3P4UA

Crystal structure of active caspase-6 in complex with ac-veid-cho inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
145
structure length
143
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTADRDNLTRRFSDLGFEVKFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of active and inhibitor-bound human Casp6
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
total genus 47
structure length 143
sequence length 145
chains with identical sequence C
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2010-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p4uA00
4ZVUA 4N7JA 1GQFA 2WDPA 3DEHA 4AW9A 3DEJA 3UO8B 2QLBA 1QDUA 1PAUA 3NR2A 4LSZA 1IBCA 4EHFA 3H11B 3GJRA 1NW9B 1SC1A 3IBCA 4NBNA 1KMCA 2J32A 1M72A 4EJFA 5LUBA 2QLFA 5IANA 5K20A 3GJQA 4EHAA 3V6MA 4JJEA 2AR9A 4QU9A 4QUAA 3S8EA 2C2KA 3R6LA 3H13A 3V6LA 1SC4A 2QL5A 3RJMA 2NN3C 3PD1A 2CNNA 4N6GA 4ZVQA 4PS0A 5LU9A 2HBZA 1RHJA 4HQ0A 5IBRA 1SHLA 4FEAA 3R7NA 2H4YA 4M9RA 4EHLA 1NMEA 3KJNA 2H4WA 4EHNA 1RHQA 4FXOA 2P2CA 2C1EA 4QUJA 2CNOA 2J33A 3R7BA 2J31A 2Y1LA 3IBFA 2XYPA 2XZDA 4D3XA 4QU5A 5IC6A 5H0IA 2H65A 1RE1A 4N5DA 3NS7A 1BMQA 1RWXA 4N6NA 2FP3A 4JB8A 4NOKA 1CVRA 2CDRA 4NBLA 3S70A 4HQRA 1F9EA 4I1RA 1NMSA 1SHJA 3V3KA 4ZVOA 3D6MA 4QULA 4D3YA 5I9TA 4JR1A 4ZVTA 1RWOA 5IAJA 3V4LA 4QU0A 1F1JA 3ITNA 2HBQA 4DCPA 4N7MA 4NOJA 4JJ8A 2CNKA 2K7ZA 4EHKA 5JFTA 4ZVRA 1CP3A 4NBKA 4PRZA 3GJSA 2XYGA 1RWWA 3P45A 2QLJA 5IABA 3BIJA 3K7EA 1I4OA 2J30A 1K88A 2H48A 1RHRA 4NOLA 4QUIA 3R5KA 4HVAA 4QUGA 4JQYA 3V4OA 4QUEA 2CNLA 3KJQA 4JQZA 5IAKA 5IAGA 3DEKA 1GFWA 1I4EB 1QX3A 3PD0A 4FGUA 2C2ZA 4AWBA 5I9BA 2CJXA 1PYOA 3D6HA 4N6OA 1QTNA 4JR2A 2FQQA 2XZTA 4PRYA 5IARA 1I51A 1RWKA 2FUNB 1RHMA 1RWPA 2HBYA 3H11A 2HBRA 4EHDA 5IBCA 1RWVA 4JJ7A 3SIRA 4D3ZA 3P4UA 4I1PA 2H5IA 1ICEA 1K86A 3D6FA 1RWMA 4QTXA 3DEIA 3H1PA 2XYHA 5IASA 3R7SA 2CJYA 3SIPA 4EHHA 3KJFA 4QUDA 4ZVSA 3V55A 4IYRA 1RHKA 2C2OA 2DKOA 3GJTA 3PCXA 4DCJA 3EDQA 3QNWA 2H5JA 5IAEA 4IEFB 3R5JA 4QTYA 2Y0BA 2QL7A 1SC3A 1NMQA 4QUBA 3EDRA 4DCOA 5IC4A 5LUAA 3R6GA 3H0EA 4JR0A 4AWAA 1RWNA 1JXQA 4QU8A 4ZVPA 3UOAB 3NKFA 4QUHA 5IBPA 4NOMA 4PS1A 3E4CA 3OD5A 2H54A 2C2MA 4FDLA 5LU8A 2QL9A 2H51A 1I3OA 1RHUA
chains in the Genus database with same CATH superfamily
2JHPA 1M76A 1EM6A 2WUVA 3I5AA 3KR2A 4WESA 1O1YA 4RC9A 3UA4A 2LPMA 4XYGA 1SA0A 1QH8A 4LSZA 3C5VA 2OQVA 3CLSD 3N07A 3NT2A 3A6LA 1C5KA 1FP4B 3L93A 3K5HA 2BH2A 3KVYA 2GBIA 4M22A 5F7OA 5CBKA 5CH5A 3JASA 1HLDA 3BSSA 1UJCA 2MINB 3HPQA 1ZIXA 3JVEA 3PUKA 3QYJA 3LU1A 1EPUA 1SUFA 4IX9A 3TCKA 5LM3A 5LZ4A 1DXYA 2GAIA 2X5NA 4YP0A 1G59A 4TSRA 3QUAA 2DB3A 3MJSA 3RV3A 4LBZA 1G3MA 1SCJA 4WA8A 4R98A 1U0SY 4DMCA 2OCBA 1UINA 2Q6LA 4KBFA 2D59A 2B21A 3PBKA 1P33A 4ZVQA 4LNUB 3ACDA 4XGRA 3KQVA 3T3HA 3VUEA 5JZ9A 1QQTA 2O8CB 1IHYA 2IXEA 4TLLB 3ZH2A 4Z9AA 1KPGA 3ZNPA 4RJIA 1CR1A 4XOIA 4IHAA 1U5AA 5HXAA 3FLBA 2CYCA 3ZCPA 4UVDA 4K6MA 1C9YA 2CF6A 5CEJA 4BB5A 5G4KA 1PJ3A 4P98A 1ZSYA 1TTTA 3DLAA 5CT5A 2VN8A 4NENB 4YRQA 1XL1A 1M33A 2IHUA 1P61B 2X15A 4ZRNA 1YC5A 3CEHA 2YRXA 2B20A 2OT3B 3O74A 2BY4A 4EPTA 5GZ1A 2FNAA 1I6KA 3I5XA 1NHGA 2C42A 2JFPA 1DQPA 1I94B 3WB2A 1YASA 4QU0A 4CG3A 3ITNA 1ZK2A 4DCPA 4A5OA 4ZVRA 4TL8A 1A72A 4LK2A 2IOQA 1V3QE 4FFOA 1SEVA 3O1LA 1Q21A 1TYCA 1SHZA 2BFCB 4IRUB 1R3UA 4AY5A 3CWCA 4A23A 1Q7CA 3GFTA 2ZJ7A 2QAGA 5HCNA 1ZJYA 5JWHA 1I30A 1G5RA 2IYWA 1T3GA 1EFKA 4TRMA 4F11A 4DANA 2C8JA 3GNQA 2G5PA 2W6IA 4NU0A 5I9BA 2CJXA 1VG9B 1R64A 1IUKA 1GITA 1KEVA 3JRNA 5BYBA 2H17A 4ESOA 1M5UA 3MWFA 3W9YA 1WZCA 4S24A 4GSYA 3MN1A 1T5TA 1VDZA 3IAAA 4PBSA 1W2HA 3K5WA 2MR5A 4KWIA 1QHSA 5AM4A 3NV7A 4B5LA 2NXJA 1XVIA 4B6GA 3VTZA 1QH1B 3E8MA 4NZOA 4OHCA 3MS2A 2UUOA 5TGTA 2QKYA 3SF8B 1NUSA 3SVLA 2AOUA 1Y1SA 4AVYA 4ZYTA 1RJEA 2ZKLA 1MT0A 4ZXFA 1PL0A 5KKCA 1X1BA 2VZLA 1EA7A 2HGSA 4CR6A 1PR2A 2R87A 4KVGA 4PXSA 4Y1GA 4EB6B 4F6CA 2GK6A 1CE8A 4KFTA 4YASA 3JWEA 1XPUA 4D4MA 4QNNA 3GX1A 5BURA 1MQSA 4BIIA 4ZRMA 5K3OA 5IKOA 1UMBB 4PQYA 2B37A 4QBFA 5DTEA 2HI0A 1V9CA 1KI8A 5KU7A 1X7GA 4E4TA 4MR7A 4AB1A 2XDQA 1M1YA 3EFOB 1QAMA 2HD4A 3R7DA 2XIQA 3DD1A 3D7LA 1PT7A 2DHQA 3V9AA 2ZCVA 1GZVA 4PGHA 4B4UA 2XBLA 3NETA 2NZVG 5DP1A 4MIEA 3BWVA 2VT3A 3LHSA 3SEZA 3QNUA 2OLKA 3T4PA 3D6UA 4HLQB 3TBHA 3TKLA 1LQUA 2I29A 3Q3EA 4GPD1 5CR9A 4BFLA 4J6EA 3OZBA 4H0FA 4GPAA 1O87A 2Z6UA 4RK6A 3A32A 1GM5A 1A1VA 1B76A 2IHYA 3W3AA 2XMRA 1GPMA 4N65A 5I7AA 4DCNA 2HYIC 4DV2B 3OIWA 2HMVA 4LAFA 5P21A 5IJXA 1TAHA 1NDHA 2CXQA 2HSEA 3DZ8A 1AF4A 4MW6A 4P3YA 2CMHA 2D00A 1TLLA 3RC3A 1Z6TA 2WWGA 3A4VA 2VA9A 1WKBA 2GBLC 2XCTB 4LYHA 2F59A 5LWQA 2G4CA 3CV3A 5AYVA 4UARA 4FDVA 4MA5A 2EVWX 4TZ0A 3BGOS 5C5CA 2R6FA 4FT2A 4GS5A 3WKCA 4BPBA 1KTVA 4QPJC 3DE2X 5J4HA 2FPLA 4FFNA 2WWVD 3S68A 1X3SA 4B3DA 5CT6A 3E22A 1FU7A 4RSGA 4B3MB 1NZJA 3CR3C 3HH8A 1IUNA 4J4TA 3DMPA 4LI3X 4E2FA 3ADDA 2FP3A 3U44B 2O8BA 2GOYA 2ZPUA 3KKKA 1P3JA 2PBFA 4DRXB 1SHJA 2NYVA 3AEZA 4I08A 4BLOA 3FNBA 1Y8QA 2ZU0C 3HKBB 3H8SA 3UPUA 1NI3A 2K4MA 4Q9JA 3IXQA 3A9UA 3SJZA 4DYHA 2VWHA 1P7PA 1XEAA 4NZ9A 4ZRDA 4DLUA 3U7IA 3X2EA 4B4OA 4KBGA 5FLXA 1OA1A 4ZVLA 2H48A 2ODEA 4U9IS 3TIXB 2O50A 5IXJA 1MA3A 3IAEA 4U9UA 5GONA 4CEIA 2PX8A 2F3UA 2XUIA 3BQ9A 4MV4A 5KTMA 4MZXA 3K6SB 4KAFA 3W2HA 3WWCA 5DM2A 2FPXA 4RKWA 3RYIA 2UXCB 3QPDA 4FGKA 3OZRA 4FYHA 1DLJA 5I4IA 5IM4A 1GAXA 3K2IA 2SKDA 2HHAA 1N5DA 1TW3A 2V9ZA 5SZJA 3Q9NA 1M2VB 3GGCA 4R3UC 3M4NA 1O08A 1LLDA 2XWPA 1QMPA 2I9PA 3GA7A 5JAZA 2XODA 2ICAA 5K8CA 1IPEA 2RH9B 3GMSA 1UBOS 3IT0A 2YIVX 1MJHA 1NMZA 3AUKA 1QF6A 3A6ZA 3RKRA 5AHKA 2Z1NA 3IQXA 3DNMA 5CVDA 2J6IA 1T0JB 2EGUA 1ZHHA 3PI7A 2YXEA 1R0CA 3QLVA 2D0PB 1ESMA 1D6MA 2VJOA 1Z3CA 3FMOB 3KJGA 3KR1A 4GWGA 4PZAA 1WCIB 1XU4A 3AR4A 3M8KA 4H08A 4QOSA 1NBIA 2A5JA 3A2KA 1XCMA 2GK3A 4BO0A 1CDDA 1M2OA 5HEKA 4F9EA 1PF7E 3L8ZA 4M38A 4C7BA 2ZREA 4R84A 1O9HA 1AKRA 1CWUA 3EYWA 2QA5A 3QXJA 1QGED 4WNAB 5TEVA 3UK0A 4M9XA 1IY2A 1BHJA 2C77A 4M54A 4WN9A 3VVMA 5HS4A 4K9OA 1YQGA 5TARA 3EXFB 2FWRA 1EE2A 3V7FA 4E4RA 1H1LB 4WZAE 1JAYA 3DOOA 5EKDA 4XSVA 3GYBA 5ICCA 2RBGA 4DZRA 3KQTA 4MR8B 1JIQA 2FLKA 4LDAA 1II9A 1W4ZA 1MAUA 1GUDA 4I3HA 4CLOB 2BFAA 5MFZA 4TYPA 2ZYGA 5JHGB 1YS2X 4OAQA 3NWBA 3C6ZA 3OIGA 3S2EA 2QVBA 4QG7A 4ALKA 3FUWA 1O8CA 4EFLA 4CIWA 1V6CA 4MJXA 2F64A 2X42A 2EJUA 4R1SA 1JFFB 1NJ6A 2D8MA 2JDID 3OBIA 4JZYA 1KJJA 5AWFC 2O2IA 5HIJA 3WRYC 3VR6D 1U2GC 3MIZA 4EPVA 4MUKA 1H5QA 1Y3FE 1SQGA 2HQRA 1R4ZA 5DBHX 4BNZA 2NU8B 1OIWA 4PX9A 4MKZA 1VJGA 4CXMA 3AUJB 3JCZA 5HE9A 1YOBA 1ID8A 1XQ9A 4LJYA 4RDIA 4HQNA 1MX9A 3CVOA 1XDSA 3DCNA 3YASA 3B60A 1P6QA 1W46A 3FCEA 3IT3A 4FU0A 4ITVA 1XJ5A 3VC7A 3GPLA 3KL4A 4FTWA 3QJGA 5DHQA 1Y81A 1NATA 4BNIA 2V7XA 4EBFA 1JEQB 2VF5X 5BVGA 1BGWA 2Z5LA 3R09A 4UBOA 4DJTA 1ODLA 3DOCA 2XT0A 3F4BA 4XI9A 5CHYA 5JYBA 4AZ0B 3L2OB 4G56A 4JUIA 2WKSA 4QLOA 4AL4A 1TEZA 2PD4A 1V7PC 4QFBA 1QORA 2OENG 4MTLA 4HUQA 5C32A 5IJ0A 1AKMA 4ER7A 2SNIE 4RVNA 4DDVA 3LCUA 3CRVA 4ITRC 3E03A 3G6WA 3UPDA 3OKAA 5FB3A 1QVVA 3R5XA 1NF2A 4CIBA 3WFJA 3ZK9A 1CUWA 2WZDA 1KAQA 1MX5A 1PL8A 2CJWB 3MUOA 1MX1A 3T52A 1NYRA 5CB4A 2JGDA 3JTMA 4IO0A 3LCJA 4RVOA 2D3TA 2OHGA 4X93A 3EW9A 5GGXA 3FY4A 2WFLB 1O4VA 1VHQA 4LRSB 3BHJA 3EUAA 3OOHA 3VHXB 7YASA 5DNEA 1W94A 3OTWA 3P2JA 1NXWA 1YR1A 1COWA 3GJ3A 2WJJA 3OIUA 1ARZA 2CLCX 1YR9A 3CWZA 5FBKA 1H6DA 4NATA 3E58A 5IVDA 5CW1A 3KQLA 3QKTA 4TTQA 4ESHA 3DHYA 3EGOA 3ROFA 2EJBA 4R8LA 3U3XA 5BN4B 5IARA 3SX2A 3VKHA 1XVTA 4LQCA 4E46A 2OGSA 3VZRA 2VJBA 1X9IA 3C4VA 3E61A 3RFUA 2I3DA 2XF2A 2OYCA 3HYRA 4M3NA 4OYRA 4RKFA 4J0EA 5EMKA 2YWBA 4WV3A 1BROA 5LP6C 1QV6A 1IZ0A 1V8PA 1W0JD 3JZAA 2MSDB 1NBHA 4F5WA 4V24A 5F12A 3PITA 4ZJPA 2EBFX 1LLCA 1E1QA 5AW6A 2X8BA 1HETA 3HFGA 3JYQA 1PRYA 5EEGA 3R6TA 4HXGA 4CETA 1XKLA 2Y92A 4C0WA 2Z2ZA 5G1PA 3ESDA 5F2EA 3VZCA 2G72A 4MDEA 2PWPA 5FPQA 2EG9A 1K89A 1HKUA 1LRJA 1Q7TA 1DRVA 3W5HA 3FI9A 3TAHA 2FQ1A 4EB8A 3EE6A 1A8UA 1KVRA 2HDHA 5BR8B 1YS9A 4YUXA 1DUIA 1U0RA 1YK1A 1OLSA 3IDQA 2WA1A 2W2VA 4V2UA 4OHKA 2J8ZA 1GGHA 3HA2A 5JLAA 4BVLA 4XVCA 1IN1A 4FWBA 1SVOA 2I67A 4L76A 4YJ3B 2H51A 3VMMA 4AKTA 4BEJA 1JJAA 1HLPA 2G63A 2RK3A 5CT9A 4D81A 4EI9A 2A0KA 4I55B 5LIPA 2CLIB 5DI3A 3VI4B 1T1IA 2PT9A 1F8UA 2NPIA 2NT4A 2QB5A 2J67A 5ALQA 4I3GA 1OMOA 3CY6A 4PZZA 1JE1A 3GRAA 2JZCA 3ZU4A 4HWOA 4O4LA 5JAUA 3H16A 3MTEA 4HN2A 4ZTUB 3I2YX 4FKZA 4Z53A 2OORC 2RI1A 4RNDB 3TZQA 5EG5A 1MO6A 5EI5A 1O97C 1IB6A 1UKEA 2HLDA 3ONFA 3O93A 2BFOA 2R9VA 3HBAA 1DCKA 1R5JA 3DBIA 4PIPA 4Z4HA 5GPBA 4MWCA 2QDKA 1QFXA 2ECQA 1SCBA 3EISA 1SHTX 5HSGA 3TTWA 3TK1A 3Q72A 4PYNA 4PN7A 4RL4A 3T1HB 4BNDA 2XMBA 2XCUA 3I6ZA 1N1GA 2VSQA 3EDOA 5MF6A 3HK2A 2J08A 1B8VA 3QVKA 5FUMA 5ALRA 3ZBUA 1I3NA 4ZAWA 1HE1C 3OX3A 2YINC 5BPFA 2OSBA 2JIPA 1U8TA 2ZSKA 5LOVF 4EZIA 4QVGA 1TX4B 3T15A 1W96A 1XGKA 2KM1A 4YECA 4MO2A 4ZHQB 2PANA 5D87A 3AESB 4DV1B 4GZMA 1MDBA 1KS2A 3ASZA 4F5DA 1BWSA 1PUXA 2VCEA 4ZT3A 4AWXA 2P1ZA 2GD6A 4YO8A 2DR0A 4UZFA 4ZAYA 3L6OO 5KQPA 2IDZA 3TX2A 3RBZA 1JHVA 2AJ8A 3IJPA 3NHJA 4UAGA 3WIDA 1XX6A 3WKBA 3FPFA 1WHTB 1OI7A 2AFRA 1GUZA 4P84A 5BUZA 3J81k 2CNBA 3K1ZA 2PKQO 1TVKA 2XVAA 3QLEA 3ZWNA 2VH1A 3OLCX 1ELOA 2PYIA 4M9ZA 2OXIA 3RIXA 4PBRA 4CUKA 1XTSA 1MR3F 4V0NA 1PWYE 2C94A 2FMHA 3HFSA 2FW9A 1TOAA 3ER6A 1BH6A 3G2QA 3U4MA 3LQFA 3QXXA 4TKVB 3C16C 4NXMB 2YJGA 2X4IA 3W04A 1KI6B 1YZHA 1TT7A 2W70A 2OAEA 4LIPD 2QVLA 3KT6A 3NC1C 3UMRA 4QOJA 5HILA 3VNAA 1GSAA 3X1WA 4I8IA 1PZHA 1HDCA 3E8XA 1HFWA 3K6SA 3OQPA 1NUTA 2BOVA 3AR6A 3P0IA 1Q16A 2PH5A 4L9RA 1KJIA 1XN4A 1IWPB 3AF4A 1PV1A 1ZVKA 2BMJA 3AUAA 2GBLA 3PEUA 2Y8EA 4UNSA 5TQ0A 1P72A 1TQDA 1QC5B 4RZUA 2J4DA 1XEWX 4B84A 2ONZA 3GVPA 1ULTA 2V3WA 1I5RA 2P67A 2Q6IA 4HH1A 4M9CA 4XDHA 3W7BA 4BCBA 4BRWA 1CK4A 1ONOA 2B5OA 2X6TA 2HF9A 2JEYA 2ZAMA 3F4KA 3H0EA 2ODPA 3IMCA 1NNUA 2FF7A 3TINA 5REQA 2YWGA 1ADBA 5AOBA 1IFXA 4C0XA 5AVTA 1WXXA 2CDBA 1UBEA 3HSSA 1RYZA 5JAIA 4GU5A 3KVNA 4N5NA 4XQCA 2ZWIA 1JU9A 2ZCUA 4CF4A 5E9WA 3AM4A 3AI1A 2J0UA 3CJRA 3BJZA 2FEXA 4UOQA 4Y6RA 3U3MA 4Q7EA 3C97A 4RPHA 3WIVA 5GJVC 3W2TA 4IFTA 1QPZA 3QTBA 4HNAA 2JAOA 4OV6B 1LBHA 1LS6A 2FUEA 3G8AA 1X8XA 2HFKA 3HI4A 3V8QA 2HJWA 4HPJB 2OZKA 4KX5A 4HQOA 3TLMA 1G19A 3U4QB 1HNXB 4Q4LA 4OGFA 1P7VA 1U02A 4D46A 1AX9A 1RQLA 1L5SA 3K9BA 5F73A 3WB0A 2LP4Y 4YDQA 3DUFB 1FS4A 1QLJA 1GL9B 1YJBA 1YJCA 2XQFA 5GAJA 4LJ6A 1GPJA 4I14A 1CW2B 1NVEA 1DXOA 1QE0A 3CF2A 5A1TA 2FPSA 1VGQA 3QBTA 4P36A 4MHOA 5CAEB 4AECA 2WT4A 4B83A 5IULC 1Z8HA 2NOAA 1WXEA 2HO5A 1CEQA 1R0YA 1VXOA 2ID8A 3R0QA 4GMHA 4EENA 2ZYSA 3TPFA 2PLFA 2GPYA 1IXRC 2IGTA 1KL7A 5H4GA 4WK4B 4B7UA 2DEUA 1JHPA 3T7JA 3TL3A 2IYEA 1VKHA 1OZAA 3Q0EA 2WIKA 3DOHA 2QZSA 4LOAA 3ECSA 2FX2A 1I80A 5IDYA 3SZGA 1AH2A 3TPZA 1E66A 1E8NA 3LFTA 3QPCA 5I8ZA 4KR2A 2HZBA 1TM2A 4GO1A 4D5GA 5J43A 1PI3A 4AU1A 1E2LA 1Q0UA 4D6YA 3N2LA 1U0FA 1MNAA 2PSJA 2CY0A 1NJ5A 4S1OA 3S27A 3VTFA 4I4TF 5EZ5A 4JMPA 1H2ZA 1P1CA 2O7SA 3S70A 4YV2A 2ZSIA 1P9RA 1K27A 4S04A 1VTKA 4O4LF 1C1DA 4AKEA 3AJAA 4N47A 1AG9A 3CUKA 1X7ZA 4HGPA 3FYCA 3EWNA 4ENPA 1TW2A 4BRZA 3K72B 1KR2A 4RFSA 5KVQA 5CM8B 4D5EA 1DBRA 2JBHA 2NYRA 4LXIA 1KFBB 4PSCA 1RNLA 2OCKA 1U1EA 2WF6A 4COKA 4ZJUA 5BMVA 1DBSA 2WQZA 4F8JA 1EFPB 5HQ3B 1QQ5A 6CHYA 5FWNA 1P5FA 4G5XA 1IRXA 3U7FB 1K2WA 5CUQA 4F5EA 4MR9A 1GYQA 1BRTA 3PPWA 1Y7PA 2PG3A 4IDOA 1QIDA 3AH8A 5DNCA 1WLYA 1ETHA 1G2IA 1M0WA 3AIKA 2V6FA 1O94C 2Z1DA 4LXYA 4PFQA 3D59A 4G0QA 3MT0A 1FJXA 2G07A 1KEPA 1YDMA 3MRXA 4N39A 2DUUA 1GN9A 4CM9D 2XUDA 1YR7A 4IF4A 1USWA 2GCPA 4QYWA 4HI0E 1Z4MA 3G0HA 2FPOA 4TTJA 3E81A 3RSOA 4KLNA 1ZJ6A 3UUGA 4BL5A 1KPIA 1NBWB 2HPZA 8GPBA 1TM4E 3KZNA 4KUGA 1QIFA 3G0CA 3GJ8A 4NSNA 3LL4A 1TK2A 2YC2C 1IWOA 2XTAA 5E1DA 3HB4X 1SXJA 3G6KA 4JI3B 3LW8A 4BVJA 4ZOCA 1D7AA 5KYYB 2NPOA 3JQEA 4UZSA 1CIVA 2LCQA 2YXDA 3EG9A 5F4ZA 3V7UA 1E7MA 3TRFA 1ABFA 2GZSA 2MSEB 3F8SA 2ET6A 3GJ5A 1XWIA 3TDKA 5IXSA 2VHQA 1RC0A 1A8SA 4TXHA 3I5UA 2PN1A 1PAUA 1U2RA 2VP5A 3G3EA 5EE9A 4KE8A 4II2A 1TCVA 1FNBA 2PFKA 4GOJA 4RFLA 3TZ6A 1HL7A 2WILA 3CNBA 1LBSA 1TE2A 2DPMA 2QLFA 2R1TB 4IRMA 4KC0A 1RYEA 2QG4A 1ZBQA 3ITDA 2P41A 1JQDA 2PGOA 4GI5A 4R0NA 4U2BA 4BVEA 1F2TB 4KQIA 4UTVA 1GTSA 3N6RA 1QCCA 4EYQA 1GKIA 1EX9A 3QKSA 1SCUA 1PD1A 3I9LA 5H9VA 1ZMRA 5FADA 2RGDA 4BFSA 1JMYA 2N47A 4OQPA 2WKPA 1TNDA 4L6IA 4JX9A 1MA0A 1W35A 1IHDA 3C43A 3FB4A 2FRDC 4WE3A 1GQOA 1VHJA 2WBLC 1LB1B 3AEUB 1UKYA 2VSNA 3IJEB 2H4YA 3KM0A 4M9RA 4B0OA 1KIFA 4ZQGA 4KGDA 2QV7A 4F45A 1AQJA 5DWVA 1LW6E 4B2LA 4JI7B 4WLOA 1ZWLA 1RP1A 4K46A 4LI0A 1AS0A 1SU6A 3SKVA 4RDXA 3EVBA 1DC8A 1E5LA 1JVNA 1KZ9A 2DTEA 1IHUA 4W99A 4BLSA 4ZFNA 1YS4A 1J1IA 1VA5A 3SBDA 1KFKB 2EX0A 4CNQA 2BDEA 4JB8A 2CJFA 1Z36A 1N2CE 1BKYA 1AKEA 1SM4A 3TTXA 2I65A 1SWWA 3BBLA 3OESA 4KEAA 3EH2A 4URUR 1TDJA 3QKIA 4XW2A 4EI7A 4W6QA 1ZGZA 4Y6PA 4J1SA 2B83A 4TLMB 4C7VA 4KIWA 4KQ2A 1CDZA 3OCWA 2X5OA 2NIPA 3JQFC 4MP3A 4ZMSA 3TIGA 5C8ZA 2PGXA 3OFSA 3DAFA 1UANA 2IS6A 1T6NA 2ZBEA 1PV2A 3IP7A 2GZMA 3HDGA 1JAHA 2J0QA 1XQXA 1RHRA 2RBEA 4RQAA 3Q7PA 2H1LA 4RV9A 2CNLA 4DCCA 9MHTA 2NX2A 1YIOA 4XPIA 4ZDJA 3O8CA 2QQ0A 2VRBA 4WOKA 2HDOA 2K5UA 3KHKA 5IMBA 4L51A 3BWYA 1JU3A 1KARA 1OQAA 2G9QA 1SCIA 5EESA 3B8HA 4ZREA 3FHTA 5C3UA 3THXB 3K71B 1SOVA 1M10A 1RJ9B 1RMTA 2ASEA 5JLJA 5DO9A 1ML3A 2V5UA 1EAMA 3HY4A 4Q9HA 1LFDB 3DAYA 4URZR 4MWOA 1GPH1 4PNHA 2LIPA 2CV2A 2OCGA 2A2ZA 4JODA 2ZYHA 3T3IA 1LDGA 1R0ZA 3ZLUA 3A2LA 5CITA 4GKJB 2YNMA 2J3QA 5CFQA 4LYJA 1XNJA 2QL7A 5FR1A 3WAKA 1KYQA 1QLWA 3HVJA 5FUQA 3TI9A 1XCBA 3A27A 4MQFA 5A3JA 2GNOA 4Q4JB 2DYKA 4EG7A 1GA6A 5D01A 1LVUA 2MWMA 4HYEA 1FLNA 1BFDA 2EFYA 2GGSA 5H9WA 3IMEA 3LPMA 1EIZA 1MORA 2C0QA 3CBGA 3F6YA 3G17A 1Y8RA 2YMLA 3OPMA 2EF0A 3JS5A 3HNPA 1LSJA 1XEWY 4TM8A 3EB9A 5ED4A 5K0FA 1Q1NA 4F91B 1GPNA 2B9EA 4YRNA 4EPWA 3CO0S 1LCIA 1J23A 3LUAA 3IOBA 3AEYA 3R0ZA 3E9YA 2D5BA 5L9AA 1WG8A 1ZUNA 1H2YA 1R6BX 2EDAA 2C4WA 4G8CA 4GX2A 4K6CA 3RM3A 2CV1A 3DDZX 3QE4A 5IUNC 3ON5A 2OO3A 5LUBA 1SRRA 2Q41A 1VGRA 5E6SB 5EJ8A 3RI3A 1FS5A 1UJ6A 4AN0A 1T4CB 2Q1YA 3I9FA 3KYDA 3ONDA 1BN7A 4QPDA 4YCDA 1V8BA 3MRVA 4J1TC 3TGLA 1Y4AE 2MSNA 4INJA 3RSLA 2PGAA 3AHFA 2LDBA 5CA0A 1S8FA 4OUDA 4UFNA 3EXG1 1YR6A 2YFKA 3LYAA 4YWHA 4FM9A 4HYQA 1ZOLA 1Y89A 1YJ8A 4B6SA 5JJBA 3Q41A 3RTBA 3IAFA 5KNBA 1FFDA 4R2KA 1LJUA 4G8BA 5I3CA 1T4BA 1MXHA 3GW8A 3HU1A 3PEFA 2GEFA 2NLOA 5DXJA 4K9RA 2QN2A 3T0GA 3ASVA 4G5OA 4H1TA 2B7LA 3FI0A 3AZPA 3NHLA 3BZBA 2WE8A 3ENQA 5EIOA 2V03A 3D7RA 3QY0A 3C3KA 3EEFA 1G5QA 2IUTA 1FUEA 4QXPA 3W34A 1AGYA 8ATCA 4G1MB 4WLEA 3H3FA 2ZUCA 4GQBA 3KPVA 2C9OA 3DBHA 3P26A 5AO9A 1OYVA 1RWXA 2FXIA 3IEVA 1GGEA 2JK0A 4MVXA 2RKOA 1U2SA 1ZC4A 1UEXC 3PF9A 1VLLA 1C81A 1O96B 4X24A 3BF7A 1ONSA 4YTEA 2PZGA 3WGVA 1EXVA 3ST7A 3K6JA 3RLIA 1PLKA 1DJNA 3DE0X 4ALJA 4ESEA 4JJ8A 1II8B 3QG5A 1OYOA 2GFHA 2POQX 4TV9F 1Z0IA 4Z3DA 1RQRA 4OI1A 2H00A 2WJIA 2O05A 3ZE0B 4A0RA 3R20A 3NP7A 1GDHA 1JWLA 1P2VA 1RZUA 2EEZA 1YQXA 4CV3A 1OH7A 2IXDA 1HEYA 3F5DA 4IUYA 2VCYA 3JQ6A 4JJAA 3NG1A 4Y2HA 5G0VA 1J0XO 4G97A 3L7IA 1N2CA 5KVAA 2EIHA 5ELXA 1RADA 4HN9A 4LSWA 1FQKA 2QVXX 2JIZD 1O9GA 1R4MB 5THQA 2C2XA 1ZINA 4B8ZA 3DEFA 3TFWA 4BTVA 2DUMA 4Z99A 1H2BA 1JGTA 4PR3A 4DUYB 3N2GA 2O2HA 3G2HA 3ND8A 1DTEA 2WA2A 3CN7A 2DHDA 4OLHA 1ICEA 5B58C 2CW5A 3MJHA 3U3ZA 4JLBA 3L79A 4G6ZA 4MSUA 4ND8A 1RLTA 1TU4A 3OPYB 3TTTA 1LBTA 5F51A 4CTJA 5FEMA 2AMYA 2P9HA 2VF7A 3GLHB 4X1IA 4XQGA 4B3GA 3HJRA 3HRHA 5BWBA 1S3SA 1FUKA 5EPUA 3T61A 2RCNA 3JQBC 4LXGA 4TSFD 5DGXA 3UCFA 1CQJB 2AB0A 4XFDA 4ZZ3A 5CDHA 5L7TA 3S8MA 4EKEA 1QTQA 1F17A 4XGIA 2L2QA 2R44A 3JD3A 3V4FA 2Q5OA 1KDVA 4E2ZA 1XC7A 1OT3A 2J3EA 1FLDA 5KS2A 4MS3B 1Q7RA 1QM5A 4LQ4A 1A3CA 5LDGA 4C08A 3JWPA 4FN5A 4ZCIA 1UBSB 1ZUWA 5K51A 3RUCA 4FEEA 5K45A 4I6GA 1EUZA 1TEXA 4AZTA 3MJ4A 5GV7A 5FOXA 3C3BA 2EFJA 3CO5A 3VAZA 1CD5A 1DEOA 2XGSA 3STUA 2UYHA 1T9GS 3PUJA 3EWIA 2AI1A 4C4YA 2R6DA 4KO3S 1CZKA 5CIQA 3DZDA 4PLYA 1AZLA 1F0KA 4FMDB 1PJAA 1TF2A 3ENKA 5C80A 2XTJA 1NN0A 2GXUA 1BH2A 3E0XA 1QRSA 2ZI3A 1M7GA 4TZTA 3DPIA 3FRJA 4ZOBA 1SEPA 1MG5A 3D0RA 2FXVA 5FL7D 1YJAA 3VAAA 4K26A 1FNCA 4I9NA 1NN5A 3ZW9A 3IRUA 1AHNA 2ZJZA 2Y05A 4WIAA 1RBMA 3NO4A 4XUCA 1K08A 1PG2A 5B57C 1QU3A 1K75A 4AJ1A 5KCMA 4ZJZA 4RK4A 3VO2A 2HRRA 2KWIA 2I6FA 1MNQA 3DV2A 2JIBA 5TQVA 2Q6KA 3WK8A 4BE4A 5C18A 5MN6A 3UJDA 4QJ3A 1EP1B 2CHGA 3DQQA 2QP9X 4H2DA 4MVJI 3B1XA 4XLTA 3DXFA 2OUIA 3EOAI 1JS1X 1Z0SA 4LJ7A 4PSDA 5E9JA 4CIYA 3JQ8B 1EZZA 4H7JA 4HNSA 4EVSA 3WLNA 3IP1A 4M0DA 2YL2A 3UOGA 1QOPB 4QODA 2C8LA 2Z9CA 2I33A 4WACA 5B3KA 1VJ0A 1N2ZA 1ENOA 2HREA 4CIVA 2AOTA 4IVRA 4BN0A 1DMSA 1H65A 2HMAA 3NU1A 1JDVA 4DT1B 3LGSA 1JR3E 2BELA 2V6BA 3GDGA 3A6HA 4DGSA 2BGLA 2XUQA 1TZJA 5F3WB 2RGXA 3NYRA 4GKKB 5AIBA 3JVUA 1BVUA 1W6UA 1X14A 2OM2A 1YHZA 3HA5A 3DV9A 3MD0A 4JBGA 5KEIA 1KTIA 2ZT7A 1EJ0A 2B94A 2V97A 3N6VA 4KXVA 1D9XA 4QUIA 5TR9A 3V4OA 3VNRA 1PZMA 2IEBA 3FDIA 3STXA 2GZ3A 2IPOA 1SQ0A 2O2XA 1NE2A 1UKBA 4LHSA 2O2GA 3H17A 4MQLA 3QSYA 1M7HA 3C5WP 4DWOA 1AHIA 3O8OA 3L40A 4GX5A 4JROA 4CQLA 5B64A 3WNZA 5J1SB 5DHRA 2R00A 1V11A 4WOCA 1L4NA 3AM5A 1FP7A 4MIOA 1U5CA 4RF4A 3AF0A 2JGRA 3OJWA 4BFCA 3AOEC 3ILVA 2O3UA 3OM1A 1Z5VA 1ECGA 1USVA 2KPOA 3PRJA 1WCYA 3UXYA 1GAEO 2V9PA 4QT4A 2JAQA 3U49A 1XXHB 4X3CA 3T7SA 1ECJA 2VJMB 1SAYA 2E87A 4D80A 4IM7A 2PMWB 1WPQA 2BTQA 4DIKA 3VR4H 1V16B 2CLHB 1A9TA 2H06A 4UBNA 4ZV9A 3QNWA 2ZZMA 2R8BA 2YC4C 3BD7A 4JJIA 4RIEA 4GXTA 5EXEA 2FHSA 1OX6A 4M1MA 3N9IA 1E8MA 3KVVA 4NJMB 2XD9A 1B6TA 3SMQA 2XQVA 2WRZA 4C1NA 3P9XA 1PDWA 3FTQA 1JQ5A 1RLJA 4PWYA 3ZIAD 2CDAA 3AETA 3W6OA 1CZOA 5TY0A 2Y1FA 4DY4A 5BORA 3QRWA 4HRAA 2XJ4A 3RIHA 1UODA 3AF5A 3IPYA 4YUWA 1VL5A 1WHSA 3C15C 1SUCA 3R0XA 2MCFA 5JCXA 5L3QB 1JPVA 2R66A 5KDDA 4DSZA 4AC9A 1XJCA 1BA2A 1UFVA 3PU6A 1N6RA 4HLUA 1UMCA 3MOSA 5JNWA 5C7IO 5C5IA 1Y9AA 3ESQA 2JAUA 1VSBA 2XIJA 3WQHA 1H2FA 2ZJYA 4HEA1 3A1TA 4JU9A 3T3MB 4A8JA 1S9HA 4G85A 3Q4GA 1K8YB 2HIAA 4X8LA 1N0VC 1PX0A 5EJFA 3LCVB 2WC1A 3EDCA 3IV9A 2HTFA 2D7JA 2E4AA 3DKPA 3OTQA 2DQZA 3AEKA 3TFQA 2BVNA 2ZYDA 2BGTA 4NQRA 3RYTC 2Q21A 4HF7A 3ZH9B 1NL3A 4YAKA 3GEGA 4MH0R 2JATA 5TNXA 2IIQA 3S7ZA 2E2WA 2VWGA 4X94A 5J5CA 2D2FA 3TUIC 3OFNA 3B13B 5ARBA 4MVJH 4YPVA 4FFDA 4N0EA 5AK4A 2GB4A 5E4JA 3O8LA 3CX3A 1TM5E 4QSMA 5A3VA 4JVOA 3WGOA 3TVYA 3L41A 3AR9A 4D44A 3PQ5A 3GRVA 4B3HA 4CFYA 9ATCA 4RV4A 2H4JA 2GZ1A 1JI3A 2OLJA 2FTKE 3F5SA 1YULA 5DBEX 5CXQA 2XMZA 4WZBE 3ESRA 2VDOB 3TW8A 1U98A 3CVYA 3KLPX 5JR3A 1TIPA 3F7MA 3NBUA 4KDFA 3FWHA 5DGIA 1AURA 2HSWA 2R84A 3L0PA 4CM3A 1LK0A 4KVZA 1V7CA 5FI3A 4DIDA 4Q7QA 1G5TA 3N87A 3LPAA 2XRMA 4R54A 4XSHA 5HHTA 2JFBA 1GVNB 1X9HA 1NYQA 1QO9A 1WLSA 2DTXA 2P6NA 3NCHA 1NN1A 5G4KB 4ZJYA 1DXHA 3JYHA 4H15A 3PX2A 5SZIA 1ZG3A 2HF7A 1EBBA 3SJCA 5FA6A 1E7QA 1DARA 1X6VA 3HJNA 3DXZA 1K6JA 1A97A 2BKVA 1NTOA 3AFIA 4KPEC 2VUHB 3UQYS 4IQ8A 3OFND 3TQIA 5AFSA 1X77A 1A04A 2GEBA 2ZROA 4FNOA 4N0QA 4N6OA 4EB0A 1DIAA 3A10A 2GK7A 3UWOA 3ZK8A 1XELA 5IJ9B 4XM1A 4C4XA 2AC4A 3EF1A 2NP6A 1D1PA 1JSZA 4BQSA 1XTQA 1HEIA 1P1KA 5C1IA 2R7NA 1GA4A 2QAGB 2VTVA 4GZ3A 4UEKA 2FRDA 4D79A 1Y6JA 4YVFA 1Q1AA 3NM4A 3AP2A 2O4CA 3CNOA 3KG2A 4R2LA 4CTKA 3ROEA 3BTSA 1DQSA 3DO6A 3PNOA 5KJ6A 3RRJA 5ALOA 1H8EA 2E85A 5K99A 2N42A 3DHEA 3KKQA 5DKFA 4BNHA 3HYLA 1T15A 3L4KA 5DEIA 1YRAA 4R1UA 1T8PA 3SZRA 2L19A 3WMEA 2R8ZA 4GDMA 4B3JA 3GLIE 4PZUA 1MRZA 1S9DA 2NQ8A 4C6SA 4MWDA 1RKBA 4B3XA 1YB1A 1YU6A 1ZA2A 4KN9S 3FHCB 2C1ZA 1IK6A 4CU2A 1HNZB 2AYXA 3EIEA 2IGBA 2OILA 1DXQA 4YMHA 1Z7GA 3S2IA 1BJKA 4LBYA 2OP0A 1CHDA 4EB6A 3OSZA 4PVCA 4QDTA 4KGVA 1ORTA 4OHMA 1PT9A 1HNWB 4JFAA 3IO3A 6ADHA 2Q5FA 1A7AA 2QN1A 3AF3A 4NCJA 3HRIA 4NV1A 1Z8DA 4O2BB 4BKUA 1QGDA 3I3OA 3PE4A 4IMRA 3P9CA 4KL8S 4NBNA 5I9NA 4KHPB 5EERA 5A3SA 2PTHA 4DZTA 3HFJA 4JGIA 5CPFA 1ZYUA 2GN8A 5A2QA 5KYUB 3SU8A 4R0MA 1Z0FA 3F7TA 4PINA 1UDRA 3RRYA 1BKDR 1X8KA 4O0LA 5JROA 4X71A 1ZCJA 5ITVA 3RFTA 5KPDA 1T5BA 2IODA 2QQFA 2DU8A 3DBRB 5DN6D 5FL3A 1PTJC 3NVAA 4RF2A 2IUYA 2ZTLA 3MGGA 4YBRA 3RIEA 4QGFA 1SURA 2IVZA 4QEZA 5IHPA 5JNTA 4UUMA 3DVAA 2L18A 4XVQA 2X8WA 4G41A 3LY7A 4LZOA 3B2NA 2WIDA 3RARA 3DD5A 4WAUA 2JVKA 4UHFA 3R8CA 2XDAA 5AHOA 1CQPA 3O2JA 3NXSA 2XYPA 1DOHA 1Z13A 1L7QA 2SKEA 4HR7A 3CZPA 3PCTA 4K6KA 4IH1A 1HT0A 2JAXA 5E2BA 4YRPA 1NJSA 3RAGA 3VJRA 2BZ0A 1C3JA 4N5DA 3C48A 4EGJA 5C4IA 2FFBA 2SBTA 1P44A 4RJLA 3PQ8A 1UIMA 1QKKA 1EVKA 1WSAA 1ZHFA 1YO6A 1WXDA 3BFKA 5BO5A 3K09C 3HXPA 3ZXXA 5JNVA 3I61A 1DJQA 2RJOA 3AG6A 4WGGA 3BWMA 4RXMA 3K0HA 3RVMA 3WJ2A 4Q4AA 3ZLBA 1U7HA 2CXSA 4RX1A 1ZUIA 1VE1A 2Y1DA 3K8YA 4MPPA 2JZNA 4DV5B 2R79A 2JASA 3EA5A 3QW2A 5L4LA 5HGJA 3L0BA 2O8BB 4GRAA 4E07A 2EKBA 4BZXA 2LKDA 4KXUA 4OMCA 1X1SA 4A2PA 3PDWA 5KAMA 3Q1LA 3PFGA 3ZE9A 2Z3VA 2YQZA 5HVNA 5TV2A 5HIMA 3EVAA 3KSUA 3A04A 3OMLA 4OSOA 2FQQA 3GFFA 2CNWD 3FLMA 1GZ4A 3GNTA 3KU1A 1D0IA 1U1DA 4FE7A 3HG7A 4FGSA 4IJWA 4MGKR 2VATA 2QW8A 3D6FA 2ACVA 4QTXA 4GMXA 2W58A 3DEIA 1XRLA 2WTEA 4EQ6B 4BGUA 3MHTA 3R7LA 3ZDZB 2AWNA 3NIWA 2QQEA 5KHLB 1ZM2A 1I1HA 3EEQA 4I55F 1I9GA 4LWZA 4RW0A 4EG6A 4P2GA 4OHOA 4QGSA 3KB1A 3U5TA 1QP0A 3RJ5A 4LFBB 3BA6A 3G2OA 3QVTA 1NC3A 1QFMA 3QEKA 5AT1A 5FBHA 4B87A 1BDHA 3WOVA 2CC2A 4UTNA 3EXHA 4M7WA 2JGLA 1XQ1A 4LFAB 3L4BC 2RHLA 1DUVG 1FYVA 2O2SA 4ETIA 5SY9A 3Q8WA 3R5TA 4N9QA 3LT5A 3Q87B 3QA9A 1QGAA 1XCOA 4L9WA 4XEUA 5EE5B 1QZ3A 1TO1E 1U90A 4YUAA 3TIIA 4AUMA 1H05A 1RYFA 2QL9A 3NRCA 5CA1F 5EJ2A 2Z2YA 1VE6A 3C74A 4RZSA 2Q1TA 4GZLA 1VL1A 1G21E 1UAYA 2C9DA 4NHOA 2UVPB 1XZIA 3CXUA 3CLTC 4KOEC 1PR0A 4F4DA 4RJKA 4B31A 2O7QA 2AJDA 2RJ3A 4HMPA 4S2UA 5TVKA 3X1MA 1CQWA 1X80A 1GO2A 3L8MA 1GFZA 3T35A 5AI8A 1OXVA 2VK4A 4ECAA 3A9RA 4TN1A 3PYXA 1V4NA 1HWYA 2TMDA 2W43A 3EVDA 1ECLA 5IKPA 3ETJA 1G9XA 1ORVA 3GARA 1EWKA 4TS1A 3A1CA 4LXUA 1JHDA 1YZVA 1ZGHA 2J45A 3FMFA 4ZQCB 2QPAA 3RYFB 1RIFA 3GCGA 5DHSA 3SYMA 4EVQA 1V41E 4UTRA 1THTA 1GWNA 3SNKA 3C8DA 3PKIA 5C8DA 4P58A 1AC5A 5DLYA 1JUDA 3HL4A 3OP1A 5KC9A 3QGMA 1CP2A 2QU7A 4G1CA 2J6CA 5FOUA 4Q4DA 5SYMA 4RQUA 4DLBA 1AQYA 1C2TA 4Y98A 3EQ9A 4G65A 1WDKA 2W6NA 3CSUA 3RTAA 4P5PA 1U3WA 2NAPA 5A71A 2C7VA 1B1AA 1YT5A 2AK2A 1RXWA 3KQWA 3H4TA 5E1BA 1YB6A 5JWOA 1QIKA 3DMTC 1GPKA 4MV5A 3UJNA 5J40A 5T6BA 4Q1CA 1XK6A 2H4HA 3RSGA 1NONA 1NIPA 2QRJA 4KPUB 1VHLA 1PQPA 2O8DA 5FXMA 3SKYA 3TAUA 2H2DA 2NTNA 3QH4A 3RYCB 3H19A 1TQ6A 1I6LA 3IPCA 4Y2TA 4MS1A 1F9EA 1FBTA 1JDBB 3HYTA 4GUAA 4D0SA 1EGAA 2NAFA 4P3PA 1MPXA 4AZ0A 1TA9A 2BUAA 3PJRA 5ILOA 5T41A 4EFMA 1T2VA 3GFBA 4DA9A 1OT5A 3AHIA 2D1QA 3Q88A 1WD7A 3OJLA 4B3IA 3VR5D 5COAA 1LC0A 1G3RA 1OHHA 3ZW8A 2IZOA 3KJQA 1M6YA 4KGZA 4BHTA 1FW6A 2AN3A 3OMXA 5FTNA 2CFRA 5AI0A 1LWNA 3QM1A 3T7IA 1F5SA 2PKXA 3A8TA 4EZEA 3L5KA 2XE6A 5JEDA 3D6HA 3ZUGA 3DT9A 3QIVA 3DT6A 4YMWA 5F1PA 2HUPA 1T5HX 5D2CA 5JWRA 5KSOA 4NMMA 4K81B 5J59A 2V98A 1C9MA 1OREA 3H6HA 3W3ZB 3N2KA 3VNVA 3IEPA 1SBZA 1TM7E 2CVHA 4GE3A 3RGWS 3HM9A 2JGEA 4P83A 4AIRA 3DL0A 1K97A 2QZ9A 5F4BA 1B73A 2VQEB 3OF2A 5LVAA 2F17A 1ADYA 5CA1A 1RRVA 3C3WA 4PYQA 3C85A 3CIOA 4E94A 5BN4A 4NX2A 1FOEB 5LBIA 4W5RA 2YV4A 3IQZA 4DG8A 5CBPA 5ELMA 5K03A 1TUIA 4QTYA 1VKNA 3OQOA 2JFGA 2YN0A 2F9LA 5JI2E 4LYAA 2FJ0A 1KYTA 3PQDA 5FR2A 1TYEB 4WZZA 3VYTB 2QRPA 2G28A 3AIIA 4R8RA 5IN5A 4KR0A 4AZ3B 3JSXA 5EXSA 3W79A 5C52B 2C2BA 2ZRQA 1E2FA 2H6EA 3KXKA 4MP8A 4ON9A 1GILA 1XD2B 1GN8A 2EOAA 5LU8A 4F2HA 1BD3A 2BRUA 3KQHA 1UEIA 2B4QA 2IFTA 3BTVA 5CDFE 4DM7A 2DR2A 1HRDA 1QH9A 1S2GA 3LNTA 3KXDA 4G1EB 4GP9A 4HAUA 4TV8F 5C1DA 5JD5A 4B80A 3EDMA 2WT8A 1H1DA 1K6XA 1KMIY 1W88B 2C07A 2E9SA 2H63A 4Q16A 3KSRA 1YDHA 3ED1A 4V3CA 2PIDA 1O6BA 5AW3A 4X7MA 4K0KB 5FQOA 1EFHA 1V96A 1PW7A 1VPTA 1RQPA 1E64A 4B8YA 3M6MD 1L6RA 2REOA 3C4QA 3SLGA 3WRYA 4LJRA 1GT6A 3BHIA 1A71A 1DFHA 1ZK0A 1PVOA 4I55A 2YJTD 1G8JA 3OZXA 4RHFA 4W7IA 3EAFA 5DI3B 3VR3D 3HB1A 3LIPA 3T34A 4CR8A 3EOBI 2CYBA 5JD3A 2CJPA 3NDPA 3FWYA 3JQPA 3UB3A 4ANFA 4DVGA 4YRIA 5D84A 5I7SA 2CSUA 2GD1O 3GFVA 3GU3A 1PHRA 1GG2A 2W2XA 4KODA 4YRFA 5ERYA 4DIEA 4DUGA 5A5DA 2IQIA 1FP1D 4ZMRA 1UJ5A 3GZTB 1JR4A 3IDAA 3WB1A 4EA6A 3SSOA 1SPBS 2AC2A 3UWKA 2WTMA 2VL7A 2ZW9A 4GI3A 5EY5B 3SZLA 1FFYA 3MF4A 5JMPA 4RY9A 4V0ME 2P9BA 4ZQIA 2OXEA 3RFCA 1XRRA 3E3MA 5CGQB 4P4LA 3UENA 4EEKA 3TLXA 4CPDA 1ZH6A 3FBWA 4Q12A 5T5QA 4B2IA 1U3GA 3QWIA 4JBNA 5T8KA 3D8UA 3OQVA 1GDDA 3UVEA 3W06A 4RA6B 3DFIA 4RK5A 4DR3B 1KK3A 5DNVA 4KIFA 2DJ5A 3BJMA 2ZIGA 3BWDD 5H59A 2CDCA 3V3KA 1I3CA 2TMKA 4JOQA 3QBDA 4J43A 3KJEA 4CCAA 4B33A 2M98A 1QVWA 1YQUA 5G1NA 3QHAA 2XNHA 1OBVA 3CINA 4X95A 4A0GA 4M0KA 4O0MA 3OZ7A 1VYTA 1G38A 4DCGA 2QY9A 2Q46A 2WSLA 3AWIA 1LK7A 3QVGB 4LF8B 1BGXT 4H7IA 1YACA 1BXRB 1QAOA 3FZNA 4ZVMA 5I48A 2OORA 1UFOA 5H82A 4AYXA 4OFWA 2FSPA 1NOJA 1N2HA 4YJGB 4X8OA 5JZVA 1JFSA 4HMQA 4BKPA 2X3FA 2V0NA 1K98A 1Z15A 3BE6A 4MUIA 4EHJA 5JNUA 2BGNA 2E55A 4FE3A 1IQUA 4R9VA 1GA1A 3ITEA 2P2GA 2L17A 4EDHA 1D8TA 3OFVA 1OKKD 4QEKA 3TNLA 5KO2A 4O4HA 1B74A 5CCEA 3KQQA 3U4AA 3MJFA 2C2OA 3ZV5A 2CUTA 5AXAA 4ETNA 4P9NA 1V4VA 1LKZA 2HMTA 4IIGA 1E9RA 1C8KA 3OHPA 1PR6A 2I76A 4O2BF 5CP8A 5FOQA 4G0OA 5DMHA 3R9IA 4IS2A 3K20A 4BKOA 3RU3A 4JU8A 3G2MA 1M2JA 3B9PA 4TV9A 4WJZA 4BFYA 2OFXA 1E4EB 3PP8A 5JBQA 1TU3A 1GCOA 2QLNA 3A70A 3GT7A 3P9QA 2Z9BA 2JI9A 4PBTA 2BTOA 3GN2A 3I76A 3GRZA 3L8CA 3HWRA 2PUEA 3PNPA 1KP9A 1U0OC 4O1MA 4PNZA 1DTWB 4FYPA 4BWVA 5HW0A 4RKEA 2AZTA 2AFIE 4I50A 5F52A 4IH4A 4UBMA 4FW9A 1H2XA 4G5FA 4JL6A 1QNFA 1XCGB 2DFTA 3GAMA 4AMBA 1ZICA 1V95A 1Z28A 3A9WA 1UK8A 4AF8A 2QSJA 4I9HA 2GXQA 1TI7A 3F4LA 3BGIA 2QN9A 1B6RA 3K32A 4I5FA 2WSSD 4RK1A 4YACA 3Q2OA 3NATA 4GWLA 1Q83A 3D6AA 3QK7A 4DIBA 1KEKA 2JLQA 1Z18A 5CCDA 2OO5A 5LD2C 4BJ5A 2X13A 2AOVA 3N53A 2Q9AA 4IJKA 4PSUA 2AT1A 3CZRA 4RY0A 2RKBA 3JQ7B 3WDMA 3GVCA 3RC9A 4PGAA 2ONJA 4K2AA 1P1BA 2YWEA 4BMOB 3EPRA 5CH3A 1SO8A 2IXGA 3IALA 1I14A 4J07A 4DNPA 4HT3B 4EFKA 1C7ZA 1KMHB 4YAFA 3TRKA 1GNTA 1G8AA 4U6NA 1F1BA 3UANA 3UHJA 3DLTA 1I4TD 4IIFA 4W7SA 3GFOA 1T36B 1XMXA 4WZBA 5AVSA 4R8SA 1Q91A 1ZVQA 4HADA 1YNOA 3WWYA 1DC7A 3NWOA 3VJLA 2ZB8A 5B37A 3ZHVA 4PZDA 4DREA 1XZQA 1ZLYA 2CWWA 3UT0A 4H59A 1KZ6A 4Z51A 3GGPA 1OVMA 3TIFA 1NIJA 2E49A 2KLHA 3ZLJA 1ZN8A 2FETA 2W6MA 3FVTA 3L0OA 4YXFA 1FYFA 2AUMA 8LDHA 4RS3A 2HBQA 4O25A 4F6RA 1D07A 3BRWD 3EZNA 5TPWB 1W5EA 4J90A 1A27A 5KTKA 3CZCA 3ZGXA 3BIJA 2OV3A 4RVHA 4JJKA 2XMPA 1IY0A 4O02B 6AT1A 4Y6SA 1XZBA 5IFLA 1UDWA 5EPEA 4IV5A 2DH5A 3X1JA 3CS3A 5ER6A 4CKXA 5BN5A 4UEJA 5F2NA 3HLYA 3B6EA 4CMKA 1C3XA 1LPBB 2IBTA 3LKVA 3MUNA 4HDKB 1JAZA 5BWCA 1DEKA 1Z7WA 2ZRMA 1U8CB 1OH8A 2YXLA 4UNPA 3BAFA 1QF7A 4RCVA 4MI1A 2OL4A 2OFFA 1SD2A 3A9VA 1EFPA 4DKJA 2R6JA 3BPSA 4TTAA 5K3CA 2VSXA 5D1NA 2AYYA 3I04A 3L7NA 4XUEA 2QVGA 5CDFA 4LOIA 5CW2A 5TVGA 1YMQA 3EF0A 2J0EA 4TWIA 1G8KA 2IXAA 3CX6A 4JJZA 4CQMA 3O26A 4OBXA 3TI7A 1KJYA 2CV0A 1LGYA 3IIEA 5L3ZA 3G2LA 2JIRA 5J4KA 3N1UA 2C3YA 2W7TA 1DV1A 4FFBA 3K73O 5HCIA 1W2GA 3ZY4A 1ESCA 1BMFA 1TD1A 4JR0A 3SHOA 4DMMA 4DBZA 2OZLB 1DX6A 2GEKA 2LW7A 4XWAA 1XR3A 2SCUA 4Q39A 3S2YA 3ASUA 3TOXA 3UCXA 4BJ6A 3KV3O 3HACA 3QKUA 2XEXA 1U8FO 2WU4A 3A2NA 3K8ZA 1PZNA 4FS3A 4IIUA 4X90A 3DC7A 4C0AC 2VUUA 5BVHB 3CTMA 1RKQA 1W19A 1YBFA 1B0UA 3CB4A 3E9ZA 4OI4A 4EZBA 1JPNA 1PEAA 1UJMA 1HSOA 3U31A 4R2HA 3UMSA 2P3QA 5C8XA 1RKUA 2ZR0A 2HLNA 3CQ9A 4F71A 1VZ3A 1OGYA 3EARA 2I6UA 3V48A 1KJZA 2IEGA 2PTGA 3C6QA 1CJTC 5CB6A 5IDXA 3RRZA 1T5DX 2B69A 2GLTA 1GCAA 3RIYA 2JARA 2YN2A 1NOKA 5DX0A 4BQQA 3ZBPA 4FPXA 3MGBA 3TH5A 4L07A 4OL0A 3R23A 2E5WA 2XVXA 1RLIA 4X3PA 4GF5A 1DVRA 4FCVA 1AS3A 2PSSA 3RVLA 3U7QB 2FI1A 1OWPA 3ICVA 1WUTA 2ZT6A 4JEIA 4B76A 4AYWA 4G0WA 5JJ5A 2O57A 2Q4EA 5DYWA 5JE8A 2BBOA 4A8HA 2GUGA 4X6XA 5JMOA 2A7QA 1HDGO 4QJ5A 1HG0A 2A1UA 5FA5A 1D6NA 3C3AA 2CNOA 4Z9FA 2REBA 4LBWA 2JJ2D 2Q07A 4BJHB 1S96A 4PN3A 5JYEA 5NULA 1FTGA 1EXWA 1TRKA 2IU4A 4LKRA 2ISCA 5KWJA 4X64B 4C4ZA 1OLOA 4QO7A 1GD1O 4HMOA 5ALHA 3KTOA 1D6JA 2B5WA 2FLVA 2JLBA 2OAP1 1TKCA 1IVYA 2GCNA 4GYYA 4RMNA 3GLIA 4MZDA 2D1SA 1QB8A 4P31A 2WUDA 4YMIA 4Y18A 4UJ3A 5I9TA 1AD2A 1XDBA 4W6ZA 3U1TA 2IS4A 2E5LB 1G16A 1K1EA 2BGIA 1EEHA 1KK0A 2M2IA 2BFMA 4MQ4A 2QW1A 4YCJA 1H0HA 1PFKA 3E7DA 3WSWA 2PGJA 2GA8A 4JUAA 2R4QA 4EELA 1J00A 5EZ6B 1Z56C 2W98A 4IH9A 4PC7A 1DRJA 3GGOA 1ZMBA 5U1PA 5K9ZA 2CBXA 2EKZA 4JENA 3CLUC 1GEEA 1JIIA 1JF8A 1O5OA 4QECA 5FWYA 1JECA 2IIPA 3JVDA 2NMVA 3H2BA 4E2XA 4QGAA 4WN3A 5JBNA 3I5MA 5TPWA 1C80A 5LDDC 4WL0A 4ZV7A 4ABTA 3FCYA 1BYUA 4TL7A 4EGQA 1RZRD 1R5OA 4ALMA 2L0XA 4MUYA 4B0PA 5FBRB 3C3MA 3OLZA 3EJWA 3QFCA 3ICWA 5IM5A 3ESAA 4DABA 4UHBA 5ALLA 1G41A 2W2TA 5B7PA 1A5AB 2VTDA 2WWTA 1W85A 3IUNA 2R8RA 4PSVA 3CPEA 3RD5A 5AQ1A 2C29D 1GUBA 5CLIA 4UQLA 4UC0A 1PR5A 2WQ7A 1TYBE 2OMEA 1UP4A 3P0HA 1N92A 4XWGA 3UMGA 2ZBVA 4ZCTA 1KI2A 1V1RA 3MAAC 4M9QA 2IIBA 3M82A 3MEQA 4G09A 1S2MA 1E98A 2F9FA 1JZTA 1ZSVA 3U7HB 5NLLA 2W6CX 3UV3A 2I0FA 2WYIA 3L18A 1HTWA 2A5GA 2QMUA 4PLPA 1E5TA 1S2DA 3MJDA 3N2YA 3KTAA 4OMFG 3CMMA 1T4DA 2QX6A 4YIKA 5K3FB 5TT1A 3WRVA 4LZPA 4DEXA 1AHPA 2J5QA 3MCAA 2H2IA 1WKVA 1Q95A 1KZHA 1TQHA 2H07A 1R6UA 1TM3E 2CLDX 1UM9A 1NBME 3FDJA 4Z7NB 2D6FA 1C8BA 4US0R 4D82A 2H1CA 2GPTA 2D74A 1VGVA 2NYUA 3FYUB 4TT3A 5K0LA 3MG9A 2VT6A 4TUYB 3G2KA 4CEHB 1WCXA 1K4KA 2HWYA 4CLRB 1JVSA 1Z7YA 3PK0A 4MAAA 2FEWB 1JFVA 1FUIA 2Z4TA 3HBNA 4Y2UA 2QR3A 4JI5B 3ZWYA 2Q5QA 2H08A 4O3MA 4K9NA 1E79D 2G82A 2X5XA 4OFZA 2ERXA 4UTXA 3EVTA 3H0CA 3EAQA 1Z12A 3TD2A 4OKIA 2J3KA 1QS0B 1XK7A 2VHWA 4HDNA 5ES3A 2ZCJA 3PD7A 5ADHA 1VIDA 4LYFA 1PTKA 2HO4A 5CLGA 2GAFA 3LVQE 4IAOA 4LHYA 2Y1WA 3ZLVA 3D4IA 3OY2A 6NULA 1XMIA 1PS9A 3PFWO 3UW3A 4M1TA 1XA4A 3K70C 3KYDB 3D4LA 1E69A 1V5WA 1ZL2A 4OA8A 4QOEA 5C1OA 3FA2A 1UCFA 2O7NA 3TCXB 1RPZA 2XOKA 2BFDB 2BV3A 2IYTA 5TIIA 3KZOA 4Y6GB 3USES 1TAGA 4OLJA 4BWFB 1TECE 1RYBA 4PHTA 3PE6A 1PFWA 1SKYE 3TCNA 2QTBA 4JBLA 1HV8A 1HPLA 2Y1OA 3BXPA 3WMWA 4F3KA 1BHO1 5A3QA 1FYWA 4YH1A 2BSQA 3OKFA 3K0SA 4BIMA 2BRUC 3PTZA 4FHCA 1HBJA 4DCMA 4C07A 2CXXA 2PX6A 4C0JA 3TRJA 4H0CA 1SKYB 3IO5A 1Z17A 4KRGA 1IBKB 3IPRA 3GRYA 2C3PA 4C0BA 5LB4A 3P45A 4EEZA 1LPNA 3SEQA 1WNFA 2F62A 1QRTA 3ELBA 3GAFA 4CKBA 5HUQA 4YDHB 1H3FA 3D3KA 3RVJA 1R6XA 3CKLA 2YXPX 4FHDA 4G0YA 2XKKA 3GUYA 2C2ZA 2V7GA 3KOZA 1VRCA 4M1ZA 3SI7A 1C9KA 4MUJA 4W8GA 2YYAA 1Q57A 3T5CA 3V1LA 4ZZ0A 4IQ0A 3D4NA 4O6VA 5CMLA 5EXDA 1TQ4A 5T3YA 3WG9A 4FR5A 2W2NA 3G2IA 4WOBA 2A1IA 4NAUA 4DJDC 1YQ9A 2YJ5A 3G0GA 3G5TA 3LO5A 2XYHA 3EWSA 3N7UA 1ZUD1 2WSYB 3GFQA 3HXTA 4K6GA 2A9RA 3GC6A 4KCGA 2NADA 4W5JA 4YQZA 4DS3A 1LPSA 4MEJA 1DBIA 5BN1A 2H57A 3S81A 3MYYA 4TVBA 2WJVA 1WU8A 2GRAA 4ROSA 3VKFA 2XUKA 3SHVA 3FCCA 4R68A 2O7RA 2GRJA 3R5SA 1NKSA 2R8XA 2BWJA 1Z5WA 1E20A 1NPDA 3JWJA 3EDRA 4HDRB 1NF3A 2DQKA 2VRCA 3MS7A 5AICA 3VTKA 5B4UA 3VOTA 3SDBA 3I8XA 3LHIA 4GKVA 2NTYC 2WSIA 1LXCA 4MJ3A 1PVDA 1YL6A 1KVQA 3ABRB 4HS4A 3TVDA 1Q50A 4YJHA 1XCPA 3JQFA 3E3OA 4ZQBA 3ZU5A 4DA8A 2BFPA 2XOEA 5DH9A 3GRRA 4JYCA 4HFMA 1KVTA 3EQZA 4MPDA 4EG4A 3CUSA 4YP9A 3CRW1 1R0BA 3IMFA 3OUTA 1WF3A 4HNQA 3CZMA 3GT4A 2O0KA 4YRJA 3G8CA 4MS3A 2FQYA 3CRMA 2YRFA 1T3SA 3QIAA 1QUFA 2QNRA 4UZEA 2FPPB 4WKBA 4E5MA 2BF7A 4LPSA 4K0RA 4C6TA 4OHBA 4EHAA 3FMGA 2QRQA 3C8ZA 2EBHX 4UKDA 2G80A 4UMVA 2CLSA 4C7JA 1OU4A 1WW3A 2Q4TA 1FX0B 5KTRA 1ISJA 1GXSB 1UBGA 2AJBA 2YKGA 1BSVA 4ACBA 1KWGA 4OHUA 3WOHA 3DH0A 2JF0A 3DAGA 4IWYA 2PLWA 2A33A 5A9SB 3FPLA 1E8DA 1NX9A 4U0JA 4U7PB 4B75A 2QD2A 3PHCA 4L08A 1L5WA 1Q3HA 2CXUA 4MINA 2LD4A 2DETA 4M7OA 2CKMA 4MV9A 1R37A 3NGXA 4I8XA 5AJYA 3NWPA 1MVLA 2RE8A 1QFZA 2V45A 2XB9A 2REQB 3OIFA 1VECA 4RVDA 2IYYA 4KACA 2JGKA 1XV5A 4REQB 4AN4A 5MN5A 3N5KA 3ILHA 4JQSA 3JQBA 3U9LA 2BE9A 3FDFA 4QFMA 3HO1A 2EFCB 3AFGA 3LWDA 2P2LA 3KB2A 2AUNA 3LTEA 2WUFA 2AD5A 1GRCA 4JGGA 2GJ9A 4M21A 1IPHA 3V8VA 3HXQA 5K1ZA 3FSEA 3T3PB 3VR2D 1PT5A 3W1EA 3MGAA 4KUHA 4OG2A 5CYFA 4CV0A 1NG9A 1LW7A 2I80A 3CX7A 3R3SA 1E3JA 5JQGB 2IH4A 1O2DA 1F1JA 1UZMA 4U8GA 4PLWA 1G20A 2GLUA 1LJLA 3NBXX 5DGDA 3WQSB 1MC8A 1JXAA 3COWA 1A7JA 2QI9F 1YZFA 4UMDA 1E1CA 1HYEA 3BKWA 2OHOA 1RWBA 4HVAA 5JSZA 1STOA 2XYRA 4KQEA 5BXQC 1KDTA 1RYNA 3FNHA 1GPDG 2H9YA 3QVUA 1JTEA 1AZWA 3IDSA 4QBKA 1P62B 3RNOA 2Q1WA 2DPGA 4UTZA 4ZWNA 3WYDA 1ODFA 1SMKA 3G02A 1BJTA 1FFCA 4QLAA 4XWTA 1MP0A 3L1IA 2FUNB 2X5KO 2XNJA 3WK5A 1L5KA 3BN3A 1QTIA 1XMPA 4J1QA 4NABA 1UZAA 3QXHA 5CG2A 3AI2A 2OUKA 2FPGB 1XKXA 4TX1A 5F3RA 2F43B 1US8A 5C5DA 3SQWA 1SKQA 4M8SA 5AVVA 5JALA 3RREA 1ONNA 5LZ9A 3IVCA 4IOJA 2O8FA 3W3AD 2IITA 2VJAA 1FNDA 4PC3A 4WWHA 3SS9X 3ZE7A 4BO8A 4F4CA 5KZMB 4JX8A 4O63O 2VTBB 2G1KA 1EK6A 3TGWA 2HHLA 4DIUA 2UVQA 1HDYA 3QVMA 6REQA 4CL0A 1HT3A 1L5MA 3TVTA 2B6HA 2O0LA 2EU8A 3T9BA 1SUPA 2WZCA 4OFXA 3VNBA 4BBAA 2VPZA 1JWAB 1J9GA 1Q3KA 3FM9A 4KN6A 2B30A 3T95A 2G5CA 4IZ6A 3E3NA 4P7KA 1TT5A 2YYSA 4R4JA 5SYAA 2AG0A 2A86A 4H7PA 2KLBA 2RJNA 2DWQA 3BG5A 4QJBA 5EKUA 5HKOA 2XXAA 2DGDA 1DKQA 3HA3A 4Y67A 3VSEA 3L8GA 3HNRA 1YHNA 3OF5A 1GZ6A 1X1EA 2Q0HA 4EYOA 1F0PA 1KMCA 4OQEA 1EFVB 1T1EA 5AOCA 4IIDA 3AINA 1RFGE 4LZNA 3V7NA 2O1SA 3JPYA 3R76A 3IVGA 4JSYA 2QE7D 2YN4A 4G86A 1U94A 4URFA 4DTCA 5M2QA 3U3OA 2GKGA 1LEHA 2DFNA 5IH3A 4HL6A 1URPA 4BLWA 4QUAA 4ZYLA 3D5EA 5B12A 3T54A 3P2OA 4FWTA 3CVUA 3CT6A 4ENWA 1FY2A 1R0LA 1JAIA 5I3ZA 2CNNA 2HT1A 4R16A 1ECCA 3AW8A 1HFJA 2G3YA 4QEDA 2VRCD 5FBZA 1ZNYA 4F56A 1ISPA 1KK1A 3BFXA 4M9UA 1B1CA 2I1LA 3GPBA 1PIWA 1AA6A 2VYVD 4NBUA 4CDGA 2J07A 3SP1A 3LUFA 2Y3IA 5LA6A 3B8EA 1MPTA 1A4IA 1R4NB 1ZS9A 2LCFA 2Z04A 4RWZA 2UV8A 3ENZA 4ZTZB 2ZJ6A 4MKIA 4NYIR 4K87A 3I83A 4F1KA 5EMMA 3HSKA 3WWOA 1WMEA 2ZM5A 1H5UA 2I54A 3DWIA 2NPFA 4NZPA 4N4AA 1U9CA 1J25A 4OHPA 4UFPA 4FGZA 1IIRA 1IL0A 1UMDB 2MU1A 3V7WA 5LOVA 1AB5A 4D9CA 4FBMA 5G0SA 1RP7A 1V3UA 5AKJA 4CKYA 1DO8A 2JLUA 3TSZA 1JLSA 2OFPA 3DEZA 1KAHA 4EF4A 4FMBB 3E5HA 1NVWQ 3NASA 3KL2A 2JCXA 3VOBA 2QUKA 1Z39A 2RIRA 3VR1A 2VI5A 3C3JA 4IIJB 2J3MA 3SS7X 4EATA 3GR6A 4BFVA 4NF2A 2X0JA 1ML4A 2AR7A 2P8SA 1F4LA 2NZXA 3R3HA 3T99A 2D2VA 2XX3A 2G08A 1YE8A 3H5TA 1GTL1 1YDEA 4GD3Q 4TQUS 3H4IA 1VLHA 2Y27A 1ZD9A 3A1WA 3LRXA 2H7VA 3KUCA 4KH0A 4R69A 3ZOKA 5FDFA 1CLUA 5JDCC 1ZNQO 2XUPA 2YV1A 4W5WA 4UUBA 4R5MA 3EPJA 1Z4NA 5LLSA 3DLBA 2XZPA 1J06A 3PIIA 3RBXA 3GP8A 3CVVA 5HKLA 2CDNA 1CR2A 1JIKA 2FJUA 4JZKA 4UHKA 3ZZNA 1CJSA 4GC5A 4ONEA 4V2IA 3WKAA 1KXJA 3H7AA 1DAMA 2ZRIA 4A5SA 2QMYA 3ODGA 3A11A 4CL8A 2OB2A 3P27A 4Y8VA 1NUUA 1PLLA 1G17A 2X14A 4LRTB 3WRWA 2ZRAA 1T0IA 2ZT5A 2EP5A 3DDUA 3MGKA 5I4BA 4HZIA 4HNGA 4FCCA 2Q1UA 5FHRA 1DL5A 4DCOA 5E3JA 1E0AA 1QOQB 5HMMA 2GJKA 3X1ZA 4XTRA 4BO3A 4NCHA 4UREA 4XX1A 3CZ9A 5K6AC 3COPA 3GEEA 2H92A 4L15A 5HWSA 3NKFA 4QGHA 1TF7A 5LQNA 3BJEA 4QO8A 4CU5A 4DMUB 1A2QA 4OYLA 5E6RA 2WWYA 1QANA 1M8FA 1WXFA 4O2RA 3HJUA 3F3KA 4IEEA 5IZ4A 2D5IA 2ZP1A 3CLVA 4TV8A 5DB4A 3NKVA 4Q9DA 3P9RA 1MH9A 2OCLA 4NFYA 2BEJA 3H11B 5I8WA 3F6SA 1G8FA 5COQA 1CIJA 2JH3A 3GA5A 1WKCA 1H0RA 1JDSA 2YHIB 4FWIB 5DWQA 1G6OA 2AN1A 4YK7A 2DC1A 5HJEA 4M1EA 2GPBA 4Z49A 1OW3B 5KNCH 4RGYA 5H1YA 1DG1G 1SZDA 1WW8A 1Z2PX 4KLAA 2YX1A 2CMKA 1LNSA 2QRNA 2I1QA 3UC9A 2X8LA 5G41A 4PSKA 4HVTA 5B1YA 2CB0A 1B16A 1B26A 4XR9A 3ESBA 4E3WA 2WU1A 3RJMA 1NVXQ 4UNQA 4C7KA 3QFHA 4ALIA 1X7XA 3AFNA 3KDAA 5MDHA 3TF5A 2VQ6A 3FFXA 3MLBA 1T8YA 3STTA 4ZCSA 2ZZKA 3L8EA 5DW3A 2OG2A 2PZEA 1V6SA 1J2TA 2VZEA 1TTHA 3KWFA 4M87A 1E79A 1TEVA 1NY6A 2FPKA 4R2WA 4ZV4A 1H4QA 1UQTA 2PX5A 5BQXA 1XLTC 2K2WA 1V39A 2GKOA 2Q9UA 1HORA 2CVQA 4U2EA 3R4VA 4DCVA 5CDTA 3E9EA 3LXXA 1GRNA 2OV1A 5BNTA 2FGKA 4RHYA 3BXOA 1NZDA 4I1VA 4WLUA 2DUNA 1QH8B 1XMSA 3NGLA 4PW0A 1HG1A 2DHCA 1DADA 3D8NA 3I37X 2WVGA 3ROPA 4DDHA 1FLAA 2OYRA 5HGXA 1GZUA 2C82A 1JT9A 3A1VA 3RSHA 5CB4B 3X1XA 2WJZB 5KWVA 2OV2A 3BFVA 1PQWA 2UZ4A 2FPWA 3RWMB 1JB9A 4MJLA 3D8HA 3M6AA 4FQ5A 4GEKA 4LISA 1S6YA 4LDZA 1L5ZA 3WVNA 3FUVA 1QIHA 3L7YA 3LQKA 4WRRA 4DMLA 4EY5A 1YZTA 1ZW6A 4YJ2F 5FO1A 4C4SA 4ENVA 5C4GB 3WFZA 4W5QA 2C5AA 3QYPA 1SB9A 3L6CA 4DLWA 2F4VB 3OPNA 4U7JA 4BBZA 3VPXA 1R7RA 3UBMA 2VJNA 3ZYCA 1AK1A 1B3RA 3MHPA 4BXOA 2AOXA 4XASA 2GX6A 1ZKMA 3KK0A 4YBZA 1E4YA 3G8DA 2OK7A 1ZD4A 2IOYA 1BE6A 1J8MF 3HCRA 1MO4A 2RI6A 3OQBA 1JDNA 3PUXA 4HEQA 4ZPJA 2CFOA 3B7GA 4XCVA 3CMCO 4YP5A 5LP6A 2IUSA 1S8NA 3ZY3A 1MQ9A 3HB9A 5L3VA 1HO3A 1V5EA 3F47A 1EYZA 2G9VA 2MYNA 4QPNA 1K3FA 4Q02A 2A6PA 1E2JA 2I78A 3WYEA 3ZXYA 4M1YA 1M1UA 1N6KA 3EIXA 2NU6B 4YROA 1JR3A 1NU6A 2X7JA 4KQ6A 1CKEA 1I3MA 3RNLA 3DWFA 2QTTA 4PFKA 4UVIA 4NNPA 4R1PA 5HP4A 2ZB7A 4RY2A 1CRZA 3OTHA 4RIGA 2JA2A 1PWEA 3GH1A 3PICA 4J3JA 4OPMA 4W9NC 5DBFA 3RANA 3WLIA 3H5IA 3K30A 4NULA 3OU6A 4OXQA 2HCFA 3ZDYB 2R6ZA 1K7FB 3M6XA 5DZSA 1CCWA 1GZHB 3NV9A 4HYYA 3PGXA 4MLCA 3MPOA 4R2IA 5ALUA 2DT5A 3ZGYA 3QE9Y 2O59A 3VC3A 2JVJA 3OEWA 1QHXA 3X1KA 3DEAA 1DKRA 2PRJA 4ZVUA 2VDQB 2JKZA 3UJAA 2VNSA 4JL8A 2DPHA 1AQIA 5FTWA 5C46F 3DZIA 1CRLA 5J63A 3D7SA 4LZLA 4NKRA 4MW7A 4IXTA 1NW9B 1VL2A 2CUZA 2GZ2A 2ILTA 3GDHA 1UKZA 3WGGA 4AY3A 1I9CA 2Z98A 2YWRA 4GI1A 4DPLA 1U7PA 1YUBA 1QYDA 3FPKA 3HA7A 2VWPA 2XLCA 5E95A 2FP4A 1M0SA 3NEPX 2P79A 4NI5A 1DAHA 3SF8A 1ZHOA 4M88A 3AVXA 4G5HA 1L4EA 2UVPA 3BS4A 1VCNA 3JRXA 2ZSDA 4LJ8A 3RJZA 3SE7A 2DWCA 4BO6A 3GRUA 1XCJA 3BE4A 3H9CA 3OIDA 2IV2X 2B9VA 3WGLA 3ZN2A 1XRSB 3SYLA 1VOTA 3OQIB 4I9UA 2AQIA 5EJIA 1NMXA 2YZ7A 5AI6A 3ZDRA 1IBRA 4OL9A 4XLZA 3DJFA 1KYYA 5DK4A 3KHUA 2R5NA 2FEPA 3PDUA 4JP3A 4CF3A 1NW3A 1GFSA 2HLPA 3FNFA 4MKFA 5FUBA 4OTZA 3K1JA 1XQYA 4X6UA 2ZJ2A 4BAZA 4DLVA 4OX9Y 1BZYA 3LVFO 4PU0A 1DO2A 4AMGA 1Q1BA 4WMLA 3E5MA 2I4IA 2D0DA 2I2AA 5K2MA 2ABWA 2IDJA 5F7ZA 2OC9A 3MVEA 1R8QA 4RZXA 2LUOA 1ZNXA 3E1GA 3NPAA 5ADUS 1HYQA 3VH3A 1VMIA 4GGOA 5L3SB 3KKOA 3LOPA 4OP3A 2I9KA 1G1MA 5AJHA 1LF5A 1FZQA 3BXZA 3DWEX 4OY3A 1T1RA 3U3KA 3DNFA 3IT1A 4BPRA 4WUVA 4F2GA 3REFA 3MC1A 3MT9A 1Q0PA 1CY0A 3BCHA 2ZQYA 4N49A 3M6LA 2B98A 3WRXC 3UIEA 3ZXIA 4H16A 4JLOA 3DP7A 1WDLA 2HV9A 4U6QA 3RT9A 5IVPA 1DGQA 3PSHA 3GO4A 5D3QA 4N9WA 2FV8A 1V6AA 4U2DA 4CQMD 5DCWA 3H2ZA 2ZOSA 4P6VF 1LD3A 3DYBA 3RO7A 1E5DA 3ZV3A 4DV7B 1IG3A 1RTTA 2VF8A 4L27A 2OFWA 2VEOA 3U09A 5E4FA 4FDAA 5DP2A 4RK0A 5DCLA 2GT1A 3EA4A 2PBZA 2D1FA 4W1PA 3TE7A 4ENRA 2DP4E 1L8AA 3ZWOA 4FI3C 2D2IA 4TZKA 4DUPA 1IWBB 3I39X 3E3LA 3VU9A 4BNLA 1Z68A 1CJBA 1U0LA 2KX7A 1RHKA 2ZTSA 4FFMA 5J5VA 4S12A 3ZCUA 2HMWA 1WQ4A 1JDTA 1GRQA 2FR8A 1ZI6A 4HLDA 3SQXA 1LBIA 1EK1A 4PLVA 3RTCA 1MVOA 1P1JA 2W6QA 7AT1A 5KTNA 1S5PA 3WR5A 2BI4A 2XWQA 4GNKA 4G8DA 4DEVA 1KO4A 2JLCA 3VSAA 3KSBC 2WHXA 1ZXXA 1L1EA 1H2RS 5JXIA 1J6UA 3IOMA 1PGQA 1QIEA 3K09A 2I34A 3ECCA 3GD5A 5AKGA 5GONB 4PZ9A 3G23A 3IKVA 4Q4CA 1FRVA 1P6XA 1QCZA 3MOIA 2OE2A 3T7RA 1CEEA 4WOJA 1E7RA 2H11A 4RM3A 4E2YA 3PNBA 2Q62A 5I9MA 5I4CA 1TJNA 3IS3A 2G7MC 4A26A 4AM8A 3FVWA 2XVZA 4BVBA 5AKLA 3E7FA 4AZ3A 2X2EA 3BJIC 4K8RB 1G2PA 2YASA 4YA6A 4W5OA 3A1DA 3CE6A 3GPIA 2FWNA 3QOWA 1W76A 4JBWA 1SBHA 1ZCBA 1O6FA 4HFRA 3NUGA 4X20A 4ZO6A 1L1FA 1HK7A 4I66A 2JLXA 1SH7A 1JMKC 4YRSA 3ZI4A 4BRSA 5JAQA 2C88A 1UZUA 1YRBA 1TA0A 2C20A 4ND6A 3W8NA 3WWDA 5HK9A 5JAHA 3LUJA 3MAJA 4ME6A 1ZMXA 4BQFA 2IE0A 1ODSA 3PT5A 5AVOA 5A4MS 4JUFA 4A91A 4PEVA 3OFKA 1UBRS 3KP1A 3OZFA 3GCXA 4IVPA 4PO1A 1OIXA 2IZ6A 4OQFA 4HQ6A 3MWGA 4YJDA 4FBLA 2XKAA 2QEQA 4B7CA 1JEDA 3K8OE 3EXFA 2Y4NA 3ULKA 3E70C 4G0VA 4B82A 1P1RA 4D4KA 1KC3A 1E18A 3GQBB 4M0CA 4GICA 4P86A 3UAXA 4BEWA 1N77A 3SEAA 4IDHA 4S2EA 4YHHB 4I4IA 1RJWA 2IHVA 5ALTA 2VJLA 3VYSB 1HSZA 4MUAA 1MUUA 2WHYA 1UPAA 4J16C 4QQKA 3KB8A 3TN7A 2BLLA 1G7SA 4D92A 1XEXA 4RLQA 1YZLA 4UVHA 5H16A 3VH4A 2R5FA 4FYWA 3TGPA 1N5MA 3TR0A 5A02A 4F4IA 2QORA 3VR4A 1MGOA 4LXXA 1PEDA 1ULUA 4YJ3F 2I62A 3EHEA 5LQSA 1JQBA 3UYLA 1JHMA 1SWVA 3CH4B 3K53A 3KT0A 5BSWA 1PNOA 2FFHA 4E32A 1GSIA 2I71A 3EBPA 3L1VA 4IDAA 4EVIA 3NDJA 2X0KA 4Q05A 3HXKA 3MB5A 5I4KA 2V1UA 3M4JA 5HF9A 1OKKA 1XKQA 4LOHA 5CCBA 2B25A 4ZAGA 4V0OA 2R1ZA 2A9VA 2P9ZA 4WHMA 6YASA 5IUJC 3U7GA 1RAEA 4B46A 2VQDA 1W52X 5FBLB 3HBFA 4K1XA 1XTKA 1KQGA 1XUOA 2ZRHA 3VR6A 4DDTA 1IY1A 121PA 4OHFA 1CS0B 1T13A 1NM5C 1U31A 2PGDA 3H84A 3IAHA 4YRDA 3S55A 4YT2A 3F8WA 5CYGA 3KJHA 2BFFB 3LT2A 2CZGA 4DYDA 1QRDA 1CF2O 1RMYA 3QELB 5HCUA 1DHRA 3RABA 3F3YA 5LPNA 3FYTA 5BR1A 1NLFA 1Z6QA 2JLYA 4GM1A 1LS1A 4W1QA 4Y30A 3KFLA 1DWOA 3LPDA 4Y0NA 3RG2A 4TXJA 1PQUA 1IEVA 3C7AA 4HB0A 4PPQA 2D2EA 3UAZA 2ZAOA 3FOCA 1U3CA 3M6FA 2CBGA 1A5TA 2EHJA 3A3YA 3OHMA 4IG9A 4O5AA 4OREX 3LC2O 1AGRA 3WYAA 4ID9A 3GLGB 3AB7A 2Z56A 3WMRA 1LUAA 1IXZA 3I01A 3QBJA 4HAWA 3I01M 1XA3A 2NZUG 2PS3A 1OAKA 1T3HA 3OKPA 4OXRA 5IZCC 1K3UB 1CUYA 3O8DA 5B1IA 1J90A 4A6XA 1E4EA 2GJ4A 4PIVA 2AJCA 3TSYA 2GHRA 1Y42X 2JDIA 3AL2A 5CEEA 4JB0A 2QZPA 2PZJA 4CT4B 4J0HA 5GIPE 3CX4A 4JKIA 4Q4HA 4ZA2A 4KV9A 5JYCA 2QUZA 3LK7A 3OQJA 4Z54A 2P78A 3HYNA 2W0MA 2R6CA 3EAGA 3UG7A 1GUAA 4TOIA 3HJGA 5KJEA 3DLPX 2VBFA 5ALPA 2CVPA 2WJ6A 2WSMA 1NW8A 4HQ0A 1W29A 1UZLA 4FYVA 2O0JA 1YC2A 2WJ3A 2QS9A 5HPYB 3VI3B 3MW8A 3D0KA 3B1WA 3K2EA 3V8EA 4FBGA 4D99A 5IC5A 3FUUA 3ICQB 1O8BA 4PG8A 5IRCD 4GOXA 4RYLA 4DA4A 1VBFA 1RABA 1WCWA 3QVLA 3EODA 4KBYA 2PUFA 3LY5A 4R81A 1PWZA 4YJ3A 4I8DA 4G9EA 2JRLA 2O14A 3UOWA 3WLKX 2O07A 3K6RA 1GU1A 3DAHA 5KDLA 1YS7A 3NS7A 1EBUA 1N6LA 1C3VA 4E7OA 1TAQA 3V42A 2QD4A 3PWTA 4YAJA 1TJ3A 4CLDA 4JC5A 3RSCA 4RKYA 4V0LA 3WGZA 2FU5C 3S6JA 1CUEA 1W36B 4PIMA 3NC4A 3ND6A 3NANA 4OYYA 4C6HA 1KEEB 5I6DA 3O90A 2IHZA 4GYJA 1GLVA 2I3AA 5C35A 5I7UA 1W47A 2OZPA