3P4UB

Crystal structure of active caspase-6 in complex with ac-veid-cho inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
92
Chain Sequence
YTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFKDPSAIGKKQVPFASMLTKKLHFFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of active and inhibitor-bound human Casp6
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
total genus 23
structure length 92
sequence length 94
chains with identical sequence D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2010-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3p4uB00
2C2OB 1NMEB 1RWNB 1RHMB 3P4UB 2CJYB 1RHQB 1GFWB 2H5IB 2FQQB 4ZVQB 2CDRB 2H65B 4ZVRB 3KJFB 2H51B 3KJQB 1RWWB 3D6MB 2HBQB 3GJRB 3GJTB 2Y1LB 2CNLB 3D6FB 3R6LB 3R7NB 1RWVB 2HBZB 2CNNB 2H5JB 2CJXB 2QL7B 4LSZB 1RHRB 5IC4B 2XYPB 2P2CB 4DCPB 3EDQB 5K20B 1RWPB 2C2KB 4DCJB 1IBCB 3EDRB 2H54B 3IBFB 1SC1B 2C2ZB 1QTNB 2QL9B 2QLFB 1I51B 4ZVUB 1RWKB 4ZVSB 2HBYB 3SIPB 4DCOB 2H4WB 3R5JB 1RWXB 1F9EB 3R6GB 1SC3B 2XZDB 3KJNB 3GJSB 1RE1B 3R7SB 2CNKB 1QDUB 4JB8B 1RWOB 1I3OB 2QLBB 3IBCB 1RWMB 5IC6B 2Y0BB 2C1EB 3R7BB 1RHKB 2C2MB 4ZVTB 2XYHB 2H4YB 3QNWB 2DKOB 4ZVPB 3P45B 2QL5B 2HBRB 2XYGB 3D6HB 1PAUB 1RHJB 4ZVOB 1SC4B 3RJMB 3GJQB 1ICEB 1BMQB 1RHUB 2H48B 3NS7B 2CNOB 2QLJB 1PYOB 2XZTB
chains in the Genus database with same CATH superfamily
2VA3A 3MCSA 4B9LA 1S0VA 3MTJA 4X4RA 3WDOA 1X4CA 3I0RB 4WE1A 3Q83A 4MYUA 5D6GA 4NA2A 3G82B 3QO9B 1ZH5A 3OFEA 1RU2A 2DEJA 1RHQB 4F3OA 1JKHA 2XNRA 1NK8A 4J9OA 3KLEB 2HIYA 4IO1A 2DNNA 4LVNP 1S1XB 4ZVQB 3W9JA 2LDYA 1TK8A 2XTJP 2KZMA 2R9LA 2F8MA 5KT4A 2X1AA 3KK1A 4ECUA 3PZPA 2C3MA 2DB1A 4L76A 2LEPA 3M9NB 2UP1A 4LF6J 2DR6A 1CJUB 1LEOA 5E3PA 3FBCA 5F8MA 3U1MA 5HVGA 2Q3PA 3MM9B 4JI2J 3MUVP 1VRQC 3D6MB 3T6JA 4PG6A 2XO6A 2OSRA 3FDSA 4IFVA 4LUBA 4A4JA 2CNLB 4USVA 4HHJA 4Q0BB 4U7UD 1T9WA 1OY8A 4CLTA 3LWMA 3M2VB 3GIKA 5IT9U 1NJYA 2DEIA 2YQ0A 3KK2B 1T7PA 1WOPA 3T5JA 1EX8A 2MDAA 4B9VA 3C6TA 1GX5A 4UW2A 3HHNB 4ILLA 2E1CA 1S6PB 3K59A 4O3PA 5K8MA 3OVAA 2X1FA 3QAUA 2WOMA 1RA7A 1S6QB 3F56A 3PYGA 1X0FA 2EFOA 1F9HA 2F4VJ 4NLOA 4ZIWA 1S6QA 1S12A 1KBRA 2HG4A 2P9CA 4O0NA 1WEZA 4QW9A 1N5YA 2BQUA 2B4UA 4DF8A 2DRAA 5GVQA 2W7PA 1OO0B 2EFPA 4Q44A 1YJUA 1HQ2A 4BC7A 3AD8C 4NYOA 4M63A 3D2WA 1H73A 4KC5A 2BR0A 3CEDA 3HO1A 2GJFA 2QA4G 1SKRA 2R7UA 1SQEA 4IOAQ 1UVJA 1N34J 1FERA 4P72A 2XNQA 4C97A 1WORA 1FXLA 2FUG9 1AB8A 1SB6A 5A8RB 3QMQA 2DNZA 3KG0A 2DGQA 5C42B 4U67Q 4N56A 3Q0AA 1IJEB 1WWHA 2COLA 4OYWA 1Z2LA 2MQPA 4NLGA 2QSWA 3R5JB 2MKIA 4M94A 4ID5A 3JSYA 4FNIA 1D8YA 1IM4A 1F9EB 3GP9A 2D7SA 4DI6A 5IM0A 3A8JA 4ZPBA 2IM0A 1UZDA 1FKOB 3C14B 3MAAA 3V5RA 3KK3A 1W2BR 1NK5A 2JEGA 3PHEA 2EG1A 4OI1A 4ZVEA 2JEJA 2CNKB 3RZAA 5I3UA 4WKYA 2BE9B 5D4LA 3THTA 4MKYA 1RWMB 1DZ5A 2O66A 2ZDOA 4CM2A 2FJVA 1WHWA 4MFBB 2AJ4A 4QR1A 1LWEA 4MJKA 3TWZA 1WI8A 4CH7A 3OR1B 2GFFA 3N79A 4DL7A 1TKDA 2X3DA 4LMZA 2HHHJ 3MEEB 4ZCLA 3KWMA 3D6HB 3HP6A 1H3DA 1FEHA 2JNJA 2H3EB 2NXNA 1ZS6A 2BXJA 3R8YA 2WCXA 4W4MA 2KO1A 4Q5VA 5KFSA 5J2QB 3S7RA 3BN4A 2MKHA 2FJXA 3EVOA 4EGLA 3ZTSA 2XY6A 5J2QA 2QT7A 4G1PA 4DR5J 3NL0A 2NZCA 2IJRA 5KFKA 1MU2B 3HHDA 1K8AT 3UD3P 1PO6A 1IUJA 3OVBA 2DGOA 2G2OA 3B82A 1VBZA 2IBKA 4FKXA 2V9WA 2GO8A 2EBGA 1R8BA 1EETA 1KTQA 2Z2MA 2ZE2B 1IM6A 2OFHX 2F40A 4MKBA 1APSA 4K4TA 4YDXA 1OY9A 2FC9A 4FS2A 4YFUA 1QLNA 2CPXA 1KVKA 3ZTOA 3LP1A 1RSCA 4KV8B 4BLGA 1G3OA 1N0VC 2MYFA 3N9UC 4USIA 5KOWA 2MGZB 2V8PA 1VQ9S 3DLGA 4DPOA 3G8TA 5B0EA 4CNYA 4DPWA 1HNVB 1LNQA 2WONB 1BQXA 3LGNA 3MPWA 3IAS9 1QTMA 2XMTA 2G1DA 2VOPA 4ETXA 3T1AA 1BQNA 2HRYA 3GFXA 4F2RA 3I82A 3VAGA 1B0PA 2H5EA 4AQYF 2WB1D 4C7QA 2BQRA 3RBEA 1S97A 4JI3F 1SH2A 3IRWP 1VRUB 2X1GA 1UCNA 5DQHA 4B9SA 1MG7A 5IFMA 3EM1A 3FSXA 2IYGA 1I94J 4DF4A 1XTZA 3BM7A 5KFYA 3OTBA 1R8AA 3MECA 2V8VA 5LXYA 3D4JA 1RTHB 1FE0A 3LOUA 3NBPA 3CF5Q 2IJNA 4DL4A 4A8OA 3QIDA 4YOEA 1N32F 2VQFJ 3UI3A 5K14A 5KG0A 1U8SA 3WQPA 4CNZA 3DOMB 4RLEA 5HQ8A 4RZRA 1VISA 1EAYC 2HVEA 2BYCA 4C11B 5KG2A 1M90T 2G0JA 3MPUB 4HT5A 3W9HA 2W9BB 2LQ9A 2CVEA 4G1QA 3DI6B 5LXRA 3MR2A 2CVIA 4LFAJ 1U0HB 4EK2A 4DSEA 5HLFA 2UUAJ 2O67A 4LJMA 4QIWD 4WFAQ 4JYAJ 1IR1A 2LEAA 4BWMA 1C4CA 4KGMA 1S0OA 1S49A 4YS2A 2WW8A 4Y2AA 2K3KA 2V2KA 3IXQA 4LRCA 3ZNUA 2DGXA 2R2TA 3PW4A 4DSFA 1VRUA 3MPDA 1CULA 4TKTA 4C8MA 5T14A 2HHQA 1QE1A 4ED6A 5ETKA 4A8KA 1K1SA 2QG9B 5M2UA 2CQPA 5KFBA 1S9EA 4LF6F 3CJKB 1XMQJ 3CULA 3DOKA 1OSDA 3GWCA 1B64A 3EWGA 4RBTA 2NPFA 4RNNA 1KQFB 3IAM9 3Q8VA 2OO4A 3PO5A 5CH7B 3IBWA 2YKQA 2HW3A 2OD4A 1WDTA 3A3PB 1K0TA 2DHXA 4QIVA 5ITHA 4Z37A 4YY3F 2ZOGA 2Q1LA 2N3LA 2HZAA 2KVQE 3ZZTA 4YB7A 5DO2A 2JDJA 1S4EA 1WHVA 1RBLA 1Q95G 2F4FA 1HQEA 3ENAA 5HLFB 2XZDB 1YITS 3JTOA 2E44A 2EK6A 1FRJA 1X4FA 4IQMA 4L3KA 3R7SB 3PW0A 4MK7A 1RAAB 4DG1B 2I9SA 3G71S 4FF3A 4ECQA 2RDDA 1P6TA 3SYZA 1SL0A 3GV5B 4LF8F 4WFYA 2ZC4A 3CJRA 4IH6A 2Y0BB 2KU7A 4IFYB 2OPSB 4USWA 1RHKB 1WI6A 4KB7A 3W3SA 1VK3A 2CUYA 4IQXA 4QWBA 2MHNA 1S1VB 3UR3C 1QM9A 3IS9B 3BKTA 2HKEA 3PY8A 1L3KA 4X4VA 3N4WA 4UY8T 1YWXA 3UO0A 2GHWA 5CYQB 4X66J 5D4NA 3CC2S 3T5LA 2Z0GA 5T41A 1EETB 2NXUA 4I56A 1DTQB 1QAYA 3CD7A 4DQIA 2Z2ZA 3E01B 4FP9A 5A6PA 4UOGA 2WVFA 1SXLA 3PYEA 1RT2A 4KGZB 4QZVB 4JI5J 4N47A 1I6JA 3MEGB 3LPEA 3BSAA 4C8NA 3CCVS 2ZOFA 4KIAA 2XB2D 4WP8A 4ED7A 3KMSA 5H9EK 2Z58B 2M3DA 3T41A 1U48A 1WHYA 3A1YG 4NRTA 3R1HA 1NSQA 2W9CB 1RHMB 2CG4A 3NP5A 3P4UB 2JFDA 2E7WA 1H0HB 2YWWA 2OTLS 4F4ZA 3S01A 1FNXH 3GCXP 6AT1B 1H6KX 1QSLA 4C8KA 5D8HB 1RT7A 3BBCA 3IP0A 3MEDB 4DX6A 5EWGA 3M6VA 4UY85 1S1VA 3NCRA 4IR1A 2DRDA 1SKUB 2KB2A 1NHKL 1NKEA 1Q78A 4AE5A 1QVFR 4O23A 3IA0A 4DPTA 4LF7F 4OV1A 3KJFB 2XO7A 3ZO7A 5KFNA 2CADA 3DOKB 3BDPA 4P9SA 4PUOB 1WELA 4J9KA 1RXOB 3OXFA 1JXVA 3AODA 3TP2A 1A7GE 2AEMA 1VC6A 1KNZA 2Y9HA 1GQEA 1QUPA 3I4PA 4X62J 5L1IA 1X9SA 1CJUA 1S4FA 4I1TA 3SDEB 3KLHB 2Q6BA 2FIUA 4DPYA 2CJAA 3AD9C 4MFBA 4N8OA 4AL6A 1U7LA 2NUUG 1U6ZA 4OYBA 1SV5B 1HWJA 1RHRB 4B3MF 4FBTA 2Y8YA 4J9UE 3MM6A 5KFLA 3HVWA 1I94F 3G86A 3R5CA 4QPTA 1F5BA 2WONA 2MQNA 3OR2B 3D0GE 3EPGA 2C42A 3KK2A 3AOAA 2CPZA 1UWBB 3SSQA 2MB0B 1R7IA 4H4MB 5CYMB 1GTEA 1XJWB 3F44A 3HHLC 3QT5A 4G65A 2CKWA 3GYGA 5CHCB 3HJFA 3MCNA 2K8GA 4ZP9A 2ZZTA 2KT2A 1RACB 2CQ4A 1FFWB 3DGPA 4X4QA 1U1PA 4KGVB 1K44A 1HA1A 3B78A 1N34F 4HL9A 2DO0A 2GO9A 4NI2A 4CWBA 3OUYB 4RO0A 5JJBA 2AYMA 1HPZB 2W2PP 2ZBPA 2XCPA 3KLGA 3CJ5A 5GAGI 4IO9Q 4NLTA 4MT1A 5IT4A 1X60A 4DV2F 5T7LA 1HL6A 5E3RA 2V34A 4NLRA 5DDOC 3B54A 3CO9A 1K1QA 1RBAA 4CYUA 5T7LB 1X4HA 1B7FA 1TV6A 2QX0A 1QAIA 3EGZA 4CDIA 1IKVB 1V3SA 1WC3A 2FHOB 4P73A 1SC3B 5ETVA 1LWEB 2OP5A 3HVTB 4DPUA 5EWEA 1YDLA 3DRSB 5BXIA 5C24B 3W5YA 3HXMA 4RWXA 1J5EJ 3HD2A 5IV4A 2DPJA 2VG7B 3R1LA 4J9MA 1D1UA 4OYOA 2RIJA 2C3YA 2ZH4A 1NKBA 4F02A 3N28A 4QYZK 1XERA 3PJ9A 4EO6A 2ZHBA 2A2CA 3RRKA 1BD6A 4FBUA 3JTNA 3JQMA 1F5AA 2F5GA 5L9NA 4DUYF 4PAAA 3TAQA 2CQCA 3FC9A 4KYZA 4OV6A 5HMZA 2CDQA 5LT5A 1JNRB 4PQUA 3DU5A 4ZPDA 3RAMA 2GVDA 2IA0A 2XYGB 4RW7A 3PKYA 4RW9B 3CMAS 5KFZA 3KJVB 1TK0A 3TZZA 4DSLA 3M30A 5EX3A 5KT3A 2HWTA 4RJVA 2JFKA 5AT1B 4DR6J 1KLMA 3I32A 4N41A 1WC5A 4QW8A 4TU7A 4QU7A 1XR6A 1PJ6A 4CLUA 2EBEA 4JV0A 1VRTA 3L7OA 2MKCA 2LECA 4TY8B 1T03B 3E2EA 3N6MA 3A12A 3AB4B 4K5SA 2YKMA 3V2UC 2E1RA 4DZ6A 1BQNB 2EG2A 2FJDB 3RU0A 2E1MC 3MPVA 1ZOTA 1FT8A 2QE5A 5FD1A 2V8HA 4NYZA 4FYXB 4LSLB 1HNXJ 5L9XA 4PXDA 1Y7PA 4USKA 3PVXA 1VR6A 2N4DA 1FK9B 1BE4A 1CS4A 2HQIA 4LT6A 1RI7A 3A8IA 4M5DA 1CBKA 2KH9A 5L1LA 2AU0A 3A13A 4O4RA 1VIXA 4OZ0A 4QWEA 3DGPB 1S7IA 1WKJA 1YLXA 2MZQA 3ZZRA 5CABA 1ZZNA 1ZAVA 3Q8UA 1TR0A 3BGRB 4LSNA 4RW4A 4FF4A 1R8CA 1RAJA 4B3TJ 2E5GA 2U1AA 2ZITA 2DGWA 2ZBIA 1Z4UA 2RF2B 4DG1A 4FKYA 1U1QA 2A6MA 3EVWA 2Y3YA 5DG7A 2W01A 1YRTA 2BANB 4JI6F 3MFHA 3OLBA 3QFHA 3D0HE 4U8YA 3MAQA 1UJ6A 4DUZJ 1S0MA 4ED5A 4OHVA 4KO0B 4MIBA 4ANDA 2HHVA 2YKNA 2YNHB 3OFHA 4EFAC 2D9PA 3CCTA 1MROA 1DTTB 5F3TA 1WC1A 1D8ZA 3X3UA 2ZWOA 2E7VA 2DNRA 2V0NA 3KHGA 4F2SA 3TZWA 4OX6A 3HSJA 3OL8A 2ALZA 3DRPB 4LBHA 1JKHB 1ULRA 4PXBA 3C46A 4GVLA 2KXFA 3VR1A 2FGOA 3VAIA 1KS2A 1ZA1B 1RBOB 4UTGA 5ETSA 4CT9A 3SI8A 2F8HA 2HHHF 2HHPA 3MEGA 3RRHA 1UVNA 2ZVSA 3C6UA 3CVKA 2C2ZB 2EWHA 1XMBA 5IWAF 3HT3A 2FDNA 2KTQA 1F60B 1YJRA 3ZC4A 3CCZA 1CJKA 2W2OP 3LWLA 4LFCJ 1TL7B 2EC2A 1TMJA 4ENOA 4G6VB 1JLBA 2QFIA 1RAEB 4YDDB 3MGJA 2L08A 2EK1A 1YJVA 2GQCA 2OKQA 2W2NP 3CJ3A 5G0RB 4QWDA 4GKKJ 3PACA 3ZZ0A 5DM7Q 4U96A 5LMNF 1L5UA 4I6WA 3G6ES 4J9PA 1HR0J 1REVA 1S7HA 4K2XA 3MM7B 2YQ3A 2R4FA 2RS8A 4WXWA 4Y6IA 3P8BB 4F0HA 2DCUB 3MMBB 1PKUA 5LM7E 4YY3J 4XPCA 4DV6F 1N36F 3DDIA 2G9OA 7FDRA 2MQQA 1VQ8S 1H38A 1UWBA 2GMJA 1UPMB 3NLCA 2B4OA 3W5ZA 1S1UB 2AD9A 1KR4A 2ILYA 4X4OA 3CCLS 3GFZA 1U24A 2DGUA 2FZKB 2AWZA 3JAMY 2F7VA 2OTJS 2J7KA 3VVTA 2XQCA 1FWKA 1NO8A 2CPFA 2PT0A 3VAMA 2XLKA 2OGUA 2BW7A 5CA5A 1ZTTA 3M8QA 2HNZB 2IRYA 2VBZA 1JMTA 3HVAA 4PR6A 2AX1A 2D74B 1N5VA 2QYCA 4KAIA 5ETPA 3VQTA 1S1XA 1WSRA 2EFQA 1LOUA 3OXGA 3POTB 4MKVA 4USUA 5KFCA 3L9ZA 3MWBA 1PAUB 3QPIA 3R9LA 4ZIVA 5J2PA 4FVCA 5KFMA 2X7IA 4NCGA 1Y3JA 2WVCA 3GSIA 3Q86A 5HP1B 1R89A 2OJ3A 1UETA 1EARA 3LAKA 4PKDB 1Q81T 4K4UA 2YKMB 2YNFA 4A47A 1RHUB 1U0SA 3M2VA 2KFNA 5G4DA 3O2IA 4DR1J 3MR7A 5A76A 4NEZA 3TX8A 2HNYA 2PE8A 4DL5A 4FXDA 1VJWA 2BRKA 3NY0A 2VF3A 5KFDA 3C16B 4CRJA 2HRUA 4XIUA 2CZVC 4K50A 2VL1A 2VA2A 1RWNB 2BJ7A 3BSCA 4X4NA 1RISA 2YKAA 2KFYA 2NS1B 2X51A 4ID8A 3CCJS 1UP1A 1TUWA 3EZOA 2XMUA 2OEKA 2VODA 2Y1RI 4OQJA 1H72C 2FQQB 4EBCA 3ITHA 3DRXA 3HX9A 5E3CA 3EE3A 3QGIA 5KFTA 3RGIA 4ECRA 5D3GA 2V69A 3P96A 3SCJE 4LQ9A 2LMIA 4K4YA 3PW7A 5J2NA 4DN9A 2RQMA 4KV8A 2Z56B 1N5QA 3CCWA 3N0VA 4KFBA 4QR0A 5KOXA 4CLLA 1NJIT 4IOCQ 1RWWB 1UMJA 1VBXA 2K1RA 4RW8B 2NR0A 1A0OB 1U2FA 2UUBJ 2VBWA 3PM9A 4K4ZA 1JNZB 3EXYA 3JTPA 1FVQA 1Q5YA 3QAEA 4ZP7A 2YWGA 4C4WA 3OTOJ 2PEHA 2R8HA 5HROA 3Q8RB 2VPWB 1PILA 4N7TA 1QJHA 4B3RJ 2G0CA 3V6JA 1X5OA 4F8RA 2Z57B 2RQ4A 4DV3J 1SJQA 4DR6F 3HJVA 3D1HA 5KFXA 2DNLA 4AUKA 3L95X 4ERDA 3BBFA 4RUAA 2IIHA 4CLYA 5B0FA 3BO3A 2JH3A 2M7SA 3CPWR 2AMCB 2BE2A 2HK2A 4I0WA 1YJWS 4DR2F 5GAEI 3GR1A 1NBEB 4IH5A 3MMJA 4NI2B 5LSRA 4F04B 3I9ZA 3OXLA 4DS4A 3T1HF 2CQGA 2HFSA 3VZHA 2KM8C 2H54B 3CJ0A 4WPAA 4HH0A 3BO2A 5IT9Y 4IG0A 4GRSA 2QRRA 2OPPB 2RRAA 2DHSA 2HMIB 3QJLA 1AUDA 3H40A 4OZNA 3FNNA 3IMQJ 5F8LA 4YR2A 1N6QB 2KZZA 4H54A 3SSRA 1E6YA 3CB4A 5FDLA 5C2CA 4TQRA 2RRBA 1S10A 3MD1A 2NUHA 1RT5A 2PA3A 3CDWA 3RB6A 3GYNA 4XAKA 3VCDA 4X4SA 3H5XA 4KHPF 2IA6A 4ZPVR 2V4RA 3PYDA 4I68A 1I51B 4ZVUB 1W7WA 3IFEA 5CCMA 1NK9A 3IM8A 2DR8A 2GVZA 2A6OA 3ONQA 4KHMA 3B8HA 4OLOA 3I5CA 3KDOA 3T6BA 3VGTA 3H2LA 4YB1P 3E51A 3HFKA 4H4OB 1VBYA 2V2QA 4U9RA 2M8DB 4PWUA 3OTCA 2PGCA 3NKYA 5F8IA 2ZDPA 1WD6A 1IR2A 3AA9A 4GKKF 3EICA 2KYXA 3D54A 4OX7A 6FD1A 3AT1B 3SBMA 2KVIA 2J9CA 1SCJB 4RW7B 3MAAB 1WG1A 4KJIA 5JUMA 5A0YB 5ETQA 2C1EB 2W8KA 3D3CJ 2QTWA 2POKA 3MEEA 1WC4A 3WIUA 1ACMB 1WKLA 2QA4S 1S9FA 1B0TA 2VASA 2RDJA 2FJAB 3P5TL 2FZGB 4PXEA 5KFFA 3M1VB 3H20A 4O44B 1FFGB 3DLEB 4C0BA 2XMVA 3LGMA 4CO3A 4P75A 2I5JA 3BREA 3AJ1A 3JAMU 3G6XA 1ZAXA 3BN7A 3HSDA 3MEKA 4MK9A 2VDHA 3FRZA 2U2FA 4I2PB 4LIWA 4OJ3A 5HJXA 3QRRA 3QO9A 2J0SD 4NXNF 4ECVA 3J7A1 1WF1A 1LWFA 1DQ9A 1HNZF 1U1LA 4WF9Q 3LTOA 2KHCA 2XMWA 2EFGA 3CDEA 2KJVA 1HD1A 1FRHA 1IKWA 1E6VA 1TKXB 4WU2A 2FY1A 3I0SB 4Y3CA 2UVRA 4IRDA 2UXDF 1XIQA 1BQMB 1ZAWA 2OAUA 1V5IB 1PJ7A 1GH8A 5K8PA 3IRXB 4K59A 4Y2CA 1R0AB 1AXQA 4U6PA 1KRPA 1HI8A 3J7YI 3OPKA 1N33F 1SH3A 1DURA 1R27B 1BY9A 2RDIA 2LDIA 1FKPB 2XBPA 4OMFG 5KFAA 3J81j 2J6SA 2K7KA 5DLFA 2QN6B 2VQEF 1NKCA 3K17A 1T9VA 2BEFA 1B4SA 3QT6A 4MTPA 5EHHA 3NEKA 1S1WA 4USHA 3QZ8A 4R0JA 3JYTA 2JEIA 3CJQA 3RG6A 3M6WA 2DO4A 5HMYA 2DR5A 4CQ1A 4NWBA 2DY1A 1T9TA 1YI2S 3J80Y 2HNDB 3UCGA 2PA8D 3UN5A 1IBKJ 1KKHA 2LQBA 4OYZA 2ACYA 3MM8B 5HO4A 3NMAA 2CXEA 2GCFA 2AT1B 3NNAA 3QLHB 1VC0A 2R2SA 2HHSA 1J5EF 3T1YF 1YKWA 5HBMB 1MSWD 2DGVA 1J5OA 2DD8S 2UXCF 5EUHA 1NDCA 4HT7A 2MPUA 3LP2A 1Q86T 1PBAA 4KY3A 1HNVA 4ZVFA 1QAJA 4C11A 1T9UA 2XWYA 2V63A 3H5UA 5AJ3F 1N6QA 2B7CB 2HS0A 5K8OA 1E6YB 5HJYA 3TZYA 1MMNA 3PIOQ 3CCSS 1WG5A 3V81A 4HACA 5D0RA 5J2MA 5KG6A 1C1BA 4RU9A 3M4XA 4B9NA 1JJCB 1MNEA 2DNPA 2AYBA 4G1IA 4ZJQA 4RW8A 1VOMA 3AXKA 3M6UA 3QQCD 1VQPS 1B99A 5KFJA 2VC1A 3ELHA 2O3DA 4ZLJA 4P52A 5DQGA 1HNIA 4DZDA 4PWDB 3K5MA 4B3MJ 3C19A 2DXEA 2Z30B 3ZTQA 3K89A 5C25A 1Q8KA 1SJRA 2QLFB 1S57A 3ZFVA 8RUCA 2QEXS 1DLOA 1TL4A 2R7XA 4LFBJ 1RWKB 1FE4A 3OL7A 1OWXA 2OELA 4J9SA 1RAFB 5GMDA 3U27A 3UDVA 1TFWA 1R0BG 1S48A 2LA6A 5E0OA 2BABA 1G1XA 4U7UK 1JLGB 4F7VA 3R5DA 1T0TV 4OJHA 1NB2A 1OMSA 1S77D 2MQ8A 4IG3A 4HDGA 4F26A 2Q6CA 5E5NA 1FWPA 1TVRB 4ZCKA 4LF7J 2JZ5A 3GIIA 2DHGA 4X4TA 2YNIB 2H1YA 1NZ8A 2KDOA 3GJSB 3H98A 4DR5F 2LEBA 3QJPA 2KJWA 3C66A 2VFVA 3BQ1A 4ZN3A 5LMUF 4DQSA 4O4GB 3M8PA 3RR7A 2APOA 2GS8A 4MK8A 4RUBA 4ZLLA 3FQKA 2ASDA 2BUNA 2QYGA 4PPZA 2V2VA 2IRUA 3ET6A 1N32J 4JV5J 4J5OA 3J81U 3G87A 1M5HA 1UA0A 1BWVA 2QL5B 2EI5A 2HBRB 3ET6B 5DQIA 5CD4A 3W5XA 1DLOB 2MMYA 3FRYA 2IAJA 2V9KA 3UD5A 3OUYA 3H25A 2ZH3A 4DLEA 1FNMA 3R3TA 4JYAF 1EQ0A 3DKDA 1JXEA 4YUDA 4OI0A 1SVDA 4LSNB 2IC3B 2WVDA 2HNDA 3OFFA 4QIEA 4OZ5A 4USMA 3Q8QB 3Q89A 1RT3B 2FHMA 4C6AA 1O0PA 2AJ0A 4DR1F 1BQMA 1HHQA 1RTJA 2VG5A 4Q7AA 2XC9A 3S1TA 2A0FB 3OVSA 1WKKA 4CLKA 1P9QC 1U45A 1FFSB 1Y5IB 3KHHA 1K9MT 3NGTA 2IRXA 4YMEA 4OHYA 3E8OA 4X65F 1Y5NB 2UUCF 3V6DA 4ZVHA 1LQ9A 1AA1B 1HBUB 1SL1A 1S9GA 1X5SA 2OUGA 2P6SA 2XY7A 4GKJJ 3N5FA 5JVHQ 1IBMF 1VI7A 4DV7J 4JI1J 3ZTPA 1VRTB 2VQFF 2GNKA 2NYIA 3BPDA 2PMHA 1X4EA 3W2VA 5H9FK 2LXUA 2FVRA 1RT6A 2H65B 4CO2A 1Q1KA 4DFPA 3KDNA 2PEBA 4E98A 1YJTA 3L3CA 4ITSA 1TU0B 1K0VA 2DH8A 3OL6A 2HWIA 3FMWA 4HI1A 1S5ZA 3L7UA 4RW6B 2DNGA 3C6UB 3GJRB 2G0IA 2LA4A 2LYVA 1NK4A 5AXMA 1CJTB 1S76D 2YNGA 1UEUA 1RKIA 5EDWA 2R7WA 4LF8J 4Q45A 2XG8A 2GMHA 2CAJA 1EKSA 2LXFA 3KLGB 3FK4A 4GVBA 4HLBA 1M5PC 2GC8A 2VFUA 1ZETA 5ETTA 3E3XA 4N5SA 3OR1A 1SJ4P 3HI9A 4U7CA 2W8LA 1P1TA 2J0QD 3O5TB 4PPDA 5IQ6A 2QMXA 3DFEA 3DYAB 4WYWA 2B7BB 4UUXA 2D3O1 1YHQS 1IBKF 1SIWB 4J91A 5GADI 1XNQF 1KHVA 4LSLA 4QBUA 2UXDJ 3T1HJ 1IWAA 4WP3A 1FNOA 5AXLA 4DV1F 3QZ7A 1FA0A 2VKZG 4RNHA 2DBBA 4MIAA 1DQAA 2MZJA 4NLSA 5D77A 2AGPA 2DNHA 3GSDA 4EZ6A 2YWHA 1X31C 1X4AA 4NZ0A 2NXEA 2UUBF 1FJCA 2IDEA 5CYQA 5B0GA 1F0XA 3N6LA 2WSCC 5BR8F 3KLHA 3ISNC 3JSMA 1TVRA 4AQYJ 1M5SA 2W24A 3AA8A 3V6KA 4B3RF 2HAIA 4N76A 2XHWA 1LWCA 1PJ5A 4OHZA 4CIOA 4K4XA 1FRKA 3BSNA 3T3FA 2Y8WA 2J7UA 4GVBB 3Q22A 2JHEA 3SCLE 2Z8QA 3PRBA 2JEFA 1YBUA 1NLKL 5DGBA 2KT5A 3PIPQ 1PBUA 3LA0A 3DLLQ 1UVMA 5DG8A 1KWMA 4Y65A 1HBMB 5HAOA 2ZH6A 1SIZA 1LXNA 4IFVB 1XEZA 3QIPA 3M2UB 1NK7A 1EQMA 1R8HA 3WX4A 3MF5A 1Q8IA 3ENVA 5D0HA 1NSPA 2FZCB 3MEDA 3H42A 3HPOA 5AE1A 3G8QA 1MMDA 1N5TA 2BOAA 1RLDA 3GIRA 2A18A 4I7FB 3R7BB 5KFGA 5M2PA 1SKSA 1HLWA 1KFDA 2OMOA 3BF4A 2UUCJ 3KHLA 1EJ7L 1F9FA 2B9XA 2DKOB 2DVIA 1RP5A 4NZ6A 4KR0B 2GA7A 2XMMA 3NOCA 3UDEA 4PUOA 2VV5A 3FSYA 4CLSA 3GU0A 1NJZA 3ILJA 1LK7A 4DQRA 2BVZA 4CO5A 2RMLA 4CO0A 1JWWA 2CQ3A 2HGLA 3MMAA 5SZTA 3W7BA 5DG9A 1XMQF 4DV4F 4P7VA 3PHTA 3VAKA 2GIRA 3D66A 4NYPA 2DNMA 2YNIA 2YWKA 4NASA 1DQ8A 1SQFA 4O44A 3S6EA 2N4CA 4PQAA 1GK8A 1C1CB 1NMEB 1W25A 4NLYA 2W7OA 4TU9A 1FTRA 2DHAA 3FMBA 4WP9A 2RHSB 4C3LA 7AT1B 4H4KA 3D28A 3PXGa 4DL2A 1PYSB 1U4BA 2R7SA 1I5OB 2M0GB 5EGYA 1YQHA 1FRMA 4B9MA 4AXJA 2BOPA 4PQUB 5GAHI 2GGPA 3SQGB 2WW4A 3DM2B 5D15A 5CAAA 2X3GA 3ICLA 1DHMA 4V1Ak 1N4LA 2DY9A 2YXLA 3IR6B 3I55S 2R7OA 3EXCX 4QWCA 3FFIB 5IS2A 1U1RA 4DUZF 3H7HB 1XNQJ 2OPPA 2FLNA 2Z2LA 1ZA2B 2HFOA 3MI7X 5ADZA 4KH0B 3MD3A 4P74A 3N5BA 4XDCA 1KLMB 4Q8EA 2Y1LB 4OIXA 1X9WA 1WG4A 1KQGB 1NCLA 1H74A 2IM3A 3D6FB 3R5GA 2CQIA 3H2VE 1ZM2A 2JVRA 3R6LB 1AROP 1HR0F 2ZVIA 2HK3A 5D4OA 1EHWA 2G1HA 1HWLA 1NPKA 4QOTA 4DR2J 1HARA 4CYUB 1VLYA 2OPSA 2W9AA 1QSYA 5L8RC 4LSZB 1G7CB 3EZ5A 1PAEX 1QAXA 3CCRS 4A8FA 3P5BP 3K7RA 4YR0A 1R6VA 1SJ1A 1JLEA 3ILOA 4ZDNA 1RYRA 1RAIB 1TL1A 3G6VA 3VHQA 3GQCA 1NSKL 4P7TA 3MECB 1VYAA 1U02A 4K2JA 4Q43A 2ZBCA 2A2DA 1HNIB 4PWDA 1D09B 2R2UA 2D1CA 4ZP8A 1UA1A 1Y10A 4DV5F 2DISA 5I3QA 1P8GA 2B8PA 2RNEA 3K8WA 4KHRA 2HQFA 1K47A 4O0IA 4F4WA 5C5JA 4C3KA 5EX0A 1M5KC 1TAQA 4YB5A 4Y2KA 4C3MA 3CC4S 3HDSA 2DGTA 1B7YB 3GTYX 3KG4A 2B9EA 3DHWC 3H2UB 4MMOA 5J2NB 3W61A 3W8GA 2ZH8A 1KOHA 1C0UB 3QT7A 3SCIE 3WC2A 2P8IA 4NRUA 4CH1A 1D9DA 2C28A 4Z7CA 3VVUA 1ZPVA 3Q2SC 4FPIA 3VGSA 1T02A 2AHOB 4ZKAA 4ZVSB 5KFUA 5M2RA 1EKRA 1TKTB 5B7WA 1CULB 1QY7A 4PG4A 3BR8A 1VQLS 3M05A 2UZAA 1TUVA 1FX4A 3J7ZT 2RQKA 4V19X 1DTTA 4S0MA 1LWXA 1OS5A 1AT1B 1ZM9A 4FYWB 3IG1A 5IXUA 4YQWA 2YKNB 2YNHA 2IVMA 5IQQA 1HW8A 1Q0NA 4XO0A 4F4YA 1ITPA 2B4PA 2OI2A 4K5RA 3JYTB 2LVWA 1NHVA 4KKOA 1QD1A 3H0PA 5CYMA 1ZTWA 1TTHB 1YBAA 1UW9A 4UZCA 3TVYA 2MLZA 2KRRA 4A8QA 4UOFA 2ZD1A 2FHKA 3D1OA 3TO8A 3BSOA 2RB7A 5LMUJ 3MR5A 4IRCA 1YVFA 1TELA 2OPQB 5F9LA 4LRFA 2HHWA 4N77A 4LIRA 3DRRB 1TFYA 3DMJA 2ZHOA 2PO4A 1VQKS 2CQHA 2C2MB 3QGGA 1BGXT 5DZ7A 3CJ2A 7FD1A 3GFYA 2ZH9A 1RT3A 4LF4J 1SV5A 3AQPA 3L7PA 2FVCA 3JSMB 2DR7A 2HURA 4ED0A 2VOOA 1HNXF 3BH6B 3J7Z5 2J8SA 2WZ1A 1W26A 4ZVOB 2N3OA 4EYHB 1HNZJ 4AYBD 1VS3A 1TAUA 2IM1A 1JJ2R 5KFQA 3NS7B 1HBUA 5GADU 2CPHA 4ZCIA 4OZ2A 2W2QP 2D9OA 4PRFA 1GT8A 4KT0C 4X84A 4ECSA 1FESA 4DS5A 2I0XA 4A48A 2KFZA 5FJ4A 3R97A 3X1LB 1FVSA 4P71A 5AJ3J 3QT8A 1MN9A 3DCAA 5MLCV 5DRKA 3U1LA 1OQ6A 3W64A 1YJNS 1L3TA 1RAHB 1U8WA 4NXMF 3EMTA 3FFIA 3TAMA 2OIHA 2AZ1A 2IY5B 2B3TB 2RSQA 4ECYA 1KQSR 1IQZA 1M1GA 2CPIA 2RVJA 4ATNA 5KFEA 2W9BA 2ZJRQ 3ETMA 1WTBA 1NSAA 2IFXA 3HSZA 3ITHB 2LFVA 2VONA 1RWUA 1C0UA 2BJ3A 2MZ1A 4ECWA 3EGWB 1NNDA 2UUTA 2Y0SD 2EKYA 4R8UB 4C9DA 4LR8A 2RAQA 2HYIB 3FBEA 2I2YA 3PEJA 1ELOA 1UFWA 1V6HA 4HVZA 5JVGQ 4NLPA 5CZXA 4CH0S 1N56A 1KVJA 4KPCA 5C42A 4KGXB 3S8SA 1L3SA 4E0DA 3TRGA 1O6XA 3HCXA 1CPZA 5A8KA 3RAXA 1N88A 1N52B 2HNYB 2AX0A 1UKUA 2CWXA 2QL7B 4F0MA 5KT7A 3T9NA 1X9MA 4LF5F 1RUSA 1YIJS 3NGKA 4NL5A 4QPXA 3ADAC 3CTRA 1NH8A 1TKZB 2PC6A 3FUYA 2YNGB 3JS9A 3O44A 3FBBA 3OD2A 3M8YA 2HSEB 4M8LA 4NLQA 4OI3A 5E3QA 5ETLA 2IMWP 3EDQB 3G82A 2KXHA 1C0TA 1WEYA 5U47A 2ASJA 3CO0P 1N5SA 2K06A 1RU1A 2MGZA 2B9WA 3IWLA 3QLHA 2FVQA 4HI2A 3OQ2A 2ZHAA 2UU9F 4R25A 1LKZA 1HNWJ 1S79A 3KMQA 3BH7B 1FDNA 1GEHA 5CCLA 3GG1A 2MZSA 3ILLA 5LL6d 2G13A 4IG0B 1TKTA 4IKAA 4DLGA 1MWQA 3G4SS 2AYGA 3D9BA 4CLFA 4F0KA 2DXDA 4R8UA 3V6DB 3VQSA 3QFWA 4H4MA 5D0EA 4OX9F 4DJBA 2JWNA 5KFIA 1X5PA 4DSJA 1V3RA 3VF0B 2CWKA 1GMUA 4KGKA 2ZNZA 4OYIA 2M2BA 3RYLA 3O6QA 3SIPB 2IDLA 4I69A 4XK8C 5H1SV 3V4MA 2CPDA 5DETA 1CVJA 3I4HX 3HKWA 4LR7A 2BKPA 2EEYA 3M7VA 3D68A 4NE9C 2FVPA 1WNEA 1VQOS 1SUQA 1U6FA 3MMCA 4L75A 2XGQA 1FEEA 2DYAA 8AT1B 4JI3J 4OJ1A 2BJ1A 3I0SA 4WKRA 4C8YA 2XULA 3MM5A 4L74A 1RKJA 1HI0P 4C98A 1BXNA 3QRPA 2AGOA 1GTHA 2B5JA 3U02A 3OTEA 5KFWA 1YK9A 5HVHA 2DK2A 3CJ8A 2E9ZA 4I6AA 4LF5J 2IMOA 3C3LA 3V4IB 3PR5B 2BJ8A 4I4BA 3TAPA 3QGPA 1JJ4A 3W63A 2E5IA 2HIQA 3BGLA 3KUEA 1UAWA 2YTCA 3GV7B 5KFHA 3F73A 3DYAA 4Z2XA 2UXCJ 1CJVA 4DV2J 1REVB 1R43A 1CQMA 4ZPCA 1XMOF 1C1CA 2FHJD 3M1VA 4ETZA 1IQTA 1H2VZ 2HS3A 3F0NA 2V2ZA 4ILRA 4QJVA 2WSEC 2RHQB 5CZVA 1MU2A 2PFDA 1D9AA 3BYPA 4ZVGA 3TYTA 1U2RA 1NHUA 4L72B 5IV3A 2R7TA 2OPRB 3NOGA 3PFEA 4EUVA 3KLVA 1S1UA 4D3HA 3FEXB 2NPIA 4ZP6A 3KK3B 3DU6A 2D3ZA 3DOMA 3MTKA 2ZD1B 4C0HA 2C2OB 3JB9k 2ACMA 3PRDA 2QA2A 4NOHA 4DV1J 1PGZA 2V8GA 1UEVA 2RQCA 4KHPJ 1MN7A 4FPRA 1RT2B 4PYAA 4ZMMA 2E5LF 2B5JB 2HHUA 4RW4B 3ZXWA 2GHPA 3PO4A 2L9WA 4UQGA 3PX6A 4NXNJ 1SC6A 3KUGA 2GJ2A 3TUPA 1FWLA 2JLEA 4WU3A 1NM2A 2F8EX 3IRXA 2VH7A 3QWUA 1IKYB 4YB6A 2G2ZA 2VPXB 4KE5A 2VG6A 3CDBA 5KFPA 1U1OA 4R5PA 1IKVA 2XWXA 2L3MA 2PD1A 3BKUA 4JUZA 5DZ6A 3I87A 4C2MA 1V5VA 4LF4F 2J9EA 1Z1ZA 4NLXA 3FCVA 4ZLPA 4FS1A 3W2WA 4A8YA 4Q8FA 2P5VA 1TKZA 4H4KC 4I6YA 4X65J 1GNKA 1ZM3A 3UW1A 4F36A 1UJ4A 3QRQA 1AZSA 3OV7A 2RUSA 3RW7A 2FJEB 2EFNA 3D67A 4ID5B 2WAQD 3AJ2A 2VC0A 4F4AA 2VQEJ 4DX8H 4Y28C 4DL0C 2FLLA 1GX6A 2LU2A 3JSRA 3DLBA 2VBYA 2ZE2A 4A46A 2FC8A 3HVRA 4DR3J 2XY5A 5HN0A 1NDPA 2Q43A 3VTIA 3CC7S 2HFUA 3NG8A 4DCPB 4CT8A 3IWXA 3CDAA 4NA3A 2F3JA 2PI4A 4X4UA 1I1GA 1XWLA 1C1BB 2BANA 3PTWA 5KT6A 2E5HA 1VIOA 3MMAB 3JQJA 2C3UA 3LGHA 1FRLA 3DLJA 5A0YA 3SEOA 4C8LA 4ZS6A 2PIIA 2MY7A 2DIVA 5AE2A 3W9IA 1IKXA 1JLFB 3UFCX 3H4BA 3M8PB 2N7YA 3G8SA 4TY8A 5F0UA 2A3JA 4DV0J 1KSPA 4DR4J 3UPFA 2MJUA 3KG1A 9RUBA 5KTQA 2MKSA 4LVOP 4GC7A 1KDNA 4DV4J 5A8KB 3K5OA 3IS9A 1Y5LB 3KUHA 3CDUA 2F9DA 3GLJA 3RR8A 2J0WA 3UN2A 3HKZD 5LSLA 1S6PA 1JLGA 2HBYB 3EZUA 3KLEA 1Q16B 1XNRF 1IN0A 4YP3A 2GGPB 3GCWP 4WIQA 4OJGA 3SQGA 4ED3A 2BKOA 2C2RA 4JI8J 1AFJA 2OPQA 2BDPA 2ZZNA 3EYZA 2ZFHA 2BZ2A 4ZHRA 3OTOF 4EBEA 1TK5A 4QU6A 1NUEA 3Q8PB 2EW9A 4WIIA 3R6GB 1FKAF 4X64F 1UVLA 3FCWA 2DHHA 3PX0A 2ATCB 2V4JB 1I3OB 4GO7X 3OHBA 1U1KA 1Y9OA 4PG8A 3I96A 3L09A 5I4MA 5K5MA 3K5NA 1U49A 2XHCA 2IM2A 2HZCA 2J6UA 4NXMJ 2HHXA 2HRTA 1X5TA 2WB4A 3TUIC 1TP7A 2VFTA 3BYRA 2J5AA 1RAOA 3C8YA 3HZEA 1ZBTA 4DN0A 3KYLA 1G4CA 1KC8T 3BEGB 1VHFA 4M5DB 1WACA 4JOUA 1HNWF 1TUGB 4EI2A 4ED1A 2ADCA 3CIZA 3TA1A 4P2SA 1LWFB 1S9EB 4JI4J 4IH7A 4J9QA 4J90A 3GZ7A 4ECZA 4BDPA 5LMNJ 4OFZA 4P10A 1KOOA 1UTAA 4Y00A 2VICA 3AAWB 1Q79A 1L3UA 4BHQA 4YEAA 2UV8G 3MURP 4A8SA 2YQ1A 4DV6J 2DRBA 4DR7F 4E2FB 2XZTB 2OMLA 4NZ7A 4DDFA 4ZITA 2XS5A 1HQEB 2D3OR 1WOOA 3UNYA 4PG5A 2VD3A 4JV2A 2V5HG 2AJFE 1DRZA 4W98A 5AE3A 3M8RA 3WBZA 3IGNA 2V4JA 2HQCA 4ELUA 1EZZB 2VIHA 3K5PA 2CJBA 1KHWA 1Q8LA 2L9NA 2PDAA 4J9VA 1MW7A 4G1QB 1NJWA 2CJ9A 5BR8J 2JOQA 2HFVA 4LRDA 1BWEA 5F41A 1GFWB 2C2EA 4FXVA 2AKWB 3CCES 4DU7A 5HK4A 4BWJA 4K4SA 4DPXA 2QLXA 8ATCB 5IWAJ 3TUZC 3OR2A 2GHVC 1N48A 4RKUC 4B3TF 3UN3A 3GONA 1UZHA 4HHHA 3L4BC 3RBZA 3NAHA 1QE1B 3TUJC 5GAHU 2CQ0A 3PW5A 1P9YA 1Y4ZB 2CPJA 4OX8A 4EO8A 1NK6A 3M32A 4FN5A 4ES3A 1KLNA 3VZIA 2D41A 2FB0A 1AFIA 1VHIA 1P1LA 1X8DA 1LXJA 5DS7A 1URRA 2EPIA 2HGNA 4URSA 2FTRA 2YX4A 4DSKA 3PEHA 3MR3A 4U8VA 3VWSA 2RILA 3HHEA 3H5SA 4NMLA 4F3MA 4CZCA 1T8EA 1EP4B 2I6WA 2CJXB 1LK5A 2JC0A 5GAGU 1Q7LB 3JSBA 2YY3A 4M5MA 2KG0A 4DV5J 4IDKB 4WFBQ 3LP1B 3TEHB 3FJ2A 3J7YU 2ZH7A 1N54B 3O8WA 4E8UA 1WTFA 4JI4F 2IPOB 5CXTA 3QWPA 5AXKA 3DLEA 3CJSA 1RWPB 3BS9A 1RADB 1UWAA 4DCJB 5J1PA 1U6BA 3THVA 3D7SB 4NLVA 4DXLA 3EDRB 3GILA 1UJ5A 2E5LJ 2KXNB 3QIPB 1AW0A 2P6TA 3BPSP 1XQIA 1S0NA 3FKBA 2VU5A 1TL1B 2KN4A 3PCOB 4K7QA 2ZEJA 3GPAA 1N8RT 4QCLA 2OLWA 5J1EA 4AL7A 1SJFA 5F8GA 3MHYA 2BACA 3FSIA 2RKIB 2E7XA 2YH1A 2HVZA 1BUXA 2DR9A 1S1TA 2HVDA 5I3PA 2ZWPA 5B0BA 4EYIB 5D78A 2ABYA 3GR0A 4M5JA 5KG1A 2DXFA 3POTA 5LOQA 1IBLF 2HLUA 3PRVA 3BGUA 4L3NA 4F4KA 4JI1F 2QIFA 2UV8A 3LALA 3HHLB 3TNVA 2H4WB 2Q79A 1IKYA 2MLXA 4M5HA 4ALZA 2V8DA 5DLGA 5ETNA 3KOAA 4M5KA 3M8ZA 1FJGF 1NZAA 2F4VF 2E66A 3SCKE 2CPYA 4IDKA 4HDHA 1ZYQA 2JX2A 4MIWA 3M2RA 4HTJA 1M5VC 3HD1A 3NNHA 1XNRJ 2WTFA 3KJNB 3DLKA 4KTQA 2ZH5A 2B43A 3D5MA 4F4XA 2QLBB 4TLQA 5DGAA 2BM0A 3MMBA 3NCPA 3OL9A 2ERRA 3PFOA 2B4VA 1FD2A 1CSJA 1X4DA 1YBTA 2XSFA 2OD6A 3LP0B 4KH1B 4M1KA 5IC6B 5A6WA 3T5KA 1PG5B 2NCKL 4OHXA 2G4BA 4A8XA 1HYSB 4URGA 4PEOA 5KAKA 1T05A 3HZGA 3CCUS 2PFFB 4GKJF 4LBIA 5FLXY 3KK1B 2B6AA 1XBWA 2RU3A 3ZZZA 1HHSA 2XGPA 4NA1A 1F2GA 3ILIA 1ICEB 3MFIA 4DR4F 2ZJPQ 4ER8A 2W9CA 1IJFB 4F67A 2HQGA 3U1NA 5B09A 4EBDA 5L1JA 2AGQA 1T3NA 1XN9A 1X7VA 2VPZB 1XC9A 1HMVA 2GAHC 2ZUGA 4USTA 1FTCA 1HBOB 3ISND 3FZ2A 4ES1A 4EEYA 4FF1A 1LFPA 5IC4B 4P2MA 5F0WA 4CCHA 2C3PA 1VC5A 2OEMA 3SV3A 4ED2A 2UVUA 2VG7A 2K2PA 4KQZA 4UUWA 1NU4A 3M6XA 3W60A 2NREA 1RT6B 4X62F 2QMWA 1LW2A 4DR3F 4K0KJ 3I31A 5HANA 1HWKA 2WOMB 2WBRA 1M0SA 5KG7A 5K9FA 3BZQA 2GIFA 2ROPA 3DMJB 3ETOA 2QSFA 3KHRA 2R8IA 1S72S 1UVIA 4RW9A 3PKMA 2CDRB 3BQ0A 1U26A 1VQ7S 3AHPA 2QC3A 3OJUA 2OSQA 3EJMA 3TR5A 4LF9F 1FDBA 1S6OA 3LO3A 4IUFA 4O3QA 2VDIA 5C7PA 1UFKA 5ETOA 3NGDA 5SUHA 2UVVA 1FX2A 3MM5B 3BGRA 2LXIA 2FD2A 2ZNYA 3FVYA 4HR2A 4ICLB 4OYAA 1HFEL 4CM0A 2PSZA 3SZ2A 2XZWA 2MJNA 5G0RA 3TQEA 5DM6Q 4JI0J 2YX7A 4FDFA 2JSXA 1FXDA 2CZ4A 4DFJA 1U0HA 1DARA 2H9ZA 2CNNB 4ZN1A 3M9MB 3KTQA 2M8HA 3MAHA 1RTDB 3OW2R 1NEEA 1GXLA 4UOCA 4HACB 5J1NA 4AD6A 5J2MB 4J9LA 2DPIA 1P27B 4CTAB 3IN5A 1S9GB 4A8WA 4DR7J 4OI4A 1RAGB 1UVKA 2KYZA 3BBBA 2DITA 4JI5F 2HAFA 3NGUA 2XYPB 2HQDA 1Z2ZA 3I0RA 4WE1B 4DMZA 5K20B 1Q8BA 2DNKA 1ZM4A 2XLIA 3FQLA 1RTHA 1JLCA 4IYQA 3TQ1A 2LKZA 4I2PA 1DTQA 3THPA 3NWRA 1K73T 4AXIA 1NK0A 3O1LA 1XK8A 3CJ4A 4I2QB 4JBCA 4WFNQ 2M9KA 2HNZA 5LJ3Y 3DHXA 3H90A 3C15B 3M32B 1SC1B 3SFGA 5BYQA 5KG4A 3UVJB 3MR6A 3DXBA 1OYEA 2P9GA 4NEYA 5E33A 1YSJA 4P2FA 1FRIA 1HKAA 3DI6A 4ICLA 4B02A 2JLGA 3TEGA 1KTVA 3BKFA 4RNMA 4FVMA 2MEWA 4Y34A 3DLHA 1WC0A 4NLDA 4DL6A 2F65A 1HBNB 2UUWA 5C2GA 4ELTA 2RS2A 3RB0A 1OPIA 3ISZA 3R27A 2A1BA 4CTAA 1M1HA 2XSJB 4DCOB 1IXKA 2QMUB 1RTZA 3I56S 3TVKA 2QFJA 4O4GA 1EB0A 2RJZA 3KKFA 1NPPA 4WCEQ 1NAQA 4B9UA 2CA9A 4V19J 4O3NA 4P6QA 3EGNA 5F3ZA 4B17A 4OZ1A 4DEZA 3BJYA 4DHVA 2MLYA 2ZH2A 4NLWA 2BE2B 3BR9A 4TYAA 2L9DA 5THWA 4JB8B 4NLUA 2GVDB 2W4CA 3M9OB 3UQSA 2GAGC 4ED4A 3HF5A 1TL5A 3TJAA 1PSDA 4KSEB 4ZJOA 2XI3A 4Q2MA 4ZHRB 1FDAA 4J37A 4DV0F 3MDFA 1WHXA 2WVBA 1EP4A 2IHR1 1FKOA 3TJ9A 3NNCA 4HEA9 2GX8A 5B0CA 3QNWB 5J2PB 2BQ3A 1BLUA 3LUYA 1J5OB 3TARA 3U7JA 1T11A 2AF6A 3MXHP 4RX6A 3HMJG 4C8ZA 4OL8A 4RNFA 1SC4B 1BHNA 4DL3A 1VMBA 3HLUA 5HVFA 4BBYA 4W92B 3CD6S 2MTLA 2HVHA 1UEKA 4K4VA 5A8RA 3VALA 2QLJB 1VGYA 3UWTA 2KI2A 1PYOB 3MCMA 1ZZFA 5ETMA 4LF9J 4I67A 5HL7Q 2AW0A 2MQLA 1HHTP 4CLWA 1LV5A 3OBIA 4LR9A 3WC0A 3UDCA 5KT5A 1H2TZ 4CLZA 1B0VA 5J1EB 2UUAF 2X1BA 1CLFA 4FF2A 1YRXA 3TX0A 1WUUA 4XTTA 1MMLA 2HFNA 1G6BA 4KKOB 4O3SA 4AL5A 3SFUA 3WIVA 5A8WA 4N8NA 3CE8A 1AYEA 2RH3A 2AV5A 3UE2A 3RBDA 3NCQA 5D0GA 2R7RA 3KLIA 2QZ8A 3PJXA 1YJ9S 3UVJA 5GAEU 3QSIA 3H5YA 1WDDA 3A8EA 3A4TA 1NB7A 5HSPA 2J9DE 4WTOB 2KRBA 4X66F 4M95A 4X2BA 3V4IA 2SXLA 1T9XA 3KXDA 3PJWA 1CC8A 4Q2LA 4JP8A 2Q66A 3BDEA 2HBQB 4NCGB 3FGVA 5KG5A 1XR7A 5LJ5Y 4LFCF 3Q8YA 3W65A 1VJQA 2LU1A 1RCOB 1Q82T 1IBLJ 4DSIA 4I7FA 2HHTA 1Y11A 2KL8A 1FJEB 3EVMA 2JRSA 3HHKA 2FGCA 2RRNA 2ADBA 2GQQA 3FEZA 4C8OA 3D0IE 2CJKA 2PMWA 5A8WB 3G9CA 4MKAA 3MOJB 2XCAA 4IOBA 1PIEA 2DNOA 2M4MA 2MHEA 2QLWA 2HVIA 1E6VB 2E1PA 2QA1A 4WK1A 2D3UA 4RBVA 4DBQA 3EX7B 1NH7A 3DOLA 3ULHA 3G6YA 3VAFA 3CNQP 2K7JA 3DXSX 2BJDA 3NMRA 3G2XA 3OSPA 1X4BA 2ZBQA 3FEYB 3I9V9 4FYVB 4M5LA 4DU8A 3J7AN 2IVFB 1D0EA 3DRYA 3PV8A 2W25A 2R8JA 1QTNB 5HI7A 3CD5A 5A2QY 1D3WA 4WZQA 1SQGA 1FD8A 4M5IA 1VQSA 3AOCA 3D6TB 3HULA 4ZK7M 2MZRA 2N82B 2M88A 2B51A 5E2QA 4AT1B 4MAKA 1U1NA 1NJXA 3VGVA 2NZ4A 2W1BA 3T5HA 1YGYA 3C6TB 1XR5A 4YHHJ 3TZXA 1WF0A 4DUTA 3ZZYA 3AB2B 5K8NA 3MUTP 2R8GA 2W4PA 2XMKA 2RKIA 1J27A 1M1KT 3CJKA 5E3AA 3C14A 5MAOA 1JIHA 1VDHA 1GXTA 4JI0F 3UR0A 2J6TA 5K14B 2HZVA 3PNIA 2OPRA 4WFZA 4IRKA 2CYYA 4PABA 1CC7A 3VAHA 5L46A 2FLPA 3RRGA 4ZLNA 1Y0HA 1RE1B 5BJRA 3US5A 3HHLA 1NDKA 1QDUB 2R8KA 1KVIA 1RWOB 4L6V3 3GG0A 3TW0A 3K0JA 3IBCB 2DNYA 4JV1A 1IVZA 4IG3B 4TXSA 5F8HA 4ECXA 4LF2A 3PG9A 2AYEA 2BBEA 1JQGA 5CYJA 2Y1IA 3MUMP 4BS2A 2E9TA 4ZVPB 2AJQA 2L41A 3A8KA 4AFFA 3RTVA 2NLWA 1OYDA 1T94A 4F25A 1BC6A 2DGSA 4LRAA 4R0EA 1KQKA 4CI0B 5IT0A 3GJQB 5KFRA 4M5NA 1R0CB 3DRPA 2G2YA 4TYBA 4WFXA 4H4OA 1SKWA 2LQJA 3Q24A 2ZC3A 4I2QA 3MM8A 4MYTA 2VHGA 2AZ3A 2FY8A 1SUQB 2W4DA 1WOSA 3C15A 3CD0A 3D3BJ 3LANA 3MMCB 4ZJLA 3W62A 3GB0A 4XPEA 5HMWA 1NXIA 1CQNA 1UL3A 4HTIA 2O5DA 3I5BA 4FYYB 2VZ9A 5I3UB 5D3GB 2KG1A 1RB0A 2W7AA 5HQMA 2N7CA 4LF1A 1N36J 2V6AA 1C0TB 3PX4A 3MPYA 1C4AA 3UNGC 3SXLA 2GZOA 2NSCA 1JLAB 3BGOP 2LQ5A 4DUYJ 4YHHF 2ZUAA 2V68A 5IZHA 2HS4A 5F8JA 1FKPA 4WJBA 2OH2A 5L1KA 2ASLA 2WRMA 3AJDA 3HFVA 1F6TA 3MM7A 3PW2A 4TNOA 3CCMS 3B6BA 1KONA 1S59A 2XS7A 2BE7D 2BJEA 4DOZA 1Y3KA 2CJQA 4RWWA 4UT4A 3IR5B 2CQ2A 4OYMA 2XLJA 3HFZB 3DRSA 5C24A 2PMZD 2FYXA 4TU8A 4DFMA 1CJVB 3M2UA 2IAJB 3GJTB 3QATA 2DH9A 2LCWA 1AZSB 3DDNA 3JQKA 4OZ3A 3CWJA 1S1WB 4Y2IA 5B0AA 3DC2A 3PDNA 3SMZA 2V94A 2GJIA 2O01C 2QO3A 4UQTA 3RUBL 4B08A 3EPIA 2ATLA 1O8BA 1JXLA 1TL3B 3R7NB 1LW0B 2B9YA 3DOLB 2H5JB 5D4PA 1R8PA 5E41A 4JI6J 4BC9A 2UXBJ 5FLXU 1VQ4S 2ROGA 1N5YB 2VFRA 3GE9A 5FIIA 5B08A 3OJSA 2WSFC 4FZVA 5H9EJ 1V3ZA 1OIAA 1YTYA 1R0AA 5BYRA 2JJ4D 2HMIA 2A10A 4KO0A 2NXJA 4NMXA 3R5BA 5CQGA 1VQMS 1IBCB 4UOHA 2MQOA 1HIYA 1OSCA 3IBFB 2UXBF 1VQYA 4WBFA 3ENQA 1R6YA 2JLFA 2KT3A 2XMAA 1LFWA 4IFYA 3KLFA 3NGSA 1HBOA 4ELVA 4LFBF 3H59A 4OHWA 2AQ4A 3OSNA 4HH1A 3CW2C 4Q0BA 2AEJA 3W2WB 1SI9A 2ZJQQ 3GIJA 2I5JB 4RW6A 3ZZOA 1U09A 2AJ2A 3ENWA 3HK2A 4TQSA 4RNOA 1T05B 2XS2A 1HWUA 2DT9A 3TAMB 2IC3A 1A6LA 2CPEA 5IOLA 1HQUA 5LSOA 5DJBA 3NWGA 1GMWD 3CCQS 3BGFA 4ED8A 1YG0A 2RD5C 3SDEA 2ALYB 2PN6A 2EXUA 4KPYA 1TL7A 2R7VA 1H7XA 2F63A 1ROFA 3CGIA 4GC6A 1Q53A 3SSSA 4JV5F 1HMVB 3G96A 1GAOA 2DTJA 3LP2B 4OYPA 4OI2A 2WHOA 1PC4A 3KLFB 2YKPA 4B3SJ 2E29A 4L73A 3P49B 3DLGB 1AUSL 1JB0C 2MQMA 1JK9B 3IG1B 4MH8A 2C2DA 4UF4A 2GQ2A 1LW2B 2MY8A 2XEXA 2ZOMA 2HEKA 1RT4B 4WXOA 4ZVTB 1RTDA 4DX7A 4FYDA 1RT7B 2H4YB 3VAJA 3P6YC 1HYSA 2F9JA 5DDRC 2NXCA 3DM2A 2AJ1A 3O3LA 2GW8A 1SJ3P 2ZBRA 1S1TB 4RL1A 4LFAF 2VPYB 2ZZMA 1MLAA 3NS5A 3K5LA 5EN1A 2HFZA 3LPYA 2H48B 1HD0A 1YJ7A 3GMGA 4QIGA 1FHTA 3AD7C 3NBPB 1CJTA 1H7WA 1R31A 5EWFA 2QJ3A 2B6AB 2DJWA 1PYTA 1XMOJ 1RTJB 2VG5B 2HWHA 3GV8B 2CQDA 3MM6B 4X4PA 3CUNA 3EGVA 4HYKA 3IGVA 4CO1A 2P9EA 4K4WA 4QYRA 1JLBB 4U95A 4KRWA 4YR3A 3AOBA 1W2IA 2H5IB 4F3QA 5AXNA 3V81B 2BMBA 1OPZA 3GYXB 3MZIA 4TLRA 2VUGA 3HM9A 1RCXB 4M5GA 1A9NB 3HHLD 2E1AA 1IR0A 2VKRA 3NGRA 1SH0A 1O51A 1WF2A 2R42A 2Z4PA 3DDKA 9ATCB 1NPRA 2LQ8A 3JXOA 4W90B 1TL3A 3WHIA 2DIUA 2B0GA 4RU2A 3C2PA 2HGMA 2V67A 3NXZA 4WTYA 2H51B 2CZ9A 2ZH1A 3ZTRA 1JX4A 2MKYA 1IBMJ 1KFSA 3IWNC 2M52A 4RR5A 4ILMA 3KLIB 4GMKA 2BW2A 2BV3A 1DFDA 4ZPWR 3D1QA 1M5OC 1UFLA 3Q2TC 3B4MA 2KHDA 3CJTA 2HBZB 1RLCL 1UW4A 2R7QA 2XMJA 3KFWX 1REGX 5KFVA 4PWWA 6FDRA 1GXUA 5HQLA 5L38A 5B0DA 1Q5VA 5I42A 1QVGR 1HWIA 1D9FA 3BO4A 1NDLA 1NRKA 1EIYB 1JLAA 3AY0A 1WJ9A 3EUNA 4DX5A 1F3FA 2P2CB 4ZPAA 5HROB 2C2KB 1OQ3A 2VBXA 3I6PA 1MWZA 5GMEA 4XDDA 3M2RB 4ZPTR 4JI8F 3OLAA 3OHAA 3K58A 2UU9J 4R5PB 3CSKA 4OYXA 2BKNA 3LW5C 1MWYA 3I5AA 3T19A 2MXYA 1RT4A 3TA0A 2PI5A 2V50A 5KT2A 1VK8A 3W2VB 3TA2A 1L3VA 4DWIA 3QJJA 4JI2F 3CT9A 4O3RA 1CEZA 2GVZB 3NS6A 3Q8SB 1S99A 3BQ2A 2YVSA 2AEFA 2YPYA 2CG8A 2D69A 2FPHX 3GFHA 3FZBA 3HSGA 3R5AA 3OT9A 3K8VA 4LREA 4ZA1A 2J9DA 2J7WA 1RDRA 2QL9B 1RT1B 4JI7F 3M8SA 4ZCMA 4RUHA 5IM0B 1VBKA 2CRLA 3F41A 4KBIA 3RW6A 2CQBA 1JJHA 2YBVA 2RF2A 2JC1A 1T95A 2FHJA 4NPOA 1B70B 4A8MP 1RQ0A 3FBFA 4RPFA 1FJ7A 4ANCA 2RUGA 1FDDA 4D3GA 5I42B 1SL2A 4EZ9A 1GMVA 1RWXB 5E7OB 3N01A 2ZM6J 2V4QA 2EVZA 4C48A 3IM9A 3H8YA 3OTDA 2VJUA 1FRXA 3QSYB 3UCZP 2K1RB 2IJFA 5L39A 1FO1A 4O3OA 5KG3A 1HW9A 2I1RA 1RA6A 1JLQB 4FNHA 1KP6A 4CP5A 3W8PA 3V6HA 2QV6A 1JLCB 4OI6A 4EMDA 2I38A 3N6NA 1F5CA 3IC1A 1WEXA 1F2HA 5JMNA 2ZM6F 2KKHA 2ZKTA 3QBCA 1UPPA 3T9ZA 5HATA 1URNA 3E01A 2UVWA 3AXMA 3FCHA 3LH2S 3W1YC 2K3IA 1HPZA 3P45B 4PCQA 5HBMA 1RTIA 2WVEA 1DY3A 1T3OA 1RHJB 2B56A 1N0UA 2WK4A 4LBPA 1DJ0A 2LP4A 2BJ9A 4C0OC 1FF2A 1RTIB 3A3OB 3DGVA 3M8QB 3W66A 3UCUP 4LQ3A 1IKWB 1TKXA 2JVOA 4KFBB 2YX1A 2DH7A 1TV6B 4PXCA 1Y00A 2CNOB 1B3TA 2ASYA 5RUBA 1FCAA 1DAXA 1HBMA 1WC6A 1IKXB 1JLFA 4WZMA 3AFGA 3H4DA 2IBOA 4BCAA 1JLQA 4FXWA 4WK3A 4CO4A 1RK8A 4UZBA 3RB4A 1VLOA 4WYLA 3R2CJ 2BA9A 2GIQA 2ILZA 1RJJA 2CJYB 1VQ5S 1ZPWX 4J7CA 4JI7J 3TVZA 2F1FA 3ZNJ1 5DDQC 3GIMA 1MROB 1TZ0A 4B3OB 4B9TA 1C2PA 1HQUB 4Z7YA 2M70A 2EKNA 1Q7YT 4B3OA 2GV1A 3LP0A 5F8NA 1SBRA 3ZZUA 3LQVA 4ANEA 3CMES 1CS4B 4OZLA 4TN2A 1X4GA 2J8AA 4QQBA 2R3VA 4ZVRB 4ECTA 2Y1JA 4IR9A 3SV4A 1FI4A 1V9OA 2W2MP 2J0XA 3J80U 4OX9J 4WWSA 4DV7F 3KJQB 1RT1A 4QYZJ 1CG2A 2AP6A 2E5JA 4OZJA 4USJC 3ZZPA 4F50A 2YWFA 1TMMA 2I8EA 2AIRB 2ROEA 3MOZA 4URQU 3UD4P 4QWAA 4Y0FA 2VG6B 3WZ0A 2FLOA 1RWVB 3TOQA 1S6UA 1GMWA 2JL9A 2BX6A 2NYHA 4K8RA 1G2EA 2NQPA 3UDLA 1RABB 1T9YA 2VB6A 5HMXA 2GMLA 1RGVA 2J76E 3CXCR 3Q23A 4RUCA 2OFGX 4I64A 4P2XA 3WX8A 1U2CA 2E9RX 3QYYA 5CD4H 1JLEB 3CMQA 3AQOA 4CLPA 1LW0A 2C2NA 3KNGA 3CIMA 1RYSA 3P3DA 2MSTA 3RBXA 3IR7B 5C25B 1SPBP 1J2VA 4EU0A 1DBDA 1KEKA 1KD1T 4HKQA 1YZ7A 2OHDA 5GMKa 2C22A 4G3IA 1VQNS 2VJVA 1FXRA 2R2RA 1LWCB 2RT3A 4OLPA 3TI0A 3RB3A 4ES2A 3BV8A 1O5JA 2L48A 4J9RA 1RZMA 2MZTA 2HLTA 3J81Y 1VQ6S 2XM3A 1H2UX 3NAIA 3LAMA 3M30B 5JXSA 4Y2MA 2DNQA 2ZKUA 3TJ8A 2FVSA 1CJKB 5F9NA 2XSJA 3K57A 1OJ4A 1QUVA 2DCLA 2YNFB 4PYDA 1WSVA 3LF0A 4DQPA 1FJGJ 5DDPC 2BRLA 2HPUA 3PYFA 5HP1A 3BB5A 3DLKB 1TQLA 5FDLB 2HQ3A 2WBMA 1QSSA 1RT5B 2QGFB 1F3VA 3VV2B 4QR2A 1T03A 4ZOSA 2CFXA 1IWGA 2O1PA 2IVYA 2MKJA 4RBUA 2MSSA 3K2YA 2LLZA 3QGHA 1VFJA 1U1MA 3A3NB 1OY6A 1YX2A 3MCOA 3NRBA 1N33J 2M5YA 5KFOA 2RU9A 2MKKA 2YKOA 5BYSA 4B3SF 4NCBA 1F1BB 3PR4A 4QIFA 3KJVA 1R3NA 2OEJA 4HHUA 4DQQA 4EWTA 2XYHB 2FJBB 4PZVA 3R2DJ 4DV3F 1Q4RA 2CIMA 3DRRA 3AH6A 1H98A 2YPZA 3OFGA 4DFKA 1X0PA 1HBNA 1HI1A 1VCTA 3SQOP 3M8WA 4LRBA 3DNCA 3KNAA 3B4DA 2YWEA 4K0KF 4TY9A 4YN3B 4GO5X 3VGUA 2IYIA 5H9FJ 2NSBA 2KM8B 4J9NA 3RJMB 2C3OA 3DN9A 1BMQB 1YRUA 2YH0A 3IO1A 3MM9A 3TANA 5ETRA 4TVAB 1YZ6A 1U25A 2BM1A 1U47A 1PCAA 2RE1A 1KN6A 2CQ1A 3RAQA 2FJWA 4NX9A 4PG7A 5A2QU 3C16A 1PC5A 2Z2YB 4NCAA 3T1YJ 2EC0A 3HVTA 2EFVA 2VFSA 2B8QA 3HT0A 4X64J 1FK9A 2XI2A
chains in the Genus database with same CATH topology
2C2OB 1NMEB 1RWNB 1RHMB 3P4UB 2CJYB 1RHQB 1GFWB 2H5IB 2FQQB 4ZVQB 2CDRB 2H65B 4ZVRB 3KJFB 2H51B 3KJQB 1RWWB 3D6MB 2HBQB 3GJRB 3GJTB 2Y1LB 2CNLB 3D6FB 3R6LB 3R7NB 1RWVB 2HBZB 2CNNB 2H5JB 2CJXB 2QL7B 4LSZB 1RHRB 5IC4B 2XYPB 2P2CB 4DCPB 3EDQB 5K20B 1RWPB 2C2KB 4DCJB 1IBCB 3EDRB 2H54B 3IBFB 1SC1B 2C2ZB 1QTNB 2QL9B 2QLFB 1I51B 4ZVUB 1RWKB 4ZVSB 2HBYB 3SIPB 4DCOB 2H4WB 3R5JB 1RWXB 1F9EB 3R6GB 1SC3B 2XZDB 3KJNB 3GJSB 1RE1B 3R7SB 2CNKB 1QDUB 4JB8B 1RWOB 1I3OB 2QLBB 3IBCB 1RWMB 5IC6B 2Y0BB 2C1EB 3R7BB 1RHKB 2C2MB 4ZVTB 2XYHB 2H4YB 3QNWB 2DKOB 4ZVPB 3P45B 2QL5B 2HBRB 2XYGB 3D6HB 1PAUB 1RHJB 4ZVOB 1SC4B 3RJMB 3GJQB 1ICEB 1BMQB 1RHUB 2H48B 3NS7B 2CNOB 2QLJB 1PYOB 2XZTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2O B;  1NME B;  1RWN B;  1RHM B;  3P4U B;  2CJY B;  1RHQ B;  1GFW B;  2H5I B;  2FQQ B;  4ZVQ B;  2CDR B;  2H65 B;  4ZVR B;  3KJF B;  2H51 B;  3KJQ B;  1RWW B;  3D6M B;  2HBQ B;  3GJR B;  3GJT B;  2Y1L B;  2CNL B;  3D6F B;  3R6L B;  3R7N B;  1RWV B;  2HBZ B;  2CNN B;  2H5J B;  2CJX B;  2QL7 B;  4LSZ B;  1RHR B;  5IC4 B;  2XYP B;  2P2C B;  4DCP B;  3EDQ B;  5K20 B;  1RWP B;  2C2K B;  4DCJ B;  1IBC B;  3EDR B;  2H54 B;  3IBF B;  1SC1 B;  2C2Z B;  1QTN B;  2QL9 B;  2QLF B;  1I51 B;  4ZVU B;  1RWK B;  4ZVS B;  2HBY B;  3SIP B;  4DCO B;  2H4W B;  3R5J B;  1RWX B;  1F9E B;  3R6G B;  1SC3 B;  2XZD B;  3KJN B;  3GJS B;  1RE1 B;  3R7S B;  2CNK B;  1QDU B;  4JB8 B;  1RWO B;  1I3O B;  2QLB B;  3IBC B;  1RWM B;  5IC6 B;  2Y0B B;  2C1E B;  3R7B B;  1RHK B;  2C2M B;  4ZVT B;  2XYH B;  2H4Y B;  3QNW B;  2DKO B;  4ZVP B;  3P45 B;  2QL5 B;  2HBR B;  2XYG B;  3D6H B;  1PAU B;  1RHJ B;  4ZVO B;  1SC4 B;  3RJM B;  3GJQ B;  1ICE B;  1BMQ B;  1RHU B;  2H48 B;  3NS7 B;  2CNO B;  2QLJ B;  1PYO B;  2XZT B; 
#chains in the Genus database with same CATH topology
 2VA3 A;  3MCS A;  4B9L A;  1S0V A;  3MTJ A;  4X4R A;  3WDO A;  1X4C A;  3I0R B;  4WE1 A;  3Q83 A;  4MYU A;  5D6G A;  4NA2 A;  3G82 B;  3QO9 B;  1ZH5 A;  3OFE A;  1RU2 A;  2DEJ A;  1RHQ B;  4F3O A;  1JKH A;  2XNR A;  1NK8 A;  4J9O A;  3KLE B;  2HIY A;  4IO1 A;  2DNN A;  4LVN P;  1S1X B;  4ZVQ B;  3W9J A;  2LDY A;  1TK8 A;  2XTJ P;  2KZM A;  2R9L A;  2F8M A;  5KT4 A;  2X1A A;  3KK1 A;  4ECU A;  3PZP A;  2C3M A;  2DB1 A;  4L76 A;  2LEP A;  3M9N B;  2UP1 A;  4LF6 J;  2DR6 A;  1CJU B;  1LEO A;  5E3P A;  3FBC A;  5F8M A;  3U1M A;  5HVG A;  2Q3P A;  3MM9 B;  4JI2 J;  3MUV P;  1VRQ C;  3D6M B;  3T6J A;  4PG6 A;  2XO6 A;  2OSR A;  3FDS A;  4IFV A;  4LUB A;  4A4J A;  2CNL B;  4USV A;  4HHJ A;  4Q0B B;  4U7U D;  1T9W A;  1OY8 A;  4CLT A;  3LWM A;  3M2V B;  3GIK A;  5IT9 U;  1NJY A;  2DEI A;  2YQ0 A;  3KK2 B;  1T7P A;  1WOP A;  3T5J A;  1EX8 A;  2MDA A;  4B9V A;  3C6T A;  1GX5 A;  4UW2 A;  3HHN B;  4ILL A;  2E1C A;  1S6P B;  3K59 A;  4O3P A;  5K8M A;  3OVA A;  2X1F A;  3QAU A;  2WOM A;  1RA7 A;  1S6Q B;  3F56 A;  3PYG A;  1X0F A;  2EFO A;  1F9H A;  2F4V J;  4NLO A;  4ZIW A;  1S6Q A;  1S12 A;  1KBR A;  2HG4 A;  2P9C A;  4O0N A;  1WEZ A;  4QW9 A;  1N5Y A;  2BQU A;  2B4U A;  4DF8 A;  2DRA A;  5GVQ A;  2W7P A;  1OO0 B;  2EFP A;  4Q44 A;  1YJU A;  1HQ2 A;  4BC7 A;  3AD8 C;  4NYO A;  4M63 A;  3D2W A;  1H73 A;  4KC5 A;  2BR0 A;  3CED A;  3HO1 A;  2GJF A;  2QA4 G;  1SKR A;  2R7U A;  1SQE A;  4IOA Q;  1UVJ A;  1N34 J;  1FER A;  4P72 A;  2XNQ A;  4C97 A;  1WOR A;  1FXL A;  2FUG 9;  1AB8 A;  1SB6 A;  5A8R B;  3QMQ A;  2DNZ A;  3KG0 A;  2DGQ A;  5C42 B;  4U67 Q;  4N56 A;  3Q0A A;  1IJE B;  1WWH A;  2COL A;  4OYW A;  1Z2L A;  2MQP A;  4NLG A;  2QSW A;  3R5J B;  2MKI A;  4M94 A;  4ID5 A;  3JSY A;  4FNI A;  1D8Y A;  1IM4 A;  1F9E B;  3GP9 A;  2D7S A;  4DI6 A;  5IM0 A;  3A8J A;  4ZPB A;  2IM0 A;  1UZD A;  1FKO B;  3C14 B;  3MAA A;  3V5R A;  3KK3 A;  1W2B R;  1NK5 A;  2JEG A;  3PHE A;  2EG1 A;  4OI1 A;  4ZVE A;  2JEJ A;  2CNK B;  3RZA A;  5I3U A;  4WKY A;  2BE9 B;  5D4L A;  3THT A;  4MKY A;  1RWM B;  1DZ5 A;  2O66 A;  2ZDO A;  4CM2 A;  2FJV A;  1WHW A;  4MFB B;  2AJ4 A;  4QR1 A;  1LWE A;  4MJK A;  3TWZ A;  1WI8 A;  4CH7 A;  3OR1 B;  2GFF A;  3N79 A;  4DL7 A;  1TKD A;  2X3D A;  4LMZ A;  2HHH J;  3MEE B;  4ZCL A;  3KWM A;  3D6H B;  3HP6 A;  1H3D A;  1FEH A;  2JNJ A;  2H3E B;  2NXN A;  1ZS6 A;  2BXJ A;  3R8Y A;  2WCX A;  4W4M A;  2KO1 A;  4Q5V A;  5KFS A;  5J2Q B;  3S7R A;  3BN4 A;  2MKH A;  2FJX A;  3EVO A;  4EGL A;  3ZTS A;  2XY6 A;  5J2Q A;  2QT7 A;  4G1P A;  4DR5 J;  3NL0 A;  2NZC A;  2IJR A;  5KFK A;  1MU2 B;  3HHD A;  1K8A T;  3UD3 P;  1PO6 A;  1IUJ A;  3OVB A;  2DGO A;  2G2O A;  3B82 A;  1VBZ A;  2IBK A;  4FKX A;  2V9W A;  2GO8 A;  2EBG A;  1R8B A;  1EET A;  1KTQ A;  2Z2M A;  2ZE2 B;  1IM6 A;  2OFH X;  2F40 A;  4MKB A;  1APS A;  4K4T A;  4YDX A;  1OY9 A;  2FC9 A;  4FS2 A;  4YFU A;  1QLN A;  2CPX A;  1KVK A;  3ZTO A;  3LP1 A;  1RSC A;  4KV8 B;  4BLG A;  1G3O A;  1N0V C;  2MYF A;  3N9U C;  4USI A;  5KOW A;  2MGZ B;  2V8P A;  1VQ9 S;  3DLG A;  4DPO A;  3G8T A;  5B0E A;  4CNY A;  4DPW A;  1HNV B;  1LNQ A;  2WON B;  1BQX A;  3LGN A;  3MPW A;  3IAS 9;  1QTM A;  2XMT A;  2G1D A;  2VOP A;  4ETX A;  3T1A A;  1BQN A;  2HRY A;  3GFX A;  4F2R A;  3I82 A;  3VAG A;  1B0P A;  2H5E A;  4AQY F;  2WB1 D;  4C7Q A;  2BQR A;  3RBE A;  1S97 A;  4JI3 F;  1SH2 A;  3IRW P;  1VRU B;  2X1G A;  1UCN A;  5DQH A;  4B9S A;  1MG7 A;  5IFM A;  3EM1 A;  3FSX A;  2IYG A;  1I94 J;  4DF4 A;  1XTZ A;  3BM7 A;  5KFY A;  3OTB A;  1R8A A;  3MEC A;  2V8V A;  5LXY A;  3D4J A;  1RTH B;  1FE0 A;  3LOU A;  3NBP A;  3CF5 Q;  2IJN A;  4DL4 A;  4A8O A;  3QID A;  4YOE A;  1N32 F;  2VQF J;  3UI3 A;  5K14 A;  5KG0 A;  1U8S A;  3WQP A;  4CNZ A;  3DOM B;  4RLE A;  5HQ8 A;  4RZR A;  1VIS A;  1EAY C;  2HVE A;  2BYC A;  4C11 B;  5KG2 A;  1M90 T;  2G0J A;  3MPU B;  4HT5 A;  3W9H A;  2W9B B;  2LQ9 A;  2CVE A;  4G1Q A;  3DI6 B;  5LXR A;  3MR2 A;  2CVI A;  4LFA J;  1U0H B;  4EK2 A;  4DSE A;  5HLF A;  2UUA J;  2O67 A;  4LJM A;  4QIW D;  4WFA Q;  4JYA J;  1IR1 A;  2LEA A;  4BWM A;  1C4C A;  4KGM A;  1S0O A;  1S49 A;  4YS2 A;  2WW8 A;  4Y2A A;  2K3K A;  2V2K A;  3IXQ A;  4LRC A;  3ZNU A;  2DGX A;  2R2T A;  3PW4 A;  4DSF A;  1VRU A;  3MPD A;  1CUL A;  4TKT A;  4C8M A;  5T14 A;  2HHQ A;  1QE1 A;  4ED6 A;  5ETK A;  4A8K A;  1K1S A;  2QG9 B;  5M2U A;  2CQP A;  5KFB A;  1S9E A;  4LF6 F;  3CJK B;  1XMQ J;  3CUL A;  3DOK A;  1OSD A;  3GWC A;  1B64 A;  3EWG A;  4RBT A;  2NPF A;  4RNN A;  1KQF B;  3IAM 9;  3Q8V A;  2OO4 A;  3PO5 A;  5CH7 B;  3IBW A;  2YKQ A;  2HW3 A;  2OD4 A;  1WDT A;  3A3P B;  1K0T A;  2DHX A;  4QIV A;  5ITH A;  4Z37 A;  4YY3 F;  2ZOG A;  2Q1L A;  2N3L A;  2HZA A;  2KVQ E;  3ZZT A;  4YB7 A;  5DO2 A;  2JDJ A;  1S4E A;  1WHV A;  1RBL A;  1Q95 G;  2F4F A;  1HQE A;  3ENA A;  5HLF B;  2XZD B;  1YIT S;  3JTO A;  2E44 A;  2EK6 A;  1FRJ A;  1X4F A;  4IQM A;  4L3K A;  3R7S B;  3PW0 A;  4MK7 A;  1RAA B;  4DG1 B;  2I9S A;  3G71 S;  4FF3 A;  4ECQ A;  2RDD A;  1P6T A;  3SYZ A;  1SL0 A;  3GV5 B;  4LF8 F;  4WFY A;  2ZC4 A;  3CJR A;  4IH6 A;  2Y0B B;  2KU7 A;  4IFY B;  2OPS B;  4USW A;  1RHK B;  1WI6 A;  4KB7 A;  3W3S A;  1VK3 A;  2CUY A;  4IQX A;  4QWB A;  2MHN A;  1S1V B;  3UR3 C;  1QM9 A;  3IS9 B;  3BKT A;  2HKE A;  3PY8 A;  1L3K A;  4X4V A;  3N4W A;  4UY8 T;  1YWX A;  3UO0 A;  2GHW A;  5CYQ B;  4X66 J;  5D4N A;  3CC2 S;  3T5L A;  2Z0G A;  5T41 A;  1EET B;  2NXU A;  4I56 A;  1DTQ B;  1QAY A;  3CD7 A;  4DQI A;  2Z2Z A;  3E01 B;  4FP9 A;  5A6P A;  4UOG A;  2WVF A;  1SXL A;  3PYE A;  1RT2 A;  4KGZ B;  4QZV B;  4JI5 J;  4N47 A;  1I6J A;  3MEG B;  3LPE A;  3BSA A;  4C8N A;  3CCV S;  2ZOF A;  4KIA A;  2XB2 D;  4WP8 A;  4ED7 A;  3KMS A;  5H9E K;  2Z58 B;  2M3D A;  3T41 A;  1U48 A;  1WHY A;  3A1Y G;  4NRT A;  3R1H A;  1NSQ A;  2W9C B;  1RHM B;  2CG4 A;  3NP5 A;  3P4U B;  2JFD A;  2E7W A;  1H0H B;  2YWW A;  2OTL S;  4F4Z A;  3S01 A;  1FNX H;  3GCX P;  6AT1 B;  1H6K X;  1QSL A;  4C8K A;  5D8H B;  1RT7 A;  3BBC A;  3IP0 A;  3MED B;  4DX6 A;  5EWG A;  3M6V A;  4UY8 5;  1S1V A;  3NCR A;  4IR1 A;  2DRD A;  1SKU B;  2KB2 A;  1NHK L;  1NKE A;  1Q78 A;  4AE5 A;  1QVF R;  4O23 A;  3IA0 A;  4DPT A;  4LF7 F;  4OV1 A;  3KJF B;  2XO7 A;  3ZO7 A;  5KFN A;  2CAD A;  3DOK B;  3BDP A;  4P9S A;  4PUO B;  1WEL A;  4J9K A;  1RXO B;  3OXF A;  1JXV A;  3AOD A;  3TP2 A;  1A7G E;  2AEM A;  1VC6 A;  1KNZ A;  2Y9H A;  1GQE A;  1QUP A;  3I4P A;  4X62 J;  5L1I A;  1X9S A;  1CJU A;  1S4F A;  4I1T A;  3SDE B;  3KLH B;  2Q6B A;  2FIU A;  4DPY A;  2CJA A;  3AD9 C;  4MFB A;  4N8O A;  4AL6 A;  1U7L A;  2NUU G;  1U6Z A;  4OYB A;  1SV5 B;  1HWJ A;  1RHR B;  4B3M F;  4FBT A;  2Y8Y A;  4J9U E;  3MM6 A;  5KFL A;  3HVW A;  1I94 F;  3G86 A;  3R5C A;  4QPT A;  1F5B A;  2WON A;  2MQN A;  3OR2 B;  3D0G E;  3EPG A;  2C42 A;  3KK2 A;  3AOA A;  2CPZ A;  1UWB B;  3SSQ A;  2MB0 B;  1R7I A;  4H4M B;  5CYM B;  1GTE A;  1XJW B;  3F44 A;  3HHL C;  3QT5 A;  4G65 A;  2CKW A;  3GYG A;  5CHC B;  3HJF A;  3MCN A;  2K8G A;  4ZP9 A;  2ZZT A;  2KT2 A;  1RAC B;  2CQ4 A;  1FFW B;  3DGP A;  4X4Q A;  1U1P A;  4KGV B;  1K44 A;  1HA1 A;  3B78 A;  1N34 F;  4HL9 A;  2DO0 A;  2GO9 A;  4NI2 A;  4CWB A;  3OUY B;  4RO0 A;  5JJB A;  2AYM A;  1HPZ B;  2W2P P;  2ZBP A;  2XCP A;  3KLG A;  3CJ5 A;  5GAG I;  4IO9 Q;  4NLT A;  4MT1 A;  5IT4 A;  1X60 A;  4DV2 F;  5T7L A;  1HL6 A;  5E3R A;  2V34 A;  4NLR A;  5DDO C;  3B54 A;  3CO9 A;  1K1Q A;  1RBA A;  4CYU A;  5T7L B;  1X4H A;  1B7F A;  1TV6 A;  2QX0 A;  1QAI A;  3EGZ A;  4CDI A;  1IKV B;  1V3S A;  1WC3 A;  2FHO B;  4P73 A;  1SC3 B;  5ETV A;  1LWE B;  2OP5 A;  3HVT B;  4DPU A;  5EWE A;  1YDL A;  3DRS B;  5BXI A;  5C24 B;  3W5Y A;  3HXM A;  4RWX A;  1J5E J;  3HD2 A;  5IV4 A;  2DPJ A;  2VG7 B;  3R1L A;  4J9M A;  1D1U A;  4OYO A;  2RIJ A;  2C3Y A;  2ZH4 A;  1NKB A;  4F02 A;  3N28 A;  4QYZ K;  1XER A;  3PJ9 A;  4EO6 A;  2ZHB A;  2A2C A;  3RRK A;  1BD6 A;  4FBU A;  3JTN A;  3JQM A;  1F5A A;  2F5G A;  5L9N A;  4DUY F;  4PAA A;  3TAQ A;  2CQC A;  3FC9 A;  4KYZ A;  4OV6 A;  5HMZ A;  2CDQ A;  5LT5 A;  1JNR B;  4PQU A;  3DU5 A;  4ZPD A;  3RAM A;  2GVD A;  2IA0 A;  2XYG B;  4RW7 A;  3PKY A;  4RW9 B;  3CMA S;  5KFZ A;  3KJV B;  1TK0 A;  3TZZ A;  4DSL A;  3M30 A;  5EX3 A;  5KT3 A;  2HWT A;  4RJV A;  2JFK A;  5AT1 B;  4DR6 J;  1KLM A;  3I32 A;  4N41 A;  1WC5 A;  4QW8 A;  4TU7 A;  4QU7 A;  1XR6 A;  1PJ6 A;  4CLU A;  2EBE A;  4JV0 A;  1VRT A;  3L7O A;  2MKC A;  2LEC A;  4TY8 B;  1T03 B;  3E2E A;  3N6M A;  3A12 A;  3AB4 B;  4K5S A;  2YKM A;  3V2U C;  2E1R A;  4DZ6 A;  1BQN B;  2EG2 A;  2FJD B;  3RU0 A;  2E1M C;  3MPV A;  1ZOT A;  1FT8 A;  2QE5 A;  5FD1 A;  2V8H A;  4NYZ A;  4FYX B;  4LSL B;  1HNX J;  5L9X A;  4PXD A;  1Y7P A;  4USK A;  3PVX A;  1VR6 A;  2N4D A;  1FK9 B;  1BE4 A;  1CS4 A;  2HQI A;  4LT6 A;  1RI7 A;  3A8I A;  4M5D A;  1CBK A;  2KH9 A;  5L1L A;  2AU0 A;  3A13 A;  4O4R A;  1VIX A;  4OZ0 A;  4QWE A;  3DGP B;  1S7I A;  1WKJ A;  1YLX A;  2MZQ A;  3ZZR A;  5CAB A;  1ZZN A;  1ZAV A;  3Q8U A;  1TR0 A;  3BGR B;  4LSN A;  4RW4 A;  4FF4 A;  1R8C A;  1RAJ A;  4B3T J;  2E5G A;  2U1A A;  2ZIT A;  2DGW A;  2ZBI A;  1Z4U A;  2RF2 B;  4DG1 A;  4FKY A;  1U1Q A;  2A6M A;  3EVW A;  2Y3Y A;  5DG7 A;  2W01 A;  1YRT A;  2BAN B;  4JI6 F;  3MFH A;  3OLB A;  3QFH A;  3D0H E;  4U8Y A;  3MAQ A;  1UJ6 A;  4DUZ J;  1S0M A;  4ED5 A;  4OHV A;  4KO0 B;  4MIB A;  4AND A;  2HHV A;  2YKN A;  2YNH B;  3OFH A;  4EFA C;  2D9P A;  3CCT A;  1MRO A;  1DTT B;  5F3T A;  1WC1 A;  1D8Z A;  3X3U A;  2ZWO A;  2E7V A;  2DNR A;  2V0N A;  3KHG A;  4F2S A;  3TZW A;  4OX6 A;  3HSJ A;  3OL8 A;  2ALZ A;  3DRP B;  4LBH A;  1JKH B;  1ULR A;  4PXB A;  3C46 A;  4GVL A;  2KXF A;  3VR1 A;  2FGO A;  3VAI A;  1KS2 A;  1ZA1 B;  1RBO B;  4UTG A;  5ETS A;  4CT9 A;  3SI8 A;  2F8H A;  2HHH F;  2HHP A;  3MEG A;  3RRH A;  1UVN A;  2ZVS A;  3C6U A;  3CVK A;  2C2Z B;  2EWH A;  1XMB A;  5IWA F;  3HT3 A;  2FDN A;  2KTQ A;  1F60 B;  1YJR A;  3ZC4 A;  3CCZ A;  1CJK A;  2W2O P;  3LWL A;  4LFC J;  1TL7 B;  2EC2 A;  1TMJ A;  4ENO A;  4G6V B;  1JLB A;  2QFI A;  1RAE B;  4YDD B;  3MGJ A;  2L08 A;  2EK1 A;  1YJV A;  2GQC A;  2OKQ A;  2W2N P;  3CJ3 A;  5G0R B;  4QWD A;  4GKK J;  3PAC A;  3ZZ0 A;  5DM7 Q;  4U96 A;  5LMN F;  1L5U A;  4I6W A;  3G6E S;  4J9P A;  1HR0 J;  1REV A;  1S7H A;  4K2X A;  3MM7 B;  2YQ3 A;  2R4F A;  2RS8 A;  4WXW A;  4Y6I A;  3P8B B;  4F0H A;  2DCU B;  3MMB B;  1PKU A;  5LM7 E;  4YY3 J;  4XPC A;  4DV6 F;  1N36 F;  3DDI A;  2G9O A;  7FDR A;  2MQQ A;  1VQ8 S;  1H38 A;  1UWB A;  2GMJ A;  1UPM B;  3NLC A;  2B4O A;  3W5Z A;  1S1U B;  2AD9 A;  1KR4 A;  2ILY A;  4X4O A;  3CCL S;  3GFZ A;  1U24 A;  2DGU A;  2FZK B;  2AWZ A;  3JAM Y;  2F7V A;  2OTJ S;  2J7K A;  3VVT A;  2XQC A;  1FWK A;  1NO8 A;  2CPF A;  2PT0 A;  3VAM A;  2XLK A;  2OGU A;  2BW7 A;  5CA5 A;  1ZTT A;  3M8Q A;  2HNZ B;  2IRY A;  2VBZ A;  1JMT A;  3HVA A;  4PR6 A;  2AX1 A;  2D74 B;  1N5V A;  2QYC A;  4KAI A;  5ETP A;  3VQT A;  1S1X A;  1WSR A;  2EFQ A;  1LOU A;  3OXG A;  3POT B;  4MKV A;  4USU A;  5KFC A;  3L9Z A;  3MWB A;  1PAU B;  3QPI A;  3R9L A;  4ZIV A;  5J2P A;  4FVC A;  5KFM A;  2X7I A;  4NCG A;  1Y3J A;  2WVC A;  3GSI A;  3Q86 A;  5HP1 B;  1R89 A;  2OJ3 A;  1UET A;  1EAR A;  3LAK A;  4PKD B;  1Q81 T;  4K4U A;  2YKM B;  2YNF A;  4A47 A;  1RHU B;  1U0S A;  3M2V A;  2KFN A;  5G4D A;  3O2I A;  4DR1 J;  3MR7 A;  5A76 A;  4NEZ A;  3TX8 A;  2HNY A;  2PE8 A;  4DL5 A;  4FXD A;  1VJW A;  2BRK A;  3NY0 A;  2VF3 A;  5KFD A;  3C16 B;  4CRJ A;  2HRU A;  4XIU A;  2CZV C;  4K50 A;  2VL1 A;  2VA2 A;  1RWN B;  2BJ7 A;  3BSC A;  4X4N A;  1RIS A;  2YKA A;  2KFY A;  2NS1 B;  2X51 A;  4ID8 A;  3CCJ S;  1UP1 A;  1TUW A;  3EZO A;  2XMU A;  2OEK A;  2VOD A;  2Y1R I;  4OQJ A;  1H72 C;  2FQQ B;  4EBC A;  3ITH A;  3DRX A;  3HX9 A;  5E3C A;  3EE3 A;  3QGI A;  5KFT A;  3RGI A;  4ECR A;  5D3G A;  2V69 A;  3P96 A;  3SCJ E;  4LQ9 A;  2LMI A;  4K4Y A;  3PW7 A;  5J2N A;  4DN9 A;  2RQM A;  4KV8 A;  2Z56 B;  1N5Q A;  3CCW A;  3N0V A;  4KFB A;  4QR0 A;  5KOX A;  4CLL A;  1NJI T;  4IOC Q;  1RWW B;  1UMJ A;  1VBX A;  2K1R A;  4RW8 B;  2NR0 A;  1A0O B;  1U2F A;  2UUB J;  2VBW A;  3PM9 A;  4K4Z A;  1JNZ B;  3EXY A;  3JTP A;  1FVQ A;  1Q5Y A;  3QAE A;  4ZP7 A;  2YWG A;  4C4W A;  3OTO J;  2PEH A;  2R8H A;  5HRO A;  3Q8R B;  2VPW B;  1PIL A;  4N7T A;  1QJH A;  4B3R J;  2G0C A;  3V6J A;  1X5O A;  4F8R A;  2Z57 B;  2RQ4 A;  4DV3 J;  1SJQ A;  4DR6 F;  3HJV A;  3D1H A;  5KFX A;  2DNL A;  4AUK A;  3L95 X;  4ERD A;  3BBF A;  4RUA A;  2IIH A;  4CLY A;  5B0F A;  3BO3 A;  2JH3 A;  2M7S A;  3CPW R;  2AMC B;  2BE2 A;  2HK2 A;  4I0W A;  1YJW S;  4DR2 F;  5GAE I;  3GR1 A;  1NBE B;  4IH5 A;  3MMJ A;  4NI2 B;  5LSR A;  4F04 B;  3I9Z A;  3OXL A;  4DS4 A;  3T1H F;  2CQG A;  2HFS A;  3VZH A;  2KM8 C;  2H54 B;  3CJ0 A;  4WPA A;  4HH0 A;  3BO2 A;  5IT9 Y;  4IG0 A;  4GRS A;  2QRR A;  2OPP B;  2RRA A;  2DHS A;  2HMI B;  3QJL A;  1AUD A;  3H40 A;  4OZN A;  3FNN A;  3IMQ J;  5F8L A;  4YR2 A;  1N6Q B;  2KZZ A;  4H54 A;  3SSR A;  1E6Y A;  3CB4 A;  5FDL A;  5C2C A;  4TQR A;  2RRB A;  1S10 A;  3MD1 A;  2NUH A;  1RT5 A;  2PA3 A;  3CDW A;  3RB6 A;  3GYN A;  4XAK A;  3VCD A;  4X4S A;  3H5X A;  4KHP F;  2IA6 A;  4ZPV R;  2V4R A;  3PYD A;  4I68 A;  1I51 B;  4ZVU B;  1W7W A;  3IFE A;  5CCM A;  1NK9 A;  3IM8 A;  2DR8 A;  2GVZ A;  2A6O A;  3ONQ A;  4KHM A;  3B8H A;  4OLO A;  3I5C A;  3KDO A;  3T6B A;  3VGT A;  3H2L A;  4YB1 P;  3E51 A;  3HFK A;  4H4O B;  1VBY A;  2V2Q A;  4U9R A;  2M8D B;  4PWU A;  3OTC A;  2PGC A;  3NKY A;  5F8I A;  2ZDP A;  1WD6 A;  1IR2 A;  3AA9 A;  4GKK F;  3EIC A;  2KYX A;  3D54 A;  4OX7 A;  6FD1 A;  3AT1 B;  3SBM A;  2KVI A;  2J9C A;  1SCJ B;  4RW7 B;  3MAA B;  1WG1 A;  4KJI A;  5JUM A;  5A0Y B;  5ETQ A;  2C1E B;  2W8K A;  3D3C J;  2QTW A;  2POK A;  3MEE A;  1WC4 A;  3WIU A;  1ACM B;  1WKL A;  2QA4 S;  1S9F A;  1B0T A;  2VAS A;  2RDJ A;  2FJA B;  3P5T L;  2FZG B;  4PXE A;  5KFF A;  3M1V B;  3H20 A;  4O44 B;  1FFG B;  3DLE B;  4C0B A;  2XMV A;  3LGM A;  4CO3 A;  4P75 A;  2I5J A;  3BRE A;  3AJ1 A;  3JAM U;  3G6X A;  1ZAX A;  3BN7 A;  3HSD A;  3MEK A;  4MK9 A;  2VDH A;  3FRZ A;  2U2F A;  4I2P B;  4LIW A;  4OJ3 A;  5HJX A;  3QRR A;  3QO9 A;  2J0S D;  4NXN F;  4ECV A;  3J7A 1;  1WF1 A;  1LWF A;  1DQ9 A;  1HNZ F;  1U1L A;  4WF9 Q;  3LTO A;  2KHC A;  2XMW A;  2EFG A;  3CDE A;  2KJV A;  1HD1 A;  1FRH A;  1IKW A;  1E6V A;  1TKX B;  4WU2 A;  2FY1 A;  3I0S B;  4Y3C A;  2UVR A;  4IRD A;  2UXD F;  1XIQ A;  1BQM B;  1ZAW A;  2OAU A;  1V5I B;  1PJ7 A;  1GH8 A;  5K8P A;  3IRX B;  4K59 A;  4Y2C A;  1R0A B;  1AXQ A;  4U6P A;  1KRP A;  1HI8 A;  3J7Y I;  3OPK A;  1N33 F;  1SH3 A;  1DUR A;  1R27 B;  1BY9 A;  2RDI A;  2LDI A;  1FKP B;  2XBP A;  4OMF G;  5KFA A;  3J81 j;  2J6S A;  2K7K A;  5DLF A;  2QN6 B;  2VQE F;  1NKC A;  3K17 A;  1T9V A;  2BEF A;  1B4S A;  3QT6 A;  4MTP A;  5EHH A;  3NEK A;  1S1W A;  4USH A;  3QZ8 A;  4R0J A;  3JYT A;  2JEI A;  3CJQ A;  3RG6 A;  3M6W A;  2DO4 A;  5HMY A;  2DR5 A;  4CQ1 A;  4NWB A;  2DY1 A;  1T9T A;  1YI2 S;  3J80 Y;  2HND B;  3UCG A;  2PA8 D;  3UN5 A;  1IBK J;  1KKH A;  2LQB A;  4OYZ A;  2ACY A;  3MM8 B;  5HO4 A;  3NMA A;  2CXE A;  2GCF A;  2AT1 B;  3NNA A;  3QLH B;  1VC0 A;  2R2S A;  2HHS A;  1J5E F;  3T1Y F;  1YKW A;  5HBM B;  1MSW D;  2DGV A;  1J5O A;  2DD8 S;  2UXC F;  5EUH A;  1NDC A;  4HT7 A;  2MPU A;  3LP2 A;  1Q86 T;  1PBA A;  4KY3 A;  1HNV A;  4ZVF A;  1QAJ A;  4C11 A;  1T9U A;  2XWY A;  2V63 A;  3H5U A;  5AJ3 F;  1N6Q A;  2B7C B;  2HS0 A;  5K8O A;  1E6Y B;  5HJY A;  3TZY A;  1MMN A;  3PIO Q;  3CCS S;  1WG5 A;  3V81 A;  4HAC A;  5D0R A;  5J2M A;  5KG6 A;  1C1B A;  4RU9 A;  3M4X A;  4B9N A;  1JJC B;  1MNE A;  2DNP A;  2AYB A;  4G1I A;  4ZJQ A;  4RW8 A;  1VOM A;  3AXK A;  3M6U A;  3QQC D;  1VQP S;  1B99 A;  5KFJ A;  2VC1 A;  3ELH A;  2O3D A;  4ZLJ A;  4P52 A;  5DQG A;  1HNI A;  4DZD A;  4PWD B;  3K5M A;  4B3M J;  3C19 A;  2DXE A;  2Z30 B;  3ZTQ A;  3K89 A;  5C25 A;  1Q8K A;  1SJR A;  2QLF B;  1S57 A;  3ZFV A;  8RUC A;  2QEX S;  1DLO A;  1TL4 A;  2R7X A;  4LFB J;  1RWK B;  1FE4 A;  3OL7 A;  1OWX A;  2OEL A;  4J9S A;  1RAF B;  5GMD A;  3U27 A;  3UDV A;  1TFW A;  1R0B G;  1S48 A;  2LA6 A;  5E0O A;  2BAB A;  1G1X A;  4U7U K;  1JLG B;  4F7V A;  3R5D A;  1T0T V;  4OJH A;  1NB2 A;  1OMS A;  1S77 D;  2MQ8 A;  4IG3 A;  4HDG A;  4F26 A;  2Q6C A;  5E5N A;  1FWP A;  1TVR B;  4ZCK A;  4LF7 J;  2JZ5 A;  3GII A;  2DHG A;  4X4T A;  2YNI B;  2H1Y A;  1NZ8 A;  2KDO A;  3GJS B;  3H98 A;  4DR5 F;  2LEB A;  3QJP A;  2KJW A;  3C66 A;  2VFV A;  3BQ1 A;  4ZN3 A;  5LMU F;  4DQS A;  4O4G B;  3M8P A;  3RR7 A;  2APO A;  2GS8 A;  4MK8 A;  4RUB A;  4ZLL A;  3FQK A;  2ASD A;  2BUN A;  2QYG A;  4PPZ A;  2V2V A;  2IRU A;  3ET6 A;  1N32 J;  4JV5 J;  4J5O A;  3J81 U;  3G87 A;  1M5H A;  1UA0 A;  1BWV A;  2QL5 B;  2EI5 A;  2HBR B;  3ET6 B;  5DQI A;  5CD4 A;  3W5X A;  1DLO B;  2MMY A;  3FRY A;  2IAJ A;  2V9K A;  3UD5 A;  3OUY A;  3H25 A;  2ZH3 A;  4DLE A;  1FNM A;  3R3T A;  4JYA F;  1EQ0 A;  3DKD A;  1JXE A;  4YUD A;  4OI0 A;  1SVD A;  4LSN B;  2IC3 B;  2WVD A;  2HND A;  3OFF A;  4QIE A;  4OZ5 A;  4USM A;  3Q8Q B;  3Q89 A;  1RT3 B;  2FHM A;  4C6A A;  1O0P A;  2AJ0 A;  4DR1 F;  1BQM A;  1HHQ A;  1RTJ A;  2VG5 A;  4Q7A A;  2XC9 A;  3S1T A;  2A0F B;  3OVS A;  1WKK A;  4CLK A;  1P9Q C;  1U45 A;  1FFS B;  1Y5I B;  3KHH A;  1K9M T;  3NGT A;  2IRX A;  4YME A;  4OHY A;  3E8O A;  4X65 F;  1Y5N B;  2UUC F;  3V6D A;  4ZVH A;  1LQ9 A;  1AA1 B;  1HBU B;  1SL1 A;  1S9G A;  1X5S A;  2OUG A;  2P6S A;  2XY7 A;  4GKJ J;  3N5F A;  5JVH Q;  1IBM F;  1VI7 A;  4DV7 J;  4JI1 J;  3ZTP A;  1VRT B;  2VQF F;  2GNK A;  2NYI A;  3BPD A;  2PMH A;  1X4E A;  3W2V A;  5H9F K;  2LXU A;  2FVR A;  1RT6 A;  2H65 B;  4CO2 A;  1Q1K A;  4DFP A;  3KDN A;  2PEB A;  4E98 A;  1YJT A;  3L3C A;  4ITS A;  1TU0 B;  1K0V A;  2DH8 A;  3OL6 A;  2HWI A;  3FMW A;  4HI1 A;  1S5Z A;  3L7U A;  4RW6 B;  2DNG A;  3C6U B;  3GJR B;  2G0I A;  2LA4 A;  2LYV A;  1NK4 A;  5AXM A;  1CJT B;  1S76 D;  2YNG A;  1UEU A;  1RKI A;  5EDW A;  2R7W A;  4LF8 J;  4Q45 A;  2XG8 A;  2GMH A;  2CAJ A;  1EKS A;  2LXF A;  3KLG B;  3FK4 A;  4GVB A;  4HLB A;  1M5P C;  2GC8 A;  2VFU A;  1ZET A;  5ETT A;  3E3X A;  4N5S A;  3OR1 A;  1SJ4 P;  3HI9 A;  4U7C A;  2W8L A;  1P1T A;  2J0Q D;  3O5T B;  4PPD A;  5IQ6 A;  2QMX A;  3DFE A;  3DYA B;  4WYW A;  2B7B B;  4UUX A;  2D3O 1;  1YHQ S;  1IBK F;  1SIW B;  4J91 A;  5GAD I;  1XNQ F;  1KHV A;  4LSL A;  4QBU A;  2UXD J;  3T1H J;  1IWA A;  4WP3 A;  1FNO A;  5AXL A;  4DV1 F;  3QZ7 A;  1FA0 A;  2VKZ G;  4RNH A;  2DBB A;  4MIA A;  1DQA A;  2MZJ A;  4NLS A;  5D77 A;  2AGP A;  2DNH A;  3GSD A;  4EZ6 A;  2YWH A;  1X31 C;  1X4A A;  4NZ0 A;  2NXE A;  2UUB F;  1FJC A;  2IDE A;  5CYQ A;  5B0G A;  1F0X A;  3N6L A;  2WSC C;  5BR8 F;  3KLH A;  3ISN C;  3JSM A;  1TVR A;  4AQY J;  1M5S A;  2W24 A;  3AA8 A;  3V6K A;  4B3R F;  2HAI A;  4N76 A;  2XHW A;  1LWC A;  1PJ5 A;  4OHZ A;  4CIO A;  4K4X A;  1FRK A;  3BSN A;  3T3F A;  2Y8W A;  2J7U A;  4GVB B;  3Q22 A;  2JHE A;  3SCL E;  2Z8Q A;  3PRB A;  2JEF A;  1YBU A;  1NLK L;  5DGB A;  2KT5 A;  3PIP Q;  1PBU A;  3LA0 A;  3DLL Q;  1UVM A;  5DG8 A;  1KWM A;  4Y65 A;  1HBM B;  5HAO A;  2ZH6 A;  1SIZ A;  1LXN A;  4IFV B;  1XEZ A;  3QIP A;  3M2U B;  1NK7 A;  1EQM A;  1R8H A;  3WX4 A;  3MF5 A;  1Q8I A;  3ENV A;  5D0H A;  1NSP A;  2FZC B;  3MED A;  3H42 A;  3HPO A;  5AE1 A;  3G8Q A;  1MMD A;  1N5T A;  2BOA A;  1RLD A;  3GIR A;  2A18 A;  4I7F B;  3R7B B;  5KFG A;  5M2P A;  1SKS A;  1HLW A;  1KFD A;  2OMO A;  3BF4 A;  2UUC J;  3KHL A;  1EJ7 L;  1F9F A;  2B9X A;  2DKO B;  2DVI A;  1RP5 A;  4NZ6 A;  4KR0 B;  2GA7 A;  2XMM A;  3NOC A;  3UDE A;  4PUO A;  2VV5 A;  3FSY A;  4CLS A;  3GU0 A;  1NJZ A;  3ILJ A;  1LK7 A;  4DQR A;  2BVZ A;  4CO5 A;  2RML A;  4CO0 A;  1JWW A;  2CQ3 A;  2HGL A;  3MMA A;  5SZT A;  3W7B A;  5DG9 A;  1XMQ F;  4DV4 F;  4P7V A;  3PHT A;  3VAK A;  2GIR A;  3D66 A;  4NYP A;  2DNM A;  2YNI A;  2YWK A;  4NAS A;  1DQ8 A;  1SQF A;  4O44 A;  3S6E A;  2N4C A;  4PQA A;  1GK8 A;  1C1C B;  1NME B;  1W25 A;  4NLY A;  2W7O A;  4TU9 A;  1FTR A;  2DHA A;  3FMB A;  4WP9 A;  2RHS B;  4C3L A;  7AT1 B;  4H4K A;  3D28 A;  3PXG a;  4DL2 A;  1PYS B;  1U4B A;  2R7S A;  1I5O B;  2M0G B;  5EGY A;  1YQH A;  1FRM A;  4B9M A;  4AXJ A;  2BOP A;  4PQU B;  5GAH I;  2GGP A;  3SQG B;  2WW4 A;  3DM2 B;  5D15 A;  5CAA A;  2X3G A;  3ICL A;  1DHM A;  4V1A k;  1N4L A;  2DY9 A;  2YXL A;  3IR6 B;  3I55 S;  2R7O A;  3EXC X;  4QWC A;  3FFI B;  5IS2 A;  1U1R A;  4DUZ F;  3H7H B;  1XNQ J;  2OPP A;  2FLN A;  2Z2L A;  1ZA2 B;  2HFO A;  3MI7 X;  5ADZ A;  4KH0 B;  3MD3 A;  4P74 A;  3N5B A;  4XDC A;  1KLM B;  4Q8E A;  2Y1L B;  4OIX A;  1X9W A;  1WG4 A;  1KQG B;  1NCL A;  1H74 A;  2IM3 A;  3D6F B;  3R5G A;  2CQI A;  3H2V E;  1ZM2 A;  2JVR A;  3R6L B;  1ARO P;  1HR0 F;  2ZVI A;  2HK3 A;  5D4O A;  1EHW A;  2G1H A;  1HWL A;  1NPK A;  4QOT A;  4DR2 J;  1HAR A;  4CYU B;  1VLY A;  2OPS A;  2W9A A;  1QSY A;  5L8R C;  4LSZ B;  1G7C B;  3EZ5 A;  1PAE X;  1QAX A;  3CCR S;  4A8F A;  3P5B P;  3K7R A;  4YR0 A;  1R6V A;  1SJ1 A;  1JLE A;  3ILO A;  4ZDN A;  1RYR A;  1RAI B;  1TL1 A;  3G6V A;  3VHQ A;  3GQC A;  1NSK L;  4P7T A;  3MEC B;  1VYA A;  1U02 A;  4K2J A;  4Q43 A;  2ZBC A;  2A2D A;  1HNI B;  4PWD A;  1D09 B;  2R2U A;  2D1C A;  4ZP8 A;  1UA1 A;  1Y10 A;  4DV5 F;  2DIS A;  5I3Q A;  1P8G A;  2B8P A;  2RNE A;  3K8W A;  4KHR A;  2HQF A;  1K47 A;  4O0I A;  4F4W A;  5C5J A;  4C3K A;  5EX0 A;  1M5K C;  1TAQ A;  4YB5 A;  4Y2K A;  4C3M A;  3CC4 S;  3HDS A;  2DGT A;  1B7Y B;  3GTY X;  3KG4 A;  2B9E A;  3DHW C;  3H2U B;  4MMO A;  5J2N B;  3W61 A;  3W8G A;  2ZH8 A;  1KOH A;  1C0U B;  3QT7 A;  3SCI E;  3WC2 A;  2P8I A;  4NRU A;  4CH1 A;  1D9D A;  2C28 A;  4Z7C A;  3VVU A;  1ZPV A;  3Q2S C;  4FPI A;  3VGS A;  1T02 A;  2AHO B;  4ZKA A;  4ZVS B;  5KFU A;  5M2R A;  1EKR A;  1TKT B;  5B7W A;  1CUL B;  1QY7 A;  4PG4 A;  3BR8 A;  1VQL S;  3M05 A;  2UZA A;  1TUV A;  1FX4 A;  3J7Z T;  2RQK A;  4V19 X;  1DTT A;  4S0M A;  1LWX A;  1OS5 A;  1AT1 B;  1ZM9 A;  4FYW B;  3IG1 A;  5IXU A;  4YQW A;  2YKN B;  2YNH A;  2IVM A;  5IQQ A;  1HW8 A;  1Q0N A;  4XO0 A;  4F4Y A;  1ITP A;  2B4P A;  2OI2 A;  4K5R A;  3JYT B;  2LVW A;  1NHV A;  4KKO A;  1QD1 A;  3H0P A;  5CYM A;  1ZTW A;  1TTH B;  1YBA A;  1UW9 A;  4UZC A;  3TVY A;  2MLZ A;  2KRR A;  4A8Q A;  4UOF A;  2ZD1 A;  2FHK A;  3D1O A;  3TO8 A;  3BSO A;  2RB7 A;  5LMU J;  3MR5 A;  4IRC A;  1YVF A;  1TEL A;  2OPQ B;  5F9L A;  4LRF A;  2HHW A;  4N77 A;  4LIR A;  3DRR B;  1TFY A;  3DMJ A;  2ZHO A;  2PO4 A;  1VQK S;  2CQH A;  2C2M B;  3QGG A;  1BGX T;  5DZ7 A;  3CJ2 A;  7FD1 A;  3GFY A;  2ZH9 A;  1RT3 A;  4LF4 J;  1SV5 A;  3AQP A;  3L7P A;  2FVC A;  3JSM B;  2DR7 A;  2HUR A;  4ED0 A;  2VOO A;  1HNX F;  3BH6 B;  3J7Z 5;  2J8S A;  2WZ1 A;  1W26 A;  4ZVO B;  2N3O A;  4EYH B;  1HNZ J;  4AYB D;  1VS3 A;  1TAU A;  2IM1 A;  1JJ2 R;  5KFQ A;  3NS7 B;  1HBU A;  5GAD U;  2CPH A;  4ZCI A;  4OZ2 A;  2W2Q P;  2D9O A;  4PRF A;  1GT8 A;  4KT0 C;  4X84 A;  4ECS A;  1FES A;  4DS5 A;  2I0X A;  4A48 A;  2KFZ A;  5FJ4 A;  3R97 A;  3X1L B;  1FVS A;  4P71 A;  5AJ3 J;  3QT8 A;  1MN9 A;  3DCA A;  5MLC V;  5DRK A;  3U1L A;  1OQ6 A;  3W64 A;  1YJN S;  1L3T A;  1RAH B;  1U8W A;  4NXM F;  3EMT A;  3FFI A;  3TAM A;  2OIH A;  2AZ1 A;  2IY5 B;  2B3T B;  2RSQ A;  4ECY A;  1KQS R;  1IQZ A;  1M1G A;  2CPI A;  2RVJ A;  4ATN A;  5KFE A;  2W9B A;  2ZJR Q;  3ETM A;  1WTB A;  1NSA A;  2IFX A;  3HSZ A;  3ITH B;  2LFV A;  2VON A;  1RWU A;  1C0U A;  2BJ3 A;  2MZ1 A;  4ECW A;  3EGW B;  1NND A;  2UUT A;  2Y0S D;  2EKY A;  4R8U B;  4C9D A;  4LR8 A;  2RAQ A;  2HYI B;  3FBE A;  2I2Y A;  3PEJ A;  1ELO A;  1UFW A;  1V6H A;  4HVZ A;  5JVG Q;  4NLP A;  5CZX A;  4CH0 S;  1N56 A;  1KVJ A;  4KPC A;  5C42 A;  4KGX B;  3S8S A;  1L3S A;  4E0D A;  3TRG A;  1O6X A;  3HCX A;  1CPZ A;  5A8K A;  3RAX A;  1N88 A;  1N52 B;  2HNY B;  2AX0 A;  1UKU A;  2CWX A;  2QL7 B;  4F0M A;  5KT7 A;  3T9N A;  1X9M A;  4LF5 F;  1RUS A;  1YIJ S;  3NGK A;  4NL5 A;  4QPX A;  3ADA C;  3CTR A;  1NH8 A;  1TKZ B;  2PC6 A;  3FUY A;  2YNG B;  3JS9 A;  3O44 A;  3FBB A;  3OD2 A;  3M8Y A;  2HSE B;  4M8L A;  4NLQ A;  4OI3 A;  5E3Q A;  5ETL A;  2IMW P;  3EDQ B;  3G82 A;  2KXH A;  1C0T A;  1WEY A;  5U47 A;  2ASJ A;  3CO0 P;  1N5S A;  2K06 A;  1RU1 A;  2MGZ A;  2B9W A;  3IWL A;  3QLH A;  2FVQ A;  4HI2 A;  3OQ2 A;  2ZHA A;  2UU9 F;  4R25 A;  1LKZ A;  1HNW J;  1S79 A;  3KMQ A;  3BH7 B;  1FDN A;  1GEH A;  5CCL A;  3GG1 A;  2MZS A;  3ILL A;  5LL6 d;  2G13 A;  4IG0 B;  1TKT A;  4IKA A;  4DLG A;  1MWQ A;  3G4S S;  2AYG A;  3D9B A;  4CLF A;  4F0K A;  2DXD A;  4R8U A;  3V6D B;  3VQS A;  3QFW A;  4H4M A;  5D0E A;  4OX9 F;  4DJB A;  2JWN A;  5KFI A;  1X5P A;  4DSJ A;  1V3R A;  3VF0 B;  2CWK A;  1GMU A;  4KGK A;  2ZNZ A;  4OYI A;  2M2B A;  3RYL A;  3O6Q A;  3SIP B;  2IDL A;  4I69 A;  4XK8 C;  5H1S V;  3V4M A;  2CPD A;  5DET A;  1CVJ A;  3I4H X;  3HKW A;  4LR7 A;  2BKP A;  2EEY A;  3M7V A;  3D68 A;  4NE9 C;  2FVP A;  1WNE A;  1VQO S;  1SUQ A;  1U6F A;  3MMC A;  4L75 A;  2XGQ A;  1FEE A;  2DYA A;  8AT1 B;  4JI3 J;  4OJ1 A;  2BJ1 A;  3I0S A;  4WKR A;  4C8Y A;  2XUL A;  3MM5 A;  4L74 A;  1RKJ A;  1HI0 P;  4C98 A;  1BXN A;  3QRP A;  2AGO A;  1GTH A;  2B5J A;  3U02 A;  3OTE A;  5KFW A;  1YK9 A;  5HVH A;  2DK2 A;  3CJ8 A;  2E9Z A;  4I6A A;  4LF5 J;  2IMO A;  3C3L A;  3V4I B;  3PR5 B;  2BJ8 A;  4I4B A;  3TAP A;  3QGP A;  1JJ4 A;  3W63 A;  2E5I A;  2HIQ A;  3BGL A;  3KUE A;  1UAW A;  2YTC A;  3GV7 B;  5KFH A;  3F73 A;  3DYA A;  4Z2X A;  2UXC J;  1CJV A;  4DV2 J;  1REV B;  1R43 A;  1CQM A;  4ZPC A;  1XMO F;  1C1C A;  2FHJ D;  3M1V A;  4ETZ A;  1IQT A;  1H2V Z;  2HS3 A;  3F0N A;  2V2Z A;  4ILR A;  4QJV A;  2WSE C;  2RHQ B;  5CZV A;  1MU2 A;  2PFD A;  1D9A A;  3BYP A;  4ZVG A;  3TYT A;  1U2R A;  1NHU A;  4L72 B;  5IV3 A;  2R7T A;  2OPR B;  3NOG A;  3PFE A;  4EUV A;  3KLV A;  1S1U A;  4D3H A;  3FEX B;  2NPI A;  4ZP6 A;  3KK3 B;  3DU6 A;  2D3Z A;  3DOM A;  3MTK A;  2ZD1 B;  4C0H A;  2C2O B;  3JB9 k;  2ACM A;  3PRD A;  2QA2 A;  4NOH A;  4DV1 J;  1PGZ A;  2V8G A;  1UEV A;  2RQC A;  4KHP J;  1MN7 A;  4FPR A;  1RT2 B;  4PYA A;  4ZMM A;  2E5L F;  2B5J B;  2HHU A;  4RW4 B;  3ZXW A;  2GHP A;  3PO4 A;  2L9W A;  4UQG A;  3PX6 A;  4NXN J;  1SC6 A;  3KUG A;  2GJ2 A;  3TUP A;  1FWL A;  2JLE A;  4WU3 A;  1NM2 A;  2F8E X;  3IRX A;  2VH7 A;  3QWU A;  1IKY B;  4YB6 A;  2G2Z A;  2VPX B;  4KE5 A;  2VG6 A;  3CDB A;  5KFP A;  1U1O A;  4R5P A;  1IKV A;  2XWX A;  2L3M A;  2PD1 A;  3BKU A;  4JUZ A;  5DZ6 A;  3I87 A;  4C2M A;  1V5V A;  4LF4 F;  2J9E A;  1Z1Z A;  4NLX A;  3FCV A;  4ZLP A;  4FS1 A;  3W2W A;  4A8Y A;  4Q8F A;  2P5V A;  1TKZ A;  4H4K C;  4I6Y A;  4X65 J;  1GNK A;  1ZM3 A;  3UW1 A;  4F36 A;  1UJ4 A;  3QRQ A;  1AZS A;  3OV7 A;  2RUS A;  3RW7 A;  2FJE B;  2EFN A;  3D67 A;  4ID5 B;  2WAQ D;  3AJ2 A;  2VC0 A;  4F4A A;  2VQE J;  4DX8 H;  4Y28 C;  4DL0 C;  2FLL A;  1GX6 A;  2LU2 A;  3JSR A;  3DLB A;  2VBY A;  2ZE2 A;  4A46 A;  2FC8 A;  3HVR A;  4DR3 J;  2XY5 A;  5HN0 A;  1NDP A;  2Q43 A;  3VTI A;  3CC7 S;  2HFU A;  3NG8 A;  4DCP B;  4CT8 A;  3IWX A;  3CDA A;  4NA3 A;  2F3J A;  2PI4 A;  4X4U A;  1I1G A;  1XWL A;  1C1B B;  2BAN A;  3PTW A;  5KT6 A;  2E5H A;  1VIO A;  3MMA B;  3JQJ A;  2C3U A;  3LGH A;  1FRL A;  3DLJ A;  5A0Y A;  3SEO A;  4C8L A;  4ZS6 A;  2PII A;  2MY7 A;  2DIV A;  5AE2 A;  3W9I A;  1IKX A;  1JLF B;  3UFC X;  3H4B A;  3M8P B;  2N7Y A;  3G8S A;  4TY8 A;  5F0U A;  2A3J A;  4DV0 J;  1KSP A;  4DR4 J;  3UPF A;  2MJU A;  3KG1 A;  9RUB A;  5KTQ A;  2MKS A;  4LVO P;  4GC7 A;  1KDN A;  4DV4 J;  5A8K B;  3K5O A;  3IS9 A;  1Y5L B;  3KUH A;  3CDU A;  2F9D A;  3GLJ A;  3RR8 A;  2J0W A;  3UN2 A;  3HKZ D;  5LSL A;  1S6P A;  1JLG A;  2HBY B;  3EZU A;  3KLE A;  1Q16 B;  1XNR F;  1IN0 A;  4YP3 A;  2GGP B;  3GCW P;  4WIQ A;  4OJG A;  3SQG A;  4ED3 A;  2BKO A;  2C2R A;  4JI8 J;  1AFJ A;  2OPQ A;  2BDP A;  2ZZN A;  3EYZ A;  2ZFH A;  2BZ2 A;  4ZHR A;  3OTO F;  4EBE A;  1TK5 A;  4QU6 A;  1NUE A;  3Q8P B;  2EW9 A;  4WII A;  3R6G B;  1FKA F;  4X64 F;  1UVL A;  3FCW A;  2DHH A;  3PX0 A;  2ATC B;  2V4J B;  1I3O B;  4GO7 X;  3OHB A;  1U1K A;  1Y9O A;  4PG8 A;  3I96 A;  3L09 A;  5I4M A;  5K5M A;  3K5N A;  1U49 A;  2XHC A;  2IM2 A;  2HZC A;  2J6U A;  4NXM J;  2HHX A;  2HRT A;  1X5T A;  2WB4 A;  3TUI C;  1TP7 A;  2VFT A;  3BYR A;  2J5A A;  1RAO A;  3C8Y A;  3HZE A;  1ZBT A;  4DN0 A;  3KYL A;  1G4C A;  1KC8 T;  3BEG B;  1VHF A;  4M5D B;  1WAC A;  4JOU A;  1HNW F;  1TUG B;  4EI2 A;  4ED1 A;  2ADC A;  3CIZ A;  3TA1 A;  4P2S A;  1LWF B;  1S9E B;  4JI4 J;  4IH7 A;  4J9Q A;  4J90 A;  3GZ7 A;  4ECZ A;  4BDP A;  5LMN J;  4OFZ A;  4P10 A;  1KOO A;  1UTA A;  4Y00 A;  2VIC A;  3AAW B;  1Q79 A;  1L3U A;  4BHQ A;  4YEA A;  2UV8 G;  3MUR P;  4A8S A;  2YQ1 A;  4DV6 J;  2DRB A;  4DR7 F;  4E2F B;  2XZT B;  2OML A;  4NZ7 A;  4DDF A;  4ZIT A;  2XS5 A;  1HQE B;  2D3O R;  1WOO A;  3UNY A;  4PG5 A;  2VD3 A;  4JV2 A;  2V5H G;  2AJF E;  1DRZ A;  4W98 A;  5AE3 A;  3M8R A;  3WBZ A;  3IGN A;  2V4J A;  2HQC A;  4ELU A;  1EZZ B;  2VIH A;  3K5P A;  2CJB A;  1KHW A;  1Q8L A;  2L9N A;  2PDA A;  4J9V A;  1MW7 A;  4G1Q B;  1NJW A;  2CJ9 A;  5BR8 J;  2JOQ A;  2HFV A;  4LRD A;  1BWE A;  5F41 A;  1GFW B;  2C2E A;  4FXV A;  2AKW B;  3CCE S;  4DU7 A;  5HK4 A;  4BWJ A;  4K4S A;  4DPX A;  2QLX A;  8ATC B;  5IWA J;  3TUZ C;  3OR2 A;  2GHV C;  1N48 A;  4RKU C;  4B3T F;  3UN3 A;  3GON A;  1UZH A;  4HHH A;  3L4B C;  3RBZ A;  3NAH A;  1QE1 B;  3TUJ C;  5GAH U;  2CQ0 A;  3PW5 A;  1P9Y A;  1Y4Z B;  2CPJ A;  4OX8 A;  4EO8 A;  1NK6 A;  3M32 A;  4FN5 A;  4ES3 A;  1KLN A;  3VZI A;  2D41 A;  2FB0 A;  1AFI A;  1VHI A;  1P1L A;  1X8D A;  1LXJ A;  5DS7 A;  1URR A;  2EPI A;  2HGN A;  4URS A;  2FTR A;  2YX4 A;  4DSK A;  3PEH A;  3MR3 A;  4U8V A;  3VWS A;  2RIL A;  3HHE A;  3H5S A;  4NML A;  4F3M A;  4CZC A;  1T8E A;  1EP4 B;  2I6W A;  2CJX B;  1LK5 A;  2JC0 A;  5GAG U;  1Q7L B;  3JSB A;  2YY3 A;  4M5M A;  2KG0 A;  4DV5 J;  4IDK B;  4WFB Q;  3LP1 B;  3TEH B;  3FJ2 A;  3J7Y U;  2ZH7 A;  1N54 B;  3O8W A;  4E8U A;  1WTF A;  4JI4 F;  2IPO B;  5CXT A;  3QWP A;  5AXK A;  3DLE A;  3CJS A;  1RWP B;  3BS9 A;  1RAD B;  1UWA A;  4DCJ B;  5J1P A;  1U6B A;  3THV A;  3D7S B;  4NLV A;  4DXL A;  3EDR B;  3GIL A;  1UJ5 A;  2E5L J;  2KXN B;  3QIP B;  1AW0 A;  2P6T A;  3BPS P;  1XQI A;  1S0N A;  3FKB A;  2VU5 A;  1TL1 B;  2KN4 A;  3PCO B;  4K7Q A;  2ZEJ A;  3GPA A;  1N8R T;  4QCL A;  2OLW A;  5J1E A;  4AL7 A;  1SJF A;  5F8G A;  3MHY A;  2BAC A;  3FSI A;  2RKI B;  2E7X A;  2YH1 A;  2HVZ A;  1BUX A;  2DR9 A;  1S1T A;  2HVD A;  5I3P A;  2ZWP A;  5B0B A;  4EYI B;  5D78 A;  2ABY A;  3GR0 A;  4M5J A;  5KG1 A;  2DXF A;  3POT A;  5LOQ A;  1IBL F;  2HLU A;  3PRV A;  3BGU A;  4L3N A;  4F4K A;  4JI1 F;  2QIF A;  2UV8 A;  3LAL A;  3HHL B;  3TNV A;  2H4W B;  2Q79 A;  1IKY A;  2MLX A;  4M5H A;  4ALZ A;  2V8D A;  5DLG A;  5ETN A;  3KOA A;  4M5K A;  3M8Z A;  1FJG F;  1NZA A;  2F4V F;  2E66 A;  3SCK E;  2CPY A;  4IDK A;  4HDH A;  1ZYQ A;  2JX2 A;  4MIW A;  3M2R A;  4HTJ A;  1M5V C;  3HD1 A;  3NNH A;  1XNR J;  2WTF A;  3KJN B;  3DLK A;  4KTQ A;  2ZH5 A;  2B43 A;  3D5M A;  4F4X A;  2QLB B;  4TLQ A;  5DGA A;  2BM0 A;  3MMB A;  3NCP A;  3OL9 A;  2ERR A;  3PFO A;  2B4V A;  1FD2 A;  1CSJ A;  1X4D A;  1YBT A;  2XSF A;  2OD6 A;  3LP0 B;  4KH1 B;  4M1K A;  5IC6 B;  5A6W A;  3T5K A;  1PG5 B;  2NCK L;  4OHX A;  2G4B A;  4A8X A;  1HYS B;  4URG A;  4PEO A;  5KAK A;  1T05 A;  3HZG A;  3CCU S;  2PFF B;  4GKJ F;  4LBI A;  5FLX Y;  3KK1 B;  2B6A A;  1XBW A;  2RU3 A;  3ZZZ A;  1HHS A;  2XGP A;  4NA1 A;  1F2G A;  3ILI A;  1ICE B;  3MFI A;  4DR4 F;  2ZJP Q;  4ER8 A;  2W9C A;  1IJF B;  4F67 A;  2HQG A;  3U1N A;  5B09 A;  4EBD A;  5L1J A;  2AGQ A;  1T3N A;  1XN9 A;  1X7V A;  2VPZ B;  1XC9 A;  1HMV A;  2GAH C;  2ZUG A;  4UST A;  1FTC A;  1HBO B;  3ISN D;  3FZ2 A;  4ES1 A;  4EEY A;  4FF1 A;  1LFP A;  5IC4 B;  4P2M A;  5F0W A;  4CCH A;  2C3P A;  1VC5 A;  2OEM A;  3SV3 A;  4ED2 A;  2UVU A;  2VG7 A;  2K2P A;  4KQZ A;  4UUW A;  1NU4 A;  3M6X A;  3W60 A;  2NRE A;  1RT6 B;  4X62 F;  2QMW A;  1LW2 A;  4DR3 F;  4K0K J;  3I31 A;  5HAN A;  1HWK A;  2WOM B;  2WBR A;  1M0S A;  5KG7 A;  5K9F A;  3BZQ A;  2GIF A;  2ROP A;  3DMJ B;  3ETO A;  2QSF A;  3KHR A;  2R8I A;  1S72 S;  1UVI A;  4RW9 A;  3PKM A;  2CDR B;  3BQ0 A;  1U26 A;  1VQ7 S;  3AHP A;  2QC3 A;  3OJU A;  2OSQ A;  3EJM A;  3TR5 A;  4LF9 F;  1FDB A;  1S6O A;  3LO3 A;  4IUF A;  4O3Q A;  2VDI A;  5C7P A;  1UFK A;  5ETO A;  3NGD A;  5SUH A;  2UVV A;  1FX2 A;  3MM5 B;  3BGR A;  2LXI A;  2FD2 A;  2ZNY A;  3FVY A;  4HR2 A;  4ICL B;  4OYA A;  1HFE L;  4CM0 A;  2PSZ A;  3SZ2 A;  2XZW A;  2MJN A;  5G0R A;  3TQE A;  5DM6 Q;  4JI0 J;  2YX7 A;  4FDF A;  2JSX A;  1FXD A;  2CZ4 A;  4DFJ A;  1U0H A;  1DAR A;  2H9Z A;  2CNN B;  4ZN1 A;  3M9M B;  3KTQ A;  2M8H A;  3MAH A;  1RTD B;  3OW2 R;  1NEE A;  1GXL A;  4UOC A;  4HAC B;  5J1N A;  4AD6 A;  5J2M B;  4J9L A;  2DPI A;  1P27 B;  4CTA B;  3IN5 A;  1S9G B;  4A8W A;  4DR7 J;  4OI4 A;  1RAG B;  1UVK A;  2KYZ A;  3BBB A;  2DIT A;  4JI5 F;  2HAF A;  3NGU A;  2XYP B;  2HQD A;  1Z2Z A;  3I0R A;  4WE1 B;  4DMZ A;  5K20 B;  1Q8B A;  2DNK A;  1ZM4 A;  2XLI A;  3FQL A;  1RTH A;  1JLC A;  4IYQ A;  3TQ1 A;  2LKZ A;  4I2P A;  1DTQ A;  3THP A;  3NWR A;  1K73 T;  4AXI A;  1NK0 A;  3O1L A;  1XK8 A;  3CJ4 A;  4I2Q B;  4JBC A;  4WFN Q;  2M9K A;  2HNZ A;  5LJ3 Y;  3DHX A;  3H90 A;  3C15 B;  3M32 B;  1SC1 B;  3SFG A;  5BYQ A;  5KG4 A;  3UVJ B;  3MR6 A;  3DXB A;  1OYE A;  2P9G A;  4NEY A;  5E33 A;  1YSJ A;  4P2F A;  1FRI A;  1HKA A;  3DI6 A;  4ICL A;  4B02 A;  2JLG A;  3TEG A;  1KTV A;  3BKF A;  4RNM A;  4FVM A;  2MEW A;  4Y34 A;  3DLH A;  1WC0 A;  4NLD A;  4DL6 A;  2F65 A;  1HBN B;  2UUW A;  5C2G A;  4ELT A;  2RS2 A;  3RB0 A;  1OPI A;  3ISZ A;  3R27 A;  2A1B A;  4CTA A;  1M1H A;  2XSJ B;  4DCO B;  1IXK A;  2QMU B;  1RTZ A;  3I56 S;  3TVK A;  2QFJ A;  4O4G A;  1EB0 A;  2RJZ A;  3KKF A;  1NPP A;  4WCE Q;  1NAQ A;  4B9U A;  2CA9 A;  4V19 J;  4O3N A;  4P6Q A;  3EGN A;  5F3Z A;  4B17 A;  4OZ1 A;  4DEZ A;  3BJY A;  4DHV A;  2MLY A;  2ZH2 A;  4NLW A;  2BE2 B;  3BR9 A;  4TYA A;  2L9D A;  5THW A;  4JB8 B;  4NLU A;  2GVD B;  2W4C A;  3M9O B;  3UQS A;  2GAG C;  4ED4 A;  3HF5 A;  1TL5 A;  3TJA A;  1PSD A;  4KSE B;  4ZJO A;  2XI3 A;  4Q2M A;  4ZHR B;  1FDA A;  4J37 A;  4DV0 F;  3MDF A;  1WHX A;  2WVB A;  1EP4 A;  2IHR 1;  1FKO A;  3TJ9 A;  3NNC A;  4HEA 9;  2GX8 A;  5B0C A;  3QNW B;  5J2P B;  2BQ3 A;  1BLU A;  3LUY A;  1J5O B;  3TAR A;  3U7J A;  1T11 A;  2AF6 A;  3MXH P;  4RX6 A;  3HMJ G;  4C8Z A;  4OL8 A;  4RNF A;  1SC4 B;  1BHN A;  4DL3 A;  1VMB A;  3HLU A;  5HVF A;  4BBY A;  4W92 B;  3CD6 S;  2MTL A;  2HVH A;  1UEK A;  4K4V A;  5A8R A;  3VAL A;  2QLJ B;  1VGY A;  3UWT A;  2KI2 A;  1PYO B;  3MCM A;  1ZZF A;  5ETM A;  4LF9 J;  4I67 A;  5HL7 Q;  2AW0 A;  2MQL A;  1HHT P;  4CLW A;  1LV5 A;  3OBI A;  4LR9 A;  3WC0 A;  3UDC A;  5KT5 A;  1H2T Z;  4CLZ A;  1B0V A;  5J1E B;  2UUA F;  2X1B A;  1CLF A;  4FF2 A;  1YRX A;  3TX0 A;  1WUU A;  4XTT A;  1MML A;  2HFN A;  1G6B A;  4KKO B;  4O3S A;  4AL5 A;  3SFU A;  3WIV A;  5A8W A;  4N8N A;  3CE8 A;  1AYE A;  2RH3 A;  2AV5 A;  3UE2 A;  3RBD A;  3NCQ A;  5D0G A;  2R7R A;  3KLI A;  2QZ8 A;  3PJX A;  1YJ9 S;  3UVJ A;  5GAE U;  3QSI A;  3H5Y A;  1WDD A;  3A8E A;  3A4T A;  1NB7 A;  5HSP A;  2J9D E;  4WTO B;  2KRB A;  4X66 F;  4M95 A;  4X2B A;  3V4I A;  2SXL A;  1T9X A;  3KXD A;  3PJW A;  1CC8 A;  4Q2L A;  4JP8 A;  2Q66 A;  3BDE A;  2HBQ B;  4NCG B;  3FGV A;  5KG5 A;  1XR7 A;  5LJ5 Y;  4LFC F;  3Q8Y A;  3W65 A;  1VJQ A;  2LU1 A;  1RCO B;  1Q82 T;  1IBL J;  4DSI A;  4I7F A;  2HHT A;  1Y11 A;  2KL8 A;  1FJE B;  3EVM A;  2JRS A;  3HHK A;  2FGC A;  2RRN A;  2ADB A;  2GQQ A;  3FEZ A;  4C8O A;  3D0I E;  2CJK A;  2PMW A;  5A8W B;  3G9C A;  4MKA A;  3MOJ B;  2XCA A;  4IOB A;  1PIE A;  2DNO A;  2M4M A;  2MHE A;  2QLW A;  2HVI A;  1E6V B;  2E1P A;  2QA1 A;  4WK1 A;  2D3U A;  4RBV A;  4DBQ A;  3EX7 B;  1NH7 A;  3DOL A;  3ULH A;  3G6Y A;  3VAF A;  3CNQ P;  2K7J A;  3DXS X;  2BJD A;  3NMR A;  3G2X A;  3OSP A;  1X4B A;  2ZBQ A;  3FEY B;  3I9V 9;  4FYV B;  4M5L A;  4DU8 A;  3J7A N;  2IVF B;  1D0E A;  3DRY A;  3PV8 A;  2W25 A;  2R8J A;  1QTN B;  5HI7 A;  3CD5 A;  5A2Q Y;  1D3W A;  4WZQ A;  1SQG A;  1FD8 A;  4M5I A;  1VQS A;  3AOC A;  3D6T B;  3HUL A;  4ZK7 M;  2MZR A;  2N82 B;  2M88 A;  2B51 A;  5E2Q A;  4AT1 B;  4MAK A;  1U1N A;  1NJX A;  3VGV A;  2NZ4 A;  2W1B A;  3T5H A;  1YGY A;  3C6T B;  1XR5 A;  4YHH J;  3TZX A;  1WF0 A;  4DUT A;  3ZZY A;  3AB2 B;  5K8N A;  3MUT P;  2R8G A;  2W4P A;  2XMK A;  2RKI A;  1J27 A;  1M1K T;  3CJK A;  5E3A A;  3C14 A;  5MAO A;  1JIH A;  1VDH A;  1GXT A;  4JI0 F;  3UR0 A;  2J6T A;  5K14 B;  2HZV A;  3PNI A;  2OPR A;  4WFZ A;  4IRK A;  2CYY A;  4PAB A;  1CC7 A;  3VAH A;  5L46 A;  2FLP A;  3RRG A;  4ZLN A;  1Y0H A;  1RE1 B;  5BJR A;  3US5 A;  3HHL A;  1NDK A;  1QDU B;  2R8K A;  1KVI A;  1RWO B;  4L6V 3;  3GG0 A;  3TW0 A;  3K0J A;  3IBC B;  2DNY A;  4JV1 A;  1IVZ A;  4IG3 B;  4TXS A;  5F8H A;  4ECX A;  4LF2 A;  3PG9 A;  2AYE A;  2BBE A;  1JQG A;  5CYJ A;  2Y1I A;  3MUM P;  4BS2 A;  2E9T A;  4ZVP B;  2AJQ A;  2L41 A;  3A8K A;  4AFF A;  3RTV A;  2NLW A;  1OYD A;  1T94 A;  4F25 A;  1BC6 A;  2DGS A;  4LRA A;  4R0E A;  1KQK A;  4CI0 B;  5IT0 A;  3GJQ B;  5KFR A;  4M5N A;  1R0C B;  3DRP A;  2G2Y A;  4TYB A;  4WFX A;  4H4O A;  1SKW A;  2LQJ A;  3Q24 A;  2ZC3 A;  4I2Q A;  3MM8 A;  4MYT A;  2VHG A;  2AZ3 A;  2FY8 A;  1SUQ B;  2W4D A;  1WOS A;  3C15 A;  3CD0 A;  3D3B J;  3LAN A;  3MMC B;  4ZJL A;  3W62 A;  3GB0 A;  4XPE A;  5HMW A;  1NXI A;  1CQN A;  1UL3 A;  4HTI A;  2O5D A;  3I5B A;  4FYY B;  2VZ9 A;  5I3U B;  5D3G B;  2KG1 A;  1RB0 A;  2W7A A;  5HQM A;  2N7C A;  4LF1 A;  1N36 J;  2V6A A;  1C0T B;  3PX4 A;  3MPY A;  1C4A A;  3UNG C;  3SXL A;  2GZO A;  2NSC A;  1JLA B;  3BGO P;  2LQ5 A;  4DUY J;  4YHH F;  2ZUA A;  2V68 A;  5IZH A;  2HS4 A;  5F8J A;  1FKP A;  4WJB A;  2OH2 A;  5L1K A;  2ASL A;  2WRM A;  3AJD A;  3HFV A;  1F6T A;  3MM7 A;  3PW2 A;  4TNO A;  3CCM S;  3B6B A;  1KON A;  1S59 A;  2XS7 A;  2BE7 D;  2BJE A;  4DOZ A;  1Y3K A;  2CJQ A;  4RWW A;  4UT4 A;  3IR5 B;  2CQ2 A;  4OYM A;  2XLJ A;  3HFZ B;  3DRS A;  5C24 A;  2PMZ D;  2FYX A;  4TU8 A;  4DFM A;  1CJV B;  3M2U A;  2IAJ B;  3GJT B;  3QAT A;  2DH9 A;  2LCW A;  1AZS B;  3DDN A;  3JQK A;  4OZ3 A;  3CWJ A;  1S1W B;  4Y2I A;  5B0A A;  3DC2 A;  3PDN A;  3SMZ A;  2V94 A;  2GJI A;  2O01 C;  2QO3 A;  4UQT A;  3RUB L;  4B08 A;  3EPI A;  2ATL A;  1O8B A;  1JXL A;  1TL3 B;  3R7N B;  1LW0 B;  2B9Y A;  3DOL B;  2H5J B;  5D4P A;  1R8P A;  5E41 A;  4JI6 J;  4BC9 A;  2UXB J;  5FLX U;  1VQ4 S;  2ROG A;  1N5Y B;  2VFR A;  3GE9 A;  5FII A;  5B08 A;  3OJS A;  2WSF C;  4FZV A;  5H9E J;  1V3Z A;  1OIA A;  1YTY A;  1R0A A;  5BYR A;  2JJ4 D;  2HMI A;  2A10 A;  4KO0 A;  2NXJ A;  4NMX A;  3R5B A;  5CQG A;  1VQM S;  1IBC B;  4UOH A;  2MQO A;  1HIY A;  1OSC A;  3IBF B;  2UXB F;  1VQY A;  4WBF A;  3ENQ A;  1R6Y A;  2JLF A;  2KT3 A;  2XMA A;  1LFW A;  4IFY A;  3KLF A;  3NGS A;  1HBO A;  4ELV A;  4LFB F;  3H59 A;  4OHW A;  2AQ4 A;  3OSN A;  4HH1 A;  3CW2 C;  4Q0B A;  2AEJ A;  3W2W B;  1SI9 A;  2ZJQ Q;  3GIJ A;  2I5J B;  4RW6 A;  3ZZO A;  1U09 A;  2AJ2 A;  3ENW A;  3HK2 A;  4TQS A;  4RNO A;  1T05 B;  2XS2 A;  1HWU A;  2DT9 A;  3TAM B;  2IC3 A;  1A6L A;  2CPE A;  5IOL A;  1HQU A;  5LSO A;  5DJB A;  3NWG A;  1GMW D;  3CCQ S;  3BGF A;  4ED8 A;  1YG0 A;  2RD5 C;  3SDE A;  2ALY B;  2PN6 A;  2EXU A;  4KPY A;  1TL7 A;  2R7V A;  1H7X A;  2F63 A;  1ROF A;  3CGI A;  4GC6 A;  1Q53 A;  3SSS A;  4JV5 F;  1HMV B;  3G96 A;  1GAO A;  2DTJ A;  3LP2 B;  4OYP A;  4OI2 A;  2WHO A;  1PC4 A;  3KLF B;  2YKP A;  4B3S J;  2E29 A;  4L73 A;  3P49 B;  3DLG B;  1AUS L;  1JB0 C;  2MQM A;  1JK9 B;  3IG1 B;  4MH8 A;  2C2D A;  4UF4 A;  2GQ2 A;  1LW2 B;  2MY8 A;  2XEX A;  2ZOM A;  2HEK A;  1RT4 B;  4WXO A;  4ZVT B;  1RTD A;  4DX7 A;  4FYD A;  1RT7 B;  2H4Y B;  3VAJ A;  3P6Y C;  1HYS A;  2F9J A;  5DDR C;  2NXC A;  3DM2 A;  2AJ1 A;  3O3L A;  2GW8 A;  1SJ3 P;  2ZBR A;  1S1T B;  4RL1 A;  4LFA F;  2VPY B;  2ZZM A;  1MLA A;  3NS5 A;  3K5L A;  5EN1 A;  2HFZ A;  3LPY A;  2H48 B;  1HD0 A;  1YJ7 A;  3GMG A;  4QIG A;  1FHT A;  3AD7 C;  3NBP B;  1CJT A;  1H7W A;  1R31 A;  5EWF A;  2QJ3 A;  2B6A B;  2DJW A;  1PYT A;  1XMO J;  1RTJ B;  2VG5 B;  2HWH A;  3GV8 B;  2CQD A;  3MM6 B;  4X4P A;  3CUN A;  3EGV A;  4HYK A;  3IGV A;  4CO1 A;  2P9E A;  4K4W A;  4QYR A;  1JLB B;  4U95 A;  4KRW A;  4YR3 A;  3AOB A;  1W2I A;  2H5I B;  4F3Q A;  5AXN A;  3V81 B;  2BMB A;  1OPZ A;  3GYX B;  3MZI A;  4TLR A;  2VUG A;  3HM9 A;  1RCX B;  4M5G A;  1A9N B;  3HHL D;  2E1A A;  1IR0 A;  2VKR A;  3NGR A;  1SH0 A;  1O51 A;  1WF2 A;  2R42 A;  2Z4P A;  3DDK A;  9ATC B;  1NPR A;  2LQ8 A;  3JXO A;  4W90 B;  1TL3 A;  3WHI A;  2DIU A;  2B0G A;  4RU2 A;  3C2P A;  2HGM A;  2V67 A;  3NXZ A;  4WTY A;  2H51 B;  2CZ9 A;  2ZH1 A;  3ZTR A;  1JX4 A;  2MKY A;  1IBM J;  1KFS A;  3IWN C;  2M52 A;  4RR5 A;  4ILM A;  3KLI B;  4GMK A;  2BW2 A;  2BV3 A;  1DFD A;  4ZPW R;  3D1Q A;  1M5O C;  1UFL A;  3Q2T C;  3B4M A;  2KHD A;  3CJT A;  2HBZ B;  1RLC L;  1UW4 A;  2R7Q A;  2XMJ A;  3KFW X;  1REG X;  5KFV A;  4PWW A;  6FDR A;  1GXU A;  5HQL A;  5L38 A;  5B0D A;  1Q5V A;  5I42 A;  1QVG R;  1HWI A;  1D9F A;  3BO4 A;  1NDL A;  1NRK A;  1EIY B;  1JLA A;  3AY0 A;  1WJ9 A;  3EUN A;  4DX5 A;  1F3F A;  2P2C B;  4ZPA A;  5HRO B;  2C2K B;  1OQ3 A;  2VBX A;  3I6P A;  1MWZ A;  5GME A;  4XDD A;  3M2R B;  4ZPT R;  4JI8 F;  3OLA A;  3OHA A;  3K58 A;  2UU9 J;  4R5P B;  3CSK A;  4OYX A;  2BKN A;  3LW5 C;  1MWY A;  3I5A A;  3T19 A;  2MXY A;  1RT4 A;  3TA0 A;  2PI5 A;  2V50 A;  5KT2 A;  1VK8 A;  3W2V B;  3TA2 A;  1L3V A;  4DWI A;  3QJJ A;  4JI2 F;  3CT9 A;  4O3R A;  1CEZ A;  2GVZ B;  3NS6 A;  3Q8S B;  1S99 A;  3BQ2 A;  2YVS A;  2AEF A;  2YPY A;  2CG8 A;  2D69 A;  2FPH X;  3GFH A;  3FZB A;  3HSG A;  3R5A A;  3OT9 A;  3K8V A;  4LRE A;  4ZA1 A;  2J9D A;  2J7W A;  1RDR A;  2QL9 B;  1RT1 B;  4JI7 F;  3M8S A;  4ZCM A;  4RUH A;  5IM0 B;  1VBK A;  2CRL A;  3F41 A;  4KBI A;  3RW6 A;  2CQB A;  1JJH A;  2YBV A;  2RF2 A;  2JC1 A;  1T95 A;  2FHJ A;  4NPO A;  1B70 B;  4A8M P;  1RQ0 A;  3FBF A;  4RPF A;  1FJ7 A;  4ANC A;  2RUG A;  1FDD A;  4D3G A;  5I42 B;  1SL2 A;  4EZ9 A;  1GMV A;  1RWX B;  5E7O B;  3N01 A;  2ZM6 J;  2V4Q A;  2EVZ A;  4C48 A;  3IM9 A;  3H8Y A;  3OTD A;  2VJU A;  1FRX A;  3QSY B;  3UCZ P;  2K1R B;  2IJF A;  5L39 A;  1FO1 A;  4O3O A;  5KG3 A;  1HW9 A;  2I1R A;  1RA6 A;  1JLQ B;  4FNH A;  1KP6 A;  4CP5 A;  3W8P A;  3V6H A;  2QV6 A;  1JLC B;  4OI6 A;  4EMD A;  2I38 A;  3N6N A;  1F5C A;  3IC1 A;  1WEX A;  1F2H A;  5JMN A;  2ZM6 F;  2KKH A;  2ZKT A;  3QBC A;  1UPP A;  3T9Z A;  5HAT A;  1URN A;  3E01 A;  2UVW A;  3AXM A;  3FCH A;  3LH2 S;  3W1Y C;  2K3I A;  1HPZ A;  3P45 B;  4PCQ A;  5HBM A;  1RTI A;  2WVE A;  1DY3 A;  1T3O A;  1RHJ B;  2B56 A;  1N0U A;  2WK4 A;  4LBP A;  1DJ0 A;  2LP4 A;  2BJ9 A;  4C0O C;  1FF2 A;  1RTI B;  3A3O B;  3DGV A;  3M8Q B;  3W66 A;  3UCU P;  4LQ3 A;  1IKW B;  1TKX A;  2JVO A;  4KFB B;  2YX1 A;  2DH7 A;  1TV6 B;  4PXC A;  1Y00 A;  2CNO B;  1B3T A;  2ASY A;  5RUB A;  1FCA A;  1DAX A;  1HBM A;  1WC6 A;  1IKX B;  1JLF A;  4WZM A;  3AFG A;  3H4D A;  2IBO A;  4BCA A;  1JLQ A;  4FXW A;  4WK3 A;  4CO4 A;  1RK8 A;  4UZB A;  3RB4 A;  1VLO A;  4WYL A;  3R2C J;  2BA9 A;  2GIQ A;  2ILZ A;  1RJJ A;  2CJY B;  1VQ5 S;  1ZPW X;  4J7C A;  4JI7 J;  3TVZ A;  2F1F A;  3ZNJ 1;  5DDQ C;  3GIM A;  1MRO B;  1TZ0 A;  4B3O B;  4B9T A;  1C2P A;  1HQU B;  4Z7Y A;  2M70 A;  2EKN A;  1Q7Y T;  4B3O A;  2GV1 A;  3LP0 A;  5F8N A;  1SBR A;  3ZZU A;  3LQV A;  4ANE A;  3CME S;  1CS4 B;  4OZL A;  4TN2 A;  1X4G A;  2J8A A;  4QQB A;  2R3V A;  4ZVR B;  4ECT A;  2Y1J A;  4IR9 A;  3SV4 A;  1FI4 A;  1V9O A;  2W2M P;  2J0X A;  3J80 U;  4OX9 J;  4WWS A;  4DV7 F;  3KJQ B;  1RT1 A;  4QYZ J;  1CG2 A;  2AP6 A;  2E5J A;  4OZJ A;  4USJ C;  3ZZP A;  4F50 A;  2YWF A;  1TMM A;  2I8E A;  2AIR B;  2ROE A;  3MOZ A;  4URQ U;  3UD4 P;  4QWA A;  4Y0F A;  2VG6 B;  3WZ0 A;  2FLO A;  1RWV B;  3TOQ A;  1S6U A;  1GMW A;  2JL9 A;  2BX6 A;  2NYH A;  4K8R A;  1G2E A;  2NQP A;  3UDL A;  1RAB B;  1T9Y A;  2VB6 A;  5HMX A;  2GML A;  1RGV A;  2J76 E;  3CXC R;  3Q23 A;  4RUC A;  2OFG X;  4I64 A;  4P2X A;  3WX8 A;  1U2C A;  2E9R X;  3QYY A;  5CD4 H;  1JLE B;  3CMQ A;  3AQO A;  4CLP A;  1LW0 A;  2C2N A;  3KNG A;  3CIM A;  1RYS A;  3P3D A;  2MST A;  3RBX A;  3IR7 B;  5C25 B;  1SPB P;  1J2V A;  4EU0 A;  1DBD A;  1KEK A;  1KD1 T;  4HKQ A;  1YZ7 A;  2OHD A;  5GMK a;  2C22 A;  4G3I A;  1VQN S;  2VJV A;  1FXR A;  2R2R A;  1LWC B;  2RT3 A;  4OLP A;  3TI0 A;  3RB3 A;  4ES2 A;  3BV8 A;  1O5J A;  2L48 A;  4J9R A;  1RZM A;  2MZT A;  2HLT A;  3J81 Y;  1VQ6 S;  2XM3 A;  1H2U X;  3NAI A;  3LAM A;  3M30 B;  5JXS A;  4Y2M A;  2DNQ A;  2ZKU A;  3TJ8 A;  2FVS A;  1CJK B;  5F9N A;  2XSJ A;  3K57 A;  1OJ4 A;  1QUV A;  2DCL A;  2YNF B;  4PYD A;  1WSV A;  3LF0 A;  4DQP A;  1FJG J;  5DDP C;  2BRL A;  2HPU A;  3PYF A;  5HP1 A;  3BB5 A;  3DLK B;  1TQL A;  5FDL B;  2HQ3 A;  2WBM A;  1QSS A;  1RT5 B;  2QGF B;  1F3V A;  3VV2 B;  4QR2 A;  1T03 A;  4ZOS A;  2CFX A;  1IWG A;  2O1P A;  2IVY A;  2MKJ A;  4RBU A;  2MSS A;  3K2Y A;  2LLZ A;  3QGH A;  1VFJ A;  1U1M A;  3A3N B;  1OY6 A;  1YX2 A;  3MCO A;  3NRB A;  1N33 J;  2M5Y A;  5KFO A;  2RU9 A;  2MKK A;  2YKO A;  5BYS A;  4B3S F;  4NCB A;  1F1B B;  3PR4 A;  4QIF A;  3KJV A;  1R3N A;  2OEJ A;  4HHU A;  4DQQ A;  4EWT A;  2XYH B;  2FJB B;  4PZV A;  3R2D J;  4DV3 F;  1Q4R A;  2CIM A;  3DRR A;  3AH6 A;  1H98 A;  2YPZ A;  3OFG A;  4DFK A;  1X0P A;  1HBN A;  1HI1 A;  1VCT A;  3SQO P;  3M8W A;  4LRB A;  3DNC A;  3KNA A;  3B4D A;  2YWE A;  4K0K F;  4TY9 A;  4YN3 B;  4GO5 X;  3VGU A;  2IYI A;  5H9F J;  2NSB A;  2KM8 B;  4J9N A;  3RJM B;  2C3O A;  3DN9 A;  1BMQ B;  1YRU A;  2YH0 A;  3IO1 A;  3MM9 A;  3TAN A;  5ETR A;  4TVA B;  1YZ6 A;  1U25 A;  2BM1 A;  1U47 A;  1PCA A;  2RE1 A;  1KN6 A;  2CQ1 A;  3RAQ A;  2FJW A;  4NX9 A;  4PG7 A;  5A2Q U;  3C16 A;  1PC5 A;  2Z2Y B;  4NCA A;  3T1Y J;  2EC0 A;  3HVT A;  2EFV A;  2VFS A;  2B8Q A;  3HT0 A;  4X64 J;  1FK9 A;  2XI2 A; 
#chains in the Genus database with same CATH homology
 2C2O B;  1NME B;  1RWN B;  1RHM B;  3P4U B;  2CJY B;  1RHQ B;  1GFW B;  2H5I B;  2FQQ B;  4ZVQ B;  2CDR B;  2H65 B;  4ZVR B;  3KJF B;  2H51 B;  3KJQ B;  1RWW B;  3D6M B;  2HBQ B;  3GJR B;  3GJT B;  2Y1L B;  2CNL B;  3D6F B;  3R6L B;  3R7N B;  1RWV B;  2HBZ B;  2CNN B;  2H5J B;  2CJX B;  2QL7 B;  4LSZ B;  1RHR B;  5IC4 B;  2XYP B;  2P2C B;  4DCP B;  3EDQ B;  5K20 B;  1RWP B;  2C2K B;  4DCJ B;  1IBC B;  3EDR B;  2H54 B;  3IBF B;  1SC1 B;  2C2Z B;  1QTN B;  2QL9 B;  2QLF B;  1I51 B;  4ZVU B;  1RWK B;  4ZVS B;  2HBY B;  3SIP B;  4DCO B;  2H4W B;  3R5J B;  1RWX B;  1F9E B;  3R6G B;  1SC3 B;  2XZD B;  3KJN B;  3GJS B;  1RE1 B;  3R7S B;  2CNK B;  1QDU B;  4JB8 B;  1RWO B;  1I3O B;  2QLB B;  3IBC B;  1RWM B;  5IC6 B;  2Y0B B;  2C1E B;  3R7B B;  1RHK B;  2C2M B;  4ZVT B;  2XYH B;  2H4Y B;  3QNW B;  2DKO B;  4ZVP B;  3P45 B;  2QL5 B;  2HBR B;  2XYG B;  3D6H B;  1PAU B;  1RHJ B;  4ZVO B;  1SC4 B;  3RJM B;  3GJQ B;  1ICE B;  1BMQ B;  1RHU B;  2H48 B;  3NS7 B;  2CNO B;  2QLJ B;  1PYO B;  2XZT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...