3P4WA

Structure of desflurane bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p4wA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p4wA01
3P50A 4NZBA 4PIRA 5HEUA 2BYRA 4FRRA 2VL0A 2X00D 5J5GA 3SIOA 2BR7A 2BYNA 5J5FA 2WNJA 3SH1A 3ZKRA 5HCJA 2ZJVA 2YOEA 2XYTA 2PH9A 2BG9B 5BRXA 2YMEA 3JAFA 3PEOA 5HEOA 5L4EA 3P4WA 3IGQA 3RQWA 3TLSA 3WIPA 2M6BA 4UM3A 5HEGA 2Y58A 2W8FA 4BQTA 4QABA 4HFEA 4WV9A 4IREA 2XQ7A 1UW6A 3WTOA 4HQPA 5KE4A 4X5TA 4QH4A 2LM2A 4ILAA 4LMKA 5IUXA 3U8KA 2Y54A 3UU3A 3LSVA 3RQUA 5LG3A 4IL9A 3JAEA 3JADA 4HFIA 3WTLA 3UU5A 4QH1A 4UM3P 2PGZA 2XNTA 5J5IA 4TWFA 2Y56A 3WTHA 4EZ1A 2W8GA 3EI0A 5CO5A 3UQ4A 4HFBA 2XQ4A 3UUBA 4QAAA 4D01A 4ZK1A 2YN6A 5L4HA 5L47A 2Y57A 3U8MA 3UU4A 4ZRUA 4ALXA 4HFDA 2WZYA 2XNVA 4LMLA 4HFCA 2XQ8A 4ILBA 3TLTA 4TNWA 2MAWA 2WNCA 3RIAA 2XZ6A 5HCMA 3WTIA 1UV6A 4QACA 3U8LA 3ZDHA 2XNUA 4DBMA 5AFNA 5BW2A 4XHEA 5AFMB 4Z90A 2LKGA 2X00A 5JMEA 4ILCA 2ZJUA 2BJ0A 2BYSA 2WNLA 4BFQA 5LXBA 3WTKA 2LLYA 4COFA 4IL4A 2XQ5A 4TWDA 5HEJA 3U8NA 3WTMA 3TLUA 3PMZA 5AFMA 1OEDB 5FJVA 5TVCA 3SQ6A 3RI5A 4UM3S 5AFLA 4AFHA 3UQ7A 2BR8A 4XK9A 4AFTA 1OEDE 4ZK4A 1OEDA 4LMJA 5J0ZA 4UXUA 4ZR6A 4B5DA 2YMDA 1UX2A 3TLVA 3T4MA 2BG9C 4TNVA 1OEDC 3WTJA 5HEHA 3U8JA 3ZDGA 2M6IA 3RIFA 4ZZCA 3UU6A 3GUAA 2C9TA 2XZ5A 2KSRA 2BYQA 2XQAA 3EAMA 2WN9A 4QH5A 4AFGA 5BP0A 4UM1A 2QC1B 2BG9A 4A98A 5SYOA 5CFBA 2UZ6A 3C79A 5AFKA 4ZZBA 4HFHA 4A97A 2Y7YA 2BYPA 2YKSA 4TWHA 2XQ6A 5J5HA 3EHZA 5AFHA 5AINA 2LKHA 2BG9E 1I9BA 4NPPA 4UY2A 2XQ3A 4ZJSA 5KZUA 4Z91A 3WTNA 2XYSA 5AFJA 3SQ9A 4F8HA 2XQ9A 4ZJTA 3RHWA 3C84A 3UU8A 3TLWA
chains in the Genus database with same CATH superfamily
3P50A 2XZEA 3ZYKA 5ABHA 4JI2T 4G63A 1Z8UA 2BYNA 4X1YE 3NZPA 1UK5A 2ZM2A 3EABA 4DV4T 3IGQA 3GN5A 4FI5A 3H37A 2ZLYA 2UXXB 5ABFA 4NXNT 5AQUB 4HFEA 4UV8B 3ZMZB 2ACZA 5FVKA 2CLYC 4LF8T 3NVOA 3N9LA 3VHLA 2Y8DA 3MA9A 2Q9QA 3O1IA 3KVAA 5FMNA 3LK42 3RQUA 3UU5A 1JNRA 2XNTA 4IT4A 4CQIA 4EZ1A 2QA7A 3UUBA 2YDSA 4QWNB 2V7KA 2JPFA 2X66A 4PK5A 5HXEA 2Y57A 4P09A 4HWHA 5HWXA 4JYAT 2V26A 2H7VC 3O1JA 4X1IE 2BBHA 3N9QA 4I4TE 4Z8XA 2BJ0A 4A56A 1VOMA 3AB3B 5FL1A 4KUMB 2E5VA 5CGMA 4DNDA 2HH7A 3PUSA 2XM1A 1IBKT 4CN1A 2RA1A 3JC6D 4B5DA 2W66A 2X0LB 1B7TA 3OJAA 4XZCA 4X20E 3GUAA 3NKZA 4ZI3D 5DQWA 2H3RA 3LK3B 4IDOA 4A98A 1BR4A 2E8IA 4EV6A 4DR3T 3B13A 3WI3A 1AJ3A 3PUZF 1EZ3A 1JNZA 2OV9A 2WDQA 1WFDA 1E7PA 3LDQB 4PK6A 2CEAA 2NOXA 4QXCB 2M6BA 5JDMA 4H9RC 3ZJ1A 4OX9T 3G06A 4OYJA 3I0QA 3K3OA 2CM0A 1QUUA 4HFIA 5JDFA 2V7LA 5L3EB 5CO5A 5LGTB 3DJBA 4UR9A 2NW9A 2F4VT 3U8MA 4ZHQE 4LMLA 3QC9A 2MAWA 2ODVA 5LHGB 1WYBA 4XHEA 4DR5T 4ILCA 2BKPA 3ZSSA 4KMCA 2YDRA 2JMKA 3ZC1A 1H7CA 4GK0E 2EHOD 3SQ6A 2XAJB 4CI3B 4IE0A 2NWBA 2YMDA 4IE6A 5AQJB 5HEHA 3PUAA 5HXRA 4YLHA 3WAKA 4PNIA 3LBXA 2WP9A 3ONLC 3OTOT 3QK6A 2WAUA 4EGWA 3EHZA 4PJLA 3ETUA 1I9BA 4QX8B 2XQ3A 3AEGA 4O4IE 4ZI3C 3NBXX 4YHJA 2XQ9A 4ZJTA 3C4WA 5BR8T 4NZBA 4PIRA 4I43B 5ADXL 5AQNB 2YOEA 2WZHA 4U2YA 3FBZA 3RQWA 4PJJA 3WIPA 4QXHB 2Q9QB 4BQTA 2L9QA 3TKLB 1NWMX 2E9XD 4MALA 2LM2A 2BVMA 2LSJA 4QKNA 2Y54A 1XWMA 4CI2B 4UM3P 5LGUB 2YU2A 1NAFA 5LXTE 5JH7E 2YEVC 5FY0A 5L47A 4K0KT 5JTGA 3C4XA 3TLTA 2DHRA 5AFMB 2UUCT 4I0UA 3JC6C 2UXCT 5FKYA 5HEJA 1X9BA 5ABFB 3P8CD 2X9HA 2W4XA 4JEUB 3FHNA 4UXUA 1MIWA 2LHRA 5KDMC 2UXDT 4B3MT 4PK4A 3ZDGA 2JRKA 3P4SA 4UVAB 3CPZA 5HXSA 2BVLA 4UF0B 3AEEA 1YW0A 2LKHA 1HFAA 2XYSA 4YT0A 2BS2A 1G8XA 1KEYA 3SIOA 4EZHA 1D1CA 1OWAA 2BS4A 2XHEB 3LJCA 4DUYT 2WNJA 2VKHA 1KNRA 2N2NA 2PH9A 4LFCT 2J1DG 1VCSA 1MIYA 1WR6A 3RRWA 1UW6A 2OA5A 3L3PA 2NTXA 3QUJA 2UU9T 4MFRA 5EK2A 3V5SA 2RPAA 3WTLA 3NWIA 5J5IA 2Y56A 2CPTA 4GYRA 4DMWA 2YN6A 2MPKA 2X0YA 2XNVA 3AA0B 4JLEA 1ZHCA 2XQ8A 4HFCA 4ILBA 2X9XA 4EAHA 3IHRA 4P0AA 2VKOA 1T98A 2QVAA 2BYSA 3P4RA 3WTKA 4DR1T 5FJVA 4AKHA 1WR0A 4PAGA 2IC6A 3R84B 4A5XA 4CZZB 2K48A 2WMNA 5J0ZA 4BA9A 2ZM8A 2D9DA 3FB2A 4AKIA 1XZYA 3CVRA 3RIFA 1HR0T 3KBTA 1YKEB 4UEMA 2XQAA 5L3DB 5FY7A 4AFGA 2D0TA 5EZYE 5FNVE 2QC1B 1LVKA 1KNZA 5SYOA 3N9OA 2XAQB 2WB5A 2MOZA 5AFHA 5C3JA 4GIWA 4O4LE 5F5WA 2R6GF 2SPCA 4HN9A 4FRRA 2V5DA 2X00D 2VVSA 2JJ9A 4IIJE 2H89A 4XBFB 2ZJVA 3I1AA 2WZIA 3AEDA 1SUMB 3QB5K 2HPJA 4H9SE 4WV9A 2JQQA 3ZT6A 5LHHB 2V6YA 4QHOA 2XM2A 3RGLA 3I9YA 3MJXA 5JQGE 2X0HA 3JAEA 2K9AA 3CQGB 4IE7A 4TWFA 3ZEFB 4IE4A 2RP4A 3VRBA 4ZK1A 1T72A 4Q25A 2X68A 4V1Av 4YTNA 4WBNE 3ZDHA 2XAFB 4O4HE 2HN2A 3CX7B 3K3NA 4U74A 3F57A 5JDLA 2QGSA 5DQVA 4YXDA 4B3ST 4HEAA 2BR8A 1YXRA 3W15B 2DI4A 4ZEYA 5ABEA 4E7SA 1KK7A 4DR2T 4EEBA 3LK2B 4H9PC 3RH3A 4HFHA 2WWUA 1M62A 4UY2A 3L09A 2LSYA 4HTEA 3FZLB 2EHOB 4HKAA 3RHWA 3AE2A 4JI7T 3QOFA 4BJNA 2IIUA 2XUEA 3AEBA 1MNDA 2Z6EA 3SH1A 4KHPT 3AE6A 3UULA 4G2AA 3JAFA 4YSZA 1J5WA 3VKHA 3ZMSB 2XQ7A 4HQPA 2G0UA 2CWYA 2A9UA 3PUVF 1T8BA 4YSXA 4U31A 1IJ6A 3RX6A 1KF6A 4H63V 5LB7B 1YQ4A 2IC9A 3NRYA 4LF7T 4LFBT 3PE0A 2NW8A 2HHHT 4DV6T 2HN1A 2FJEA 2PFVA 1D1BA 4H9QC 4HFDA 1BR0A 1U5PA 5LA6E 3VRAA 4Z90A 4CXYA 4LF5T 2D0UA 1ZOYA 4X65T 3PMZA 3ANWB 3FXDB 5AFLA 2LEHA 4FJOA 2BG9C 2CBIA 3K3QC 3RPUA 5ETWA 3U8JA 4O8SA 3Q2MA 2A72A 5CB4E 3UU6A 3OYZA 3C98B 3KV4A 3EAMA 5TAOA 2WN9A 5LJNA 5CFBA 1HS7A 2E9XB 5AQPB 3N2GE 2XQ6A 2WDRA 5KXJA 3UFEA 2KZ7B 3I9WA 2W61A 2Q9QD 3QNUA 5LHIB 1CHUA 2KT9A 4UXNB 2M67A 1W0BA 4JUYA 2EHOA 5AQLB 3FZKB 2DLRA 5L3GB 3DP7A 2W8FA 4K0UA 2E9XA 2V5CA 2MBGA 3SWHA 4ILAA 5IUXA 5AQOB 4J2CA 2LRKA 3LSVA 1QLBA 3ZMTB 1FMVA 4NUUA 3Q5WA 4OFZA 5AQFB 3QB5A 2A2FX 2CE7A 5CA1E 3CKDA 2NR4A 1S94A 3CX8B 3ABVA 1KNPA 2WZYA 4KP3C 2WU5A 2VKDA 5HXHA 1E1HB 1W9RA 4M1PA 2WNLA 3KVBA 3Q5EA 5DJQC 4TWDA 3TLUA 1VRBA 4KX6A 3HKEE 4B6XA 4YY3T 5TVCA 4AFHA 4YJ3E 2YU1A 4EB6E 5FXXA 2MTQA 3AA1B 1XMOT 4UVBB 5A1LA 5FXZA 2X9YA 1XNRT 2LRLA 2X51A 2C9TA 2BYQA 2VVNA 2W00A 2VL8A 4U72A 2ZM6T 4HE8A 3KBUA 5AFKA 2BYPA 3ZC0A 3SQ9A 4WYVA 4GOUA 3K8PC 1WLXA 3RF1A 3ZCIA 4GK5E 3KDSE 2BR7A 2IDOB 1UX4A 4AI6A 1HX8A 3PDYA 3VU7H 3T1HT 2BG9B 5HEOA 4OYKA 4PJMA 3MACA 5ABGA 4HWDA 3NRXA 2Y58A 3F2EA 2V1DB 2WU2A 3Q9DA 4UVCB 4DBRA 3AECA 3E08A 1O3XA 3DTOA 5EK4A 4IDNA 4D01A 2QYWA 4TNWA 4UV9B 3PU3A 5HCMA 2DWGA 4AQYT 2IUBA 2JQ9A 3U3IA 3U8NA 4ANJA 2LJLA 4C90A 3KV5A 3BQLA 2XTLA 2LOPA 3RKGA 1MMNA 3M3ZB 4NIQA 3ZN0B 3VKGA 3WTJA 1OEDC 4ZI2D 1Y01A 2VK9A 4AKRB 3IBPA 2XZ5A 3A8YC 3ZT5A 3KINB 2VASA 1FJGT 4ISSA 2IW5B 2HPLA 4ZZBA 2Y7YA 2L3LA 4TWHA 1R8IA 5AQHB 3M65A 3ZT7A 1YD8G 2CXLA 3RYCE 3HKDE 4EZ4A 1LKXA 3HR0A 3K1SA 3OYXA 4KBMB 5AQGB 1GQEA 2B76A 3NZQA 4I55E 3PEOA 4MLKA 3Q5XA 3UFGA 4ILUA 2VB6A 3GWHA 2KNDA 3WAJA 2X67A 4X5TA 2J4GA 4AQFA 1NEKA 2WMOA 3JADA 3VR8A 5LJMA 2W8GA 4PW8A 5L3BB 1SE7A 5AQIB 2WSSV 4EXTA 4ZRUA 2VURA 3WTIA 3U8LA 2XNUA 3AE4A 5LXBA 3AAEB 3CQXC 4N78D 4IL4A 5FXWA 3ZSTA 5AFMA 1UUSA 3UQ7A 5GONE 3AA7B 1FIOA 4LMJA 1IBLT 3AVSA 4KHZF 1DU2A 1I6ZA 3FZHB 1LVFA 1FMWA 5BP0A 4XAXB 2V8SV 3FXEB 3UT5E 3ANWA 2E2AA 4ERRA 3N9MA 4JI5T 5J5GA 2XASB 5JDNA 4BAYB 5J2TE 3RYIE 5IHYA 3EUHA 2WCAA 3TLSA 3UUMA 1SA0E 1W09A 3AE3A 2ES0A 3FZMB 1I94T 2JMHA 1HF8A 4TX5A 2N1GA 3LBXB 2PBIA 5C2TA 5AQRB 2KLQA 3L8RA 2W62A 5JVDE 4IDPA 1G73A 2DWKA 4WZXA 2WNCA 4DIDB 4DBMA 4I50E 3LG7A 3ETVA 4DV7T 5LCYA 3N9NA 3RYHE 4YTPA 3FBLA 4U3CA 3RI5A 2VQET 2CBJA 5JRCB 1HNWT 2VQFT 3AVRA 2WQYA 1OEDA 1U4QA 3BQIA 4ZR6A 5HYAA 5F8PA 5LMUT 2WY2A 1XDOA 5EK3A 4HWFA 3EVYA 4GKKT 4P1NA 4C91A 3ZYLA 2WS3A 4QH5A 4UM1A 4JI1T 2BG9A 4DUZT 3HI2A 1MIVA 3C79A 1HG5A 1HTJF 2J62A 3EDUA 4F8HA 2CXFA 4DR4T 4U2ZA 2XSAA 5AQSB 1OXZA 1WCRA 2WM9A 5H6RB 4H63H 5AQKB 1VCTA 1MMGA 4U7IA 2I59A 5L4EA 4IHJE 5LBQB 2BS3A 5HEGA 2UXNB 3FZFB 3UTKA 1WYCA 1HX1B 1ZV4X 5JR9A 5LGNB 4NUVA 2NP9A 3KV6A 1BR2A 1HNXT 2IMLA 4JI6T 2IHR1 3AAIA 4OHFA 2PGZA 3WTHA 3CIRA 2XJ7A 2JQKA 3AXJA 3B57A 2UXBT 3MK7C 2JQHA 3VR9A 2XZ6A 3MXZA 3AE7A 2H7OA 2LM9A 4DVDA 5LG4A 4ZS2A 4BFQA 4DBQA 3EDVA 3WTMA 2KMFA 3UUNA 5AQVB 2K5BB 3ZMUB 3PUGA 2YK0A 5LYJE 3ZMVB 3SFDA 2V6XA 1XMQT 3IEEA 2N9DA 5BMVE 4PFPA 1UURA 3C64A 5L2LA 3MZKB 5FVLA 1WRDA 2V7IA 3ZJ2A 5FL0A 2K3WA 4X66T 4ZZCA 1J5ET 5LG3A 3E0ZA 1HNZT 4U7YA 5FP3A 3L39A 2YINA 2XAHB 2P9BA 2X9WA 3AAAB 5AQTB 5HCJA 5J2UE 4JI0T 3U78A 4DV1T 2LHNA 5CJ5A 3CK6A 2NTYA 3PJAJ 3SFEA 5LNKA 4ASKA 3A5XA 3PUQA 3PJAA 1MMDA 2BBJA 4TV8E 4TZ4C 3Q5DA 2CRBA 1ZEEA 2KWIB 3UU3A 4IL9A 4EYYR 4AXPA 4UIGA 4EIWA 4QH1A 5FY1A 2LE8A 3SRZA 3EI0A 5DABA 5FXVA 5L3CB 3IA3A 4DV2T 4L0RA 4TN7B 4QACA 2C0SA 3MKDA 3OVUA 4JBWF 4COFA 4AIUA 2XQ5A 1OEDB 2CHOA 5F3JA 4AFTA 3PURA 3OPCA 2CHNA 2J47A 1IJ5A 1ZP0A 1BR1A 2JIWA 1UX2A 3N2OA 4DV5T 4YSYA 4DO0A 4CN4A 2W67A 4B3TT 3BQKA 2PTFA 2YKSA 1YQ3A 1L0VA 5JR9C 4Z91A 4DV3T 5AFJA 3RIUC 4AKGA 3UU8A 3TLWA 2CXDA 4PFOA 3HA4A 4X62T 2PG8A 2AE9A 2WDVA 3CWZB 1N36T 2C5IT 4LF6T 2VKJA 3C4ZA 3J7Yq 4WNKA 3P4WA 3D0TA 2A3DA 2C5JA 3WTOA 3CQCB 4DMVA 5AFUL 2QRXA 4LMKA 3I0OA 5JDHA 3SOLA 3P7IA 1Z0PA 2V7JA 2WBLA 1E2AA 3GA8A 2FJDA 4ZXLA 4ALXA 4MBQA 3AEFA 4AISA 4U33A 2LKGA 4ZI2C 2ZJUA 1XNQT 2LSKA 2LT3A 2GK9A 3AE8A 4UM3S 3PUWF 2FBWA 4AQGA 1N34T 2V6YB 3T4MA 4TNVA 3CMLA 4PJNA 1LRZA 2ZMAA 2XY8B 3PV0F 4JI4T 4IE5A 4YJ2E 2UUBT 2KINB 2XSBA 4WW0A 3V5UA 3O4XE 1N32T 3C84A 4QX7B 1IZNB 3H3AA 2BYRA 1D0XA 2VL0A 4CXXA 1N33T 3ZKRA 4CI1B 3T8OA 5BRXA 2FJBA 3HL6A 3ZN1B 5HAXA 4ZI7E 3PUYF 5LOVE 3H3MA 4UF0A 3E22E 4IREA 1S35A 2H88A 5AQQB 5KE4A 4O2BE 4UELA 3ESLA 3U8KA 3ONXA 2MYSA 4JV5T 5FYMA 4E7ZA 1UGOA 2LSGA 2W63A 3J9X1 5LBMA 3GN5B 3O9XA 2V7MA 2KXPB 4O4JE 3AE5A 2E9XC 5LP6E 1UV6A 5BW2A 4YHHT 3RKOA 2X00A 2LSIA 3F31A 2BKOA 4IDQA 2LLYA 4TUYE 2C5KT 1KFYA 4CN6A 3RC3A 2FUPA 4MHCA 3CX6B 4HFVA 4DR6T 4ZK4A 2I6HA 4QXBB 1YKHB 3N9PA 1XDPA 3OBVE 5JREA 3RYFE 1D1AA 2WWVA 3PU8A 5IWAT 3PTRB 3JCFA 5J5HA 1ZKEA 3RIUA 3WTNA 5AQMB 5E0OA 5L3FB 4LF4T 4KI0F 2BDEA 3ZYMA 3C50A 2KWHA 2BZBA 4HWIB 1HCIA 3RLFF 3HKCE 3KFWX 2CLYB 5IYZE 4ZS3A 2XAGB 3LFMA 3AA6B 4H9NC 1T7SA 4P0BA 5H6QB 2NW7A 5J1GA 3R6NA 4BJMA 3S4UA 4EOZB 1QSDA 4IGUA 4YFSA 4LFAT 1X79A 2XQ4A 2E5LT 2VWAA 4QAAA 4DV0T 5L4HA 4JI8T 3UU4A 2Y6XA 5HXCA 5AFNA 4L9IA 4LF9T 5KX5E 4H9OC 4JEHB 5JMEA 3RC8A 4GYSA 4WBOA 1CUNA 2D2SA 1OEDE 3AE1A 4HGAA 3N5LA 4AKLA 1UCUA 2UUAT 2FJAA 4YTMA 3GMIA 5LMNT 3SS1A 4DR7T 3AXJB 2DCFA 3ZLIA 2UZ6A 4A97A 5AINA 1MNEA 2CMRA 4EEDA 2XPKA 3X1DA 4ZJSA 5KZUA 4ZOLE 2DNXA 3RRCA 1Y64B 3PUXF 5HEUA 4L5GA 4ADZA 5J5FA 3ONJA 2W2UA 5JDGA 2W0GA 3C51A 3OKQA 2XYTA 4OK0A 2YMEA 4UM3A 4QABA 3O1HA 3HKBE 2ACXA 2Y48B 2CWOA 3UUXB 3T1YT 3A7MA 2B1EA 4QH4A 4HWCA 2L8KA 5C8YE 1HG2A 2LOSA 1D0ZA 4X1KE 3IF8B 3N2KE 2BKNA 5JDQA 2XQYA 3UQ4A 4HFBA 3ZPOA 1FEWA 1IAPA 1M7KA 1SHZC 3RIAA 3P4PA 1US7B 1J1JA 3BK9A 4AQFC 4JI3T 2K24A 4ISTA 2I0MA 2ODUA 1D0YA 2D5UA 1NENA 1IBMT 4XK9A 2DL1A 4X64T 4GKJT 3AEAA 3AE9A 2CA5A 1MMAA 4IDZA 5M4YA 3TLVA 2OLTA 2IAKA 3B5MA 4CXWA 2M6IA 2ZM0A 2Q9QC 4O2AE 2KSRA 2PJQA 1W0AA 5CA0E 1UX5A 2EHOC 2CCQA 2YDQA 5HWYA 4TV9E 3KV9A 4F6RC 2AXDS 1V9DA 4B3RT 5KMGP 2BG9E 4NXMT 3P4QA 4NPPA 3ZCJA 5JR9B 5JRCA 4EYUA
chains in the Genus database with same CATH topology
3P50A 4NZBA 4PIRA 5HEUA 2BYRA 4FRRA 2VL0A 2X00D 5J5GA 3SIOA 2BR7A 2BYNA 5J5FA 2WNJA 3SH1A 3ZKRA 5HCJA 2ZJVA 2YOEA 2XYTA 2PH9A 2BG9B 5BRXA 2YMEA 3JAFA 3PEOA 5HEOA 5L4EA 3P4WA 3IGQA 3RQWA 3TLSA 3WIPA 2M6BA 4UM3A 5HEGA 2Y58A 2W8FA 4BQTA 4QABA 4HFEA 4WV9A 4IREA 2XQ7A 1UW6A 3WTOA 4HQPA 5KE4A 4X5TA 4QH4A 2LM2A 4ILAA 4LMKA 5IUXA 3U8KA 2Y54A 3UU3A 3LSVA 3RQUA 5LG3A 4IL9A 3JAEA 3JADA 4HFIA 3WTLA 3UU5A 4QH1A 4UM3P 2PGZA 2XNTA 5J5IA 4TWFA 2Y56A 3WTHA 4EZ1A 2W8GA 3EI0A 5CO5A 3UQ4A 4HFBA 2XQ4A 3UUBA 4QAAA 4D01A 4ZK1A 2YN6A 5L4HA 5L47A 2Y57A 3U8MA 3UU4A 4ZRUA 4ALXA 4HFDA 2WZYA 2XNVA 4LMLA 4HFCA 2XQ8A 4ILBA 3TLTA 4TNWA 2MAWA 2WNCA 3RIAA 2XZ6A 5HCMA 3WTIA 1UV6A 4QACA 3U8LA 3ZDHA 2XNUA 4DBMA 5AFNA 5BW2A 4XHEA 5AFMB 4Z90A 2LKGA 2X00A 5JMEA 4ILCA 2ZJUA 2BJ0A 2BYSA 2WNLA 4BFQA 5LXBA 3WTKA 2LLYA 4COFA 4IL4A 2XQ5A 4TWDA 5HEJA 3U8NA 3WTMA 3TLUA 3PMZA 5AFMA 1OEDB 5FJVA 5TVCA 3SQ6A 3RI5A 4UM3S 5AFLA 4AFHA 3UQ7A 2BR8A 4XK9A 4AFTA 1OEDE 4ZK4A 1OEDA 4LMJA 5J0ZA 4UXUA 4ZR6A 4B5DA 2YMDA 1UX2A 3TLVA 3T4MA 2BG9C 4TNVA 1OEDC 3WTJA 5HEHA 3U8JA 3ZDGA 2M6IA 3RIFA 4ZZCA 3UU6A 3GUAA 2C9TA 2XZ5A 2KSRA 2BYQA 2XQAA 3EAMA 2WN9A 4QH5A 4AFGA 5BP0A 4UM1A 2QC1B 2BG9A 4A98A 5SYOA 5CFBA 2UZ6A 3C79A 5AFKA 4ZZBA 4HFHA 4A97A 2Y7YA 2BYPA 2YKSA 4TWHA 2XQ6A 5J5HA 3EHZA 5AFHA 5AINA 2LKHA 2BG9E 1I9BA 4NPPA 4UY2A 2XQ3A 4ZJSA 5KZUA 4Z91A 3WTNA 2XYSA 5AFJA 3SQ9A 4F8HA 2XQ9A 4ZJTA 3RHWA 3C84A 3UU8A 3TLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P50 A;  4NZB A;  4PIR A;  5HEU A;  2BYR A;  4FRR A;  2VL0 A;  2X00 D;  5J5G A;  3SIO A;  2BR7 A;  2BYN A;  5J5F A;  2WNJ A;  3SH1 A;  3ZKR A;  5HCJ A;  2ZJV A;  2YOE A;  2XYT A;  2PH9 A;  2BG9 B;  5BRX A;  2YME A;  3JAF A;  3PEO A;  5HEO A;  5L4E A;  3P4W A;  3IGQ A;  3RQW A;  3TLS A;  3WIP A;  2M6B A;  4UM3 A;  5HEG A;  2Y58 A;  2W8F A;  4BQT A;  4QAB A;  4HFE A;  4WV9 A;  4IRE A;  2XQ7 A;  1UW6 A;  3WTO A;  4HQP A;  5KE4 A;  4X5T A;  4QH4 A;  2LM2 A;  4ILA A;  4LMK A;  5IUX A;  3U8K A;  2Y54 A;  3UU3 A;  3LSV A;  3RQU A;  5LG3 A;  4IL9 A;  3JAE A;  3JAD A;  4HFI A;  3WTL A;  3UU5 A;  4QH1 A;  4UM3 P;  2PGZ A;  2XNT A;  5J5I A;  4TWF A;  2Y56 A;  3WTH A;  4EZ1 A;  2W8G A;  3EI0 A;  5CO5 A;  3UQ4 A;  4HFB A;  2XQ4 A;  3UUB A;  4QAA A;  4D01 A;  4ZK1 A;  2YN6 A;  5L4H A;  5L47 A;  2Y57 A;  3U8M A;  3UU4 A;  4ZRU A;  4ALX A;  4HFD A;  2WZY A;  2XNV A;  4LML A;  4HFC A;  2XQ8 A;  4ILB A;  3TLT A;  4TNW A;  2MAW A;  2WNC A;  3RIA A;  2XZ6 A;  5HCM A;  3WTI A;  1UV6 A;  4QAC A;  3U8L A;  3ZDH A;  2XNU A;  4DBM A;  5AFN A;  5BW2 A;  4XHE A;  5AFM B;  4Z90 A;  2LKG A;  2X00 A;  5JME A;  4ILC A;  2ZJU A;  2BJ0 A;  2BYS A;  2WNL A;  4BFQ A;  5LXB A;  3WTK A;  2LLY A;  4COF A;  4IL4 A;  2XQ5 A;  4TWD A;  5HEJ A;  3U8N A;  3WTM A;  3TLU A;  3PMZ A;  5AFM A;  1OED B;  5FJV A;  5TVC A;  3SQ6 A;  3RI5 A;  4UM3 S;  5AFL A;  4AFH A;  3UQ7 A;  2BR8 A;  4XK9 A;  4AFT A;  1OED E;  4ZK4 A;  1OED A;  4LMJ A;  5J0Z A;  4UXU A;  4ZR6 A;  4B5D A;  2YMD A;  1UX2 A;  3TLV A;  3T4M A;  2BG9 C;  4TNV A;  1OED C;  3WTJ A;  5HEH A;  3U8J A;  3ZDG A;  2M6I A;  3RIF A;  4ZZC A;  3UU6 A;  3GUA A;  2C9T A;  2XZ5 A;  2KSR A;  2BYQ A;  2XQA A;  3EAM A;  2WN9 A;  4QH5 A;  4AFG A;  5BP0 A;  4UM1 A;  2QC1 B;  2BG9 A;  4A98 A;  5SYO A;  5CFB A;  2UZ6 A;  3C79 A;  5AFK A;  4ZZB A;  4HFH A;  4A97 A;  2Y7Y A;  2BYP A;  2YKS A;  4TWH A;  2XQ6 A;  5J5H A;  3EHZ A;  5AFH A;  5AIN A;  2LKH A;  2BG9 E;  1I9B A;  4NPP A;  4UY2 A;  2XQ3 A;  4ZJS A;  5KZU A;  4Z91 A;  3WTN A;  2XYS A;  5AFJ A;  3SQ9 A;  4F8H A;  2XQ9 A;  4ZJT A;  3RHW A;  3C84 A;  3UU8 A;  3TLW A; 
#chains in the Genus database with same CATH topology
 3P50 A;  2XZE A;  3ZYK A;  5ABH A;  4JI2 T;  4G63 A;  1Z8U A;  2BYN A;  4X1Y E;  3NZP A;  1UK5 A;  2ZM2 A;  3EAB A;  4DV4 T;  3IGQ A;  3GN5 A;  4FI5 A;  3H37 A;  2ZLY A;  2UXX B;  5ABF A;  4NXN T;  5AQU B;  4HFE A;  4UV8 B;  3ZMZ B;  2ACZ A;  5FVK A;  2CLY C;  4LF8 T;  3NVO A;  3N9L A;  3VHL A;  2Y8D A;  3MA9 A;  2Q9Q A;  3O1I A;  3KVA A;  5FMN A;  3LK4 2;  3RQU A;  3UU5 A;  1JNR A;  2XNT A;  4IT4 A;  4CQI A;  4EZ1 A;  2QA7 A;  3UUB A;  2YDS A;  4QWN B;  2V7K A;  2JPF A;  2X66 A;  4PK5 A;  5HXE A;  2Y57 A;  4P09 A;  4HWH A;  5HWX A;  4JYA T;  2V26 A;  2H7V C;  3O1J A;  4X1I E;  2BBH A;  3N9Q A;  4I4T E;  4Z8X A;  2BJ0 A;  4A56 A;  1VOM A;  3AB3 B;  5FL1 A;  4KUM B;  2E5V A;  5CGM A;  4DND A;  2HH7 A;  3PUS A;  2XM1 A;  1IBK T;  4CN1 A;  2RA1 A;  3JC6 D;  4B5D A;  2W66 A;  2X0L B;  1B7T A;  3OJA A;  4XZC A;  4X20 E;  3GUA A;  3NKZ A;  4ZI3 D;  5DQW A;  2H3R A;  3LK3 B;  4IDO A;  4A98 A;  1BR4 A;  2E8I A;  4EV6 A;  4DR3 T;  3B13 A;  3WI3 A;  1AJ3 A;  3PUZ F;  1EZ3 A;  1JNZ A;  2OV9 A;  2WDQ A;  1WFD A;  1E7P A;  3LDQ B;  4PK6 A;  2CEA A;  2NOX A;  4QXC B;  2M6B A;  5JDM A;  4H9R C;  3ZJ1 A;  4OX9 T;  3G06 A;  4OYJ A;  3I0Q A;  3K3O A;  2CM0 A;  1QUU A;  4HFI A;  5JDF A;  2V7L A;  5L3E B;  5CO5 A;  5LGT B;  3DJB A;  4UR9 A;  2NW9 A;  2F4V T;  3U8M A;  4ZHQ E;  4LML A;  3QC9 A;  2MAW A;  2ODV A;  5LHG B;  1WYB A;  4XHE A;  4DR5 T;  4ILC A;  2BKP A;  3ZSS A;  4KMC A;  2YDR A;  2JMK A;  3ZC1 A;  1H7C A;  4GK0 E;  2EHO D;  3SQ6 A;  2XAJ B;  4CI3 B;  4IE0 A;  2NWB A;  2YMD A;  4IE6 A;  5AQJ B;  5HEH A;  3PUA A;  5HXR A;  4YLH A;  3WAK A;  4PNI A;  3LBX A;  2WP9 A;  3ONL C;  3OTO T;  3QK6 A;  2WAU A;  4EGW A;  3EHZ A;  4PJL A;  3ETU A;  1I9B A;  4QX8 B;  2XQ3 A;  3AEG A;  4O4I E;  4ZI3 C;  3NBX X;  4YHJ A;  2XQ9 A;  4ZJT A;  3C4W A;  5BR8 T;  4NZB A;  4PIR A;  4I43 B;  5ADX L;  5AQN B;  2YOE A;  2WZH A;  4U2Y A;  3FBZ A;  3RQW A;  4PJJ A;  3WIP A;  4QXH B;  2Q9Q B;  4BQT A;  2L9Q A;  3TKL B;  1NWM X;  2E9X D;  4MAL A;  2LM2 A;  2BVM A;  2LSJ A;  4QKN A;  2Y54 A;  1XWM A;  4CI2 B;  4UM3 P;  5LGU B;  2YU2 A;  1NAF A;  5LXT E;  5JH7 E;  2YEV C;  5FY0 A;  5L47 A;  4K0K T;  5JTG A;  3C4X A;  3TLT A;  2DHR A;  5AFM B;  2UUC T;  4I0U A;  3JC6 C;  2UXC T;  5FKY A;  5HEJ A;  1X9B A;  5ABF B;  3P8C D;  2X9H A;  2W4X A;  4JEU B;  3FHN A;  4UXU A;  1MIW A;  2LHR A;  5KDM C;  2UXD T;  4B3M T;  4PK4 A;  3ZDG A;  2JRK A;  3P4S A;  4UVA B;  3CPZ A;  5HXS A;  2BVL A;  4UF0 B;  3AEE A;  1YW0 A;  2LKH A;  1HFA A;  2XYS A;  4YT0 A;  2BS2 A;  1G8X A;  1KEY A;  3SIO A;  4EZH A;  1D1C A;  1OWA A;  2BS4 A;  2XHE B;  3LJC A;  4DUY T;  2WNJ A;  2VKH A;  1KNR A;  2N2N A;  2PH9 A;  4LFC T;  2J1D G;  1VCS A;  1MIY A;  1WR6 A;  3RRW A;  1UW6 A;  2OA5 A;  3L3P A;  2NTX A;  3QUJ A;  2UU9 T;  4MFR A;  5EK2 A;  3V5S A;  2RPA A;  3WTL A;  3NWI A;  5J5I A;  2Y56 A;  2CPT A;  4GYR A;  4DMW A;  2YN6 A;  2MPK A;  2X0Y A;  2XNV A;  3AA0 B;  4JLE A;  1ZHC A;  2XQ8 A;  4HFC A;  4ILB A;  2X9X A;  4EAH A;  3IHR A;  4P0A A;  2VKO A;  1T98 A;  2QVA A;  2BYS A;  3P4R A;  3WTK A;  4DR1 T;  5FJV A;  4AKH A;  1WR0 A;  4PAG A;  2IC6 A;  3R84 B;  4A5X A;  4CZZ B;  2K48 A;  2WMN A;  5J0Z A;  4BA9 A;  2ZM8 A;  2D9D A;  3FB2 A;  4AKI A;  1XZY A;  3CVR A;  3RIF A;  1HR0 T;  3KBT A;  1YKE B;  4UEM A;  2XQA A;  5L3D B;  5FY7 A;  4AFG A;  2D0T A;  5EZY E;  5FNV E;  2QC1 B;  1LVK A;  1KNZ A;  5SYO A;  3N9O A;  2XAQ B;  2WB5 A;  2MOZ A;  5AFH A;  5C3J A;  4GIW A;  4O4L E;  5F5W A;  2R6G F;  2SPC A;  4HN9 A;  4FRR A;  2V5D A;  2X00 D;  2VVS A;  2JJ9 A;  4IIJ E;  2H89 A;  4XBF B;  2ZJV A;  3I1A A;  2WZI A;  3AED A;  1SUM B;  3QB5 K;  2HPJ A;  4H9S E;  4WV9 A;  2JQQ A;  3ZT6 A;  5LHH B;  2V6Y A;  4QHO A;  2XM2 A;  3RGL A;  3I9Y A;  3MJX A;  5JQG E;  2X0H A;  3JAE A;  2K9A A;  3CQG B;  4IE7 A;  4TWF A;  3ZEF B;  4IE4 A;  2RP4 A;  3VRB A;  4ZK1 A;  1T72 A;  4Q25 A;  2X68 A;  4V1A v;  4YTN A;  4WBN E;  3ZDH A;  2XAF B;  4O4H E;  2HN2 A;  3CX7 B;  3K3N A;  4U74 A;  3F57 A;  5JDL A;  2QGS A;  5DQV A;  4YXD A;  4B3S T;  4HEA A;  2BR8 A;  1YXR A;  3W15 B;  2DI4 A;  4ZEY A;  5ABE A;  4E7S A;  1KK7 A;  4DR2 T;  4EEB A;  3LK2 B;  4H9P C;  3RH3 A;  4HFH A;  2WWU A;  1M62 A;  4UY2 A;  3L09 A;  2LSY A;  4HTE A;  3FZL B;  2EHO B;  4HKA A;  3RHW A;  3AE2 A;  4JI7 T;  3QOF A;  4BJN A;  2IIU A;  2XUE A;  3AEB A;  1MND A;  2Z6E A;  3SH1 A;  4KHP T;  3AE6 A;  3UUL A;  4G2A A;  3JAF A;  4YSZ A;  1J5W A;  3VKH A;  3ZMS B;  2XQ7 A;  4HQP A;  2G0U A;  2CWY A;  2A9U A;  3PUV F;  1T8B A;  4YSX A;  4U31 A;  1IJ6 A;  3RX6 A;  1KF6 A;  4H63 V;  5LB7 B;  1YQ4 A;  2IC9 A;  3NRY A;  4LF7 T;  4LFB T;  3PE0 A;  2NW8 A;  2HHH T;  4DV6 T;  2HN1 A;  2FJE A;  2PFV A;  1D1B A;  4H9Q C;  4HFD A;  1BR0 A;  1U5P A;  5LA6 E;  3VRA A;  4Z90 A;  4CXY A;  4LF5 T;  2D0U A;  1ZOY A;  4X65 T;  3PMZ A;  3ANW B;  3FXD B;  5AFL A;  2LEH A;  4FJO A;  2BG9 C;  2CBI A;  3K3Q C;  3RPU A;  5ETW A;  3U8J A;  4O8S A;  3Q2M A;  2A72 A;  5CB4 E;  3UU6 A;  3OYZ A;  3C98 B;  3KV4 A;  3EAM A;  5TAO A;  2WN9 A;  5LJN A;  5CFB A;  1HS7 A;  2E9X B;  5AQP B;  3N2G E;  2XQ6 A;  2WDR A;  5KXJ A;  3UFE A;  2KZ7 B;  3I9W A;  2W61 A;  2Q9Q D;  3QNU A;  5LHI B;  1CHU A;  2KT9 A;  4UXN B;  2M67 A;  1W0B A;  4JUY A;  2EHO A;  5AQL B;  3FZK B;  2DLR A;  5L3G B;  3DP7 A;  2W8F A;  4K0U A;  2E9X A;  2V5C A;  2MBG A;  3SWH A;  4ILA A;  5IUX A;  5AQO B;  4J2C A;  2LRK A;  3LSV A;  1QLB A;  3ZMT B;  1FMV A;  4NUU A;  3Q5W A;  4OFZ A;  5AQF B;  3QB5 A;  2A2F X;  2CE7 A;  5CA1 E;  3CKD A;  2NR4 A;  1S94 A;  3CX8 B;  3ABV A;  1KNP A;  2WZY A;  4KP3 C;  2WU5 A;  2VKD A;  5HXH A;  1E1H B;  1W9R A;  4M1P A;  2WNL A;  3KVB A;  3Q5E A;  5DJQ C;  4TWD A;  3TLU A;  1VRB A;  4KX6 A;  3HKE E;  4B6X A;  4YY3 T;  5TVC A;  4AFH A;  4YJ3 E;  2YU1 A;  4EB6 E;  5FXX A;  2MTQ A;  3AA1 B;  1XMO T;  4UVB B;  5A1L A;  5FXZ A;  2X9Y A;  1XNR T;  2LRL A;  2X51 A;  2C9T A;  2BYQ A;  2VVN A;  2W00 A;  2VL8 A;  4U72 A;  2ZM6 T;  4HE8 A;  3KBU A;  5AFK A;  2BYP A;  3ZC0 A;  3SQ9 A;  4WYV A;  4GOU A;  3K8P C;  1WLX A;  3RF1 A;  3ZCI A;  4GK5 E;  3KDS E;  2BR7 A;  2IDO B;  1UX4 A;  4AI6 A;  1HX8 A;  3PDY A;  3VU7 H;  3T1H T;  2BG9 B;  5HEO A;  4OYK A;  4PJM A;  3MAC A;  5ABG A;  4HWD A;  3NRX A;  2Y58 A;  3F2E A;  2V1D B;  2WU2 A;  3Q9D A;  4UVC B;  4DBR A;  3AEC A;  3E08 A;  1O3X A;  3DTO A;  5EK4 A;  4IDN A;  4D01 A;  2QYW A;  4TNW A;  4UV9 B;  3PU3 A;  5HCM A;  2DWG A;  4AQY T;  2IUB A;  2JQ9 A;  3U3I A;  3U8N A;  4ANJ A;  2LJL A;  4C90 A;  3KV5 A;  3BQL A;  2XTL A;  2LOP A;  3RKG A;  1MMN A;  3M3Z B;  4NIQ A;  3ZN0 B;  3VKG A;  3WTJ A;  1OED C;  4ZI2 D;  1Y01 A;  2VK9 A;  4AKR B;  3IBP A;  2XZ5 A;  3A8Y C;  3ZT5 A;  3KIN B;  2VAS A;  1FJG T;  4ISS A;  2IW5 B;  2HPL A;  4ZZB A;  2Y7Y A;  2L3L A;  4TWH A;  1R8I A;  5AQH B;  3M65 A;  3ZT7 A;  1YD8 G;  2CXL A;  3RYC E;  3HKD E;  4EZ4 A;  1LKX A;  3HR0 A;  3K1S A;  3OYX A;  4KBM B;  5AQG B;  1GQE A;  2B76 A;  3NZQ A;  4I55 E;  3PEO A;  4MLK A;  3Q5X A;  3UFG A;  4ILU A;  2VB6 A;  3GWH A;  2KND A;  3WAJ A;  2X67 A;  4X5T A;  2J4G A;  4AQF A;  1NEK A;  2WMO A;  3JAD A;  3VR8 A;  5LJM A;  2W8G A;  4PW8 A;  5L3B B;  1SE7 A;  5AQI B;  2WSS V;  4EXT A;  4ZRU A;  2VUR A;  3WTI A;  3U8L A;  2XNU A;  3AE4 A;  5LXB A;  3AAE B;  3CQX C;  4N78 D;  4IL4 A;  5FXW A;  3ZST A;  5AFM A;  1UUS A;  3UQ7 A;  5GON E;  3AA7 B;  1FIO A;  4LMJ A;  1IBL T;  3AVS A;  4KHZ F;  1DU2 A;  1I6Z A;  3FZH B;  1LVF A;  1FMW A;  5BP0 A;  4XAX B;  2V8S V;  3FXE B;  3UT5 E;  3ANW A;  2E2A A;  4ERR A;  3N9M A;  4JI5 T;  5J5G A;  2XAS B;  5JDN A;  4BAY B;  5J2T E;  3RYI E;  5IHY A;  3EUH A;  2WCA A;  3TLS A;  3UUM A;  1SA0 E;  1W09 A;  3AE3 A;  2ES0 A;  3FZM B;  1I94 T;  2JMH A;  1HF8 A;  4TX5 A;  2N1G A;  3LBX B;  2PBI A;  5C2T A;  5AQR B;  2KLQ A;  3L8R A;  2W62 A;  5JVD E;  4IDP A;  1G73 A;  2DWK A;  4WZX A;  2WNC A;  4DID B;  4DBM A;  4I50 E;  3LG7 A;  3ETV A;  4DV7 T;  5LCY A;  3N9N A;  3RYH E;  4YTP A;  3FBL A;  4U3C A;  3RI5 A;  2VQE T;  2CBJ A;  5JRC B;  1HNW T;  2VQF T;  3AVR A;  2WQY A;  1OED A;  1U4Q A;  3BQI A;  4ZR6 A;  5HYA A;  5F8P A;  5LMU T;  2WY2 A;  1XDO A;  5EK3 A;  4HWF A;  3EVY A;  4GKK T;  4P1N A;  4C91 A;  3ZYL A;  2WS3 A;  4QH5 A;  4UM1 A;  4JI1 T;  2BG9 A;  4DUZ T;  3HI2 A;  1MIV A;  3C79 A;  1HG5 A;  1HTJ F;  2J62 A;  3EDU A;  4F8H A;  2CXF A;  4DR4 T;  4U2Z A;  2XSA A;  5AQS B;  1OXZ A;  1WCR A;  2WM9 A;  5H6R B;  4H63 H;  5AQK B;  1VCT A;  1MMG A;  4U7I A;  2I59 A;  5L4E A;  4IHJ E;  5LBQ B;  2BS3 A;  5HEG A;  2UXN B;  3FZF B;  3UTK A;  1WYC A;  1HX1 B;  1ZV4 X;  5JR9 A;  5LGN B;  4NUV A;  2NP9 A;  3KV6 A;  1BR2 A;  1HNX T;  2IML A;  4JI6 T;  2IHR 1;  3AAI A;  4OHF A;  2PGZ A;  3WTH A;  3CIR A;  2XJ7 A;  2JQK A;  3AXJ A;  3B57 A;  2UXB T;  3MK7 C;  2JQH A;  3VR9 A;  2XZ6 A;  3MXZ A;  3AE7 A;  2H7O A;  2LM9 A;  4DVD A;  5LG4 A;  4ZS2 A;  4BFQ A;  4DBQ A;  3EDV A;  3WTM A;  2KMF A;  3UUN A;  5AQV B;  2K5B B;  3ZMU B;  3PUG A;  2YK0 A;  5LYJ E;  3ZMV B;  3SFD A;  2V6X A;  1XMQ T;  3IEE A;  2N9D A;  5BMV E;  4PFP A;  1UUR A;  3C64 A;  5L2L A;  3MZK B;  5FVL A;  1WRD A;  2V7I A;  3ZJ2 A;  5FL0 A;  2K3W A;  4X66 T;  4ZZC A;  1J5E T;  5LG3 A;  3E0Z A;  1HNZ T;  4U7Y A;  5FP3 A;  3L39 A;  2YIN A;  2XAH B;  2P9B A;  2X9W A;  3AAA B;  5AQT B;  5HCJ A;  5J2U E;  4JI0 T;  3U78 A;  4DV1 T;  2LHN A;  5CJ5 A;  3CK6 A;  2NTY A;  3PJA J;  3SFE A;  5LNK A;  4ASK A;  3A5X A;  3PUQ A;  3PJA A;  1MMD A;  2BBJ A;  4TV8 E;  4TZ4 C;  3Q5D A;  2CRB A;  1ZEE A;  2KWI B;  3UU3 A;  4IL9 A;  4EYY R;  4AXP A;  4UIG A;  4EIW A;  4QH1 A;  5FY1 A;  2LE8 A;  3SRZ A;  3EI0 A;  5DAB A;  5FXV A;  5L3C B;  3IA3 A;  4DV2 T;  4L0R A;  4TN7 B;  4QAC A;  2C0S A;  3MKD A;  3OVU A;  4JBW F;  4COF A;  4AIU A;  2XQ5 A;  1OED B;  2CHO A;  5F3J A;  4AFT A;  3PUR A;  3OPC A;  2CHN A;  2J47 A;  1IJ5 A;  1ZP0 A;  1BR1 A;  2JIW A;  1UX2 A;  3N2O A;  4DV5 T;  4YSY A;  4DO0 A;  4CN4 A;  2W67 A;  4B3T T;  3BQK A;  2PTF A;  2YKS A;  1YQ3 A;  1L0V A;  5JR9 C;  4Z91 A;  4DV3 T;  5AFJ A;  3RIU C;  4AKG A;  3UU8 A;  3TLW A;  2CXD A;  4PFO A;  3HA4 A;  4X62 T;  2PG8 A;  2AE9 A;  2WDV A;  3CWZ B;  1N36 T;  2C5I T;  4LF6 T;  2VKJ A;  3C4Z A;  3J7Y q;  4WNK A;  3P4W A;  3D0T A;  2A3D A;  2C5J A;  3WTO A;  3CQC B;  4DMV A;  5AFU L;  2QRX A;  4LMK A;  3I0O A;  5JDH A;  3SOL A;  3P7I A;  1Z0P A;  2V7J A;  2WBL A;  1E2A A;  3GA8 A;  2FJD A;  4ZXL A;  4ALX A;  4MBQ A;  3AEF A;  4AIS A;  4U33 A;  2LKG A;  4ZI2 C;  2ZJU A;  1XNQ T;  2LSK A;  2LT3 A;  2GK9 A;  3AE8 A;  4UM3 S;  3PUW F;  2FBW A;  4AQG A;  1N34 T;  2V6Y B;  3T4M A;  4TNV A;  3CML A;  4PJN A;  1LRZ A;  2ZMA A;  2XY8 B;  3PV0 F;  4JI4 T;  4IE5 A;  4YJ2 E;  2UUB T;  2KIN B;  2XSB A;  4WW0 A;  3V5U A;  3O4X E;  1N32 T;  3C84 A;  4QX7 B;  1IZN B;  3H3A A;  2BYR A;  1D0X A;  2VL0 A;  4CXX A;  1N33 T;  3ZKR A;  4CI1 B;  3T8O A;  5BRX A;  2FJB A;  3HL6 A;  3ZN1 B;  5HAX A;  4ZI7 E;  3PUY F;  5LOV E;  3H3M A;  4UF0 A;  3E22 E;  4IRE A;  1S35 A;  2H88 A;  5AQQ B;  5KE4 A;  4O2B E;  4UEL A;  3ESL A;  3U8K A;  3ONX A;  2MYS A;  4JV5 T;  5FYM A;  4E7Z A;  1UGO A;  2LSG A;  2W63 A;  3J9X 1;  5LBM A;  3GN5 B;  3O9X A;  2V7M A;  2KXP B;  4O4J E;  3AE5 A;  2E9X C;  5LP6 E;  1UV6 A;  5BW2 A;  4YHH T;  3RKO A;  2X00 A;  2LSI A;  3F31 A;  2BKO A;  4IDQ A;  2LLY A;  4TUY E;  2C5K T;  1KFY A;  4CN6 A;  3RC3 A;  2FUP A;  4MHC A;  3CX6 B;  4HFV A;  4DR6 T;  4ZK4 A;  2I6H A;  4QXB B;  1YKH B;  3N9P A;  1XDP A;  3OBV E;  5JRE A;  3RYF E;  1D1A A;  2WWV A;  3PU8 A;  5IWA T;  3PTR B;  3JCF A;  5J5H A;  1ZKE A;  3RIU A;  3WTN A;  5AQM B;  5E0O A;  5L3F B;  4LF4 T;  4KI0 F;  2BDE A;  3ZYM A;  3C50 A;  2KWH A;  2BZB A;  4HWI B;  1HCI A;  3RLF F;  3HKC E;  3KFW X;  2CLY B;  5IYZ E;  4ZS3 A;  2XAG B;  3LFM A;  3AA6 B;  4H9N C;  1T7S A;  4P0B A;  5H6Q B;  2NW7 A;  5J1G A;  3R6N A;  4BJM A;  3S4U A;  4EOZ B;  1QSD A;  4IGU A;  4YFS A;  4LFA T;  1X79 A;  2XQ4 A;  2E5L T;  2VWA A;  4QAA A;  4DV0 T;  5L4H A;  4JI8 T;  3UU4 A;  2Y6X A;  5HXC A;  5AFN A;  4L9I A;  4LF9 T;  5KX5 E;  4H9O C;  4JEH B;  5JME A;  3RC8 A;  4GYS A;  4WBO A;  1CUN A;  2D2S A;  1OED E;  3AE1 A;  4HGA A;  3N5L A;  4AKL A;  1UCU A;  2UUA T;  2FJA A;  4YTM A;  3GMI A;  5LMN T;  3SS1 A;  4DR7 T;  3AXJ B;  2DCF A;  3ZLI A;  2UZ6 A;  4A97 A;  5AIN A;  1MNE A;  2CMR A;  4EED A;  2XPK A;  3X1D A;  4ZJS A;  5KZU A;  4ZOL E;  2DNX A;  3RRC A;  1Y64 B;  3PUX F;  5HEU A;  4L5G A;  4ADZ A;  5J5F A;  3ONJ A;  2W2U A;  5JDG A;  2W0G A;  3C51 A;  3OKQ A;  2XYT A;  4OK0 A;  2YME A;  4UM3 A;  4QAB A;  3O1H A;  3HKB E;  2ACX A;  2Y48 B;  2CWO A;  3UUX B;  3T1Y T;  3A7M A;  2B1E A;  4QH4 A;  4HWC A;  2L8K A;  5C8Y E;  1HG2 A;  2LOS A;  1D0Z A;  4X1K E;  3IF8 B;  3N2K E;  2BKN A;  5JDQ A;  2XQY A;  3UQ4 A;  4HFB A;  3ZPO A;  1FEW A;  1IAP A;  1M7K A;  1SHZ C;  3RIA A;  3P4P A;  1US7 B;  1J1J A;  3BK9 A;  4AQF C;  4JI3 T;  2K24 A;  4IST A;  2I0M A;  2ODU A;  1D0Y A;  2D5U A;  1NEN A;  1IBM T;  4XK9 A;  2DL1 A;  4X64 T;  4GKJ T;  3AEA A;  3AE9 A;  2CA5 A;  1MMA A;  4IDZ A;  5M4Y A;  3TLV A;  2OLT A;  2IAK A;  3B5M A;  4CXW A;  2M6I A;  2ZM0 A;  2Q9Q C;  4O2A E;  2KSR A;  2PJQ A;  1W0A A;  5CA0 E;  1UX5 A;  2EHO C;  2CCQ A;  2YDQ A;  5HWY A;  4TV9 E;  3KV9 A;  4F6R C;  2AXD S;  1V9D A;  4B3R T;  5KMG P;  2BG9 E;  4NXM T;  3P4Q A;  4NPP A;  3ZCJ A;  5JR9 B;  5JRC A;  4EYU A; 
#chains in the Genus database with same CATH homology
 3P50 A;  4NZB A;  4PIR A;  5HEU A;  2BYR A;  4FRR A;  2VL0 A;  2X00 D;  5J5G A;  3SIO A;  2BR7 A;  2BYN A;  5J5F A;  2WNJ A;  3SH1 A;  3ZKR A;  5HCJ A;  2ZJV A;  2YOE A;  2XYT A;  2PH9 A;  2BG9 B;  5BRX A;  2YME A;  3JAF A;  3PEO A;  5HEO A;  5L4E A;  3P4W A;  3IGQ A;  3RQW A;  3TLS A;  3WIP A;  2M6B A;  4UM3 A;  5HEG A;  2Y58 A;  2W8F A;  4BQT A;  4QAB A;  4HFE A;  4WV9 A;  4IRE A;  2XQ7 A;  1UW6 A;  3WTO A;  4HQP A;  5KE4 A;  4X5T A;  4QH4 A;  2LM2 A;  4ILA A;  4LMK A;  5IUX A;  3U8K A;  2Y54 A;  3UU3 A;  3LSV A;  3RQU A;  5LG3 A;  4IL9 A;  3JAE A;  3JAD A;  4HFI A;  3WTL A;  3UU5 A;  4QH1 A;  4UM3 P;  2PGZ A;  2XNT A;  5J5I A;  4TWF A;  2Y56 A;  3WTH A;  4EZ1 A;  2W8G A;  3EI0 A;  5CO5 A;  3UQ4 A;  4HFB A;  2XQ4 A;  3UUB A;  4QAA A;  4D01 A;  4ZK1 A;  2YN6 A;  5L4H A;  5L47 A;  2Y57 A;  3U8M A;  3UU4 A;  4ZRU A;  4ALX A;  4HFD A;  2WZY A;  2XNV A;  4LML A;  4HFC A;  2XQ8 A;  4ILB A;  3TLT A;  4TNW A;  2MAW A;  2WNC A;  3RIA A;  2XZ6 A;  5HCM A;  3WTI A;  1UV6 A;  4QAC A;  3U8L A;  3ZDH A;  2XNU A;  4DBM A;  5AFN A;  5BW2 A;  4XHE A;  5AFM B;  4Z90 A;  2LKG A;  2X00 A;  5JME A;  4ILC A;  2ZJU A;  2BJ0 A;  2BYS A;  2WNL A;  4BFQ A;  5LXB A;  3WTK A;  2LLY A;  4COF A;  4IL4 A;  2XQ5 A;  4TWD A;  5HEJ A;  3U8N A;  3WTM A;  3TLU A;  3PMZ A;  5AFM A;  1OED B;  5FJV A;  5TVC A;  3SQ6 A;  3RI5 A;  4UM3 S;  5AFL A;  4AFH A;  3UQ7 A;  2BR8 A;  4XK9 A;  4AFT A;  1OED E;  4ZK4 A;  1OED A;  4LMJ A;  5J0Z A;  4UXU A;  4ZR6 A;  4B5D A;  2YMD A;  1UX2 A;  3TLV A;  3T4M A;  2BG9 C;  4TNV A;  1OED C;  3WTJ A;  5HEH A;  3U8J A;  3ZDG A;  2M6I A;  3RIF A;  4ZZC A;  3UU6 A;  3GUA A;  2C9T A;  2XZ5 A;  2KSR A;  2BYQ A;  2XQA A;  3EAM A;  2WN9 A;  4QH5 A;  4AFG A;  5BP0 A;  4UM1 A;  2QC1 B;  2BG9 A;  4A98 A;  5SYO A;  5CFB A;  2UZ6 A;  3C79 A;  5AFK A;  4ZZB A;  4HFH A;  4A97 A;  2Y7Y A;  2BYP A;  2YKS A;  4TWH A;  2XQ6 A;  5J5H A;  3EHZ A;  5AFH A;  5AIN A;  2LKH A;  2BG9 E;  1I9B A;  4NPP A;  4UY2 A;  2XQ3 A;  4ZJS A;  5KZU A;  4Z91 A;  3WTN A;  2XYS A;  5AFJ A;  3SQ9 A;  4F8H A;  2XQ9 A;  4ZJT A;  3RHW A;  3C84 A;  3UU8 A;  3TLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...