3P4WA

Structure of desflurane bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p4wA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p4wA01
5LXBA 4AFTA 3WTHA 3LSVA 4LMJA 4ZR6A 2XYSA 4HFHA 3ZKRA 2C9TA 2X00A 2Y58A 3JAEA 4Z90A 2XZ6A 2XQAA 3RIAA 2Y57A 3P50A 3RI5A 2BG9B 3UU3A 2QC1B 2XQ6A 5L47A 4HQPA 4NPPA 1OEDA 3EAMA 2XNVA 2XQ4A 2XQ7A 2PGZA 5LG3A 4QH1A 4TWDA 5KE4A 4EZ1A 3WTIA 3EI0A 4UY2A 4Z91A 4QH4A 4NZBA 2WNCA 2BR7A 2BYQA 3UU4A 4D01A 5J5FA 3UU6A 4DBMA 4A97A 2YMDA 2VL0A 3WIPA 2LLYA 2BYRA 4QH5A 3U8MA 2M6BA 5J5HA 5CFBA 2BG9C 3TLVA 5CO5A 4QACA 4X5TA 2M6IA 4ZK4A 5J0ZA 4UM1A 1OEDC 3WTKA 5AFMB 4HFDA 2XQ5A 2BJ0A 2XQ8A 4TNWA 2WNLA 5SYOA 4F8HA 3RHWA 4ZZCA 4QAAA 4QABA 5AFKA 5HEHA 4LMLA 3WTMA 4XK9A 3PMZA 2BG9A 5BW2A 5L4EA 5TVCA 4B5DA 4TNVA 2X00D 2XQ3A 3SH1A 4HFIA 4IREA 4TWFA 5BP0A 5KZUA 5AFNA 5HEOA 5HCMA 5HEUA 3C84A 4A98A 5AINA 2Y56A 2ZJUA 2XZ5A 4ZRUA 4UM3P 4COFA 1UV6A 2YMEA 3JADA 3UQ7A 5BRXA 4UXUA 4ZK1A 3U8LA 5AFLA 1I9BA 2YN6A 4ILCA 2BG9E 4ILAA 3RQUA 1OEDE 3TLUA 3RIFA 5AFMA 4LMKA 3ZDHA 1UX2A 3U8KA 5HCJA 2MAWA 4TWHA 3SQ6A 4BQTA 4ZJSA 4ZJTA 3P4WA 3UU5A 3SIOA 3WTJA 2XNUA 4AFGA 4ALXA 3WTNA 3TLWA 2BYNA 3WTLA 2LKHA 4XHEA 2PH9A 5HEGA 3U8JA 2YOEA 3TLSA 1UW6A 2LM2A 2Y54A 4UM3S 5J5GA 2W8FA 2BR8A 2W8GA 5AFJA 5HEJA 4HFEA 3EHZA 4HFCA 3UUBA 2BYPA 5AFHA 3GUAA 2WNJA 5JMEA 3RQWA 2WZYA 3T4MA 5L4HA 2ZJVA 4ZZBA 4PIRA 3SQ9A 3U8NA 2WN9A 3JAFA 1OEDB 5J5IA 3IGQA 4BFQA 3C79A 4AFHA 3ZDGA 4ILBA 5IUXA 4UM3A 2KSRA 2XQ9A 4IL9A 2BYSA 2YKSA 2XNTA 3UQ4A 2Y7YA 4IL4A 3TLTA 4HFBA 5FJVA 3PEOA 2UZ6A 3WTOA 2XYTA 4WV9A 3UU8A 2LKGA 4FRRA
chains in the Genus database with same CATH superfamily
5C8YE 5KMGP 5LB7B 2W2UA 2XYSA 2C9TA 3AA7B 4DBRA 4PJLA 2V26A 4KP3C 5LMUT 2IMLA 2QVAA 2WM9A 3PV0F 5KE4A 2LOSA 5JREA 4Z91A 2XASB 3ZT7A 4PK5A 2UXCT 2CBIA 4A97A 1HFAA 2EHOB 2XAGB 3MK7C 3ANWB 2NTYA 3PUZF 3C4XA 3CMLA 3ONJA 2BJ0A 1SHZC 2IC6A 3DP7A 2X9HA 3HI2A 4X20E 3Q9DA 4WZXA 3MJXA 2V8SV 3U8LA 5AFLA 2CLYC 5JRCB 2MPKA 3ZDHA 2BVMA 3ETUA 1MNEA 2SPCA 4U3CA 2BYNA 3WTLA 4U2ZA 4HTEA 3JC6D 2BR8A 3EABA 5HEJA 3EHZA 3BQKA 1IAPA 2BYPA 4AQFC 2V7MA 3H37A 1HF8A 3LG7A 2OLTA 2VVNA 2PG8A 2B1EA 2LOPA 3ZMSB 5HXCA 3RYIE 2L9QA 2E5VA 3G06A 1YQ3A 3AA0B 3CKDA 4DR1T 4DBQA 2CEAA 4JI6T 2LM9A 3S4UA 2X66A 3AE5A 3K8PC 1WR6A 3WIPA 4GYRA 4YSZA 3VKGA 1X9BA 3OJAA 2M6IA 4P0BA 2V1DB 2KWHA 4PFOA 2JQKA 4LF9T 2D9DA 1E7PA 4QABA 1JNRA 3AE4A 2UXNB 2W63A 5TVCA 2VB6A 4I43B 2XZEA 5KZUA 2ES0A 1UK5A 4UF0A 4YY3T 1HR0T 1ZHCA 3CX6B 3EVYA 2VQFT 4MHCA 2W4XA 3LDQB 3V5UA 3SQ6A 4LFAT 1S94A 2FBWA 3RYFE 2E9XB 3BK9A 2YEVC 2W62A 2W8GA 2JRKA 5FL1A 4IDPA 3K3QC 4OYKA 4DV4T 3KINB 3ZN1B 4ILBA 3FZKB 2IAKA 2KSRA 4QXHB 1CUNA 2XNTA 3PE0A 5AQOB 3A5XA 1QLBA 3EDUA 3GA8A 2CRBA 4AQYT 3HL6A 4F6RC 1O3XA 2XQAA 2CA5A 2Y57A 1N32T 4EEDA 2BG9B 4ZI2C 5HXRA 2JMHA 4QH1A 4EZ1A 4UY2A 2QA7A 2MBGA 5JDHA 5CA1E 5ABFB 4D01A 5J5FA 2XUEA 2J4GA 1IJ5A 5CFBA 5IYZE 4EV6A 5AFMB 3KBTA 2N9DA 3ZMZB 4F8HA 4QAAA 2BKNA 1W09A 2CBJA 3T1YT 4IHJE 2WU5A 1XZYA 4KI0F 2UUAT 2CMRA 4KX6A 4A98A 5AINA 4UELA 4B3RT 2NW9A 4ZK1A 4O2AE 5BMVE 5L3GB 4H9OC 3VR9A 5AQPB 4LMKA 2A3DA 2J47A 4KBMB 1CHUA 4DV1T 4ZJTA 4QXCB 5HWXA 2M67A 3TLWA 4HKAA 5AQRB 2LSJA 3N9LA 5J1GA 2CPTA 3C50A 4HFCA 4IDNA 2V6XA 2CE7A 2Y6XA 4X1KE 3RQWA 2ZJVA 2KNDA 2LJLA 1V9DA 4UVCB 4EZHA 3I9WA 2WCAA 3N2OA 2I6HA 3CX8B 5AQIB 5L3CB 3PEOA 5ADXL 3VR8A 4OX9T 1KEYA 2QYWA 3JAEA 3ESLA 4GKKT 3VU7H 5JR9C 3BQIA 2XQ7A 2PGZA 3EI0A 2DLRA 3A7MA 4QX7B 2Q9QA 2HHHT 4Z8XA 5LBQB 2NR4A 4X5TA 1OEDC 3VRBA 1XNQT 2WDVA 3RKGA 5L3FB 3WTMA 3ZYLA 3KV4A 3ZYMA 3RC8A 4P0AA 5L4EA 3VKHA 4B5DA 1BR2A 2X00D 3Q5XA 4IREA 5FXXA 5HEUA 3QUJA 4QX8B 3CWZB 3CQCB 4ZRUA 4PFPA 5GONE 3UQ7A 4U2YA 4UXUA 4IE7A 2IUBA 1IJ6A 2ZM8A 2HPLA 4DV6T 4NIQA 3HKEE 4I55E 5JR9B 5JDQA 4PAGA 5LCYA 3OBVE 2MYSA 4PJNA 2XM2A 3UUXB 4O4IE 2D2SA 1OEDB 2PFVA 3N9PA 3OKQA 5LJNA 1N33T 2DNXA 5LXTE 4U7IA 2XQ9A 3C4WA 4YTPA 1UURA 3UQ4A 3TLTA 1OXZA 2XYTA 4HWCA 2LKGA 3UT5E 3PUYF 3ZKRA 4Z90A 2N1GA 4JUYA 4EAHA 4YT0A 3GWHA 3EAMA 4DR2T 1EZ3A 2YU2A 1R8IA 3UU6A 3AE2A 4UV8B 3ZT5A 3U8MA 4JI2T 3RGLA 5CO5A 4JI8T 4M1PA 3PJAA 3ABVA 2XQ3A 5LOVE 3ZLIA 2CWOA 5HEOA 1UX5A 3A8YC 2D0UA 3AE3A 3AE8A 4UXNB 3M65A 2EHOA 2HPJA 3ANWA 3C4ZA 4X1YE 3C51A 2K48A 2WY2A 3WTJA 2WDRA 1FJGT 4P09A 4BA9A 3WTNA 5FP3A 2L3LA 3WAKA 2LSKA 3AEGA 2XAHB 4B3MT 5F8PA 4TX5A 4ZZBA 3RIUA 5JRCA 4CXYA 3N2KE 2ZM0A 3JCFA 3R6NA 4YXDA 5LBMA 2IIUA 3NWIA 4JBWF 2NWBA 1KNPA 2WMOA 1U4QA 5EK3A 1WR0A 4OK0A 3L09A 3PURA 3IF8B 4EEBA 2NOXA 5AQUB 4CXXA 3B5MA 3PDYA 1H7CA 3LBXB 4NPPA 4DV7T 4IGUA 3LK42 3H3MA 2UUCT 4ILUA 5J5HA 1M7KA 3P4QA 5L3BB 1VOMA 3HA4A 5AFUL 5L3EB 4ZS3A 5BW2A 4CN1A 4LF5T 3WAJA 5E0OA 4B3TT 1ZV4X 1UV6A 3I0QA 2W67A 4K0UA 1N36T 5LA6E 3P4RA 2MOZA 3CPZA 4NXNT 1ZEEA 3IA3A 3P4WA 4ALXA 2PH9A 2PBIA 4JEUB 4DVDA 2W61A 1SA0E 1VCTA 4L0RA 3ETVA 3T8OA 2IC9A 3SQ9A 4C91A 5JDFA 3PUSA 5C2TA 1WYCA 5HXSA 3ZDGA 5IUXA 4AFHA 2K5BB 4ADZA 2CXDA 2Y7YA 2XAJB 3B57A 2E9XA 5EK2A 2H89A 4HWDA 2LHRA 4ANJA 4AFTA 1W0AA 1WCRA 4HWHA 3MA9A 2XAQB 4DIDB 4ZI3C 3AAEB 3HKCE 2XM1A 4ZHQE 3AE9A 3FZFB 4MBQA 1QUUA 3AXJB 2V6YB 1UGOA 5LHGB 5JDGA 1T7SA 4JI4T 1OWAA 4QACA 4YTNA 3ZEFB 2XQ5A 4K0KT 3RHWA 2LT3A 4ZXLA 3PMZA 2CLYB 2BG9A 3J7Yq 2C5IT 4YJ3E 1HX1B 4WNKA 1HG2A 3PTRB 2C5JA 2H7VC 3LK2B 1XDPA 1IZNB 2HN2A 1VCSA 1XWMA 4ZS2A 5JDLA 5AQVB 2BG9E 1WRDA 3HR0A 5AFMA 3U8KA 3I1AA 3QB5A 3SIOA 1X79A 5LP6E 3GN5B 2QGSA 2DWGA 2KZ7B 2YU1A 1W0BA 3AVRA 4H9PC 4ISSA 5FY7A 3D0TA 3PUWF 5FXVA 4PK4A 4IIJE 4GK0E 1SUMB 4J2CA 2CHOA 2R6GF 5FVKA 2BYSA 1KNZA 3E08A 3GMIA 1YXRA 4LF7T 2I0MA 3NBXX 5DJQC 2LEHA 4LFBT 4HFHA 2NW8A 4JI1T 2JIWA 2WBLA 1LKXA 1T72A 2D5UA 2XQ4A 2E5LT 5LG3A 2WNCA 4JYAT 2YMDA 2VL0A 2WSSV 1B7TA 1KNRA 2IDOB 5J0ZA 5LNKA 5JH7E 3RPUA 3RYHE 4AXPA 3K3NA 2VVSA 3MKDA 4CN6A 5HCMA 2FJDA 2Y56A 2BS2A 4BJMA 3CQXC 5BRXA 3JC6C 3OPCA 4AI6A 3P4SA 2P9BA 4EXTA 1UX2A 2Q9QD 3SFDA 2MAWA 4QHOA 2A72A 4JEHB 4ZJSA 2G0UA 3O1IA 2YDQA 3PUGA 2X51A 2Y54A 2WZHA 2X9YA 1E1HB 3RF1A 2WS3A 5AFHA 1Y01A 4HE8A 4UR9A 4N78D 4LFCT 1N34T 3H3AA 2HN1A 2DI4A 4PJMA 1IBKT 3ONXA 1YQ4A 4IL4A 4U33A 5FJVA 4ERRA 3ZCJA 1D0ZA 2K3WA 3O1JA 3VHLA 2X9XA 2LRKA 3PUVF 2XQ6A 4H9QC 2Y48B 3W15B 4KHZF 2XNVA 1OEDA 4HQPA 4HEAA 1DU2A 3ZC0A 4IE6A 4TWDA 3DJBA 1FIOA 2WZIA 3SRZA 4EIWA 2LLYA 3KV5A 5EK4A 1XMOT 2M6BA 4UM1A 4AKHA 3AE6A 4LMLA 3I9YA 2BKPA 4O4JE 3J9X1 4TNVA 5KDMC 4P1NA 4TWFA 1NENA 4GYSA 5ABEA 2ZJUA 4PK6A 2XQYA 4DUYT 1D0XA 2Y8DA 1NWMX 5FY0A 3TLUA 4A56A 2QRXA 3X1DA 3E22E 4U7YA 2A2FX 1MMGA 3CQGB 3TLSA 1UW6A 4CI3B 2WDQA 1HNXT 3CVRA 4HGAA 5IWAT 4PIRA 3AAAB 4DR6T 4X62T 2E2AA 2EHOD 5FKYA 5C3JA 5HXHA 3PUQA 2RA1A 4YTMA 3ZJ1A 5CB4E 1VRBA 2CCQA 2H3RA 3OTOT 2WU2A 3OYZA 3SOLA 4UIGA 2JMKA 4X64T 5J2UE 4OHFA 2XZ6A 3MXZA 1Z0PA 3ZT6A 3UU3A 2QC1B 4DNDA 4AKGA 2VKDA 4NZBA 1MNDA 4IT4A 4B3ST 5AQQB 1U5PA 3AA1B 2BYRA 2CHNA 3TLVA 3FBLA 4AKRB 5AQFB 3OYXA 2WNLA 4OFZA 4YSYA 4WBNE 5JQGE 3FB2A 1LRZA 5AFKA 5HEHA 3CIRA 3LBXA 5A1LA 4AKIA 3C84A 3P7IA 1MMAA 2E8IA 4FJOA 4EYYR 4COFA 5H6QB 1FMVA 4AISA 4XBFB 3I0OA 3L39A 5ETWA 3QK6A 3RQUA 3AEDA 3L8RA 4BQTA 2V7LA 4DMVA 3AB3B 4DMWA 2UUBT 2LKHA 3U8JA 4H9RC 4HWFA 4NXMT 4DV3T 1BR4A 2JQ9A 2KMFA 3RRWA 1D1AA 4JI3T 5AQHB 3C79A 1T98A 2OA5A 1XMQT 2RPAA 5ABHA 3KVAA 4HFBA 5L2LA 1M62A 2N2NA 2LHNA 4ZR6A 2AXDS 2Y58A 5M4YA 1L0VA 4IE4A 1HS7A 3AA6B 2BBJA 4DR5T 2ACZA 3R84B 2XSAA 3VRAA 1ZP0A 5LGUB 5KXJA 2X0HA 3Q2MA 4I4TE 3N9NA 4CI1B 1WFDA 5AQKB 2VL8A 4O2BE 3RRCA 4X66T 3TKLB 4IE5A 3N5LA 4HFDA 2E9XD 2XQ8A 4HWIB 5HWYA 5LJMA 1YKEB 3U78A 1IBLT 4H9NC 4I0UA 1WLXA 3AXJA 2X68A 2JQQA 2V6YA 4PJJA 2ZM6T 4U72A 5F5WA 4H63V 2W00A 4XZCA 1LVKA 2D0TA 1US7B 3AEFA 2FJEA 4JLEA 2H88A 3UU5A 2UXXB 3ZCIA 3U3IA 3IHRA 2VKJA 3AE1A 1BR1A 2J1DG 5AQMB 1KF6A 1MIVA 1LVFA 4YFSA 4L9IA 3Q5EA 2KINB 4WYVA 2NP9A 4EB6E 2GK9A 4Q25A 3HKDE 4AQFA 3AE7A 4IDQA 2ODUA 3GN5A 3ZYKA 1NAFA 5LGTB 3N9OA 1MMNA 3L3PA 5HAXA 3O4XE 3LK3B 3M3ZB 5DABA 4U74A 2ZLYA 4ASKA 4DV2T 3QOFA 3B13A 1XDOA 2ZM2A 3ZSTA 3ZC1A 1MIYA 2CXFA 3AVSA 5HXEA 4DUZT 3KVBA 2BYQA 4DO0A 2KWIB 4GIWA 3UUNA 3PJAJ 5BR8T 3AEBA 4ZI2D 3WTKA 4TNWA 3AAIA 2WB5A 4GKJT 1J5WA 3FBZA 4CI2B 5JTGA 2W0GA 3F2EA 2XAFB 1IBMT 2NTXA 4UM3P 3QC9A 3JADA 3K3OA 1HX8A 4DR7T 3C98B 2C5KT 2PJQA 2VWAA 1UX4A 4E7ZA 2XNUA 3UFEA 1E2AA 3N9MA 5L3DB 2HH7A 4EOZB 5AFJA 1SE7A 1T8BA 4YHJA 4L5GA 3KFWX 5ABFA 4YHHT 1D1CA 4LF6T 3FHNA 3T4MA 2E9XC 5J5IA 4MFRA 3UUMA 3NKZA 3LJCA 4WV9A 3UU8A 1J1JA 1ZOYA 2PTFA 3KV6A 3RLFF 3EUHA 3P8CD 2JJ9A 5FMNA 5JVDE 4E7SA 1YD8G 2WWVA 2VASA 2FJAA 1I94T 4G2AA 2FUPA 1FEWA 2BG9C 4ZK4A 5EZYE 2JPFA 4H9SE 4WBOA 3UTKA 2BBHA 2DHRA 4V1Av 2XHEB 4TV8E 2A9UA 4DV5T 3RH3A 3NZPA 3RKOA 3O1HA 2X0YA 2VQET 1S35A 5FVLA 2YMEA 1KFYA 1MMDA 5FY1A 1W9RA 2VKOA 2YN6A 2IHR1 3IBPA 2XTLA 4LF4T 4PNIA 2CWYA 1G8XA 1UCUA 5LHHB 3SWHA 1FMWA 5KX5E 1ZKEA 3AEAA 4XHEA 3F31A 2YOEA 4AKLA 4UM3S 2W8FA 2V7JA 4HFEA 3F57A 2XY8B 2BS4A 3UULA 3FXEB 2DCFA 1I6ZA 3RX6A 3Q5WA 2ZMAA 3U8NA 1BR0A 4ISTA 1D1BA 4I50E 3ZSSA 2W66A 4UM3A 1HCIA 3CK6A 4FI5A 4DR3T 5AQTB 2YKSA 3KDSE 4AQGA 3ZMTB 2KT9A 3WTHA 3LSVA 4B6XA 4LMJA 4MALA 4BJNA 3T1HT 3E0ZA 2BKOA 4O4LE 3NVOA 3RI5A 4GOUA 2DL1A 1AJ3A 5LYJE 4X1IE 3KV9A 4UF0B 4ZEYA 2H7OA 4TN7B 2BR7A 5DQVA 2MTQA 5JR9A 3MZKB 2VURA 5TAOA 4X65T 4XAXB 4CXWA 5FL0A 4NUVA 5AQSB 5AQGB 4BAYB 5SYOA 4ZZCA 2LSYA 4U31A 4QWNB 5J2TE 3O9XA 1XNRT 4CZZB 1UUSA 2OV9A 1D0YA 5HYAA 2XZ5A 2WAUA 2V7IA 3ZJ2A 4ILCA 1OEDE 3RIFA 4YLHA 1HNWT 4YJ2E 3OVUA 5HCJA 4TWHA 5LG4A 4UVAB 3EDVA 2LRLA 1QSDA 1MIWA 3NZQA 1JNZA 4UV9B 3FZMB 3K1SA 2V5DA 2UXBT 4HN9A 4EZ4A 5CGMA 3KBUA 2WZYA 5L4HA 4EYUA 2VK9A 3ZPOA 3NRYA 2KXPB 3IGQA 5ABGA 3ZMUB 2XJ7A 4IDZA 2UZ6A 3WTOA 3IEEA 4FRRA 3PUXF 4JI7T 2LSIA 3SFEA 4WW0A 4OYJA 1GQEA 3RIAA 2LSGA 5FNVE 2BS3A 5L47A 1J5ET 1HNZT 3RC3A 4DV0T 3ONLC 3LFMA 4IDOA 4JI0T 4QH4A 4UVBB 3AEEA 3MACA 4YSXA 2BVLA 4DBMA 5FXWA 4TZ4C 2YK0A 5JDMA 4QH5A 2VKHA 2DWKA 5DQWA 3ZN0B 1NEKA 2LE8A 2ODVA 2C0SA 3N9QA 2WWUA 2YINA 2Q9QC 2UXDT 4TV9E 5BP0A 2ACXA 4ZOLE 3WI3A 4KHPT 2K24A 4GK5E 3PU3A 4PW8A 2X0LB 4JV5T 1I9BA 2IW5B 4DR4T 3AECA 3V5SA 3Q5DA 2BDEA 4TUYE 2KLQA 5HEGA 2V7KA 4KUMB 4AIUA 5CJ5A 5FXZA 2X9WA 5H6RB 1HTJF 2WNJA 4UEMA 4O4HE 4NUUA 2UU9T 2V5CA 3FXDB 2WMNA 3JAFA 5AQJB 3SS1A 4IL9A 4C90A 1WYBA 5CA0E 2Q9QB 2YDSA 2X67A 2J62A 5LXBA 2WQYA 2WP9A 4H63H 3CX7B 2X00A 2K9AA 4ZI7E 4EGWA 2JQHA 2BZBA 1Z8UA 3P50A 3PU8A 5AQLB 5FYMA 3NRXA 3WTIA 2XSBA 5LMNT 3UU4A 3FZHB 3N2GE 5LHIB 5IHYA 2NW7A 3PUAA 4ZI3D 4QXBB 4A5XA 2FJBA 3QNUA 5LGNB 1G73A 3ZMVB 4CN4A 1YKHB 4XK9A 5AQNB 3SH1A 4HFIA 4G63A 5AFNA 3HKBE 3QB5K 4JI5T 4MLKA 3C64A 2I59A 4ILAA 3FZLB 4QKNA 3RYCE 2L8KA 1Y64B 4O8SA 1YW0A 4AFGA 2EHOC 1KK7A 2LM2A 3P4PA 5J5GA 4KMCA 3UFGA 2YDRA 4CQIA 2XPKA 3UUBA 3GUAA 5JMEA 4IE0A 3BQLA 5JDNA 2WN9A 1HG5A 4LF8T 2AE9A 4HFVA 4BFQA 2RP4A 2Z6EA 3DTOA 2F4VT 2CXLA 2B76A 2CM0A 5F3JA 3RIUC
chains in the Genus database with same CATH topology
5LXBA 4AFTA 3WTHA 3LSVA 4LMJA 4ZR6A 2XYSA 4HFHA 3ZKRA 2C9TA 2X00A 2Y58A 3JAEA 4Z90A 2XZ6A 2XQAA 3RIAA 2Y57A 3P50A 3RI5A 2BG9B 3UU3A 2QC1B 2XQ6A 5L47A 4HQPA 4NPPA 1OEDA 3EAMA 2XNVA 2XQ4A 2XQ7A 2PGZA 5LG3A 4QH1A 4TWDA 5KE4A 4EZ1A 3WTIA 3EI0A 4UY2A 4Z91A 4QH4A 4NZBA 2WNCA 2BR7A 2BYQA 3UU4A 4D01A 5J5FA 3UU6A 4DBMA 4A97A 2YMDA 2VL0A 3WIPA 2LLYA 2BYRA 4QH5A 3U8MA 2M6BA 5J5HA 5CFBA 2BG9C 3TLVA 5CO5A 4QACA 4X5TA 2M6IA 4ZK4A 5J0ZA 4UM1A 1OEDC 3WTKA 5AFMB 4HFDA 2XQ5A 2BJ0A 2XQ8A 4TNWA 2WNLA 5SYOA 4F8HA 3RHWA 4ZZCA 4QAAA 4QABA 5AFKA 5HEHA 4LMLA 3WTMA 4XK9A 3PMZA 2BG9A 5BW2A 5L4EA 5TVCA 4B5DA 4TNVA 2X00D 2XQ3A 3SH1A 4HFIA 4IREA 4TWFA 5BP0A 5KZUA 5AFNA 5HEOA 5HCMA 5HEUA 3C84A 4A98A 5AINA 2Y56A 2ZJUA 2XZ5A 4ZRUA 4UM3P 4COFA 1UV6A 2YMEA 3JADA 3UQ7A 5BRXA 4UXUA 4ZK1A 3U8LA 5AFLA 1I9BA 2YN6A 4ILCA 2BG9E 4ILAA 3RQUA 1OEDE 3TLUA 3RIFA 5AFMA 4LMKA 3ZDHA 1UX2A 3U8KA 5HCJA 2MAWA 4TWHA 3SQ6A 4BQTA 4ZJSA 4ZJTA 3P4WA 3UU5A 3SIOA 3WTJA 2XNUA 4AFGA 4ALXA 3WTNA 3TLWA 2BYNA 3WTLA 2LKHA 4XHEA 2PH9A 5HEGA 3U8JA 2YOEA 3TLSA 1UW6A 2LM2A 2Y54A 4UM3S 5J5GA 2W8FA 2BR8A 2W8GA 5AFJA 5HEJA 4HFEA 3EHZA 4HFCA 3UUBA 2BYPA 5AFHA 3GUAA 2WNJA 5JMEA 3RQWA 2WZYA 3T4MA 5L4HA 2ZJVA 4ZZBA 4PIRA 3SQ9A 3U8NA 2WN9A 3JAFA 1OEDB 5J5IA 3IGQA 4BFQA 3C79A 4AFHA 3ZDGA 4ILBA 5IUXA 4UM3A 2KSRA 2XQ9A 4IL9A 2BYSA 2YKSA 2XNTA 3UQ4A 2Y7YA 4IL4A 3TLTA 4HFBA 5FJVA 3PEOA 2UZ6A 3WTOA 2XYTA 4WV9A 3UU8A 2LKGA 4FRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LXB A;  4AFT A;  3WTH A;  3LSV A;  4LMJ A;  4ZR6 A;  2XYS A;  4HFH A;  3ZKR A;  2C9T A;  2X00 A;  2Y58 A;  3JAE A;  4Z90 A;  2XZ6 A;  2XQA A;  3RIA A;  2Y57 A;  3P50 A;  3RI5 A;  2BG9 B;  3UU3 A;  2QC1 B;  2XQ6 A;  5L47 A;  4HQP A;  4NPP A;  1OED A;  3EAM A;  2XNV A;  2XQ4 A;  2XQ7 A;  2PGZ A;  5LG3 A;  4QH1 A;  4TWD A;  5KE4 A;  4EZ1 A;  3WTI A;  3EI0 A;  4UY2 A;  4Z91 A;  4QH4 A;  4NZB A;  2WNC A;  2BR7 A;  2BYQ A;  3UU4 A;  4D01 A;  5J5F A;  3UU6 A;  4DBM A;  4A97 A;  2YMD A;  2VL0 A;  3WIP A;  2LLY A;  2BYR A;  4QH5 A;  3U8M A;  2M6B A;  5J5H A;  5CFB A;  2BG9 C;  3TLV A;  5CO5 A;  4QAC A;  4X5T A;  2M6I A;  4ZK4 A;  5J0Z A;  4UM1 A;  1OED C;  3WTK A;  5AFM B;  4HFD A;  2XQ5 A;  2BJ0 A;  2XQ8 A;  4TNW A;  2WNL A;  5SYO A;  4F8H A;  3RHW A;  4ZZC A;  4QAA A;  4QAB A;  5AFK A;  5HEH A;  4LML A;  3WTM A;  4XK9 A;  3PMZ A;  2BG9 A;  5BW2 A;  5L4E A;  5TVC A;  4B5D A;  4TNV A;  2X00 D;  2XQ3 A;  3SH1 A;  4HFI A;  4IRE A;  4TWF A;  5BP0 A;  5KZU A;  5AFN A;  5HEO A;  5HCM A;  5HEU A;  3C84 A;  4A98 A;  5AIN A;  2Y56 A;  2ZJU A;  2XZ5 A;  4ZRU A;  4UM3 P;  4COF A;  1UV6 A;  2YME A;  3JAD A;  3UQ7 A;  5BRX A;  4UXU A;  4ZK1 A;  3U8L A;  5AFL A;  1I9B A;  2YN6 A;  4ILC A;  2BG9 E;  4ILA A;  3RQU A;  1OED E;  3TLU A;  3RIF A;  5AFM A;  4LMK A;  3ZDH A;  1UX2 A;  3U8K A;  5HCJ A;  2MAW A;  4TWH A;  3SQ6 A;  4BQT A;  4ZJS A;  4ZJT A;  3P4W A;  3UU5 A;  3SIO A;  3WTJ A;  2XNU A;  4AFG A;  4ALX A;  3WTN A;  3TLW A;  2BYN A;  3WTL A;  2LKH A;  4XHE A;  2PH9 A;  5HEG A;  3U8J A;  2YOE A;  3TLS A;  1UW6 A;  2LM2 A;  2Y54 A;  4UM3 S;  5J5G A;  2W8F A;  2BR8 A;  2W8G A;  5AFJ A;  5HEJ A;  4HFE A;  3EHZ A;  4HFC A;  3UUB A;  2BYP A;  5AFH A;  3GUA A;  2WNJ A;  5JME A;  3RQW A;  2WZY A;  3T4M A;  5L4H A;  2ZJV A;  4ZZB A;  4PIR A;  3SQ9 A;  3U8N A;  2WN9 A;  3JAF A;  1OED B;  5J5I A;  3IGQ A;  4BFQ A;  3C79 A;  4AFH A;  3ZDG A;  4ILB A;  5IUX A;  4UM3 A;  2KSR A;  2XQ9 A;  4IL9 A;  2BYS A;  2YKS A;  2XNT A;  3UQ4 A;  2Y7Y A;  4IL4 A;  3TLT A;  4HFB A;  5FJV A;  3PEO A;  2UZ6 A;  3WTO A;  2XYT A;  4WV9 A;  3UU8 A;  2LKG A;  4FRR A; 
#chains in the Genus database with same CATH topology
 5C8Y E;  5KMG P;  5LB7 B;  2W2U A;  2XYS A;  2C9T A;  3AA7 B;  4DBR A;  4PJL A;  2V26 A;  4KP3 C;  5LMU T;  2IML A;  2QVA A;  2WM9 A;  3PV0 F;  5KE4 A;  2LOS A;  5JRE A;  4Z91 A;  2XAS B;  3ZT7 A;  4PK5 A;  2UXC T;  2CBI A;  4A97 A;  1HFA A;  2EHO B;  2XAG B;  3MK7 C;  3ANW B;  2NTY A;  3PUZ F;  3C4X A;  3CML A;  3ONJ A;  2BJ0 A;  1SHZ C;  2IC6 A;  3DP7 A;  2X9H A;  3HI2 A;  4X20 E;  3Q9D A;  4WZX A;  3MJX A;  2V8S V;  3U8L A;  5AFL A;  2CLY C;  5JRC B;  2MPK A;  3ZDH A;  2BVM A;  3ETU A;  1MNE A;  2SPC A;  4U3C A;  2BYN A;  3WTL A;  4U2Z A;  4HTE A;  3JC6 D;  2BR8 A;  3EAB A;  5HEJ A;  3EHZ A;  3BQK A;  1IAP A;  2BYP A;  4AQF C;  2V7M A;  3H37 A;  1HF8 A;  3LG7 A;  2OLT A;  2VVN A;  2PG8 A;  2B1E A;  2LOP A;  3ZMS B;  5HXC A;  3RYI E;  2L9Q A;  2E5V A;  3G06 A;  1YQ3 A;  3AA0 B;  3CKD A;  4DR1 T;  4DBQ A;  2CEA A;  4JI6 T;  2LM9 A;  3S4U A;  2X66 A;  3AE5 A;  3K8P C;  1WR6 A;  3WIP A;  4GYR A;  4YSZ A;  3VKG A;  1X9B A;  3OJA A;  2M6I A;  4P0B A;  2V1D B;  2KWH A;  4PFO A;  2JQK A;  4LF9 T;  2D9D A;  1E7P A;  4QAB A;  1JNR A;  3AE4 A;  2UXN B;  2W63 A;  5TVC A;  2VB6 A;  4I43 B;  2XZE A;  5KZU A;  2ES0 A;  1UK5 A;  4UF0 A;  4YY3 T;  1HR0 T;  1ZHC A;  3CX6 B;  3EVY A;  2VQF T;  4MHC A;  2W4X A;  3LDQ B;  3V5U A;  3SQ6 A;  4LFA T;  1S94 A;  2FBW A;  3RYF E;  2E9X B;  3BK9 A;  2YEV C;  2W62 A;  2W8G A;  2JRK A;  5FL1 A;  4IDP A;  3K3Q C;  4OYK A;  4DV4 T;  3KIN B;  3ZN1 B;  4ILB A;  3FZK B;  2IAK A;  2KSR A;  4QXH B;  1CUN A;  2XNT A;  3PE0 A;  5AQO B;  3A5X A;  1QLB A;  3EDU A;  3GA8 A;  2CRB A;  4AQY T;  3HL6 A;  4F6R C;  1O3X A;  2XQA A;  2CA5 A;  2Y57 A;  1N32 T;  4EED A;  2BG9 B;  4ZI2 C;  5HXR A;  2JMH A;  4QH1 A;  4EZ1 A;  4UY2 A;  2QA7 A;  2MBG A;  5JDH A;  5CA1 E;  5ABF B;  4D01 A;  5J5F A;  2XUE A;  2J4G A;  1IJ5 A;  5CFB A;  5IYZ E;  4EV6 A;  5AFM B;  3KBT A;  2N9D A;  3ZMZ B;  4F8H A;  4QAA A;  2BKN A;  1W09 A;  2CBJ A;  3T1Y T;  4IHJ E;  2WU5 A;  1XZY A;  4KI0 F;  2UUA T;  2CMR A;  4KX6 A;  4A98 A;  5AIN A;  4UEL A;  4B3R T;  2NW9 A;  4ZK1 A;  4O2A E;  5BMV E;  5L3G B;  4H9O C;  3VR9 A;  5AQP B;  4LMK A;  2A3D A;  2J47 A;  4KBM B;  1CHU A;  4DV1 T;  4ZJT A;  4QXC B;  5HWX A;  2M67 A;  3TLW A;  4HKA A;  5AQR B;  2LSJ A;  3N9L A;  5J1G A;  2CPT A;  3C50 A;  4HFC A;  4IDN A;  2V6X A;  2CE7 A;  2Y6X A;  4X1K E;  3RQW A;  2ZJV A;  2KND A;  2LJL A;  1V9D A;  4UVC B;  4EZH A;  3I9W A;  2WCA A;  3N2O A;  2I6H A;  3CX8 B;  5AQI B;  5L3C B;  3PEO A;  5ADX L;  3VR8 A;  4OX9 T;  1KEY A;  2QYW A;  3JAE A;  3ESL A;  4GKK T;  3VU7 H;  5JR9 C;  3BQI A;  2XQ7 A;  2PGZ A;  3EI0 A;  2DLR A;  3A7M A;  4QX7 B;  2Q9Q A;  2HHH T;  4Z8X A;  5LBQ B;  2NR4 A;  4X5T A;  1OED C;  3VRB A;  1XNQ T;  2WDV A;  3RKG A;  5L3F B;  3WTM A;  3ZYL A;  3KV4 A;  3ZYM A;  3RC8 A;  4P0A A;  5L4E A;  3VKH A;  4B5D A;  1BR2 A;  2X00 D;  3Q5X A;  4IRE A;  5FXX A;  5HEU A;  3QUJ A;  4QX8 B;  3CWZ B;  3CQC B;  4ZRU A;  4PFP A;  5GON E;  3UQ7 A;  4U2Y A;  4UXU A;  4IE7 A;  2IUB A;  1IJ6 A;  2ZM8 A;  2HPL A;  4DV6 T;  4NIQ A;  3HKE E;  4I55 E;  5JR9 B;  5JDQ A;  4PAG A;  5LCY A;  3OBV E;  2MYS A;  4PJN A;  2XM2 A;  3UUX B;  4O4I E;  2D2S A;  1OED B;  2PFV A;  3N9P A;  3OKQ A;  5LJN A;  1N33 T;  2DNX A;  5LXT E;  4U7I A;  2XQ9 A;  3C4W A;  4YTP A;  1UUR A;  3UQ4 A;  3TLT A;  1OXZ A;  2XYT A;  4HWC A;  2LKG A;  3UT5 E;  3PUY F;  3ZKR A;  4Z90 A;  2N1G A;  4JUY A;  4EAH A;  4YT0 A;  3GWH A;  3EAM A;  4DR2 T;  1EZ3 A;  2YU2 A;  1R8I A;  3UU6 A;  3AE2 A;  4UV8 B;  3ZT5 A;  3U8M A;  4JI2 T;  3RGL A;  5CO5 A;  4JI8 T;  4M1P A;  3PJA A;  3ABV A;  2XQ3 A;  5LOV E;  3ZLI A;  2CWO A;  5HEO A;  1UX5 A;  3A8Y C;  2D0U A;  3AE3 A;  3AE8 A;  4UXN B;  3M65 A;  2EHO A;  2HPJ A;  3ANW A;  3C4Z A;  4X1Y E;  3C51 A;  2K48 A;  2WY2 A;  3WTJ A;  2WDR A;  1FJG T;  4P09 A;  4BA9 A;  3WTN A;  5FP3 A;  2L3L A;  3WAK A;  2LSK A;  3AEG A;  2XAH B;  4B3M T;  5F8P A;  4TX5 A;  4ZZB A;  3RIU A;  5JRC A;  4CXY A;  3N2K E;  2ZM0 A;  3JCF A;  3R6N A;  4YXD A;  5LBM A;  2IIU A;  3NWI A;  4JBW F;  2NWB A;  1KNP A;  2WMO A;  1U4Q A;  5EK3 A;  1WR0 A;  4OK0 A;  3L09 A;  3PUR A;  3IF8 B;  4EEB A;  2NOX A;  5AQU B;  4CXX A;  3B5M A;  3PDY A;  1H7C A;  3LBX B;  4NPP A;  4DV7 T;  4IGU A;  3LK4 2;  3H3M A;  2UUC T;  4ILU A;  5J5H A;  1M7K A;  3P4Q A;  5L3B B;  1VOM A;  3HA4 A;  5AFU L;  5L3E B;  4ZS3 A;  5BW2 A;  4CN1 A;  4LF5 T;  3WAJ A;  5E0O A;  4B3T T;  1ZV4 X;  1UV6 A;  3I0Q A;  2W67 A;  4K0U A;  1N36 T;  5LA6 E;  3P4R A;  2MOZ A;  3CPZ A;  4NXN T;  1ZEE A;  3IA3 A;  3P4W A;  4ALX A;  2PH9 A;  2PBI A;  4JEU B;  4DVD A;  2W61 A;  1SA0 E;  1VCT A;  4L0R A;  3ETV A;  3T8O A;  2IC9 A;  3SQ9 A;  4C91 A;  5JDF A;  3PUS A;  5C2T A;  1WYC A;  5HXS A;  3ZDG A;  5IUX A;  4AFH A;  2K5B B;  4ADZ A;  2CXD A;  2Y7Y A;  2XAJ B;  3B57 A;  2E9X A;  5EK2 A;  2H89 A;  4HWD A;  2LHR A;  4ANJ A;  4AFT A;  1W0A A;  1WCR A;  4HWH A;  3MA9 A;  2XAQ B;  4DID B;  4ZI3 C;  3AAE B;  3HKC E;  2XM1 A;  4ZHQ E;  3AE9 A;  3FZF B;  4MBQ A;  1QUU A;  3AXJ B;  2V6Y B;  1UGO A;  5LHG B;  5JDG A;  1T7S A;  4JI4 T;  1OWA A;  4QAC A;  4YTN A;  3ZEF B;  2XQ5 A;  4K0K T;  3RHW A;  2LT3 A;  4ZXL A;  3PMZ A;  2CLY B;  2BG9 A;  3J7Y q;  2C5I T;  4YJ3 E;  1HX1 B;  4WNK A;  1HG2 A;  3PTR B;  2C5J A;  2H7V C;  3LK2 B;  1XDP A;  1IZN B;  2HN2 A;  1VCS A;  1XWM A;  4ZS2 A;  5JDL A;  5AQV B;  2BG9 E;  1WRD A;  3HR0 A;  5AFM A;  3U8K A;  3I1A A;  3QB5 A;  3SIO A;  1X79 A;  5LP6 E;  3GN5 B;  2QGS A;  2DWG A;  2KZ7 B;  2YU1 A;  1W0B A;  3AVR A;  4H9P C;  4ISS A;  5FY7 A;  3D0T A;  3PUW F;  5FXV A;  4PK4 A;  4IIJ E;  4GK0 E;  1SUM B;  4J2C A;  2CHO A;  2R6G F;  5FVK A;  2BYS A;  1KNZ A;  3E08 A;  3GMI A;  1YXR A;  4LF7 T;  2I0M A;  3NBX X;  5DJQ C;  2LEH A;  4LFB T;  4HFH A;  2NW8 A;  4JI1 T;  2JIW A;  2WBL A;  1LKX A;  1T72 A;  2D5U A;  2XQ4 A;  2E5L T;  5LG3 A;  2WNC A;  4JYA T;  2YMD A;  2VL0 A;  2WSS V;  1B7T A;  1KNR A;  2IDO B;  5J0Z A;  5LNK A;  5JH7 E;  3RPU A;  3RYH E;  4AXP A;  3K3N A;  2VVS A;  3MKD A;  4CN6 A;  5HCM A;  2FJD A;  2Y56 A;  2BS2 A;  4BJM A;  3CQX C;  5BRX A;  3JC6 C;  3OPC A;  4AI6 A;  3P4S A;  2P9B A;  4EXT A;  1UX2 A;  2Q9Q D;  3SFD A;  2MAW A;  4QHO A;  2A72 A;  4JEH B;  4ZJS A;  2G0U A;  3O1I A;  2YDQ A;  3PUG A;  2X51 A;  2Y54 A;  2WZH A;  2X9Y A;  1E1H B;  3RF1 A;  2WS3 A;  5AFH A;  1Y01 A;  4HE8 A;  4UR9 A;  4N78 D;  4LFC T;  1N34 T;  3H3A A;  2HN1 A;  2DI4 A;  4PJM A;  1IBK T;  3ONX A;  1YQ4 A;  4IL4 A;  4U33 A;  5FJV A;  4ERR A;  3ZCJ A;  1D0Z A;  2K3W A;  3O1J A;  3VHL A;  2X9X A;  2LRK A;  3PUV F;  2XQ6 A;  4H9Q C;  2Y48 B;  3W15 B;  4KHZ F;  2XNV A;  1OED A;  4HQP A;  4HEA A;  1DU2 A;  3ZC0 A;  4IE6 A;  4TWD A;  3DJB A;  1FIO A;  2WZI A;  3SRZ A;  4EIW A;  2LLY A;  3KV5 A;  5EK4 A;  1XMO T;  2M6B A;  4UM1 A;  4AKH A;  3AE6 A;  4LML A;  3I9Y A;  2BKP A;  4O4J E;  3J9X 1;  4TNV A;  5KDM C;  4P1N A;  4TWF A;  1NEN A;  4GYS A;  5ABE A;  2ZJU A;  4PK6 A;  2XQY A;  4DUY T;  1D0X A;  2Y8D A;  1NWM X;  5FY0 A;  3TLU A;  4A56 A;  2QRX A;  3X1D A;  3E22 E;  4U7Y A;  2A2F X;  1MMG A;  3CQG B;  3TLS A;  1UW6 A;  4CI3 B;  2WDQ A;  1HNX T;  3CVR A;  4HGA A;  5IWA T;  4PIR A;  3AAA B;  4DR6 T;  4X62 T;  2E2A A;  2EHO D;  5FKY A;  5C3J A;  5HXH A;  3PUQ A;  2RA1 A;  4YTM A;  3ZJ1 A;  5CB4 E;  1VRB A;  2CCQ A;  2H3R A;  3OTO T;  2WU2 A;  3OYZ A;  3SOL A;  4UIG A;  2JMK A;  4X64 T;  5J2U E;  4OHF A;  2XZ6 A;  3MXZ A;  1Z0P A;  3ZT6 A;  3UU3 A;  2QC1 B;  4DND A;  4AKG A;  2VKD A;  4NZB A;  1MND A;  4IT4 A;  4B3S T;  5AQQ B;  1U5P A;  3AA1 B;  2BYR A;  2CHN A;  3TLV A;  3FBL A;  4AKR B;  5AQF B;  3OYX A;  2WNL A;  4OFZ A;  4YSY A;  4WBN E;  5JQG E;  3FB2 A;  1LRZ A;  5AFK A;  5HEH A;  3CIR A;  3LBX A;  5A1L A;  4AKI A;  3C84 A;  3P7I A;  1MMA A;  2E8I A;  4FJO A;  4EYY R;  4COF A;  5H6Q B;  1FMV A;  4AIS A;  4XBF B;  3I0O A;  3L39 A;  5ETW A;  3QK6 A;  3RQU A;  3AED A;  3L8R A;  4BQT A;  2V7L A;  4DMV A;  3AB3 B;  4DMW A;  2UUB T;  2LKH A;  3U8J A;  4H9R C;  4HWF A;  4NXM T;  4DV3 T;  1BR4 A;  2JQ9 A;  2KMF A;  3RRW A;  1D1A A;  4JI3 T;  5AQH B;  3C79 A;  1T98 A;  2OA5 A;  1XMQ T;  2RPA A;  5ABH A;  3KVA A;  4HFB A;  5L2L A;  1M62 A;  2N2N A;  2LHN A;  4ZR6 A;  2AXD S;  2Y58 A;  5M4Y A;  1L0V A;  4IE4 A;  1HS7 A;  3AA6 B;  2BBJ A;  4DR5 T;  2ACZ A;  3R84 B;  2XSA A;  3VRA A;  1ZP0 A;  5LGU B;  5KXJ A;  2X0H A;  3Q2M A;  4I4T E;  3N9N A;  4CI1 B;  1WFD A;  5AQK B;  2VL8 A;  4O2B E;  3RRC A;  4X66 T;  3TKL B;  4IE5 A;  3N5L A;  4HFD A;  2E9X D;  2XQ8 A;  4HWI B;  5HWY A;  5LJM A;  1YKE B;  3U78 A;  1IBL T;  4H9N C;  4I0U A;  1WLX A;  3AXJ A;  2X68 A;  2JQQ A;  2V6Y A;  4PJJ A;  2ZM6 T;  4U72 A;  5F5W A;  4H63 V;  2W00 A;  4XZC A;  1LVK A;  2D0T A;  1US7 B;  3AEF A;  2FJE A;  4JLE A;  2H88 A;  3UU5 A;  2UXX B;  3ZCI A;  3U3I A;  3IHR A;  2VKJ A;  3AE1 A;  1BR1 A;  2J1D G;  5AQM B;  1KF6 A;  1MIV A;  1LVF A;  4YFS A;  4L9I A;  3Q5E A;  2KIN B;  4WYV A;  2NP9 A;  4EB6 E;  2GK9 A;  4Q25 A;  3HKD E;  4AQF A;  3AE7 A;  4IDQ A;  2ODU A;  3GN5 A;  3ZYK A;  1NAF A;  5LGT B;  3N9O A;  1MMN A;  3L3P A;  5HAX A;  3O4X E;  3LK3 B;  3M3Z B;  5DAB A;  4U74 A;  2ZLY A;  4ASK A;  4DV2 T;  3QOF A;  3B13 A;  1XDO A;  2ZM2 A;  3ZST A;  3ZC1 A;  1MIY A;  2CXF A;  3AVS A;  5HXE A;  4DUZ T;  3KVB A;  2BYQ A;  4DO0 A;  2KWI B;  4GIW A;  3UUN A;  3PJA J;  5BR8 T;  3AEB A;  4ZI2 D;  3WTK A;  4TNW A;  3AAI A;  2WB5 A;  4GKJ T;  1J5W A;  3FBZ A;  4CI2 B;  5JTG A;  2W0G A;  3F2E A;  2XAF B;  1IBM T;  2NTX A;  4UM3 P;  3QC9 A;  3JAD A;  3K3O A;  1HX8 A;  4DR7 T;  3C98 B;  2C5K T;  2PJQ A;  2VWA A;  1UX4 A;  4E7Z A;  2XNU A;  3UFE A;  1E2A A;  3N9M A;  5L3D B;  2HH7 A;  4EOZ B;  5AFJ A;  1SE7 A;  1T8B A;  4YHJ A;  4L5G A;  3KFW X;  5ABF A;  4YHH T;  1D1C A;  4LF6 T;  3FHN A;  3T4M A;  2E9X C;  5J5I A;  4MFR A;  3UUM A;  3NKZ A;  3LJC A;  4WV9 A;  3UU8 A;  1J1J A;  1ZOY A;  2PTF A;  3KV6 A;  3RLF F;  3EUH A;  3P8C D;  2JJ9 A;  5FMN A;  5JVD E;  4E7S A;  1YD8 G;  2WWV A;  2VAS A;  2FJA A;  1I94 T;  4G2A A;  2FUP A;  1FEW A;  2BG9 C;  4ZK4 A;  5EZY E;  2JPF A;  4H9S E;  4WBO A;  3UTK A;  2BBH A;  2DHR A;  4V1A v;  2XHE B;  4TV8 E;  2A9U A;  4DV5 T;  3RH3 A;  3NZP A;  3RKO A;  3O1H A;  2X0Y A;  2VQE T;  1S35 A;  5FVL A;  2YME A;  1KFY A;  1MMD A;  5FY1 A;  1W9R A;  2VKO A;  2YN6 A;  2IHR 1;  3IBP A;  2XTL A;  4LF4 T;  4PNI A;  2CWY A;  1G8X A;  1UCU A;  5LHH B;  3SWH A;  1FMW A;  5KX5 E;  1ZKE A;  3AEA A;  4XHE A;  3F31 A;  2YOE A;  4AKL A;  4UM3 S;  2W8F A;  2V7J A;  4HFE A;  3F57 A;  2XY8 B;  2BS4 A;  3UUL A;  3FXE B;  2DCF A;  1I6Z A;  3RX6 A;  3Q5W A;  2ZMA A;  3U8N A;  1BR0 A;  4IST A;  1D1B A;  4I50 E;  3ZSS A;  2W66 A;  4UM3 A;  1HCI A;  3CK6 A;  4FI5 A;  4DR3 T;  5AQT B;  2YKS A;  3KDS E;  4AQG A;  3ZMT B;  2KT9 A;  3WTH A;  3LSV A;  4B6X A;  4LMJ A;  4MAL A;  4BJN A;  3T1H T;  3E0Z A;  2BKO A;  4O4L E;  3NVO A;  3RI5 A;  4GOU A;  2DL1 A;  1AJ3 A;  5LYJ E;  4X1I E;  3KV9 A;  4UF0 B;  4ZEY A;  2H7O A;  4TN7 B;  2BR7 A;  5DQV A;  2MTQ A;  5JR9 A;  3MZK B;  2VUR A;  5TAO A;  4X65 T;  4XAX B;  4CXW A;  5FL0 A;  4NUV A;  5AQS B;  5AQG B;  4BAY B;  5SYO A;  4ZZC A;  2LSY A;  4U31 A;  4QWN B;  5J2T E;  3O9X A;  1XNR T;  4CZZ B;  1UUS A;  2OV9 A;  1D0Y A;  5HYA A;  2XZ5 A;  2WAU A;  2V7I A;  3ZJ2 A;  4ILC A;  1OED E;  3RIF A;  4YLH A;  1HNW T;  4YJ2 E;  3OVU A;  5HCJ A;  4TWH A;  5LG4 A;  4UVA B;  3EDV A;  2LRL A;  1QSD A;  1MIW A;  3NZQ A;  1JNZ A;  4UV9 B;  3FZM B;  3K1S A;  2V5D A;  2UXB T;  4HN9 A;  4EZ4 A;  5CGM A;  3KBU A;  2WZY A;  5L4H A;  4EYU A;  2VK9 A;  3ZPO A;  3NRY A;  2KXP B;  3IGQ A;  5ABG A;  3ZMU B;  2XJ7 A;  4IDZ A;  2UZ6 A;  3WTO A;  3IEE A;  4FRR A;  3PUX F;  4JI7 T;  2LSI A;  3SFE A;  4WW0 A;  4OYJ A;  1GQE A;  3RIA A;  2LSG A;  5FNV E;  2BS3 A;  5L47 A;  1J5E T;  1HNZ T;  3RC3 A;  4DV0 T;  3ONL C;  3LFM A;  4IDO A;  4JI0 T;  4QH4 A;  4UVB B;  3AEE A;  3MAC A;  4YSX A;  2BVL A;  4DBM A;  5FXW A;  4TZ4 C;  2YK0 A;  5JDM A;  4QH5 A;  2VKH A;  2DWK A;  5DQW A;  3ZN0 B;  1NEK A;  2LE8 A;  2ODV A;  2C0S A;  3N9Q A;  2WWU A;  2YIN A;  2Q9Q C;  2UXD T;  4TV9 E;  5BP0 A;  2ACX A;  4ZOL E;  3WI3 A;  4KHP T;  2K24 A;  4GK5 E;  3PU3 A;  4PW8 A;  2X0L B;  4JV5 T;  1I9B A;  2IW5 B;  4DR4 T;  3AEC A;  3V5S A;  3Q5D A;  2BDE A;  4TUY E;  2KLQ A;  5HEG A;  2V7K A;  4KUM B;  4AIU A;  5CJ5 A;  5FXZ A;  2X9W A;  5H6R B;  1HTJ F;  2WNJ A;  4UEM A;  4O4H E;  4NUU A;  2UU9 T;  2V5C A;  3FXD B;  2WMN A;  3JAF A;  5AQJ B;  3SS1 A;  4IL9 A;  4C90 A;  1WYB A;  5CA0 E;  2Q9Q B;  2YDS A;  2X67 A;  2J62 A;  5LXB A;  2WQY A;  2WP9 A;  4H63 H;  3CX7 B;  2X00 A;  2K9A A;  4ZI7 E;  4EGW A;  2JQH A;  2BZB A;  1Z8U A;  3P50 A;  3PU8 A;  5AQL B;  5FYM A;  3NRX A;  3WTI A;  2XSB A;  5LMN T;  3UU4 A;  3FZH B;  3N2G E;  5LHI B;  5IHY A;  2NW7 A;  3PUA A;  4ZI3 D;  4QXB B;  4A5X A;  2FJB A;  3QNU A;  5LGN B;  1G73 A;  3ZMV B;  4CN4 A;  1YKH B;  4XK9 A;  5AQN B;  3SH1 A;  4HFI A;  4G63 A;  5AFN A;  3HKB E;  3QB5 K;  4JI5 T;  4MLK A;  3C64 A;  2I59 A;  4ILA A;  3FZL B;  4QKN A;  3RYC E;  2L8K A;  1Y64 B;  4O8S A;  1YW0 A;  4AFG A;  2EHO C;  1KK7 A;  2LM2 A;  3P4P A;  5J5G A;  4KMC A;  3UFG A;  2YDR A;  4CQI A;  2XPK A;  3UUB A;  3GUA A;  5JME A;  4IE0 A;  3BQL A;  5JDN A;  2WN9 A;  1HG5 A;  4LF8 T;  2AE9 A;  4HFV A;  4BFQ A;  2RP4 A;  2Z6E A;  3DTO A;  2F4V T;  2CXL A;  2B76 A;  2CM0 A;  5F3J A;  3RIU C; 
#chains in the Genus database with same CATH homology
 5LXB A;  4AFT A;  3WTH A;  3LSV A;  4LMJ A;  4ZR6 A;  2XYS A;  4HFH A;  3ZKR A;  2C9T A;  2X00 A;  2Y58 A;  3JAE A;  4Z90 A;  2XZ6 A;  2XQA A;  3RIA A;  2Y57 A;  3P50 A;  3RI5 A;  2BG9 B;  3UU3 A;  2QC1 B;  2XQ6 A;  5L47 A;  4HQP A;  4NPP A;  1OED A;  3EAM A;  2XNV A;  2XQ4 A;  2XQ7 A;  2PGZ A;  5LG3 A;  4QH1 A;  4TWD A;  5KE4 A;  4EZ1 A;  3WTI A;  3EI0 A;  4UY2 A;  4Z91 A;  4QH4 A;  4NZB A;  2WNC A;  2BR7 A;  2BYQ A;  3UU4 A;  4D01 A;  5J5F A;  3UU6 A;  4DBM A;  4A97 A;  2YMD A;  2VL0 A;  3WIP A;  2LLY A;  2BYR A;  4QH5 A;  3U8M A;  2M6B A;  5J5H A;  5CFB A;  2BG9 C;  3TLV A;  5CO5 A;  4QAC A;  4X5T A;  2M6I A;  4ZK4 A;  5J0Z A;  4UM1 A;  1OED C;  3WTK A;  5AFM B;  4HFD A;  2XQ5 A;  2BJ0 A;  2XQ8 A;  4TNW A;  2WNL A;  5SYO A;  4F8H A;  3RHW A;  4ZZC A;  4QAA A;  4QAB A;  5AFK A;  5HEH A;  4LML A;  3WTM A;  4XK9 A;  3PMZ A;  2BG9 A;  5BW2 A;  5L4E A;  5TVC A;  4B5D A;  4TNV A;  2X00 D;  2XQ3 A;  3SH1 A;  4HFI A;  4IRE A;  4TWF A;  5BP0 A;  5KZU A;  5AFN A;  5HEO A;  5HCM A;  5HEU A;  3C84 A;  4A98 A;  5AIN A;  2Y56 A;  2ZJU A;  2XZ5 A;  4ZRU A;  4UM3 P;  4COF A;  1UV6 A;  2YME A;  3JAD A;  3UQ7 A;  5BRX A;  4UXU A;  4ZK1 A;  3U8L A;  5AFL A;  1I9B A;  2YN6 A;  4ILC A;  2BG9 E;  4ILA A;  3RQU A;  1OED E;  3TLU A;  3RIF A;  5AFM A;  4LMK A;  3ZDH A;  1UX2 A;  3U8K A;  5HCJ A;  2MAW A;  4TWH A;  3SQ6 A;  4BQT A;  4ZJS A;  4ZJT A;  3P4W A;  3UU5 A;  3SIO A;  3WTJ A;  2XNU A;  4AFG A;  4ALX A;  3WTN A;  3TLW A;  2BYN A;  3WTL A;  2LKH A;  4XHE A;  2PH9 A;  5HEG A;  3U8J A;  2YOE A;  3TLS A;  1UW6 A;  2LM2 A;  2Y54 A;  4UM3 S;  5J5G A;  2W8F A;  2BR8 A;  2W8G A;  5AFJ A;  5HEJ A;  4HFE A;  3EHZ A;  4HFC A;  3UUB A;  2BYP A;  5AFH A;  3GUA A;  2WNJ A;  5JME A;  3RQW A;  2WZY A;  3T4M A;  5L4H A;  2ZJV A;  4ZZB A;  4PIR A;  3SQ9 A;  3U8N A;  2WN9 A;  3JAF A;  1OED B;  5J5I A;  3IGQ A;  4BFQ A;  3C79 A;  4AFH A;  3ZDG A;  4ILB A;  5IUX A;  4UM3 A;  2KSR A;  2XQ9 A;  4IL9 A;  2BYS A;  2YKS A;  2XNT A;  3UQ4 A;  2Y7Y A;  4IL4 A;  3TLT A;  4HFB A;  5FJV A;  3PEO A;  2UZ6 A;  3WTO A;  2XYT A;  4WV9 A;  3UU8 A;  2LKG A;  4FRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...