5D7GA 1P7FA 4MELA 3AE2B 4ZYNA 1DYQA 1K52A 2WXOA 4WH4A 2JY6A 2KC2A 2LJIA 1TBEA
chains in the Genus database with same CATH topology
1T3QA 1TS2A 4YTMB 2WDRB 2BBCA 2WXGA 1DOYA 1PGAA 2M19A 3P4SB 1EWYC 1PFDA 2W3SA 4YXDB 3P4QB 1GAQB 3KQ4A 3J9CA 1SE2A 3U4EG 2KN4A 1OQRA 1AW7A 1D6EC 1JRPA 1N60A 1TY2A 4A55A 1VZ6A 4WURA 1N5WA 3Q8FA 1FXIA 1SXTA 4US9A 3CIRB 4NJCA 3KWVA 4GDKB 1L6UA 2IDYA 4WWMA 1FRRA 1XF5L 1F0ZA 3P1MA 3FAHA 4A8XC 3Q8EA 4KGSA 2WXQA 1UUPA 1WSPA 2WNMA 2MJ3A 4TQ1A 3NS1A 1IGDA 2WU5B 4A90A 3PZ7A 1TKEA 2B76B 1YN3A 3TSSA 1L0VB 1JCKB 3Q69A 4RGOS 1XEEA 2XN9C 5EE0A 2GB1A 2QSDA 1C4AA 1KRHA 3W2DA 5BMGA 1JW9D 1KF6B 1UWMA 3HUIA 1ZDXA 1QILA 2WLBA 1TY0A 2DLBA 2MH7A 2WXHA 2K22A 1E7PB 1AWDA 1CJEA 3VR9B 3AM9A 4TMAB 1C77A 3Q8AA 3P42A 2V0GA 1KFYB 2IGGA 1XLNA 1RYJA 3AE6B 4OZAA 1NVID 1TYGB 2DBYA 1MPEA 1VZ8A 4YSYB 3P4PB 3V3XA 1FEHA 1BUIC 2H89B 4Q2JA 4TSSA 4DXFA 1YJJA 4L1BA 3TEZA 4RF0A 1SJHD 4ZHOA 1SEBD 3ZJVA 3EA6A 2J53A 1VDVA 1N62A 5FR3A 1ZXHA 1ZPSA 2WP9B 1FFUA 1VZ7A 3LXFA 4RGTA 2OEDA 5I4DA 3B2GA 3RPFC 1BXTA 1LO5D 4JPSA 3V05A 3SFDB 3BK1A 3IXSA 5HG2A 1FNVA 1KTKA 1JWSD 1C9FA 4WQMA 1K50A 3AE5B 2BS3B 1WGKA 4B0EA 1B9RA 1FCLA 3WCQA 1YNTE 2WDVB 1Q10A 3IT6B 4YT0B 1ZDVA 2WS3B 4MT5A 2R61A 1QLBB 1YN5A 2RMMA 2MJDA 2L1AA 3VQIA 2WXPA 3NRZA 2LHEA 4CQNA 3LYYA 3AEEB 2L83A 2PMVA 3DWGC 1JALA 4ZOHC 4MM3B 1VJKA 2FE8A 2ICIA 4P6VF 3W9CB 4LLGM 3MC0B 4UDUC 1IBXB 2I2YA 4HKQA 3I9V1 4ARIA 1L0XB 1I4XA 1HZ5A 2INPE 3R2TA 1ET6A 1FO4A 2SEBD 4MH8A 4N59A 1RFKA 2AQ1B 1SE4A 1ESFA 3GB1A 1XLPA 4MACA 3E56A 2WXKA 2I38A 1P7EA 4ZRQA 2Y5PA 2N9LA 2PIAA 1SE3A 2LGIA 1L4ZB 1C79A 2DYMA 1JWAD 4KGTA 1N5XA 4RF1A 3C8YA 4JWUC 4ZHPA 1N61A 2G9HD 1WYGA 1ROEA 1WWTA 3ZGZA 5D3DA 3AECB 2JX5A 2N0SB 1NEKB 5G5GA 3P63A 1QT9A 2YEPF 2ZW0A 1VLBA 4TQ0A 1V8CA 3AEGB 2JSVX 1ZXIA 2KDMA 2BS2B 4C7YA 1T6BX 3NVZA 2LFIA 4IDIA 1N63A 3BYYB 2W3RA 1HXYD 4OVZA 3TUOA 2L32A 2WXJA 1D5XC 1MI0A 2L52A 4O1NA 1L4DB 1YQ3B 5BMHA 3O13A 4D2KA 1CZPA 3L4PA 2BS4B 1MHXA 1CK1A 2TSSA 1TKYA 3TEXA 3EUB2 4EE2A 3NZ3A 1GT8A 3BWUD 4JX1C 4FXCA 1FD6A 1F2RC 1KH0A 3U52E 1XO3A 2IJ0A 1TS4A 3VR8B 2Y5CA 1AYFA 1V1PB 2EELA 3PZ8A 5D3IB 4L23A 4NZLB 1C4PA 4XWTA 2FUG1 3RFZB 1EM7A 4ITKA 1V97A 4J3OD 2JWUA 2INNE 3AN1A 1JROA 1JQ4A 2PVGC 4XWWA 2Q5WD 1HZ6A 3B9JA 1C78A 1ZOYB 3SEBA 2BW2A 3AEDB 1FIQA 4ZYSA 5TSSA 5BMIA 3AEAB 1TZOA 1L6VA 4WAFA 1ZE3D 2LMCA 4R3DA 1YN4A 1FCCC 1QF6A 1QOAA 2J52A 1NI3A 4RCOA 1GB1A 2AQ3B 3AE8B 3W1SA 4KKJA 2H88B 2JQRB 5C3JB 1K53A 4IOIE 1C4CA 3HVZA 2RPVA 2J42A 2QJLA 3AMZA 3U2SC 3AB5A 4H2AA 1T5XD 2ACZB 4GLSC 1NENB 1A70A 3TEYA 3CF4A 3AE9B 3ZQ4A 4OZBA 2J4XA 1SJED 4YSZB 4REZA 4XDCA 1CQVA 1DOXA 2NTSA 5HHDG 3P4RB 2EKIA 5EE1A 3W5VB 3E9SA 2CJOA 3DWMA 4N58A 4ZRPA 4C80A 1UGJA 2K9XA 4HKZE 2W82A 4RGMA 2JYTA 3IAS1 4RGNA 3FILB 2DWQA 2HTME 3R2IA 4LTUA 1B1ZA 5BYQA 4OW0A 3VRBB 4C7ZA 1L5PA 1TS5A 4YTPB 1HEZE 3AH7A 3KWLA 2N9KA 1NYQA 4L2YA 4USAA 2DYOA 1F2RI 3I57A 2N7JA 3B2FA 2V3NA 1JWBD 3URYA 1XXGA 2IPKD 2QILA 2ZW1A 1D4BA 2K3UA 3MJ5A 1EWCA 3TEWA 1SBBB 4OZCA 1PUTA 2RDHA 3EGRA 1KLUD 3R8BA 2KACA 2JXTA 4YWGG 3ZYYX 2FBWB 5HFYA 3AE7B 2Z8LA 2PKOA 4RH6A 3VRAB 2BT6A 1K51A 5HI1A 4HJGE 1E9MA 1AN8A 1L0YB 5G5HA 2WU2B 2MJEA 2WXMA 3HVDA 4US8A 3CWIA 2E6XA 5EE9A 4AQ7A 1QKZA 1IBXA 1TJEA 3BVMA 1RM6C 2BB5A 1BMLC 4YSXB 4GDLB 4XDDA 3ETRA 1YQ4B 2GI9A 1QOGA 4A9AA 2D5GA 2Y3AA 1PDXA 3AEBB 1VRAB 1I4HA 2PLPA 4KX6B 2YEPB 1SF0A 3FC4A 4N6EB 1GTEA 2V4IB 2KMMA 5JXVA 3ZJUA 4JE3B 4LK0M 4B0MA 2XNAC 4RFBA 1FXAA 1PYWD 3N9YC 3SR6A 3MFGA 4YTNB 2NMQA 3NVVA 1GTHA 2AQ2B 2QMTA 2WXRA 3MHZA 1J7CA 2PVOD 1D5MC 1XCTL 5MPOA 2WQYB 3BVZA 5T8IA 2JU6X 1MHHE 1DOIA 1KLGD 3LB8C 1H7WA 2SAKA 2BYTA 4IKGA 1QQRA 1EU3A 1TS3A 2LEKA 4HRSA 3H8HA 1IUEA 2VZKD 3AEFB 1SB3C 3BVGA 3GP7A 1DGJA 3NVYA 3U7ZA 5AUIA 1XCQL 5GXGB 2G1EA 4NAWB 2KWDA 2KAJA 3HRDD 5FK9C 1RWSA 2MEKA 1FFVA 1I4GA 2IGHA 1HA5A 2X38A 2M0AA 2K0PA 1GPXA 1C76A 1J7BA 1PGBA 3AV8A 5FKAC 4HROA 3Q8CA 1I4RA 4KGRA 2BB6A 5H8YE 1FRDA 1ACCA 1V1PA 1EU4A 1JWUD 4NAMA 4OHJA 2IGDA 1V1OA 1IGCA 3IAM1 1JMLA 2JYEA 1FNUA 3GS2A 3BZDB 4HEA1 3W5UB 2WXLA 2JZPA 2W54A 4JWSC 1FMAD 5H92C 1NYRA 2ON8A 5BYSA 1WXQA 4M0WA 2WDQB 1R7SA 4C56C 2BTEA 3OWEB 1F77A 3NUHB 1SIJA 1GB4A 3MP9A 5LNK1 1XLOA 1HQRD 1ZP0B 1YJIA 3T3OA 1GOZA 1H7XA 1PGXA 2WXIA 1FM0D 4PT5A 3AE3B 2W55A 2V3PA 3ZJTA 2NTTA 1WRIA 5EE3A 2ONQA 4AS1A 1J7AA 1E6EB 1JWMD 1ENFA 3IT4B 3BIID 5C2TB 2CJNA 3UI3A 1UWXA 2GRIA 1VR9A 4WIPA 2OHFA 2CU3A 2M56B 3NVWA 1I4PA 2KQ4X 3BK2A 3PO0A 5AUKA 1E10A 3T3NA 4A6QA 2LHDA 5E6JA 1QOFA 1OQQA 3KLSX 2QEJC 2QIEB 4ARCA 1M4VA 3ABVB 2WXNA 2WXFA 2RDGA 5BYRA 2K5PA 1XLQA 4DQOC 4RNAA 1I7HA 3Q8BA 3AE4B 1ZUD2 1D5ZC 1YMHE 1OFFA 2LUMA 2PTLA 1I4QA 1TKGA 3BYTB 1STEA 1E0ZA 2E3TA 2PW9A 2AX5A 3SFEB 2VZKB 4XE0A 1ET9A 3AE1B 1P7FA 1SSNA 4P16A 5D7GA 3AE2B 1DYQA 1K52A 1UNSA 1MVKA 2WXOA 4WH4A 1QOBA 1Y56A 2LJIA 3FILA 4KKIA 2HDEA 4DXGA 1FNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7C A;  1T3Q A;  2PVO D;  4YTM B;  1NEN B;  2WDR B;  1A70 A;  2WQY B;  5MPO A;  1DOY A;  2M19 A;  3CF4 A;  3AE9 B;  1DOI A;  3P4S B;  1EWY C;  1PFD A;  3LB8 C;  1H7W A;  1FO4 A;  2W3S A;  4YXD B;  3P4Q B;  1GAQ B;  4N59 A;  4YSZ B;  1OQR A;  1RFK A;  1JRP A;  2LEK A;  1N60 A;  1XLP A;  4HRS A;  1N5W A;  1FXI A;  1IUE A;  1DOX A;  4US9 A;  3CIR B;  3AEF B;  3P4R B;  1SB3 C;  2EKI A;  5EE1 A;  1DGJ A;  1L6U A;  4WWM A;  1FRR A;  3W5V B;  1F0Z A;  2PIA A;  3NVY A;  3P1M A;  5AUI A;  5GXG B;  2G1E A;  2CJO A;  3DWM A;  4N58 A;  3FAH A;  2KAJ A;  4C80 A;  2K9X A;  3HRD D;  1JWA D;  1RWS A;  1N5X A;  1FFV A;  4JWU C;  2MJ3 A;  4ZHP A;  3NS1 A;  1N61 A;  2DWQ A;  2HTM E;  2WU5 B;  1GPX A;  1J7B A;  1WYG A;  3AV8 A;  1ROE A;  4HRO A;  1WWT A;  1TKE A;  2B76 B;  4LTU A;  3AEC B;  2JX5 A;  2N0S B;  1NEK B;  5G5G A;  5H8Y E;  1FRD A;  1L0V B;  3P63 A;  1QT9 A;  3VRB B;  4C7Z A;  5EE0 A;  1VLB A;  1L5P A;  4YTP B;  3AH7 A;  3KWL A;  1V8C A;  3AEG B;  1KRH A;  1NYQ A;  4USA A;  3W5U B;  1JW9 D;  1KF6 B;  1ZXI A;  1UWM A;  2W54 A;  3B2F A;  1JWB D;  2BS2 B;  2WLB A;  2MH7 A;  3HUI A;  1FMA D;  4JWS C;  2K22 A;  3NVZ A;  5H92 C;  4C7Y A;  1NYR A;  1E7P B;  1AWD A;  1WXQ A;  1N63 A;  2WDQ B;  1CJE A;  1R7S A;  2W3R A;  3VR9 B;  4IDI A;  3AM9 A;  2L52 A;  1KFY B;  1YQ3 B;  1RYJ A;  1XLN A;  3AE6 B;  1SIJ A;  1NVI D;  1TYG B;  2DBY A;  1CZP A;  3L4P A;  4YSY B;  3P4P B;  2BS4 B;  1PUT A;  1ZP0 B;  1XLO A;  1YJI A;  1H7X A;  2H89 B;  1FM0 D;  1TKY A;  3AE3 B;  2W55 A;  3EUB 2;  3ZYY X;  2FBW B;  1GT8 A;  1WRI A;  1YJJ A;  5EE3 A;  4JX1 C;  3AE7 B;  1J7A A;  1E6E B;  2PKO A;  4FXC A;  1XO3 A;  3VRA B;  2BT6 A;  5C2T B;  2CJN A;  2Y5C A;  3VR8 B;  3BII D;  1AYF A;  4ZHO A;  1E9M A;  1VDV A;  1N62 A;  5G5H A;  2WU2 B;  2MJE A;  2OHF A;  4US8 A;  2WP9 B;  1FFU A;  2CU3 A;  2M56 B;  3CWI A;  3LXF A;  3NVW A;  4ITK A;  5EE9 A;  1V97 A;  3PO0 A;  5AUK A;  1E10 A;  1TJE A;  3B2G A;  1RM6 C;  3AN1 A;  3RPF C;  1JRO A;  1QOF A;  4YSX B;  1OQQ A;  1JQ4 A;  2PVG C;  1YQ4 B;  3ETR A;  2Q5W D;  3SFD B;  2QIE B;  1QOG A;  3W9C B;  3B9J A;  3ABV B;  4A9A A;  1ZOY B;  4WQM A;  1PDX A;  3AE5 B;  2BS3 B;  1WGK A;  3AEB B;  3AED B;  2K5P A;  1B9R A;  4KX6 B;  1FIQ A;  1XLQ A;  1SF0 A;  3FC4 A;  1I7H A;  4N6E B;  3WCQ A;  2WDV B;  3AE4 B;  3AEA B;  1L6V A;  1GTE A;  4YT0 B;  2WS3 B;  1OFF A;  1ZUD 2;  1TKG A;  1QOA A;  1QF6 A;  1NI3 A;  2KMM A;  2E3T A;  1E0Z A;  3AE8 B;  1QLB B;  2AX5 A;  2H88 B;  3SFE B;  2MJD A;  2JQR B;  3AE1 B;  3NRZ A;  3AE2 B;  5C3J B;  1FXA A;  3AEE B;  2L83 A;  3HVZ A;  3AMZ A;  2QJL A;  3SR6 A;  4YTN B;  1JAL A;  1QOB A;  3DWG C;  4ZOH C;  3NVV A;  1VJK A;  1GTH A;  3AB5 A;  4P6V F;  2ACZ B; 
#chains in the Genus database with same CATH topology
 3ZKJ C;  1TS2 A;  2WDR B;  2BBC A;  4WAA A;  1DOY A;  4NNJ B;  3P4S B;  1PFD A;  3H7P B;  2ZJD A;  1V49 A;  3J9C A;  2BWF A;  2N9X A;  4ZRI A;  1OQR A;  1AW7 A;  1TY2 A;  4A55 A;  1N60 A;  1FXI A;  1SXT A;  4US9 A;  4GDK B;  2NPT A;  3WAL A;  3P1M A;  2KVR A;  3VH4 B;  1UUP A;  1V9J A;  2MJ3 A;  2IO0 B;  2M1M A;  2ZVN A;  2ZPY A;  2WU5 B;  2MCN B;  3Q2A C;  4IG7 B;  3PZ7 A;  2MSE D;  2B76 B;  3R7R A;  3NOB A;  4NJ7 A;  3Q69 A;  2KYW A;  2IO1 B;  5L83 A;  3HUI A;  1VCB A;  1ZDX A;  2MH7 A;  4URK A;  2K22 A;  2ZCC A;  1E7P B;  4MSM B;  3ZDM C;  4GSW A;  4MGK E;  1NVI D;  1VZ8 A;  4YSY B;  2L76 A;  2XK5 B;  2KHW B;  4HDO A;  1BUI C;  2H89 B;  4C00 A;  4TSS A;  4DXF A;  4EZJ A;  3RNB C;  3N1Z C;  3TEZ A;  1UH6 A;  3ZJV A;  4W9G A;  3A33 B;  1ZPS A;  3RMK C;  4RGT A;  2M8S A;  4RMA A;  1NI2 A;  2K39 A;  3B2G A;  3V05 A;  1FNV A;  1KTK A;  2M17 A;  3AE5 B;  2O2V B;  3RD2 A;  4B0E A;  3MJW A;  1YNT E;  3IT6 B;  2WS3 B;  1ZDV A;  1S1Q B;  2RMM A;  2MJD A;  2L1A A;  2WXP A;  4MGZ E;  2LHE A;  3LYY A;  2PMV A;  2FIF A;  4ZOH C;  1VJK A;  4DWF A;  1YJ1 A;  2I2Y A;  3DBR I;  1I4X A;  3NY5 A;  4MH8 A;  1Q5W B;  4G50 A;  5C1Z A;  3OLM D;  1R4M B;  2AQ1 B;  3GB1 A;  4MAC A;  4W9L A;  1P7E A;  4ZRQ A;  3UIO B;  2PIA A;  1L4Z B;  3ZRC A;  3VUY A;  4ZDV A;  1C79 A;  2MW5 A;  1WXV A;  4RF1 A;  2UYZ B;  2K6Q A;  3FKY A;  4FHJ A;  2KX0 A;  4MJS B;  3ZGZ A;  5G5G A;  1NEK B;  4GN1 A;  1D3Z A;  4B6W A;  2LGD A;  2KN5 A;  2BS2 B;  4C7Y A;  2LFI A;  4GOC A;  4IDI A;  4OVZ A;  1HXY D;  2LVO A;  3B0A A;  2JZZ A;  3DOW A;  2WXJ A;  1D5X C;  1T0Y A;  1L4D B;  2JVC A;  1YQ3 B;  4KSK C;  3O13 A;  4FA6 A;  3SDL C;  3TEX A;  3RNA C;  3ZNI D;  3BWU D;  4FXC A;  5AEK B;  3KH0 A;  2Y5C A;  1P98 A;  5IA7 A;  3QAR A;  4L23 A;  4NZL B;  1C4P A;  1UEL A;  4XWT A;  2NR2 A;  2KDF B;  3CSF A;  3RUI B;  1V97 A;  1JRO A;  1JQ4 A;  4XWW A;  3H7P A;  3B9J A;  5IO9 A;  1F1H A;  5BMI A;  4W9I A;  2LMC A;  4GDK A;  1QF6 A;  1NI3 A;  3DHG C;  1K53 A;  2VH1 A;  4W9K A;  2RPV A;  2QJL A;  2K6D B;  1WJ6 A;  1T5X D;  2ACZ B;  2B3A A;  2PEA A;  5CX3 A;  4HDQ A;  3TEY A;  5TR5 A;  5AZH A;  2N1V A;  1LGR A;  2XEW A;  1TIF A;  1SJE D;  3C19 A;  4XDC A;  5IP4 D;  1DOX A;  1N6Z A;  2LGY A;  5EE1 A;  3E9S A;  1RLF A;  2GBR A;  2INC C;  4N58 A;  4I6P A;  3WAP A;  1UGJ A;  4BBN F;  2W82 A;  4IM2 A;  2XK5 A;  2JYT A;  1X1M A;  2KTR B;  1C1Y B;  3IAS 1;  1FPY A;  3FIL B;  1H8C A;  5BYQ A;  3L54 A;  3VRB B;  4GU2 A;  2C7H A;  1L5P A;  1HEZ E;  3PZD A;  3AH7 A;  4KDI C;  2N9K A;  4L2Y A;  2DYO A;  2N9P C;  2RD0 A;  2N7J A;  1IP9 A;  4I6N B;  2DX5 B;  2O2V A;  3APD A;  4GMV A;  3DVG X;  2MLB A;  1PUT A;  1WZ0 A;  4DHZ B;  4YWG G;  3PV1 A;  3AE7 B;  1MG8 A;  5HI1 A;  2M0X A;  5G5H A;  2BYF A;  2E6X A;  3CF6 E;  4NY0 A;  3M63 B;  3DVG Y;  3CST A;  1VRA B;  3PT2 B;  2LWP A;  1GTE A;  1WX7 A;  5JXV A;  2IO2 B;  2N9E B;  4JE3 B;  2UU7 A;  2WHI A;  2LGX A;  1PYW D;  3N9Y C;  4YTN B;  1GTH A;  2AQ2 B;  2QMT A;  4MJS A;  3GE8 C;  3MHZ A;  3WAO A;  1GC6 A;  2JU6 X;  3RNE C;  1LFD A;  4K3C A;  1NDD A;  2R2O A;  1TS3 A;  2LEK A;  3UIP B;  2BKR B;  2D11 A;  3BVG A;  4NPN A;  4FN2 A;  1XCQ L;  4F8C B;  3JVZ X;  1LXD A;  3LJ3 A;  1FFV A;  2D3A A;  2M0A A;  2KKC A;  1C76 A;  1PGB A;  3Q8C A;  2LAS A;  1E7U A;  2BB6 A;  3VDZ A;  1JWU D;  4NAM A;  4IM3 A;  2FCM A;  3GS2 A;  2OOB B;  2JRH A;  4JWS C;  1SE9 A;  1FMA D;  5H92 C;  3KVF B;  4BKS D;  2BWE S;  2CKH B;  2O6V D;  2RGF A;  3OWE B;  2KZR A;  1F77 A;  1YQB A;  1WGD A;  5LNK 1;  3RYT A;  1XLO A;  3T3O A;  2ONQ A;  3BII D;  2CJN A;  4A3P A;  3V60 A;  3Q6B A;  2JWZ A;  4II3 B;  2OHF A;  2M56 B;  3NVW A;  2KFK B;  3T3N A;  4ICU A;  2CU1 A;  1HE8 A;  2LHD A;  4A6Q A;  1YX5 B;  2WXF A;  1F52 A;  2RDG A;  2K5P A;  4DQO C;  4B95 A;  3GOE A;  2PTL A;  4ANV A;  1E0Z A;  2E3T A;  3SFE B;  4XE0 A;  2KX3 A;  1SSN A;  3FIL A;  4C4V B;  4W9J A;  4KKI A;  2HDE A;  1FNW A;  1R4M I;  2IY1 B;  4YTM B;  4G0N B;  3IHP C;  1PGA A;  1EWY C;  3N1X C;  1WM2 A;  2KN4 A;  1JRP A;  2KWC A;  1VZ6 A;  1FXT B;  1N5W A;  2BYV E;  2Z59 B;  3Q8F A;  4NJC A;  2L00 B;  3QX1 A;  2IDY A;  2MBB B;  1TZ1 A;  2L05 A;  4KGS A;  1E8Z A;  2O6V B;  2WNM A;  3RNF C;  2JZ3 B;  4A90 A;  4PK1 A;  2REX A;  1Q1O A;  1TKE A;  2ZVO A;  3TSS A;  1RAX A;  1E8X A;  2GB1 A;  2QSD A;  1C4A A;  4LNF A;  2DZM A;  3SD5 A;  2L7R A;  2LZ6 A;  3EC8 A;  1KRH A;  4N9F 4;  3W2D A;  1JW9 D;  1TY0 A;  2IZV B;  1AWD A;  1J0G A;  4RM9 A;  4ACF A;  3VR9 B;  2YLM A;  3AM9 A;  4TMA B;  3Q8A A;  1XQQ A;  2IGG A;  1XLN A;  2RSU A;  2DBY A;  3P4P B;  2D10 A;  5KHO A;  2LRW A;  2NBV B;  4JGH B;  2WDT B;  3D32 A;  4RF0 A;  3EA6 A;  2DZJ A;  2L0T A;  3N30 A;  1VDV A;  1N62 A;  5FR3 A;  2KQS A;  2WP9 B;  1FFU A;  3LXF A;  1UZX B;  4TUU A;  2G3Q B;  1LO5 D;  3JSV A;  3SFD B;  1V5T A;  3IXS A;  5HG2 A;  3UF8 A;  2BS3 B;  2FCS A;  3MC9 A;  1B9R A;  2AWT A;  4YT0 B;  3SHQ A;  4AJY B;  4QAY A;  4BOZ B;  2ZNV C;  1EO6 A;  3DVN U;  3Q3J A;  2L83 A;  3JYU A;  4P7I A;  3NHE B;  2ICI A;  1IPG A;  4LLG M;  4UDU C;  4HXD A;  4ARI A;  4GIV A;  4S0R A;  3PPA A;  1ET6 A;  4N59 A;  4FBJ B;  2KNB A;  2MRP A;  2Z0E B;  1F9J A;  1PQS A;  2I38 A;  3NS8 A;  4WWP A;  3ZRF A;  2X8X X;  2L3Z A;  2DYM A;  1JWA D;  4KGT A;  3C8Y A;  4FJY A;  1WWT A;  3RN9 C;  3AEC B;  1WR6 E;  2FAZ A;  3P63 A;  2LJ5 A;  3ZW3 A;  2ZW0 A;  4WWO A;  3ENE A;  5IKC M;  1K8R B;  2JSV X;  2KFK A;  4YL8 A;  1T6B X;  1N63 A;  3TUO A;  2RR9 A;  1MI0 A;  2MX2 A;  1OEY A;  1CZP A;  3L4P A;  2BS4 B;  3ZNH B;  1CK1 A;  2TSS A;  3PVL A;  3NZ3 A;  4JX1 C;  4W9H A;  1FD6 A;  1OTR B;  1ZGU B;  3U52 E;  1XO3 A;  3K9O B;  1AYF A;  2KWU B;  2EEL A;  2BKF A;  3C0R B;  5D3I B;  2MP2 B;  4C4V A;  4P1B C;  1UF0 A;  5J17 A;  3RFZ B;  3S2A A;  4ITK A;  4ANX A;  1RRB A;  3L0W B;  3AN1 A;  1NBF C;  2N7D A;  4HLE A;  1HZ6 A;  1GJZ A;  4X57 B;  1ZOY B;  3AED B;  4ICV A;  1L6V A;  4WAF A;  4IWO A;  2PJH A;  4RCO A;  1GB1 A;  3PS6 A;  4E71 A;  3W1S A;  4KKJ A;  4BKS A;  2JQR B;  5G2N A;  2O6V A;  4IOI E;  3AMZ A;  3U2S C;  4KV2 A;  3DHH C;  3AU5 A;  3PRZ A;  1NEN B;  1A70 A;  3ML9 A;  3QIJ A;  1GUA B;  2DYB A;  2IY0 B;  4OZB A;  4W9D A;  4YSZ B;  4EUT A;  4FHK A;  2LVP A;  5HHD G;  2EKI A;  2WWZ A;  1R4N B;  4J6I A;  3ML8 A;  3N1Y C;  3H9D A;  2KLG A;  4ZRP A;  3VVW B;  2G45 B;  2C7N B;  2I1K A;  3TMP B;  1MJD A;  1WY8 A;  3W1Y A;  4LTU A;  1B1Z A;  3A4R A;  3UIN B;  3UGB B;  3VTV A;  2KAN A;  4ZRJ A;  1TS5 A;  4YTP B;  3KWL A;  2D2Q A;  3I5J C;  4USA A;  1F2R I;  3VTW A;  3B2F A;  2V3N A;  1JWB D;  3RNC C;  2EMT A;  1D4B A;  2K3U A;  2D3C A;  1EWC A;  1SBB B;  3ZDT A;  3NG0 A;  2RDH A;  1KLU D;  3R8B A;  4PYU A;  2WYQ A;  2FBW B;  2FCQ A;  2PE6 B;  2OJW A;  2BT6 A;  5DPW A;  3QK0 A;  1E9M A;  1L0Y B;  1YX6 B;  3CWI A;  1QKZ A;  2BB5 A;  1BML C;  4GDL B;  3ETR A;  1QOG A;  4A9A A;  2Y3A A;  1SF0 A;  3FC4 A;  2AYO B;  2KMM A;  4BKT A;  5IOI A;  4B0M A;  2XNA C;  1FXA A;  4KZC A;  2MA9 B;  3SR6 A;  3Q3O C;  2GBM A;  3MFG A;  4BOS C;  3HIZ A;  4II2 B;  2LGS A;  1J7C A;  2PVO D;  5MPO A;  1TTN A;  2LUE A;  5T8I A;  4PS8 A;  1H7W A;  4EEW A;  2C5L C;  2HE7 A;  4HRS A;  1WFY A;  1RFA A;  1SB3 C;  2MHJ A;  5DPT A;  1LM8 B;  5GXG B;  1LQB A;  4NAW B;  2NBW B;  2KXJ A;  3DDC B;  3HRD D;  1RWS A;  4JL9 A;  3ZVV A;  1HA5 A;  3DBS A;  4DDI D;  1P3Q U;  2K0P A;  2ZPN A;  5FKA C;  2FCN A;  3R66 C;  4NQL B;  5H8Y E;  3PRM B;  1ACC A;  4ANW A;  2W9N A;  1EU4 A;  3GZN B;  2MP2 A;  2IGD A;  1JML A;  2JXX A;  4HEA 1;  3W5U B;  1SIF A;  4WJO A;  2JZP A;  1WGR A;  4E3C A;  3APC A;  1WXQ A;  2KMA A;  3WAM A;  3NUH B;  3MP9 A;  5EDS A;  3H1U A;  2Z0D B;  2KJH B;  1YJI A;  1GOZ A;  1H7X A;  4M8M A;  5DPS A;  2V4L A;  3TIX A;  1WRI A;  4AS1 A;  4IWQ A;  1ENF A;  3A9J B;  5C2T B;  2MBE A;  3RZF A;  1UWX A;  1EF5 A;  1WYW B;  2GRI A;  2DHZ A;  1G6J A;  1VR9 A;  4EFO A;  4IWP A;  3PSE B;  2QEJ C;  4I6L B;  3OAW A;  2QIE B;  3ABV B;  2WXN A;  1E5W A;  1V86 A;  1TT5 B;  1YD8 U;  3IG3 A;  3N32 A;  2K8B A;  3PHX B;  1OFF A;  2LUM A;  1I4Q A;  1STE A;  4JQW C;  2PW9 A;  1L2N A;  2CS4 A;  1ET9 A;  3AE1 B;  2GBJ A;  2CHZ A;  1UNS A;  1Y56 A;  5HKH A;  4DXG A;  2A4Z A;  1WZ3 A;  3ZNZ B;  2M4N A;  4YXD B;  3KQ4 A;  3U4E G;  4EKU A;  3NJT A;  1D6E C;  1V5O A;  1EF1 A;  2V3S A;  3ZXR A;  3CIR B;  2MQJ A;  4WWM A;  2WGS A;  1XF5 L;  3EEC A;  3FAH A;  4A8X C;  2D3B A;  1WSP A;  1ISN A;  2UWQ A;  1E8W A;  4OVV A;  3ZXV A;  1YN3 A;  3PLU A;  1L0V B;  4RGO S;  1KOT A;  1WR1 A;  3QC8 B;  3A9K B;  4IW0 A;  2QC8 A;  3M62 B;  5BMG A;  1KF6 B;  1UWM A;  4GDL A;  2GOW A;  1CJE A;  1C77 A;  3N3K B;  2V0G A;  1KFY B;  1RYJ A;  3PRP B;  4OZA A;  1MPE A;  3OJ3 A;  1I42 A;  4Q2J A;  3QAQ A;  2GLS A;  4L1B A;  3T9L A;  1SEB D;  5DCN A;  3IFW B;  2LXA A;  3V6C B;  2LXC A;  2OED A;  4EZK A;  1ZW7 A;  4JPS A;  1WRD B;  1JWS D;  3JW0 X;  2G4S A;  1K50 A;  2BF8 B;  2CHW A;  3U8Z A;  1FCL A;  2OJR A;  2WDV B;  2K25 A;  1Q10 A;  4MT5 A;  2BQQ A;  1QLB B;  2MBO A;  4NAW A;  1HTQ A;  4FJZ A;  3VQI A;  3NRZ A;  3L13 A;  5CHF A;  4CQN A;  3AEE B;  4BKG A;  2K1F A;  3DWG C;  3HM6 X;  2VRR B;  2MBQ A;  4F1S A;  1XD3 B;  2LVQ A;  5C23 A;  3W9C B;  1WF9 A;  3SU8 X;  1IBX B;  4HKQ A;  3I9V 1;  1WH3 A;  1R4N I;  3R2T A;  1FO4 A;  2SEB D;  2CR5 A;  4G3X B;  1RFK A;  1SE4 A;  4K1R B;  1ESF A;  4M02 A;  2WXK A;  3ZTC A;  4MH0 E;  1S3S G;  3WAN A;  2Y5P A;  1JRU A;  1SE3 A;  2NBU A;  4DBG A;  1MG4 A;  2BVC A;  2KTR A;  1OQY A;  1V2Y A;  2G9H D;  5J18 A;  1ROE A;  3TCA A;  5E6P A;  5D3D A;  2JX5 A;  4P1C C;  3A9J A;  4EOY A;  1QT9 A;  2YEP F;  4TQ0 A;  3M95 A;  5FR6 A;  4DDG D;  1V8C A;  3AEG B;  2DZI A;  4KIK B;  1ZXI A;  3GE3 C;  4ZRK A;  3AXC A;  1E7V A;  2W3R A;  2L32 A;  2L52 A;  4IM0 A;  4B9K A;  3L16 A;  3UQA A;  2IBI B;  4PS7 A;  4D2K A;  4TV3 A;  4XZ4 A;  2KC1 A;  3EUB 2;  3VUW A;  2C7M B;  4KVG B;  1F2R C;  1WXS A;  3QHT A;  3VR8 B;  1V1P B;  1P9D U;  1P0R A;  2ZCB A;  2FUG 1;  3HK0 A;  1EM7 A;  3KUD B;  3DBL B;  5LXI B;  2JWU A;  2MBH A;  3P2B A;  2PVG C;  2Q5W D;  4M0W B;  3VHT C;  5LLI A;  2KDI A;  2LI5 A;  1FIQ A;  4ZYS A;  2DZK A;  1H4R A;  3AEA B;  1TZO A;  1ZE3 D;  2KMC A;  3M3J A;  2FUH B;  4WQO B;  2AQ3 B;  2H88 B;  2I1J A;  3ZIM A;  2IND C;  2J42 A;  3IBE A;  3AB5 A;  1Q0W B;  4H2A A;  3ONS A;  4MEM A;  5AZF A;  4DXA B;  3TBL D;  2GBN A;  4NQK E;  3AE9 B;  3ZQ4 A;  3A9K A;  1KM7 A;  1CQV A;  4LJO B;  3VAW A;  3DBH B;  2NTS A;  1WM3 A;  5D2M B;  3W5V B;  3VH3 B;  3DWM A;  2KD0 A;  3A4S C;  4C80 A;  2J0J A;  4HKZ E;  3L08 A;  4RGM A;  4BFR A;  2ASQ A;  1J19 A;  3GZN I;  4RGN A;  2DWQ A;  2KLC A;  3R2I A;  5IAA C;  3W1S C;  2FNJ B;  4XGA B;  4C7Z A;  4MSQ B;  3WA0 A;  1NYQ A;  3I57 A;  3URY A;  1XXG A;  1WE7 A;  2QIL A;  4AP4 C;  1M94 A;  4MGY E;  5D6J B;  1WX9 A;  3U7D A;  4OZC A;  4F7Z A;  4W9C A;  1QZE A;  2KAC A;  4GB9 A;  2JXT A;  5HFY A;  3VRA B;  1MFW A;  1U4A A;  2WU2 B;  3KW5 B;  3HVD A;  2HJ8 A;  5EE9 A;  4AQ7 A;  1IBX A;  1RM6 C;  4XDD A;  2GI9 A;  1PDX A;  2KJ6 A;  2CHX A;  2PLP A;  2KT7 A;  4N6E B;  4LCD E;  4M01 A;  4HPL B;  4HCP B;  4LK0 M;  4K7W A;  1OGW A;  3DQV A;  3NVV A;  2R2Q A;  3K9P B;  3U30 A;  2BPS A;  1D5M C;  1XCT L;  3LB8 C;  2BYT A;  4IKG A;  4KIK A;  4A3O A;  3R3M A;  2VZK D;  3AEF B;  2LRU A;  1UBI A;  3GP7 A;  2KFJ A;  2K8C A;  3NVY A;  3U7Z A;  3L17 A;  2KWD A;  3PRE A;  2KAJ A;  2IYD B;  2MEK A;  1I4G A;  2IGH A;  4WWN A;  3A1Q B;  3BY4 B;  2J0K A;  2JT4 B;  1FRD A;  1OEY J;  1WE6 A;  1V1P A;  1WI0 A;  3H7S A;  2N4F A;  4OHJ A;  1IGC A;  1YIW A;  1A5R A;  2JYE A;  2ZEQ A;  2C60 A;  3MTN B;  2QCZ A;  4HVB A;  2W54 A;  4GXB A;  3EFC A;  4M0W A;  2WDQ B;  5D94 A;  1C3T A;  2RPQ A;  4C56 C;  2BTE A;  1HTO A;  1SIJ A;  5G55 A;  2HD5 B;  1HQR D;  1FM0 D;  3ZUN A;  3ZJT A;  2W55 A;  2NTT A;  5EE3 A;  1E6E B;  3IT4 B;  4LNI A;  3HHM A;  4TKN A;  1BT0 A;  4WIP A;  2CU3 A;  2KQ4 X;  4DHZ E;  3LDZ E;  2PPH A;  1QOF A;  1OQQ A;  4IUM B;  3KLS X;  3IVF A;  4ARC A;  1M4V A;  4IC7 B;  2RDB C;  1I7H A;  3Q8B A;  3AE4 B;  1ZUD 2;  1YMH E;  4WJQ A;  1TKG A;  1V80 A;  4LNN A;  1T0Q C;  2VZK B;  2YVC A;  4P16 A;  1MVK A;  1QOB A;  4PS3 A;  3KUZ A;  3BYT B;  1T3Q A;  1Y8R C;  3H6N A;  3L10 B;  2J7Q B;  2WXG A;  3V61 A;  2M19 A;  1GC7 A;  1YOV B;  3DHI C;  2W3S A;  1GAQ B;  3P4Q B;  1SE2 A;  2VH2 A;  4K81 A;  1GG3 A;  4WUR A;  3KWV A;  3PLV A;  1L6U A;  1FRR A;  2L8J A;  1F0Z A;  2MWS B;  3Q8E A;  2WXQ A;  4TQ1 A;  3NS1 A;  4FAD A;  1IGD A;  3RUL A;  4ASW C;  4MGI E;  1JCK B;  1XEE A;  2XN9 C;  5EE0 A;  2DEN B;  1EUV B;  5IN7 A;  2WX0 A;  2WLB A;  1QIL A;  2WXH A;  2DLB A;  3RZW C;  3VTU A;  5AZG A;  1KJT A;  3QWZ B;  3P42 A;  2K8H A;  3AE6 B;  1TYG B;  3V3X A;  1FEH A;  2QDF A;  3KUC B;  4E74 A;  1YJJ A;  5JH5 C;  2AEH A;  4FJV B;  3DVN V;  3DBL I;  3MC8 A;  1SJH D;  4ZHO A;  3ZNG C;  2J53 A;  2EMS A;  1WIA A;  2DNF A;  1ZXH A;  1VZ7 A;  2G4D B;  5I4D A;  5BO4 B;  3Q3M C;  2AL6 A;  3RPF C;  1BXT A;  1E8Y A;  3BK1 A;  1WMH B;  1C9F A;  1WXM A;  4WQM A;  1WJN A;  3NZS A;  4MDK E;  1WGK A;  4XC2 A;  1IYF A;  4LDT D;  3WCQ A;  3QCA A;  2R61 A;  1YN5 A;  3AU4 A;  5DPR A;  3R7Q A;  1JAL A;  3A1Q A;  4MM3 B;  4LNK A;  3B08 A;  2FE8 A;  2BYE A;  4P6V F;  2QHO A;  3MC0 B;  4W9E A;  3APF A;  1UD7 A;  1L0X B;  3DBH I;  1HZ5 A;  2INP E;  3V6E B;  1XLP A;  3E56 A;  4M00 A;  2WX1 A;  3CMM B;  2DAF A;  2N9L A;  4WJP A;  2LGI A;  3VXW A;  2J0M A;  1N5X A;  2HTH A;  4JWU C;  4ZHP A;  1N61 A;  1WYG A;  2N0S B;  4OVU A;  4XX5 A;  4KZ0 A;  4GGQ A;  2KDB A;  1VLB A;  3VFK A;  4RM8 A;  2NVU I;  2KDM A;  3QJZ A;  5JHA A;  3O65 B;  3NVZ A;  3BYY B;  4HWI B;  2IO3 B;  3QA8 A;  4O1N A;  4BZA A;  4FUL A;  2A5U A;  2JF5 A;  1T0R C;  5BMH A;  1MHX A;  2D3G A;  1WGY A;  3KYD D;  1AAR A;  1TKY A;  4LDT B;  4EE2 A;  4K7S A;  1GT8 A;  1KH0 A;  3T8M A;  5JZE B;  2IJ0 A;  1TS4 A;  3X0W A;  2BGF A;  3PZ8 A;  2FID A;  2GMI C;  4AWJ A;  4J3O D;  2INN E;  2DAJ A;  5GMV A;  1WGH A;  1UBQ A;  3OJ4 B;  3Q3F A;  1C78 A;  3SEB A;  3JSV B;  4BAX A;  2BW2 A;  4BBN C;  2N7E A;  5TSS A;  3PTF C;  3I3T B;  4R3D A;  2D07 B;  1YN4 A;  1FCC C;  1QOA A;  2J52 A;  4CHK A;  3AE8 B;  2NCN A;  2ZZP B;  2HJ1 A;  5C3J B;  3I63 C;  1C4C A;  1ZKH A;  3HVZ A;  5KHQ A;  3Q14 C;  3PHW B;  4GLS C;  3V62 A;  1Z2M A;  3CF4 A;  3DPD A;  5L95 C;  2PE9 A;  1WGG A;  2C9W B;  2J4X A;  3Q3N C;  4WJN A;  4REZ A;  5E6N A;  2N1W A;  1J8C A;  3DBR B;  4M8N A;  2KK8 A;  3P4R B;  3TJP A;  2EKE C;  3PGE A;  1V6E A;  2CJO A;  2V9H A;  2K9X A;  5CTR C;  4HCN B;  3VUX A;  2HTM E;  3BIN A;  4DK5 A;  4OW0 A;  5LXH A;  2NS5 A;  3OG5 A;  3QQ8 B;  3ZLZ A;  4DHJ D;  2IPK D;  2ZW1 A;  1WMH A;  3RCZ A;  3MJ5 A;  2NPT B;  4HK2 A;  4G11 A;  2LD9 A;  4EZL A;  3TEW A;  3AI5 A;  1P1A A;  4KSL C;  3EGR A;  4ANU A;  1E90 A;  3ZYY X;  3ALB A;  4K3B A;  2XBB C;  2Z8L A;  2PKO A;  2KTF A;  4RH6 A;  1K51 A;  1I35 A;  4HJG E;  1AN8 A;  4MM3 A;  2MJE A;  2WXM A;  4US8 A;  4S17 A;  4CO7 A;  1TJE A;  3BVM A;  1TGZ B;  4YSX B;  1YQ4 B;  2ZNV B;  2D5G A;  3AEB B;  1I4H A;  2JUO A;  4KX6 B;  2KDE B;  2YEP B;  2AL3 A;  3KYC D;  4JLC A;  5CHV C;  2KQ7 A;  4KDL B;  2V4I B;  2KJR A;  3N20 C;  3ZJU A;  1SGH A;  1Z5S B;  2V1Y A;  3ZO5 B;  4RFB A;  1GNU A;  4K7U A;  5JHB A;  4CYE A;  3RNG C;  5E6O A;  2NMQ A;  2WXR A;  2KOX A;  4PYZ A;  3WIM A;  3ZTD A;  4JIO U;  4AOF A;  5CHW A;  2WQY B;  3BVZ A;  1MHH E;  1DOI A;  1KLG D;  1CMX B;  2SAK A;  4HJK A;  3UQB A;  1QQR A;  1EU3 A;  2KO3 A;  3HM3 A;  4FLH A;  3H8H A;  1IUE A;  3TL5 A;  1DGJ A;  5AUI A;  2G1E A;  4DHJ B;  1L7Y A;  2KVZ A;  2Y5B B;  5FK9 C;  3RI7 C;  2X38 A;  4BVU C;  2GBK A;  1GPX A;  1J7B A;  1VD2 A;  3AV8 A;  4HRO A;  4LNO A;  1I4R A;  4KGR A;  2JPH A;  1T0S C;  3AUL A;  1XT9 B;  4HPP A;  1V1O A;  3IAM 1;  1WXA A;  1FNU A;  3BZD B;  2WXL A;  4HPM B;  3NZU A;  2L0F A;  4LJP B;  4NJ6 A;  1NYR A;  2ON8 A;  3DCG A;  5BYS A;  1R7S A;  4A20 A;  1KLV A;  2KWV B;  4W9F A;  1GB4 A;  1WJU A;  1ZP0 B;  1PGX A;  2WXI A;  3B1L X;  4PT5 A;  3AE3 B;  4AJW A;  2V3P A;  3MHS D;  3EHV A;  3X23 A;  1J7A A;  1JWM D;  3EFU A;  3UI3 A;  1I4P A;  3BK2 A;  1V81 A;  3PO0 A;  5AUK A;  1E10 A;  5E6J A;  4XYC A;  5J2R A;  3ECI A;  1WX8 A;  1UGM A;  5BYR A;  1XLQ A;  4RNA A;  4AUQ C;  1D5Z C;  3RT3 B;  2JRI B;  1WJ4 A;  2AX5 A;  5D7G A;  1P7F A;  4MEL A;  3AE2 B;  4ZYN A;  1DYQ A;  1K52 A;  2WXO A;  4WH4 A;  2JY6 A;  2KC2 A;  2LJI A;  1TBE A; 
#chains in the Genus database with same CATH homology
 1T3Q A;  1TS2 A;  4YTM B;  2WDR B;  2BBC A;  2WXG A;  1DOY A;  1PGA A;  2M19 A;  3P4S B;  1EWY C;  1PFD A;  2W3S A;  4YXD B;  3P4Q B;  1GAQ B;  3KQ4 A;  3J9C A;  1SE2 A;  3U4E G;  2KN4 A;  1OQR A;  1AW7 A;  1D6E C;  1JRP A;  1N60 A;  1TY2 A;  4A55 A;  1VZ6 A;  4WUR A;  1N5W A;  3Q8F A;  1FXI A;  1SXT A;  4US9 A;  3CIR B;  4NJC A;  3KWV A;  4GDK B;  1L6U A;  2IDY A;  4WWM A;  1FRR A;  1XF5 L;  1F0Z A;  3P1M A;  3FAH A;  4A8X C;  3Q8E A;  4KGS A;  2WXQ A;  1UUP A;  1WSP A;  2WNM A;  2MJ3 A;  4TQ1 A;  3NS1 A;  1IGD A;  2WU5 B;  4A90 A;  3PZ7 A;  1TKE A;  2B76 B;  1YN3 A;  3TSS A;  1L0V B;  1JCK B;  3Q69 A;  4RGO S;  1XEE A;  2XN9 C;  5EE0 A;  2GB1 A;  2QSD A;  1C4A A;  1KRH A;  3W2D A;  5BMG A;  1JW9 D;  1KF6 B;  1UWM A;  3HUI A;  1ZDX A;  1QIL A;  2WLB A;  1TY0 A;  2DLB A;  2MH7 A;  2WXH A;  2K22 A;  1E7P B;  1AWD A;  1CJE A;  3VR9 B;  3AM9 A;  4TMA B;  1C77 A;  3Q8A A;  3P42 A;  2V0G A;  1KFY B;  2IGG A;  1XLN A;  1RYJ A;  3AE6 B;  4OZA A;  1NVI D;  1TYG B;  2DBY A;  1MPE A;  1VZ8 A;  4YSY B;  3P4P B;  3V3X A;  1FEH A;  1BUI C;  2H89 B;  4Q2J A;  4TSS A;  4DXF A;  1YJJ A;  4L1B A;  3TEZ A;  4RF0 A;  1SJH D;  4ZHO A;  1SEB D;  3ZJV A;  3EA6 A;  2J53 A;  1VDV A;  1N62 A;  5FR3 A;  1ZXH A;  1ZPS A;  2WP9 B;  1FFU A;  1VZ7 A;  3LXF A;  4RGT A;  2OED A;  5I4D A;  3B2G A;  3RPF C;  1BXT A;  1LO5 D;  4JPS A;  3V05 A;  3SFD B;  3BK1 A;  3IXS A;  5HG2 A;  1FNV A;  1KTK A;  1JWS D;  1C9F A;  4WQM A;  1K50 A;  3AE5 B;  2BS3 B;  1WGK A;  4B0E A;  1B9R A;  1FCL A;  3WCQ A;  1YNT E;  2WDV B;  1Q10 A;  3IT6 B;  4YT0 B;  1ZDV A;  2WS3 B;  4MT5 A;  2R61 A;  1QLB B;  1YN5 A;  2RMM A;  2MJD A;  2L1A A;  3VQI A;  2WXP A;  3NRZ A;  2LHE A;  4CQN A;  3LYY A;  3AEE B;  2L83 A;  2PMV A;  3DWG C;  1JAL A;  4ZOH C;  4MM3 B;  1VJK A;  2FE8 A;  2ICI A;  4P6V F;  3W9C B;  4LLG M;  3MC0 B;  4UDU C;  1IBX B;  2I2Y A;  4HKQ A;  3I9V 1;  4ARI A;  1L0X B;  1I4X A;  1HZ5 A;  2INP E;  3R2T A;  1ET6 A;  1FO4 A;  2SEB D;  4MH8 A;  4N59 A;  1RFK A;  2AQ1 B;  1SE4 A;  1ESF A;  3GB1 A;  1XLP A;  4MAC A;  3E56 A;  2WXK A;  2I38 A;  1P7E A;  4ZRQ A;  2Y5P A;  2N9L A;  2PIA A;  1SE3 A;  2LGI A;  1L4Z B;  1C79 A;  2DYM A;  1JWA D;  4KGT A;  1N5X A;  4RF1 A;  3C8Y A;  4JWU C;  4ZHP A;  1N61 A;  2G9H D;  1WYG A;  1ROE A;  1WWT A;  3ZGZ A;  5D3D A;  3AEC B;  2JX5 A;  2N0S B;  1NEK B;  5G5G A;  3P63 A;  1QT9 A;  2YEP F;  2ZW0 A;  1VLB A;  4TQ0 A;  1V8C A;  3AEG B;  2JSV X;  1ZXI A;  2KDM A;  2BS2 B;  4C7Y A;  1T6B X;  3NVZ A;  2LFI A;  4IDI A;  1N63 A;  3BYY B;  2W3R A;  1HXY D;  4OVZ A;  3TUO A;  2L32 A;  2WXJ A;  1D5X C;  1MI0 A;  2L52 A;  4O1N A;  1L4D B;  1YQ3 B;  5BMH A;  3O13 A;  4D2K A;  1CZP A;  3L4P A;  2BS4 B;  1MHX A;  1CK1 A;  2TSS A;  1TKY A;  3TEX A;  3EUB 2;  4EE2 A;  3NZ3 A;  1GT8 A;  3BWU D;  4JX1 C;  4FXC A;  1FD6 A;  1F2R C;  1KH0 A;  3U52 E;  1XO3 A;  2IJ0 A;  1TS4 A;  3VR8 B;  2Y5C A;  1AYF A;  1V1P B;  2EEL A;  3PZ8 A;  5D3I B;  4L23 A;  4NZL B;  1C4P A;  4XWT A;  2FUG 1;  3RFZ B;  1EM7 A;  4ITK A;  1V97 A;  4J3O D;  2JWU A;  2INN E;  3AN1 A;  1JRO A;  1JQ4 A;  2PVG C;  4XWW A;  2Q5W D;  1HZ6 A;  3B9J A;  1C78 A;  1ZOY B;  3SEB A;  2BW2 A;  3AED B;  1FIQ A;  4ZYS A;  5TSS A;  5BMI A;  3AEA B;  1TZO A;  1L6V A;  4WAF A;  1ZE3 D;  2LMC A;  4R3D A;  1YN4 A;  1FCC C;  1QF6 A;  1QOA A;  2J52 A;  1NI3 A;  4RCO A;  1GB1 A;  2AQ3 B;  3AE8 B;  3W1S A;  4KKJ A;  2H88 B;  2JQR B;  5C3J B;  1K53 A;  4IOI E;  1C4C A;  3HVZ A;  2RPV A;  2J42 A;  2QJL A;  3AMZ A;  3U2S C;  3AB5 A;  4H2A A;  1T5X D;  2ACZ B;  4GLS C;  1NEN B;  1A70 A;  3TEY A;  3CF4 A;  3AE9 B;  3ZQ4 A;  4OZB A;  2J4X A;  1SJE D;  4YSZ B;  4REZ A;  4XDC A;  1CQV A;  1DOX A;  2NTS A;  5HHD G;  3P4R B;  2EKI A;  5EE1 A;  3W5V B;  3E9S A;  2CJO A;  3DWM A;  4N58 A;  4ZRP A;  4C80 A;  1UGJ A;  2K9X A;  4HKZ E;  2W82 A;  4RGM A;  2JYT A;  3IAS 1;  4RGN A;  3FIL B;  2DWQ A;  2HTM E;  3R2I A;  4LTU A;  1B1Z A;  5BYQ A;  4OW0 A;  3VRB B;  4C7Z A;  1L5P A;  1TS5 A;  4YTP B;  1HEZ E;  3AH7 A;  3KWL A;  2N9K A;  1NYQ A;  4L2Y A;  4USA A;  2DYO A;  1F2R I;  3I57 A;  2N7J A;  3B2F A;  2V3N A;  1JWB D;  3URY A;  1XXG A;  2IPK D;  2QIL A;  2ZW1 A;  1D4B A;  2K3U A;  3MJ5 A;  1EWC A;  3TEW A;  1SBB B;  4OZC A;  1PUT A;  2RDH A;  3EGR A;  1KLU D;  3R8B A;  2KAC A;  2JXT A;  4YWG G;  3ZYY X;  2FBW B;  5HFY A;  3AE7 B;  2Z8L A;  2PKO A;  4RH6 A;  3VRA B;  2BT6 A;  1K51 A;  5HI1 A;  4HJG E;  1E9M A;  1AN8 A;  1L0Y B;  5G5H A;  2WU2 B;  2MJE A;  2WXM A;  3HVD A;  4US8 A;  3CWI A;  2E6X A;  5EE9 A;  4AQ7 A;  1QKZ A;  1IBX A;  1TJE A;  3BVM A;  1RM6 C;  2BB5 A;  1BML C;  4YSX B;  4GDL B;  4XDD A;  3ETR A;  1YQ4 B;  2GI9 A;  1QOG A;  4A9A A;  2D5G A;  2Y3A A;  1PDX A;  3AEB B;  1VRA B;  1I4H A;  2PLP A;  4KX6 B;  2YEP B;  1SF0 A;  3FC4 A;  4N6E B;  1GTE A;  2V4I B;  2KMM A;  5JXV A;  3ZJU A;  4JE3 B;  4LK0 M;  4B0M A;  2XNA C;  4RFB A;  1FXA A;  1PYW D;  3N9Y C;  3SR6 A;  3MFG A;  4YTN B;  2NMQ A;  3NVV A;  1GTH A;  2AQ2 B;  2QMT A;  2WXR A;  3MHZ A;  1J7C A;  2PVO D;  1D5M C;  1XCT L;  5MPO A;  2WQY B;  3BVZ A;  5T8I A;  2JU6 X;  1MHH E;  1DOI A;  1KLG D;  3LB8 C;  1H7W A;  2SAK A;  2BYT A;  4IKG A;  1QQR A;  1EU3 A;  1TS3 A;  2LEK A;  4HRS A;  3H8H A;  1IUE A;  2VZK D;  3AEF B;  1SB3 C;  3BVG A;  3GP7 A;  1DGJ A;  3NVY A;  3U7Z A;  5AUI A;  1XCQ L;  5GXG B;  2G1E A;  4NAW B;  2KWD A;  2KAJ A;  3HRD D;  5FK9 C;  1RWS A;  2MEK A;  1FFV A;  1I4G A;  2IGH A;  1HA5 A;  2X38 A;  2M0A A;  2K0P A;  1GPX A;  1C76 A;  1J7B A;  1PGB A;  3AV8 A;  5FKA C;  4HRO A;  3Q8C A;  1I4R A;  4KGR A;  2BB6 A;  5H8Y E;  1FRD A;  1ACC A;  1V1P A;  1EU4 A;  1JWU D;  4NAM A;  4OHJ A;  2IGD A;  1V1O A;  1IGC A;  3IAM 1;  1JML A;  2JYE A;  1FNU A;  3GS2 A;  3BZD B;  4HEA 1;  3W5U B;  2WXL A;  2JZP A;  2W54 A;  4JWS C;  1FMA D;  5H92 C;  1NYR A;  2ON8 A;  5BYS A;  1WXQ A;  4M0W A;  2WDQ B;  1R7S A;  4C56 C;  2BTE A;  3OWE B;  1F77 A;  3NUH B;  1SIJ A;  1GB4 A;  3MP9 A;  5LNK 1;  1XLO A;  1HQR D;  1ZP0 B;  1YJI A;  3T3O A;  1GOZ A;  1H7X A;  1PGX A;  2WXI A;  1FM0 D;  4PT5 A;  3AE3 B;  2W55 A;  2V3P A;  3ZJT A;  2NTT A;  1WRI A;  5EE3 A;  2ONQ A;  4AS1 A;  1J7A A;  1E6E B;  1JWM D;  1ENF A;  3IT4 B;  3BII D;  5C2T B;  2CJN A;  3UI3 A;  1UWX A;  2GRI A;  1VR9 A;  4WIP A;  2OHF A;  2CU3 A;  2M56 B;  3NVW A;  1I4P A;  2KQ4 X;  3BK2 A;  3PO0 A;  5AUK A;  1E10 A;  3T3N A;  4A6Q A;  2LHD A;  5E6J A;  1QOF A;  1OQQ A;  3KLS X;  2QEJ C;  2QIE B;  4ARC A;  1M4V A;  3ABV B;  2WXN A;  2WXF A;  2RDG A;  5BYR A;  2K5P A;  1XLQ A;  4DQO C;  4RNA A;  1I7H A;  3Q8B A;  3AE4 B;  1ZUD 2;  1D5Z C;  1YMH E;  1OFF A;  2LUM A;  2PTL A;  1I4Q A;  1TKG A;  3BYT B;  1STE A;  1E0Z A;  2E3T A;  2PW9 A;  2AX5 A;  3SFE B;  2VZK B;  4XE0 A;  1ET9 A;  3AE1 B;  1P7F A;  1SSN A;  4P16 A;  5D7G A;  3AE2 B;  1DYQ A;  1K52 A;  1UNS A;  1MVK A;  2WXO A;  4WH4 A;  1QOB A;  1Y56 A;  2LJI A;  3FIL A;  4KKI A;  2HDE A;  4DXG A;  1FNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...