3P4WA

Structure of desflurane bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p4wA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p4wA01
5CO5A 2ZJUA 3RIAA 3RIFA 3UUBA 2XQ8A 2BYRA 3TLTA 5AFNA 3PMZA 3P4WA 2Y57A 2YKSA 2BG9A 5FJVA 2M6BA 4LMKA 4ILAA 5HEUA 1UX2A 2BYNA 5IUXA 3U8NA 2PH9A 3WTKA 5AFHA 4QH1A 5BRXA 3SQ6A 3ZDHA 5AFMA 1OEDC 5AFMB 2XQAA 4B5DA 2XNTA 2BR8A 2XYSA 4AFTA 4TWHA 2QC1B 4UXUA 5SYOA 5HEHA 2BYSA 3WTOA 4COFA 4AFHA 3LSVA 2XQ3A 4TNVA 3SQ9A 4ZJSA 5AFJA 2Y58A 2X00D 4PIRA 2ZJVA 2W8FA 4LMJA 3PEOA 2BYPA 2BG9E 5KE4A 2XQ6A 5J0ZA 2WZYA 3UU8A 2LKHA 4TNWA 5AFKA 5J5GA 3TLVA 3JAEA 4ZK1A 3EAMA 2LLYA 4BFQA 4A98A 3C84A 4IREA 4Z91A 3WTJA 3TLWA 5HCJA 4D01A 3U8JA 3RHWA 3TLSA 5HEOA 4HFCA 4XK9A 2M6IA 1OEDB 3P50A 4TWDA 4FRRA 1OEDA 2XZ5A 4BQTA 4ZZBA 4HQPA 4EZ1A 4QACA 2VL0A 2LM2A 2BYQA 2BG9C 3WTHA 4ZRUA 1UW6A 4TWFA 4QH5A 4NPPA 3ZDGA 3WTIA 5L4HA 2X00A 3RQUA 2Y7YA 5L4EA 3WTLA 2XNUA 2YN6A 1UV6A 5HCMA 3WIPA 2WN9A 5AFLA 2BR7A 4UM1A 3SIOA 5J5IA 4HFIA 4HFHA 4QABA 2XQ5A 2XQ9A 3WTMA 3EI0A 2XNVA 4UY2A 3U8LA 3EHZA 4UM3A 3ZKRA 2BJ0A 4ILBA 4Z90A 3UU3A 2Y54A 4NZBA 2MAWA 4UM3S 5HEGA 3U8KA 5KZUA 4IL4A 2XZ6A 3T4MA 3SH1A 2XQ7A 2LKGA 5BW2A 4IL9A 2XQ4A 4HFEA 3TLUA 2W8GA 3U8MA 4HFBA 4ILCA 4X5TA 2KSRA 2YOEA 3JADA 4ZZCA 5JMEA 4A97A 5CFBA 3UU4A 4ZK4A 2BG9B 5HEJA 2YMEA 4UM3P 3C79A 2Y56A 5J5HA 2YMDA 5L47A 1I9BA 2WNLA 2WNCA 5TVCA 5LG3A 3UU6A 4LMLA 4F8HA 2UZ6A 4AFGA 4ALXA 1OEDE 2C9TA 3IGQA 5J5FA 4DBMA 2XYTA 4QAAA 3UQ4A 4WV9A 4QH4A 4XHEA 4ZJTA 2WNJA 3JAFA 4ZR6A 4HFDA 3RI5A 3UU5A 3UQ7A 5AINA 5BP0A 2PGZA 5LXBA 3RQWA 3WTNA 3GUAA
chains in the Genus database with same CATH superfamily
3QB5A 2ZJUA 3QK6A 2XUEA 3MJXA 5AFNA 2Q9QB 5FJVA 3UFGA 3PUAA 5DQWA 4ZXLA 1WCRA 4QH1A 1ZP0A 2KXPB 1E2AA 3N5LA 4CN4A 4AKGA 4UXUA 4DR1T 3PUZF 2RPAA 2XSBA 2V7IA 3FZKB 3FZHB 4UELA 1VOMA 2Y58A 5JH7E 2BVMA 1MMNA 3K8PC 2V1DB 4HWHA 3UU8A 5HXSA 3PE0A 4IDNA 4Z91A 2D0UA 3Q5XA 5HEOA 3EDUA 2KMFA 3UTKA 5AQHB 3DP7A 2VL0A 3LK3B 3ZN0B 3QUJA 2FUPA 5AQIB 3IHRA 1D1CA 2WU5A 5JDLA 3A7MA 3ZEFB 3IF8B 1W9RA 5EK4A 1IJ5A 2MYSA 2XQ7A 5JR9A 4AQGA 4H9NC 2P9BA 3TLUA 1UX4A 4O8SA 1WYBA 2YOEA 1J1JA 3UU4A 4DV5T 3S4UA 1SHZC 4CQIA 5L47A 4AFGA 5LA6E 5LMUT 4AISA 4B3RT 4UF0A 4EB6E 2BKPA 3OBVE 5H6RB 5CO5A 3AAAB 3PV0F 2YKSA 2PBIA 2X0LB 3QOFA 2PTFA 2DI4A 3FZMB 3LK2B 4G63A 3ZCJA 4ZJSA 4EGWA 1HX8A 2K24A 2NW8A 3N9LA 1KF6A 1WR6A 2D2SA 3SFEA 5ABHA 2XZEA 2F4VT 2QGSA 3BQLA 3AE9A 3C84A 3AEDA 3RC3A 5JDMA 2L8KA 2CXFA 4ZI3D 3ZT7A 4X20E 1KFYA 2HH7A 3JC6D 1UW6A 2MOZA 4NPPA 3L09A 1QSDA 2CXDA 1HCIA 4JYAT 5AQSB 2LSJA 4YFSA 3ZMZB 5JRCA 4UM3A 2Y54A 4GYSA 4V1Av 4IL4A 2XZ6A 2X66A 2L9QA 5BW2A 1IJ6A 4H9QC 2VQFT 4HFBA 2VL8A 5J1GA 2KSRA 4HGAA 3GN5B 2C5KT 2CHOA 3C98B 4MFRA 2UXDT 5BR8T 3ZC0A 4DMVA 4F8HA 3QC9A 2WAUA 3AA1B 5ABEA 3UQ4A 1Y64B 4WV9A 3AA7B 2JJ9A 1XMOT 3EUHA 3RQWA 4LF5T 2X67A 1MMDA 3JCFA 5BRXA 4E7SA 5FYMA 4LFAT 3W15B 4PJMA 2ZMAA 5FXVA 4I55E 5AQTB 4IDZA 5IWAT 3O1IA 1QUUA 5J0ZA 2BZBA 3C4ZA 2V26A 4YTNA 3EAMA 3NZQA 3L8RA 3ZJ1A 2X0YA 1YQ4A 4DUZT 3P4SA 1OEDB 2NW7A 4TWDA 5AQNB 4FRRA 5LHHB 2JMHA 3M3ZB 5KDMC 5JR9B 2IDOB 3I9WA 4PK5A 5C8YE 2CWYA 3CWZB 4IE0A 4YJ2E 3PU3A 1Y01A 4KMCA 5CGMA 2LSKA 2ZM6T 1S94A 1MMAA 1W0BA 3AAEB 2X9WA 2J47A 5GONE 4WNKA 3MZKB 2W61A 4U74A 3EABA 1HNWT 2C9TA 3IGQA 4DR6T 4LFBT 4QX8B 2UXXB 1M7KA 5EK3A 2CRBA 3RGLA 3UQ7A 2ODVA 2I0MA 1IBLT 2JQ9A 4KI0F 4HWIB 3E22E 3UUBA 1VCSA 4NXNT 2JQQA 1US7B 5LJMA 5JR9C 3RX6A 2PH9A 3RF1A 4JI5T 3O1HA 3P4RA 5AFMB 3IA3A 3T1YT 5LGUB 2WDQA 4TWHA 4LF9T 2BYSA 2VKJA 3CK6A 3R6NA 3ZMVB 2W8FA 3OKQA 2BS3A 4AQFA 4ERRA 2LT3A 4DNDA 5AQRB 4JBWF 3RKGA 3WI3A 4ISSA 4JI2T 5LBQB 2LM9A 2CBJA 4HFCA 3VRBA 1W0AA 3AEAA 2YINA 4BJMA 4TWFA 4GK0E 2ACZA 2JMKA 3AE8A 2AXDS 3SIOA 4QWNB 3AB3B 3U8LA 3EHZA 3ZKRA 3ZN1B 4C90A 2E5VA 3CIRA 3ZSTA 5AQPB 4B3MT 2XM2A 5IYZE 4X5TA 4AKHA 3PUGA 4ZI2C 1BR1A 1D0XA 2CLYC 3IEEA 3N9QA 4B3TT 3HKDE 2WNCA 5TVCA 1Z8UA 4IE4A 2Y6XA 5J5FA 3KV4A 2V6YB 4QKNA 3RYFE 1S35A 2HPLA 2X9XA 4NUVA 5DQVA 1XNRT 4TZ4C 4OHFA 3L3PA 1XDOA 4U72A 2BG9A 4LMKA 2BYNA 1OEDC 3JC6C 2E9XC 2XNTA 5FL0A 2EHOA 4IE7A 4UEMA 2WBLA 4H9SE 3PU8A 1UX5A 1HR0T 1KNZA 2XQ6A 2MTQA 2DWGA 2JIWA 2C5JA 2BS2A 1UK5A 2V5CA 4ZZBA 4EZ1A 2BYQA 4HTEA 4JI8T 2ZM0A 3FB2A 5F3JA 3WTLA 3WIPA 2I6HA 5HCMA 2DL1A 1LKXA 4Z8XA 3WTMA 1IZNB 3C51A 4ILBA 2HN1A 3U8KA 3HA4A 5J2UE 4UV8B 3CX6B 3OYZA 4YLHA 4EYUA 3VU7H 3GN5A 4ZZCA 4YHHT 5JMEA 3KFWX 2H88A 1MMGA 2HHHT 5CA1E 3SWHA 4YT0A 1U4QA 5KMGP 4MBQA 1T7SA 3KV9A 1NWMX 2OA5A 4KHZF 2W4XA 4LF4T 3RYHE 3Q5EA 3PMZA 4CN6A 3ZCIA 5DJQC 3PUSA 1HS7A 2QC1B 4WYVA 2X0HA 3LK42 3RYCE 4TX5A 3UUMA 2K48A 1UUSA 2YDSA 2UXBT 5FVKA 2D9DA 5C3JA 2WZHA 3ZYKA 2N1GA 4A98A 3VHLA 3TLWA 4D01A 2IW5B 4XK9A 4YTPA 2GK9A 2X9YA 5LB7B 4DV7T 4YSZA 2LM2A 5IHYA 5HXHA 2J62A 1BR2A 2E9XA 2OV9A 2K3WA 2Q9QD 4HFIA 4QABA 2CHNA 2WDRA 3C50A 3UUXB 3UUNA 1WR0A 1YQ3A 4A5XA 3TKLB 3U3IA 2MPKA 2H7VC 4JUYA 2N9DA 2BG9B 2YMEA 3D0TA 3PURA 4ZS3A 2QVAA 2BDEA 4XHEA 2XQYA 2WB5A 3WTNA 3CKDA 3T1HT 3RIFA 4P1NA 4YTMA 3TLTA 4BA9A 3ZYLA 4ILAA 1G73A 3OPCA 1L0VA 4AFTA 3KVAA 4GYRA 3WTOA 2IIUA 2M67A 3QB5K 3PUYF 4G2AA 5FY7A 2N2NA 3LJCA 4XZCA 2ES0A 3ETVA 1OXZA 3AE3A 5FMNA 2DLRA 5LMNT 4TNWA 3KBTA 3SRZA 1BR4A 4IREA 2X9HA 4DR4T 5HWXA 2K9AA 2BKNA 4AQYT 3P50A 2LE8A 2JQKA 3HR0A 4BQTA 3RIUA 1ZV4X 3WTHA 3BQKA 1XDPA 2X68A 5L3GB 2LJLA 4DBQA 5M4YA 2PJQA 3ANWA 2WWVA 1N32T 3RPUA 2BJ0A 4PFPA 1NENA 4GIWA 3CPZA 5LHGB 2G0UA 2XQ4A 4IL9A 4AI6A 2BVLA 3K1SA 3SFDA 3AE4A 2Y56A 3R84B 4E7ZA 3BK9A 1BR0A 1HFAA 2QA7A 3I0OA 4ADZA 2LHNA 2CE7A 1HNXT 1CHUA 2H89A 3O1JA 1J5WA 4QHOA 3KINB 4HFDA 2PGZA 2BBJA 2KZ7B 2V7LA 5EK2A 3HI2A 4EAHA 3RIAA 3SS1A 5FY1A 2MBGA 3CQXC 5AFHA 4PJLA 4ZOLE 3PUXF 4EIWA 2FJAA 4ASKA 5HEHA 4COFA 3LSVA 4UF0B 1XMQT 4U31A 2YU2A 1HTJF 2KWHA 5AFJA 1MIVA 2K5BB 2IUBA 4TN7B 4JI0T 2LEHA 2UUAT 5JREA 1VCTA 5LP6E 2IC9A 4IE5A 4IT4A 2NTYA 2M6IA 1OEDA 2HPJA 2KINB 5LCYA 4DMWA 1T8BA 2BG9C 3WTIA 3HL6A 3PTRB 3T8OA 3HKBE 4DR2T 2CXLA 2BR7A 2EHOD 3FBLA 5J5IA 4UVAB 3AVSA 4UY2A 5AFUL 1SA0E 2E2AA 4NZBA 5F8PA 2LKGA 3LDQB 2NWBA 4QXBB 5HXCA 2J4GA 4IIJE 5JDNA 2V6XA 4X1YE 3F31A 3IBPA 2B76A 3C64A 1JNRA 4ZR6A 3Q9DA 5CB4E 3I0QA 5FP3A 4PW8A 4UIGA 2KNDA 3LG7A 2M6BA 3SQ6A 2A3DA 3N2GE 5AQFB 1KNPA 5JTGA 4HWDA 3AE2A 3NRYA 3C4XA 4J2CA 5L3EB 1YXRA 5ABFA 2LKHA 4EOZB 3ZJ2A 3UT5E 1U5PA 2NR4A 2XJ7A 3FHNA 1MIWA 4X1KE 2WMOA 4WBOA 4O4LE 3HKCE 2Y48B 3N2OA 2E9XB 3GWHA 2XNUA 5E0OA 3P4QA 4JV5T 4JLEA 3E08A 1X79A 3O9XA 2BS4A 3LFMA 4O4JE 2W00A 2RP4A 3P4PA 4TV8E 4L5GA 3U78A 3T4MA 4O4HE 4LFCT 2BKOA 3NKZA 4ZI3C 4K0KT 4QXCB 4I50E 3MXZA 4A97A 4CI2B 3N9NA 4CN1A 1D1BA 1HX1B 2YDRA 1VRBA 4DBMA 3FBZA 5LXBA 2D0TA 5FXXA 3AVRA 2VB6A 2CMRA 3B5MA 2XQAA 4B5DA 4EZ4A 3PJAJ 4P09A 3O4XE 5SYOA 1KEYA 1YW0A 4HFVA 3EVYA 2V5DA 2BYPA 3V5SA 5JDFA 4PFOA 2ZLYA 2WWUA 5JDGA 3H37A 4EXTA 3B57A 4H9RC 5HAXA 1AJ3A 2WSSV 5KX5E 3QNUA 2JQHA 1Z0PA 4HWFA 2JRKA 2W2UA 2E9XD 5AQMB 1I6ZA 1HG2A 4I43B 3AEEA 2WM9A 2LSGA 2XASB 5L4EA 5HXEA 3ZLIA 4L9IA 4DV2T 4UM1A 3I1AA 4DV4T 2XM1A 4OFZA 2Y8DA 2XQ9A 3B13A 3EI0A 1HF8A 1W09A 2XNVA 2WDVA 3MA9A 2MAWA 2XAHB 2CEAA 1FJGT 4K0UA 3WAJA 4FJOA 1MNDA 4ILCA 5LXTE 3GA8A 1R8IA 3UU6A 2NW9A 2ACXA 2VURA 2KWIB 5AQVB 2WNJA 3JAFA 5EZYE 4U7IA 5AINA 5FNVE 4JI4T 3RYIE 1X9BA 3M65A 4XBFB 3I9YA 4ANJA 3UFEA 3P4WA 2XPKA 3A5XA 4GOUA 4AKLA 1WRDA 5AFMA 3RIUC 4IGUA 4KX6A 4PAGA 5LGNB 2YDQA 4NXMT 4EV6A 2X00D 5LHIB 4LMJA 3PEOA 4OYKA 2Z6EA 4M1PA 3AEFA 4HEAA 3CMLA 2YU1A 2LRLA 1NEKA 4WW0A 2DCFA 5HCJA 3N2KE 3J7Yq 4ZI7E 5C2TA 4LF6T 2WQYA 3ZMUB 2UU9T 3MK7C 2W66A 5AQLB 3VRAA 4O2AE 3RC8A 4QH5A 3ZDGA 3NVOA 4YXDA 3E0ZA 4BAYB 4JI3T 2XAQB 4CZZB 5FKYA 2V7JA 3N9MA 4MALA 1WFDA 4YJ3E 1HNZT 4QXHB 5HEGA 3Q5DA 3UULA 4B3ST 4HN9A 4HFEA 4HKAA 2IC6A 4CI3B 3AXJB 5AQOB 2KT9A 1WYCA 2A2FX 1DU2A 5HYAA 3LBXA 4LMLA 4H9PC 3CQGB 2E5LT 4P0BA 1E1HB 2LSYA 2V6YA 3AEBA 4A56A 4KP3C 2UXNB 5FY0A 4X65T 4KUMB 2BYRA 4JI6T 3J9X1 2XY8B 3Q5WA 3CQCB 4U2ZA 3U8NA 1XWMA 2V7MA 3PUVF 3BQIA 3P8CD 3SQ9A 4DBRA 4EZHA 4GK5E 5HWYA 2R6GF 2DWKA 1D1AA 3ZYMA 2LRKA 2ZM2A 4JI1T 4IDOA 2XSAA 1V9DA 4KHPT 4MLKA 1XNQT 1IBKT 2VASA 2WMNA 4WZXA 3ZT5A 4DR3T 4HQPA 3N9OA 4O4IE 3RKOA 1ZKEA 4IE6A 5L4HA 2X00A 1T98A 3CVRA 3AA6B 2C0SA 2YN6A 3N9PA 4UR9A 5AFLA 3RLFF 2QYWA 3F2EA 2Q9QC 2B1EA 3AE1A 2VKDA 1IBMT 3UU3A 4B6XA 3ZPOA 4X62T 3SH1A 4AKRB 2CPTA 2W8GA 3U8MA 3KV5A 5F5WA 3ZSSA 5FVLA 5HEJA 3OJAA 2NTXA 1N34T 4AIUA 2WNLA 1I9BA 2RA1A 4ALXA 2VK9A 1OEDE 3ETUA 4HE8A 2FJEA 3ZC1A 4X66T 4BJNA 1D0ZA 2XQ8A 4IHJE 4U2YA 5L3CB 3HKEE 2XAJB 3K3NA 1J5ET 5BMVE 4N78D 2CWOA 2W67A 5H6QB 2WS3A 3RH3A 4DR5T 5L2LA 4TNVA 5AQGB 3MACA 2XTLA 2ZJVA 2YEVC 5ETWA 5KE4A 1JNZA 4TUYE 1OWAA 2BBHA 5AFKA 5J5GA 3JAEA 4OYJA 3EDVA 2X51A 4ZK1A 4DIDB 1YKHB 2V7KA 4TV9E 1FIOA 2VVNA 4H63H 3TLSA 4WBNE 3PUQA 4PNIA 4DR7T 4ZRUA 2CLYB 1LRZA 3ESLA 2JPFA 4EEBA 4DUYT 1XZYA 2W0GA 4UVCB 3OTOT 1GQEA 2FJDA 5DABA 3AE5A 4NUUA 1NAFA 2W63A 3AA0B 3OYXA 1HG5A 3KVBA 4GKKT 4CI1B 4Q25A 1E7PA 3NRXA 3KV6A 2DHRA 5FXZA 2LOPA 5CFBA 5CJ5A 4UM3P 3C79A 1SUMB 4DVDA 2PG8A 5AQQB 1CUNA 2PFVA 2V8SV 4QAAA 4QH4A 1FMWA 2HN2A 4MHCA 1O3XA 3C4WA 3FZFB 5BP0A 4UV9B 4PJNA 1IAPA 4ILUA 5HXRA 4OK0A 3AXJA 4I4TE 2Q9QA 3SOLA 5KXJA 3WTKA 3ZDHA 2BR8A 1UCUA 2UUCT 2EHOB 1T72A 1G8XA 3VR8A 2IHR1 2KLQA 3K3QC 1UGOA 5JVDE 3NBXX 4PIRA 2QRXA 5JQGE 1KK7A 5ABFB 2H3RA 2WZYA 4PK4A 5L3BB 2WZIA 3ZMTB 2LLYA 4BFQA 5AQUB 4DV0T 2YK0A 4DV3T 1ZEEA 3F57A 2L3LA 3U8JA 4GKJT 1LVKA 3MKDA 4U3CA 4P0AA 3GMIA 2DNXA 2AE9A 3RQUA 2Y7YA 1UV6A 1FEWA 2WN9A 2LSIA 2ODUA 4HFHA 3ANWB 2E8IA 4C91A 4Z90A 3ONXA 5KZUA 4OX9T 3ZMSB 4QX7B 4AQFC 2LHRA 1N33T 3AEGA 1LVFA 4H9OC 5J5HA 3LBXB 4CXWA 5LG3A 2UZ6A 1YKEB 5LOVE 4XAXB 2CBIA 3ONJA 3UU5A 5L3FB 1I94T 4CXXA 3VR9A 5JDQA 4DO0A 3DTOA 5HEUA 4ZEYA 4JEUB 1N36T 2CM0A 4L0RA 2VQET 1EZ3A 3PDYA 4YY3T 5LNKA 4YSYA 3DJBA 3P7IA 3RRWA 3TLVA 5FXWA 5FL1A 5AQKB 2W62A 3VKGA 2I59A 2XHEB 5TAOA 3WTJA 2D5UA 3RHWA 1MNEA 5CA0E 4FI5A 2XAGB 5LBMA 5LGTB 2XZ5A 3FZLB 2SPCA 4NIQA 3AE6A 3A8YC 3H3MA 4LF7T 2EHOC 2J1DG 3ZT6A 2NP9A 2IMLA 4PK6A 5A1LA 4F6RC 3NWIA 4UM3S 4AXPA 4IDQA 1KNRA 5J2TE 4U33A 4ZS2A 4O2BE 2WCAA 4ZK4A 2UXCT 3AE7A 2FBWA 2YMDA 2A9UA 2VKHA 1M62A 1WLXA 4X1IE 3FXEB 4YSXA 1FMVA 3PJAA 5JDHA 2NOXA 3RI5A 4AKIA 5ADXL 2WU2A 1UURA 2Y57A 1QLBA 1UX2A 2A72A 5IUXA 5LJNA 3V5UA 2VKOA 3ONLC 1D0YA 1MIYA 2LOSA 2XYSA 2WP9A 1B7TA 4AFHA 2XQ3A 2C5IT 4U7YA 4JI7T 2OLTA 1ZOYA 2CCQA 3FXDB 3PUWF 2BG9E 4X64T 4CXYA 5ABGA 4I0UA 3AECA 4ZHQE 1SE7A 3K3OA 3CX7B 4UXNB 2VWAA 3VKHA 4PJJA 2VVSA 5JRCB 5LYJE 4ISTA 4YHJA 4QACA 4UVBB 3OVUA 1H7CA 2CA5A 3G06A 3WAKA 3KBUA 5L3DB 2XQ5A 2ZM8A 1ZHCA 2IAKA 4JEHB 2UUBT 5LG4A 3RRCA 4LF8T 3AAIA 3JADA 3KDSE 2WY2A 1YD8G 3L39A 3NZPA 3H3AA 4DV1T 2H7OA 2FJBA 3X1DA 3CX8B 3Q2MA 3ABVA 2XYTA 4EEDA 4HWCA 4ZI2D 4ZJTA 4DV6T 4KBMB 5AQJB 2XAFB 4H63V 4EYYR 3GUAA 4IDPA
chains in the Genus database with same CATH topology
5CO5A 2ZJUA 3RIAA 3RIFA 3UUBA 2XQ8A 2BYRA 3TLTA 5AFNA 3PMZA 3P4WA 2Y57A 2YKSA 2BG9A 5FJVA 2M6BA 4LMKA 4ILAA 5HEUA 1UX2A 2BYNA 5IUXA 3U8NA 2PH9A 3WTKA 5AFHA 4QH1A 5BRXA 3SQ6A 3ZDHA 5AFMA 1OEDC 5AFMB 2XQAA 4B5DA 2XNTA 2BR8A 2XYSA 4AFTA 4TWHA 2QC1B 4UXUA 5SYOA 5HEHA 2BYSA 3WTOA 4COFA 4AFHA 3LSVA 2XQ3A 4TNVA 3SQ9A 4ZJSA 5AFJA 2Y58A 2X00D 4PIRA 2ZJVA 2W8FA 4LMJA 3PEOA 2BYPA 2BG9E 5KE4A 2XQ6A 5J0ZA 2WZYA 3UU8A 2LKHA 4TNWA 5AFKA 5J5GA 3TLVA 3JAEA 4ZK1A 3EAMA 2LLYA 4BFQA 4A98A 3C84A 4IREA 4Z91A 3WTJA 3TLWA 5HCJA 4D01A 3U8JA 3RHWA 3TLSA 5HEOA 4HFCA 4XK9A 2M6IA 1OEDB 3P50A 4TWDA 4FRRA 1OEDA 2XZ5A 4BQTA 4ZZBA 4HQPA 4EZ1A 4QACA 2VL0A 2LM2A 2BYQA 2BG9C 3WTHA 4ZRUA 1UW6A 4TWFA 4QH5A 4NPPA 3ZDGA 3WTIA 5L4HA 2X00A 3RQUA 2Y7YA 5L4EA 3WTLA 2XNUA 2YN6A 1UV6A 5HCMA 3WIPA 2WN9A 5AFLA 2BR7A 4UM1A 3SIOA 5J5IA 4HFIA 4HFHA 4QABA 2XQ5A 2XQ9A 3WTMA 3EI0A 2XNVA 4UY2A 3U8LA 3EHZA 4UM3A 3ZKRA 2BJ0A 4ILBA 4Z90A 3UU3A 2Y54A 4NZBA 2MAWA 4UM3S 5HEGA 3U8KA 5KZUA 4IL4A 2XZ6A 3T4MA 3SH1A 2XQ7A 2LKGA 5BW2A 4IL9A 2XQ4A 4HFEA 3TLUA 2W8GA 3U8MA 4HFBA 4ILCA 4X5TA 2KSRA 2YOEA 3JADA 4ZZCA 5JMEA 4A97A 5CFBA 3UU4A 4ZK4A 2BG9B 5HEJA 2YMEA 4UM3P 3C79A 2Y56A 5J5HA 2YMDA 5L47A 1I9BA 2WNLA 2WNCA 5TVCA 5LG3A 3UU6A 4LMLA 4F8HA 2UZ6A 4AFGA 4ALXA 1OEDE 2C9TA 3IGQA 5J5FA 4DBMA 2XYTA 4QAAA 3UQ4A 4WV9A 4QH4A 4XHEA 4ZJTA 2WNJA 3JAFA 4ZR6A 4HFDA 3RI5A 3UU5A 3UQ7A 5AINA 5BP0A 2PGZA 5LXBA 3RQWA 3WTNA 3GUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CO5 A;  2ZJU A;  3RIA A;  3RIF A;  3UUB A;  2XQ8 A;  2BYR A;  3TLT A;  5AFN A;  3PMZ A;  3P4W A;  2Y57 A;  2YKS A;  2BG9 A;  5FJV A;  2M6B A;  4LMK A;  4ILA A;  5HEU A;  1UX2 A;  2BYN A;  5IUX A;  3U8N A;  2PH9 A;  3WTK A;  5AFH A;  4QH1 A;  5BRX A;  3SQ6 A;  3ZDH A;  5AFM A;  1OED C;  5AFM B;  2XQA A;  4B5D A;  2XNT A;  2BR8 A;  2XYS A;  4AFT A;  4TWH A;  2QC1 B;  4UXU A;  5SYO A;  5HEH A;  2BYS A;  3WTO A;  4COF A;  4AFH A;  3LSV A;  2XQ3 A;  4TNV A;  3SQ9 A;  4ZJS A;  5AFJ A;  2Y58 A;  2X00 D;  4PIR A;  2ZJV A;  2W8F A;  4LMJ A;  3PEO A;  2BYP A;  2BG9 E;  5KE4 A;  2XQ6 A;  5J0Z A;  2WZY A;  3UU8 A;  2LKH A;  4TNW A;  5AFK A;  5J5G A;  3TLV A;  3JAE A;  4ZK1 A;  3EAM A;  2LLY A;  4BFQ A;  4A98 A;  3C84 A;  4IRE A;  4Z91 A;  3WTJ A;  3TLW A;  5HCJ A;  4D01 A;  3U8J A;  3RHW A;  3TLS A;  5HEO A;  4HFC A;  4XK9 A;  2M6I A;  1OED B;  3P50 A;  4TWD A;  4FRR A;  1OED A;  2XZ5 A;  4BQT A;  4ZZB A;  4HQP A;  4EZ1 A;  4QAC A;  2VL0 A;  2LM2 A;  2BYQ A;  2BG9 C;  3WTH A;  4ZRU A;  1UW6 A;  4TWF A;  4QH5 A;  4NPP A;  3ZDG A;  3WTI A;  5L4H A;  2X00 A;  3RQU A;  2Y7Y A;  5L4E A;  3WTL A;  2XNU A;  2YN6 A;  1UV6 A;  5HCM A;  3WIP A;  2WN9 A;  5AFL A;  2BR7 A;  4UM1 A;  3SIO A;  5J5I A;  4HFI A;  4HFH A;  4QAB A;  2XQ5 A;  2XQ9 A;  3WTM A;  3EI0 A;  2XNV A;  4UY2 A;  3U8L A;  3EHZ A;  4UM3 A;  3ZKR A;  2BJ0 A;  4ILB A;  4Z90 A;  3UU3 A;  2Y54 A;  4NZB A;  2MAW A;  4UM3 S;  5HEG A;  3U8K A;  5KZU A;  4IL4 A;  2XZ6 A;  3T4M A;  3SH1 A;  2XQ7 A;  2LKG A;  5BW2 A;  4IL9 A;  2XQ4 A;  4HFE A;  3TLU A;  2W8G A;  3U8M A;  4HFB A;  4ILC A;  4X5T A;  2KSR A;  2YOE A;  3JAD A;  4ZZC A;  5JME A;  4A97 A;  5CFB A;  3UU4 A;  4ZK4 A;  2BG9 B;  5HEJ A;  2YME A;  4UM3 P;  3C79 A;  2Y56 A;  5J5H A;  2YMD A;  5L47 A;  1I9B A;  2WNL A;  2WNC A;  5TVC A;  5LG3 A;  3UU6 A;  4LML A;  4F8H A;  2UZ6 A;  4AFG A;  4ALX A;  1OED E;  2C9T A;  3IGQ A;  5J5F A;  4DBM A;  2XYT A;  4QAA A;  3UQ4 A;  4WV9 A;  4QH4 A;  4XHE A;  4ZJT A;  2WNJ A;  3JAF A;  4ZR6 A;  4HFD A;  3RI5 A;  3UU5 A;  3UQ7 A;  5AIN A;  5BP0 A;  2PGZ A;  5LXB A;  3RQW A;  3WTN A;  3GUA A; 
#chains in the Genus database with same CATH topology
 3QB5 A;  2ZJU A;  3QK6 A;  2XUE A;  3MJX A;  5AFN A;  2Q9Q B;  5FJV A;  3UFG A;  3PUA A;  5DQW A;  4ZXL A;  1WCR A;  4QH1 A;  1ZP0 A;  2KXP B;  1E2A A;  3N5L A;  4CN4 A;  4AKG A;  4UXU A;  4DR1 T;  3PUZ F;  2RPA A;  2XSB A;  2V7I A;  3FZK B;  3FZH B;  4UEL A;  1VOM A;  2Y58 A;  5JH7 E;  2BVM A;  1MMN A;  3K8P C;  2V1D B;  4HWH A;  3UU8 A;  5HXS A;  3PE0 A;  4IDN A;  4Z91 A;  2D0U A;  3Q5X A;  5HEO A;  3EDU A;  2KMF A;  3UTK A;  5AQH B;  3DP7 A;  2VL0 A;  3LK3 B;  3ZN0 B;  3QUJ A;  2FUP A;  5AQI B;  3IHR A;  1D1C A;  2WU5 A;  5JDL A;  3A7M A;  3ZEF B;  3IF8 B;  1W9R A;  5EK4 A;  1IJ5 A;  2MYS A;  2XQ7 A;  5JR9 A;  4AQG A;  4H9N C;  2P9B A;  3TLU A;  1UX4 A;  4O8S A;  1WYB A;  2YOE A;  1J1J A;  3UU4 A;  4DV5 T;  3S4U A;  1SHZ C;  4CQI A;  5L47 A;  4AFG A;  5LA6 E;  5LMU T;  4AIS A;  4B3R T;  4UF0 A;  4EB6 E;  2BKP A;  3OBV E;  5H6R B;  5CO5 A;  3AAA B;  3PV0 F;  2YKS A;  2PBI A;  2X0L B;  3QOF A;  2PTF A;  2DI4 A;  3FZM B;  3LK2 B;  4G63 A;  3ZCJ A;  4ZJS A;  4EGW A;  1HX8 A;  2K24 A;  2NW8 A;  3N9L A;  1KF6 A;  1WR6 A;  2D2S A;  3SFE A;  5ABH A;  2XZE A;  2F4V T;  2QGS A;  3BQL A;  3AE9 A;  3C84 A;  3AED A;  3RC3 A;  5JDM A;  2L8K A;  2CXF A;  4ZI3 D;  3ZT7 A;  4X20 E;  1KFY A;  2HH7 A;  3JC6 D;  1UW6 A;  2MOZ A;  4NPP A;  3L09 A;  1QSD A;  2CXD A;  1HCI A;  4JYA T;  5AQS B;  2LSJ A;  4YFS A;  3ZMZ B;  5JRC A;  4UM3 A;  2Y54 A;  4GYS A;  4V1A v;  4IL4 A;  2XZ6 A;  2X66 A;  2L9Q A;  5BW2 A;  1IJ6 A;  4H9Q C;  2VQF T;  4HFB A;  2VL8 A;  5J1G A;  2KSR A;  4HGA A;  3GN5 B;  2C5K T;  2CHO A;  3C98 B;  4MFR A;  2UXD T;  5BR8 T;  3ZC0 A;  4DMV A;  4F8H A;  3QC9 A;  2WAU A;  3AA1 B;  5ABE A;  3UQ4 A;  1Y64 B;  4WV9 A;  3AA7 B;  2JJ9 A;  1XMO T;  3EUH A;  3RQW A;  4LF5 T;  2X67 A;  1MMD A;  3JCF A;  5BRX A;  4E7S A;  5FYM A;  4LFA T;  3W15 B;  4PJM A;  2ZMA A;  5FXV A;  4I55 E;  5AQT B;  4IDZ A;  5IWA T;  3O1I A;  1QUU A;  5J0Z A;  2BZB A;  3C4Z A;  2V26 A;  4YTN A;  3EAM A;  3NZQ A;  3L8R A;  3ZJ1 A;  2X0Y A;  1YQ4 A;  4DUZ T;  3P4S A;  1OED B;  2NW7 A;  4TWD A;  5AQN B;  4FRR A;  5LHH B;  2JMH A;  3M3Z B;  5KDM C;  5JR9 B;  2IDO B;  3I9W A;  4PK5 A;  5C8Y E;  2CWY A;  3CWZ B;  4IE0 A;  4YJ2 E;  3PU3 A;  1Y01 A;  4KMC A;  5CGM A;  2LSK A;  2ZM6 T;  1S94 A;  1MMA A;  1W0B A;  3AAE B;  2X9W A;  2J47 A;  5GON E;  4WNK A;  3MZK B;  2W61 A;  4U74 A;  3EAB A;  1HNW T;  2C9T A;  3IGQ A;  4DR6 T;  4LFB T;  4QX8 B;  2UXX B;  1M7K A;  5EK3 A;  2CRB A;  3RGL A;  3UQ7 A;  2ODV A;  2I0M A;  1IBL T;  2JQ9 A;  4KI0 F;  4HWI B;  3E22 E;  3UUB A;  1VCS A;  4NXN T;  2JQQ A;  1US7 B;  5LJM A;  5JR9 C;  3RX6 A;  2PH9 A;  3RF1 A;  4JI5 T;  3O1H A;  3P4R A;  5AFM B;  3IA3 A;  3T1Y T;  5LGU B;  2WDQ A;  4TWH A;  4LF9 T;  2BYS A;  2VKJ A;  3CK6 A;  3R6N A;  3ZMV B;  2W8F A;  3OKQ A;  2BS3 A;  4AQF A;  4ERR A;  2LT3 A;  4DND A;  5AQR B;  4JBW F;  3RKG A;  3WI3 A;  4ISS A;  4JI2 T;  5LBQ B;  2LM9 A;  2CBJ A;  4HFC A;  3VRB A;  1W0A A;  3AEA A;  2YIN A;  4BJM A;  4TWF A;  4GK0 E;  2ACZ A;  2JMK A;  3AE8 A;  2AXD S;  3SIO A;  4QWN B;  3AB3 B;  3U8L A;  3EHZ A;  3ZKR A;  3ZN1 B;  4C90 A;  2E5V A;  3CIR A;  3ZST A;  5AQP B;  4B3M T;  2XM2 A;  5IYZ E;  4X5T A;  4AKH A;  3PUG A;  4ZI2 C;  1BR1 A;  1D0X A;  2CLY C;  3IEE A;  3N9Q A;  4B3T T;  3HKD E;  2WNC A;  5TVC A;  1Z8U A;  4IE4 A;  2Y6X A;  5J5F A;  3KV4 A;  2V6Y B;  4QKN A;  3RYF E;  1S35 A;  2HPL A;  2X9X A;  4NUV A;  5DQV A;  1XNR T;  4TZ4 C;  4OHF A;  3L3P A;  1XDO A;  4U72 A;  2BG9 A;  4LMK A;  2BYN A;  1OED C;  3JC6 C;  2E9X C;  2XNT A;  5FL0 A;  2EHO A;  4IE7 A;  4UEM A;  2WBL A;  4H9S E;  3PU8 A;  1UX5 A;  1HR0 T;  1KNZ A;  2XQ6 A;  2MTQ A;  2DWG A;  2JIW A;  2C5J A;  2BS2 A;  1UK5 A;  2V5C A;  4ZZB A;  4EZ1 A;  2BYQ A;  4HTE A;  4JI8 T;  2ZM0 A;  3FB2 A;  5F3J A;  3WTL A;  3WIP A;  2I6H A;  5HCM A;  2DL1 A;  1LKX A;  4Z8X A;  3WTM A;  1IZN B;  3C51 A;  4ILB A;  2HN1 A;  3U8K A;  3HA4 A;  5J2U E;  4UV8 B;  3CX6 B;  3OYZ A;  4YLH A;  4EYU A;  3VU7 H;  3GN5 A;  4ZZC A;  4YHH T;  5JME A;  3KFW X;  2H88 A;  1MMG A;  2HHH T;  5CA1 E;  3SWH A;  4YT0 A;  1U4Q A;  5KMG P;  4MBQ A;  1T7S A;  3KV9 A;  1NWM X;  2OA5 A;  4KHZ F;  2W4X A;  4LF4 T;  3RYH E;  3Q5E A;  3PMZ A;  4CN6 A;  3ZCI A;  5DJQ C;  3PUS A;  1HS7 A;  2QC1 B;  4WYV A;  2X0H A;  3LK4 2;  3RYC E;  4TX5 A;  3UUM A;  2K48 A;  1UUS A;  2YDS A;  2UXB T;  5FVK A;  2D9D A;  5C3J A;  2WZH A;  3ZYK A;  2N1G A;  4A98 A;  3VHL A;  3TLW A;  4D01 A;  2IW5 B;  4XK9 A;  4YTP A;  2GK9 A;  2X9Y A;  5LB7 B;  4DV7 T;  4YSZ A;  2LM2 A;  5IHY A;  5HXH A;  2J62 A;  1BR2 A;  2E9X A;  2OV9 A;  2K3W A;  2Q9Q D;  4HFI A;  4QAB A;  2CHN A;  2WDR A;  3C50 A;  3UUX B;  3UUN A;  1WR0 A;  1YQ3 A;  4A5X A;  3TKL B;  3U3I A;  2MPK A;  2H7V C;  4JUY A;  2N9D A;  2BG9 B;  2YME A;  3D0T A;  3PUR A;  4ZS3 A;  2QVA A;  2BDE A;  4XHE A;  2XQY A;  2WB5 A;  3WTN A;  3CKD A;  3T1H T;  3RIF A;  4P1N A;  4YTM A;  3TLT A;  4BA9 A;  3ZYL A;  4ILA A;  1G73 A;  3OPC A;  1L0V A;  4AFT A;  3KVA A;  4GYR A;  3WTO A;  2IIU A;  2M67 A;  3QB5 K;  3PUY F;  4G2A A;  5FY7 A;  2N2N A;  3LJC A;  4XZC A;  2ES0 A;  3ETV A;  1OXZ A;  3AE3 A;  5FMN A;  2DLR A;  5LMN T;  4TNW A;  3KBT A;  3SRZ A;  1BR4 A;  4IRE A;  2X9H A;  4DR4 T;  5HWX A;  2K9A A;  2BKN A;  4AQY T;  3P50 A;  2LE8 A;  2JQK A;  3HR0 A;  4BQT A;  3RIU A;  1ZV4 X;  3WTH A;  3BQK A;  1XDP A;  2X68 A;  5L3G B;  2LJL A;  4DBQ A;  5M4Y A;  2PJQ A;  3ANW A;  2WWV A;  1N32 T;  3RPU A;  2BJ0 A;  4PFP A;  1NEN A;  4GIW A;  3CPZ A;  5LHG B;  2G0U A;  2XQ4 A;  4IL9 A;  4AI6 A;  2BVL A;  3K1S A;  3SFD A;  3AE4 A;  2Y56 A;  3R84 B;  4E7Z A;  3BK9 A;  1BR0 A;  1HFA A;  2QA7 A;  3I0O A;  4ADZ A;  2LHN A;  2CE7 A;  1HNX T;  1CHU A;  2H89 A;  3O1J A;  1J5W A;  4QHO A;  3KIN B;  4HFD A;  2PGZ A;  2BBJ A;  2KZ7 B;  2V7L A;  5EK2 A;  3HI2 A;  4EAH A;  3RIA A;  3SS1 A;  5FY1 A;  2MBG A;  3CQX C;  5AFH A;  4PJL A;  4ZOL E;  3PUX F;  4EIW A;  2FJA A;  4ASK A;  5HEH A;  4COF A;  3LSV A;  4UF0 B;  1XMQ T;  4U31 A;  2YU2 A;  1HTJ F;  2KWH A;  5AFJ A;  1MIV A;  2K5B B;  2IUB A;  4TN7 B;  4JI0 T;  2LEH A;  2UUA T;  5JRE A;  1VCT A;  5LP6 E;  2IC9 A;  4IE5 A;  4IT4 A;  2NTY A;  2M6I A;  1OED A;  2HPJ A;  2KIN B;  5LCY A;  4DMW A;  1T8B A;  2BG9 C;  3WTI A;  3HL6 A;  3PTR B;  3T8O A;  3HKB E;  4DR2 T;  2CXL A;  2BR7 A;  2EHO D;  3FBL A;  5J5I A;  4UVA B;  3AVS A;  4UY2 A;  5AFU L;  1SA0 E;  2E2A A;  4NZB A;  5F8P A;  2LKG A;  3LDQ B;  2NWB A;  4QXB B;  5HXC A;  2J4G A;  4IIJ E;  5JDN A;  2V6X A;  4X1Y E;  3F31 A;  3IBP A;  2B76 A;  3C64 A;  1JNR A;  4ZR6 A;  3Q9D A;  5CB4 E;  3I0Q A;  5FP3 A;  4PW8 A;  4UIG A;  2KND A;  3LG7 A;  2M6B A;  3SQ6 A;  2A3D A;  3N2G E;  5AQF B;  1KNP A;  5JTG A;  4HWD A;  3AE2 A;  3NRY A;  3C4X A;  4J2C A;  5L3E B;  1YXR A;  5ABF A;  2LKH A;  4EOZ B;  3ZJ2 A;  3UT5 E;  1U5P A;  2NR4 A;  2XJ7 A;  3FHN A;  1MIW A;  4X1K E;  2WMO A;  4WBO A;  4O4L E;  3HKC E;  2Y48 B;  3N2O A;  2E9X B;  3GWH A;  2XNU A;  5E0O A;  3P4Q A;  4JV5 T;  4JLE A;  3E08 A;  1X79 A;  3O9X A;  2BS4 A;  3LFM A;  4O4J E;  2W00 A;  2RP4 A;  3P4P A;  4TV8 E;  4L5G A;  3U78 A;  3T4M A;  4O4H E;  4LFC T;  2BKO A;  3NKZ A;  4ZI3 C;  4K0K T;  4QXC B;  4I50 E;  3MXZ A;  4A97 A;  4CI2 B;  3N9N A;  4CN1 A;  1D1B A;  1HX1 B;  2YDR A;  1VRB A;  4DBM A;  3FBZ A;  5LXB A;  2D0T A;  5FXX A;  3AVR A;  2VB6 A;  2CMR A;  3B5M A;  2XQA A;  4B5D A;  4EZ4 A;  3PJA J;  4P09 A;  3O4X E;  5SYO A;  1KEY A;  1YW0 A;  4HFV A;  3EVY A;  2V5D A;  2BYP A;  3V5S A;  5JDF A;  4PFO A;  2ZLY A;  2WWU A;  5JDG A;  3H37 A;  4EXT A;  3B57 A;  4H9R C;  5HAX A;  1AJ3 A;  2WSS V;  5KX5 E;  3QNU A;  2JQH A;  1Z0P A;  4HWF A;  2JRK A;  2W2U A;  2E9X D;  5AQM B;  1I6Z A;  1HG2 A;  4I43 B;  3AEE A;  2WM9 A;  2LSG A;  2XAS B;  5L4E A;  5HXE A;  3ZLI A;  4L9I A;  4DV2 T;  4UM1 A;  3I1A A;  4DV4 T;  2XM1 A;  4OFZ A;  2Y8D A;  2XQ9 A;  3B13 A;  3EI0 A;  1HF8 A;  1W09 A;  2XNV A;  2WDV A;  3MA9 A;  2MAW A;  2XAH B;  2CEA A;  1FJG T;  4K0U A;  3WAJ A;  4FJO A;  1MND A;  4ILC A;  5LXT E;  3GA8 A;  1R8I A;  3UU6 A;  2NW9 A;  2ACX A;  2VUR A;  2KWI B;  5AQV B;  2WNJ A;  3JAF A;  5EZY E;  4U7I A;  5AIN A;  5FNV E;  4JI4 T;  3RYI E;  1X9B A;  3M65 A;  4XBF B;  3I9Y A;  4ANJ A;  3UFE A;  3P4W A;  2XPK A;  3A5X A;  4GOU A;  4AKL A;  1WRD A;  5AFM A;  3RIU C;  4IGU A;  4KX6 A;  4PAG A;  5LGN B;  2YDQ A;  4NXM T;  4EV6 A;  2X00 D;  5LHI B;  4LMJ A;  3PEO A;  4OYK A;  2Z6E A;  4M1P A;  3AEF A;  4HEA A;  3CML A;  2YU1 A;  2LRL A;  1NEK A;  4WW0 A;  2DCF A;  5HCJ A;  3N2K E;  3J7Y q;  4ZI7 E;  5C2T A;  4LF6 T;  2WQY A;  3ZMU B;  2UU9 T;  3MK7 C;  2W66 A;  5AQL B;  3VRA A;  4O2A E;  3RC8 A;  4QH5 A;  3ZDG A;  3NVO A;  4YXD A;  3E0Z A;  4BAY B;  4JI3 T;  2XAQ B;  4CZZ B;  5FKY A;  2V7J A;  3N9M A;  4MAL A;  1WFD A;  4YJ3 E;  1HNZ T;  4QXH B;  5HEG A;  3Q5D A;  3UUL A;  4B3S T;  4HN9 A;  4HFE A;  4HKA A;  2IC6 A;  4CI3 B;  3AXJ B;  5AQO B;  2KT9 A;  1WYC A;  2A2F X;  1DU2 A;  5HYA A;  3LBX A;  4LML A;  4H9P C;  3CQG B;  2E5L T;  4P0B A;  1E1H B;  2LSY A;  2V6Y A;  3AEB A;  4A56 A;  4KP3 C;  2UXN B;  5FY0 A;  4X65 T;  4KUM B;  2BYR A;  4JI6 T;  3J9X 1;  2XY8 B;  3Q5W A;  3CQC B;  4U2Z A;  3U8N A;  1XWM A;  2V7M A;  3PUV F;  3BQI A;  3P8C D;  3SQ9 A;  4DBR A;  4EZH A;  4GK5 E;  5HWY A;  2R6G F;  2DWK A;  1D1A A;  3ZYM A;  2LRK A;  2ZM2 A;  4JI1 T;  4IDO A;  2XSA A;  1V9D A;  4KHP T;  4MLK A;  1XNQ T;  1IBK T;  2VAS A;  2WMN A;  4WZX A;  3ZT5 A;  4DR3 T;  4HQP A;  3N9O A;  4O4I E;  3RKO A;  1ZKE A;  4IE6 A;  5L4H A;  2X00 A;  1T98 A;  3CVR A;  3AA6 B;  2C0S A;  2YN6 A;  3N9P A;  4UR9 A;  5AFL A;  3RLF F;  2QYW A;  3F2E A;  2Q9Q C;  2B1E A;  3AE1 A;  2VKD A;  1IBM T;  3UU3 A;  4B6X A;  3ZPO A;  4X62 T;  3SH1 A;  4AKR B;  2CPT A;  2W8G A;  3U8M A;  3KV5 A;  5F5W A;  3ZSS A;  5FVL A;  5HEJ A;  3OJA A;  2NTX A;  1N34 T;  4AIU A;  2WNL A;  1I9B A;  2RA1 A;  4ALX A;  2VK9 A;  1OED E;  3ETU A;  4HE8 A;  2FJE A;  3ZC1 A;  4X66 T;  4BJN A;  1D0Z A;  2XQ8 A;  4IHJ E;  4U2Y A;  5L3C B;  3HKE E;  2XAJ B;  3K3N A;  1J5E T;  5BMV E;  4N78 D;  2CWO A;  2W67 A;  5H6Q B;  2WS3 A;  3RH3 A;  4DR5 T;  5L2L A;  4TNV A;  5AQG B;  3MAC A;  2XTL A;  2ZJV A;  2YEV C;  5ETW A;  5KE4 A;  1JNZ A;  4TUY E;  1OWA A;  2BBH A;  5AFK A;  5J5G A;  3JAE A;  4OYJ A;  3EDV A;  2X51 A;  4ZK1 A;  4DID B;  1YKH B;  2V7K A;  4TV9 E;  1FIO A;  2VVN A;  4H63 H;  3TLS A;  4WBN E;  3PUQ A;  4PNI A;  4DR7 T;  4ZRU A;  2CLY B;  1LRZ A;  3ESL A;  2JPF A;  4EEB A;  4DUY T;  1XZY A;  2W0G A;  4UVC B;  3OTO T;  1GQE A;  2FJD A;  5DAB A;  3AE5 A;  4NUU A;  1NAF A;  2W63 A;  3AA0 B;  3OYX A;  1HG5 A;  3KVB A;  4GKK T;  4CI1 B;  4Q25 A;  1E7P A;  3NRX A;  3KV6 A;  2DHR A;  5FXZ A;  2LOP A;  5CFB A;  5CJ5 A;  4UM3 P;  3C79 A;  1SUM B;  4DVD A;  2PG8 A;  5AQQ B;  1CUN A;  2PFV A;  2V8S V;  4QAA A;  4QH4 A;  1FMW A;  2HN2 A;  4MHC A;  1O3X A;  3C4W A;  3FZF B;  5BP0 A;  4UV9 B;  4PJN A;  1IAP A;  4ILU A;  5HXR A;  4OK0 A;  3AXJ A;  4I4T E;  2Q9Q A;  3SOL A;  5KXJ A;  3WTK A;  3ZDH A;  2BR8 A;  1UCU A;  2UUC T;  2EHO B;  1T72 A;  1G8X A;  3VR8 A;  2IHR 1;  2KLQ A;  3K3Q C;  1UGO A;  5JVD E;  3NBX X;  4PIR A;  2QRX A;  5JQG E;  1KK7 A;  5ABF B;  2H3R A;  2WZY A;  4PK4 A;  5L3B B;  2WZI A;  3ZMT B;  2LLY A;  4BFQ A;  5AQU B;  4DV0 T;  2YK0 A;  4DV3 T;  1ZEE A;  3F57 A;  2L3L A;  3U8J A;  4GKJ T;  1LVK A;  3MKD A;  4U3C A;  4P0A A;  3GMI A;  2DNX A;  2AE9 A;  3RQU A;  2Y7Y A;  1UV6 A;  1FEW A;  2WN9 A;  2LSI A;  2ODU A;  4HFH A;  3ANW B;  2E8I A;  4C91 A;  4Z90 A;  3ONX A;  5KZU A;  4OX9 T;  3ZMS B;  4QX7 B;  4AQF C;  2LHR A;  1N33 T;  3AEG A;  1LVF A;  4H9O C;  5J5H A;  3LBX B;  4CXW A;  5LG3 A;  2UZ6 A;  1YKE B;  5LOV E;  4XAX B;  2CBI A;  3ONJ A;  3UU5 A;  5L3F B;  1I94 T;  4CXX A;  3VR9 A;  5JDQ A;  4DO0 A;  3DTO A;  5HEU A;  4ZEY A;  4JEU B;  1N36 T;  2CM0 A;  4L0R A;  2VQE T;  1EZ3 A;  3PDY A;  4YY3 T;  5LNK A;  4YSY A;  3DJB A;  3P7I A;  3RRW A;  3TLV A;  5FXW A;  5FL1 A;  5AQK B;  2W62 A;  3VKG A;  2I59 A;  2XHE B;  5TAO A;  3WTJ A;  2D5U A;  3RHW A;  1MNE A;  5CA0 E;  4FI5 A;  2XAG B;  5LBM A;  5LGT B;  2XZ5 A;  3FZL B;  2SPC A;  4NIQ A;  3AE6 A;  3A8Y C;  3H3M A;  4LF7 T;  2EHO C;  2J1D G;  3ZT6 A;  2NP9 A;  2IML A;  4PK6 A;  5A1L A;  4F6R C;  3NWI A;  4UM3 S;  4AXP A;  4IDQ A;  1KNR A;  5J2T E;  4U33 A;  4ZS2 A;  4O2B E;  2WCA A;  4ZK4 A;  2UXC T;  3AE7 A;  2FBW A;  2YMD A;  2A9U A;  2VKH A;  1M62 A;  1WLX A;  4X1I E;  3FXE B;  4YSX A;  1FMV A;  3PJA A;  5JDH A;  2NOX A;  3RI5 A;  4AKI A;  5ADX L;  2WU2 A;  1UUR A;  2Y57 A;  1QLB A;  1UX2 A;  2A72 A;  5IUX A;  5LJN A;  3V5U A;  2VKO A;  3ONL C;  1D0Y A;  1MIY A;  2LOS A;  2XYS A;  2WP9 A;  1B7T A;  4AFH A;  2XQ3 A;  2C5I T;  4U7Y A;  4JI7 T;  2OLT A;  1ZOY A;  2CCQ A;  3FXD B;  3PUW F;  2BG9 E;  4X64 T;  4CXY A;  5ABG A;  4I0U A;  3AEC A;  4ZHQ E;  1SE7 A;  3K3O A;  3CX7 B;  4UXN B;  2VWA A;  3VKH A;  4PJJ A;  2VVS A;  5JRC B;  5LYJ E;  4IST A;  4YHJ A;  4QAC A;  4UVB B;  3OVU A;  1H7C A;  2CA5 A;  3G06 A;  3WAK A;  3KBU A;  5L3D B;  2XQ5 A;  2ZM8 A;  1ZHC A;  2IAK A;  4JEH B;  2UUB T;  5LG4 A;  3RRC A;  4LF8 T;  3AAI A;  3JAD A;  3KDS E;  2WY2 A;  1YD8 G;  3L39 A;  3NZP A;  3H3A A;  4DV1 T;  2H7O A;  2FJB A;  3X1D A;  3CX8 B;  3Q2M A;  3ABV A;  2XYT A;  4EED A;  4HWC A;  4ZI2 D;  4ZJT A;  4DV6 T;  4KBM B;  5AQJ B;  2XAF B;  4H63 V;  4EYY R;  3GUA A;  4IDP A; 
#chains in the Genus database with same CATH homology
 5CO5 A;  2ZJU A;  3RIA A;  3RIF A;  3UUB A;  2XQ8 A;  2BYR A;  3TLT A;  5AFN A;  3PMZ A;  3P4W A;  2Y57 A;  2YKS A;  2BG9 A;  5FJV A;  2M6B A;  4LMK A;  4ILA A;  5HEU A;  1UX2 A;  2BYN A;  5IUX A;  3U8N A;  2PH9 A;  3WTK A;  5AFH A;  4QH1 A;  5BRX A;  3SQ6 A;  3ZDH A;  5AFM A;  1OED C;  5AFM B;  2XQA A;  4B5D A;  2XNT A;  2BR8 A;  2XYS A;  4AFT A;  4TWH A;  2QC1 B;  4UXU A;  5SYO A;  5HEH A;  2BYS A;  3WTO A;  4COF A;  4AFH A;  3LSV A;  2XQ3 A;  4TNV A;  3SQ9 A;  4ZJS A;  5AFJ A;  2Y58 A;  2X00 D;  4PIR A;  2ZJV A;  2W8F A;  4LMJ A;  3PEO A;  2BYP A;  2BG9 E;  5KE4 A;  2XQ6 A;  5J0Z A;  2WZY A;  3UU8 A;  2LKH A;  4TNW A;  5AFK A;  5J5G A;  3TLV A;  3JAE A;  4ZK1 A;  3EAM A;  2LLY A;  4BFQ A;  4A98 A;  3C84 A;  4IRE A;  4Z91 A;  3WTJ A;  3TLW A;  5HCJ A;  4D01 A;  3U8J A;  3RHW A;  3TLS A;  5HEO A;  4HFC A;  4XK9 A;  2M6I A;  1OED B;  3P50 A;  4TWD A;  4FRR A;  1OED A;  2XZ5 A;  4BQT A;  4ZZB A;  4HQP A;  4EZ1 A;  4QAC A;  2VL0 A;  2LM2 A;  2BYQ A;  2BG9 C;  3WTH A;  4ZRU A;  1UW6 A;  4TWF A;  4QH5 A;  4NPP A;  3ZDG A;  3WTI A;  5L4H A;  2X00 A;  3RQU A;  2Y7Y A;  5L4E A;  3WTL A;  2XNU A;  2YN6 A;  1UV6 A;  5HCM A;  3WIP A;  2WN9 A;  5AFL A;  2BR7 A;  4UM1 A;  3SIO A;  5J5I A;  4HFI A;  4HFH A;  4QAB A;  2XQ5 A;  2XQ9 A;  3WTM A;  3EI0 A;  2XNV A;  4UY2 A;  3U8L A;  3EHZ A;  4UM3 A;  3ZKR A;  2BJ0 A;  4ILB A;  4Z90 A;  3UU3 A;  2Y54 A;  4NZB A;  2MAW A;  4UM3 S;  5HEG A;  3U8K A;  5KZU A;  4IL4 A;  2XZ6 A;  3T4M A;  3SH1 A;  2XQ7 A;  2LKG A;  5BW2 A;  4IL9 A;  2XQ4 A;  4HFE A;  3TLU A;  2W8G A;  3U8M A;  4HFB A;  4ILC A;  4X5T A;  2KSR A;  2YOE A;  3JAD A;  4ZZC A;  5JME A;  4A97 A;  5CFB A;  3UU4 A;  4ZK4 A;  2BG9 B;  5HEJ A;  2YME A;  4UM3 P;  3C79 A;  2Y56 A;  5J5H A;  2YMD A;  5L47 A;  1I9B A;  2WNL A;  2WNC A;  5TVC A;  5LG3 A;  3UU6 A;  4LML A;  4F8H A;  2UZ6 A;  4AFG A;  4ALX A;  1OED E;  2C9T A;  3IGQ A;  5J5F A;  4DBM A;  2XYT A;  4QAA A;  3UQ4 A;  4WV9 A;  4QH4 A;  4XHE A;  4ZJT A;  2WNJ A;  3JAF A;  4ZR6 A;  4HFD A;  3RI5 A;  3UU5 A;  3UQ7 A;  5AIN A;  5BP0 A;  2PGZ A;  5LXB A;  3RQW A;  3WTN A;  3GUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...