3P4WA

Structure of desflurane bound to a pentameric ligand-gated ion channel, glic
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title X-ray structures of general anaesthetics bound to a pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 97
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3p4wA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3p4wA01
5L4EA 4HFBA 2M6BA 2ZJUA 4TNWA 5KZUA 5J5FA 5AINA 3UUBA 4ILCA 5J5GA 3TLUA 3SQ6A 3WTLA 3WTKA 2XQ6A 4ZR6A 3TLVA 4ZZCA 4AFHA 1OEDE 2KSRA 3ZDHA 4QABA 2LM2A 4HFHA 4TWDA 2Y58A 2XQ8A 3C84A 2PH9A 2XQ5A 3TLSA 5HEJA 4DBMA 5IUXA 4UM3S 4HFDA 3JAFA 2BR8A 2BG9C 3UQ7A 2XQ7A 2BG9A 4D01A 3RHWA 4B5DA 4NZBA 5L47A 3JADA 3SH1A 1UW6A 4UM3P 2XQ3A 5TVCA 5SYOA 2BYQA 4ZJSA 5J5HA 3GUAA 4ILBA 4BQTA 2MAWA 2YMDA 3P50A 4ILAA 1I9BA 2WN9A 3RIFA 3UU5A 3RI5A 2Y57A 3ZDGA 4EZ1A 4Z91A 3RQWA 2W8FA 2BJ0A 5HEHA 4FRRA 4A97A 2BYNA 4AFTA 4IL9A 2WNLA 3UQ4A 4COFA 2VL0A 5CFBA 2XNUA 3LSVA 2BYPA 4UXUA 5KE4A 5AFJA 5AFMB 3EHZA 2BYSA 3RIAA 4TNVA 2YMEA 2Y56A 4PIRA 2BYRA 3WTHA 3PMZA 3RQUA 4LMKA 3WTMA 3JAEA 2WNCA 2WNJA 4A98A 4IL4A 3SIOA 4ZK1A 5HEOA 2BG9E 1OEDA 2Y54A 5AFNA 4ZJTA 3TLWA 4UY2A 2Y7YA 4IREA 2XNTA 4QH4A 3T4MA 3WIPA 3P4WA 3UU6A 2X00A 3U8MA 3TLTA 4F8HA 3U8KA 4ZRUA 4HFEA 4QH5A 3UU3A 2PGZA 4HFIA 2YOEA 5BRXA 5FJVA 1UV6A 4NPPA 4ZK4A 3IGQA 2YN6A 5HCMA 4TWFA 2XYSA 5AFMA 2XQ9A 2XZ6A 5AFKA 5HEGA 2BG9B 3WTNA 3PEOA 5L4HA 2WZYA 3EI0A 1UX2A 4LMJA 4LMLA 2X00D 4UM1A 4ZZBA 2ZJVA 4WV9A 3WTJA 5AFHA 4AFGA 3SQ9A 4TWHA 4X5TA 1OEDC 5LG3A 4Z90A 2LLYA 2BR7A 2LKHA 5J0ZA 3UU8A 4BFQA 5J5IA 4XK9A 4HFCA 4ALXA 4XHEA 5BW2A 2XQ4A 3UU4A 4QACA 3U8NA 5HCJA 3C79A 3WTOA 2XQAA 4HQPA 5LXBA 2C9TA 2XNVA 5AFLA 4QH1A 5JMEA 2UZ6A 5CO5A 3U8JA 2XZ5A 2W8GA 3U8LA 3EAMA 2XYTA 5BP0A 2LKGA 4UM3A 2YKSA 4QAAA 3WTIA 3ZKRA 5HEUA 1OEDB 2QC1B 2M6IA
chains in the Genus database with same CATH superfamily
2N1GA 3MK7C 2DCFA 4HFBA 5FY7A 4DV7T 2JQKA 2C0SA 5FY1A 4LFAT 3WTLA 1H7CA 1O3XA 2LM2A 4TWDA 2LSJA 3Q9DA 2CLYC 1W0AA 3N9NA 2KZ7B 3NWIA 3RKOA 4NZBA 1MIVA 5F8PA 3K3NA 4ILBA 1XMOT 4I0UA 4AQFC 3K3OA 2FJAA 4X1IE 2Q9QA 3AEGA 1IBKT 5HEHA 3PUYF 4A97A 1UGOA 3LK2B 1WR0A 3K8PC 3M3ZB 2UXBT 1D0ZA 2V7MA 3AEDA 2XNTA 2MPKA 2X00A 2V7LA 3HL6A 2BBHA 4QHOA 2YDRA 2Y8DA 1KFYA 2XQ9A 4YLHA 3WAJA 1Z8UA 4DV1T 5L2LA 3FB2A 2HHHT 2OA5A 3SQ9A 2LLYA 3R6NA 4IE5A 2VKDA 4OX9T 3ZMSB 4QACA 5JDMA 4ERRA 3AE1A 4PJMA 3ZJ1A 3LK3B 2AXDS 2FBWA 4U33A 4BJMA 5AINA 2CM0A 2C5JA 4AFHA 3TLVA 1D1BA 5LG4A 4P0BA 3RPUA 2HN1A 4DBMA 3PE0A 5ABFB 3CWZB 3AECA 2BG9A 3ZYMA 3T1HT 4M1PA 4IIJE 1W0BA 1ZKEA 3N9OA 4UV8B 4V1Av 2KLQA 2XNUA 1W9RA 3VR9A 1LKXA 2X9WA 2Y56A 3F57A 2V6YA 4GYRA 2PG8A 4GK0E 5AQLB 2ZM6T 2IC9A 2WB5A 4HEAA 3CMLA 1J1JA 2H7OA 5FJVA 3RC8A 5AFMA 2EHOB 3CPZA 4C90A 5HEGA 4QX8B 4GYSA 3T1YT 3OBVE 1XZYA 3RIUA 4KUMB 1WFDA 5BW2A 3RRCA 4UF0B 4TZ4C 3P4RA 5J2TE 1U4QA 4LF8T 5J1GA 2XQYA 5FXZA 3WTIA 5LNKA 2YEVC 3OTOT 3AE7A 3NZQA 2M6BA 2JMKA 2I59A 2NWBA 3GWHA 5AQFB 4DBQA 1M62A 3ETUA 2WDVA 4ZXLA 3EABA 2JMHA 2IDOB 3GUAA 4BQTA 3AE2A 4DIDB 1UK5A 4KI0F 1WRDA 4Z91A 4U3CA 2BYNA 5CFBA 3LSVA 4UXUA 2LHNA 4LF9T 5AFMB 4IDPA 3ZSSA 1MMGA 3Q5DA 5LJMA 3ZT5A 3FZKB 4DV2T 4WW0A 4IE4A 4E7SA 4UY2A 3PJAA 4ZS2A 3DTOA 2UUBT 3ZMUB 1HR0T 1E1HB 3CX8B 4JI1T 1T98A 4JI4T 2P9BA 1I94T 4QWNB 2X0LB 3VHLA 4KHZF 4B3ST 2NR4A 4X5TA 2UXXB 4BJNA 4H9RC 2XQ4A 2YK0A 2WZIA 1SUMB 4QH1A 4JLEA 2W67A 4O2BE 5LHGB 2VVSA 5AQNB 4QAAA 3KDSE 2WU5A 4PK5A 3WI3A 2XM2A 1MMDA 3PU8A 3SOLA 3VKGA 3VR8A 2VKHA 3VU7H 3FZMB 2CA5A 3CVRA 2EHOC 3UQ7A 4DUZT 2QA7A 5JRCA 2VURA 2LT3A 1WYBA 2BVMA 4ZJSA 5LBMA 4ILAA 2V7JA 2VL8A 2W8FA 4O4LE 3AA7B 3KV9A 2VL0A 3ZN1B 4HWCA 3AE6A 4I4TE 2KMFA 1XWMA 3C98B 4PIRA 4LF6T 2JPFA 3JAEA 4PFOA 2JQHA 3SIOA 3LK42 5FL0A 1NENA 2XPKA 2XY8B 3T4MA 5GONE 3KV4A 2LM9A 2LSKA 2WCAA 3P8CD 2CXDA 1LVKA 1UX5A 3RF1A 4ZRUA 4I43B 3JC6C 1VRBA 1SA0E 4TV8E 3AE8A 5LMUT 3I1AA 4AKGA 4HWIB 2MYSA 4YTPA 4U2ZA 3C4ZA 3C4XA 4LF4T 3ONXA 5CO5A 4JYAT 2VKOA 2FUPA 5JRCB 5AQGB 5JVDE 3FBZA 3RIUC 1HX8A 4O4HE 3SQ6A 3ZC0A 3OJAA 4DV4T 2CBIA 3NKZA 4GK5E 3N2KE 4A56A 2XUEA 4U7YA 2XQ5A 1HF8A 1HTJF 1WYCA 3V5SA 4C91A 4DVDA 4KMCA 2IAKA 3IF8B 2JIWA 5IYZE 4DV3T 2DL1A 3N2GE 5CJ5A 3KV6A 5L3FB 2Y57A 2CWOA 2A3DA 2WNLA 4HE8A 3RYHE 1IBMT 2BYRA 3RQUA 3AE4A 4A98A 5LJNA 4X20E 2Y7YA 4YFSA 2BDEA 3OPCA 3RYCE 3PURA 2BBJA 5AQIB 2VVNA 4DR7T 2WWUA 3BQIA 3AEFA 4N78D 2ZLYA 5FXVA 1FMVA 4H63H 5E0OA 4HFIA 5HXSA 4OK0A 3S4UA 2XYSA 2IC6A 5HXCA 3O1IA 1MMNA 4ILUA 3ESLA 2G0UA 5JREA 1IJ6A 5DQWA 2NOXA 3W15B 1FIOA 5AQHB 2J47A 5LXTE 1FEWA 3CK6A 4DO0A 3WTOA 5LXBA 4AKIA 3IHRA 2D9DA 4WBOA 4X64T 3EAMA 3NVOA 2L8KA 5KX5E 1MIWA 2R6GF 3HA4A 1WLXA 2M6IA 2QC1B 1KK7A 3ZDHA 2WWVA 5AQVB 1IZNB 2L3LA 3NZPA 4U7IA 3UFGA 2J4GA 4H9NC 4X1YE 5C2TA 3AE5A 4EYYR 3AVRA 3F2EA 1HFAA 2EHOD 5ABEA 4EGWA 4K0UA 4EZ4A 2QYWA 3FZHB 3LBXB 3HKEE 4O4IE 2NW9A 1IBLT 2D0TA 3HR0A 2WNCA 1BR2A 5AQSB 2CWYA 1QLBA 4WBNE 3U8MA 3FBLA 1SE7A 5ETWA 4DR5T 3U8KA 4ANJA 2YOEA 2CXFA 4X1KE 3C51A 5ABFA 4ZI3C 5L4HA 2UXCT 4FJOA 5JDLA 1IAPA 4UVBB 4DR3T 5AQKB 4Z90A 1V9DA 3ETVA 4NXMT 3UU8A 2ES0A 4XK9A 3AA6B 3JC6D 4HKAA 1ZHCA 5TAOA 2IHR1 1G73A 4OYJA 2D0UA 1N32T 2X9YA 4XZCA 2LEHA 5JR9B 2NW8A 3J7Yq 4EXTA 2K48A 2GK9A 2A9UA 4CI3B 2LE8A 2WMNA 1XNRT 4ZI7E 3ZMVB 5HEJA 1L0VA 5IUXA 4UM3S 2WY2A 2EHOA 2X0HA 5ABHA 3QB5A 5SYOA 3L39A 2MBGA 4ZEYA 5ABGA 4MBQA 4HWFA 2B76A 4QX7B 3AB3B 3U78A 4UF0A 4LF7T 4IE0A 3EHZA 4KP3C 2LRLA 3FHNA 5AQUB 5LCYA 1UX4A 2YINA 1YXRA 4ZI2C 2WNJA 4CI1B 1CUNA 4HWDA 3P4WA 2DNXA 1OXZA 2V26A 4A5XA 3UUNA 4F8HA 2LSGA 3ZSTA 4O4JE 4GIWA 2PGZA 2YDQA 4EB6E 2IMLA 2VK9A 2UU9T 3WTJA 3NRXA 4ZS3A 3KVAA 4UR9A 3D0TA 3CX7B 2HN2A 2RP4A 1KNRA 5J5IA 4HFCA 2IW5B 1SHZC 4JI0T 3TKLB 5BR8T 3NBXX 5AQPB 2WDRA 2H89A 1N36T 2WBLA 2C9TA 4YSYA 3C50A 3U8JA 4GKKT 4NXNT 2NW7A 3JCFA 4P0AA 4WYVA 3AVSA 2WM9A 5FMNA 1OEDB 5L4EA 5KZUA 4KHPT 4YTNA 1D0XA 3CQXC 4YTMA 4AKLA 2Y6XA 3EDUA 2VKJA 1BR0A 3I0QA 3CQGB 3VRBA 4AKHA 1ZV4X 2XQ7A 4TV9E 2MOZA 3RHWA 3VKHA 2WMOA 3H37A 2XAQB 3MA9A 5C8YE 4JEHB 2X67A 1YQ3A 1JNZA 3RI5A 1NAFA 2E8IA 2W4XA 5JR9C 2FJEA 3O1JA 4UVAB 2CPTA 2ODUA 3TLWA 3ZYLA 3ZMTB 1I6ZA 5IHYA 4QH4A 5F5WA 2IIUA 3I9YA 3H3MA 4F6RC 3FXEB 4ZOLE 3B57A 1UV6A 3IGQA 4TWFA 5FP3A 3PU3A 4DBRA 3WTNA 3PEOA 3BQLA 3PUQA 2LJLA 2VQET 4WV9A 3MJXA 5EK4A 3UFEA 4BFQA 2N9DA 1S94A 4ZI3D 2CHOA 1D1AA 4HQPA 5M4YA 4XBFB 4NUVA 5JDNA 2UUCT 2WP9A 3PTRB 2WZHA 3LDQB 3ZCJA 2E9XB 4UV9B 2LKGA 2NTXA 2YDSA 4TNWA 4IDOA 2HPLA 4ILCA 3WTKA 3AAEB 3C4WA 3A8YC 4DV6T 4HN9A 3HKBE 4QABA 2CHNA 5LHIB 4PNIA 3G06A 4JEUB 3RYIE 5CB4E 2PBIA 4B5DA 3JADA 2W61A 4PK4A 3O1HA 1W09A 3ZMZB 4CXXA 1KNZA 3RRWA 2BKOA 3RX6A 1EZ3A 5H6RB 3T8OA 3RGLA 1HG2A 3UQ4A 4COFA 4IHJE 1HS7A 2YMEA 3GA8A 4BA9A 4U74A 4GOUA 3KBUA 3AXJB 2JQ9A 5C3JA 2BVLA 1J5ET 4QXBB 3OYXA 4ZI2D 4X66T 4HFVA 5KDMC 4NPPA 1E7PA 2DI4A 2XZ6A 2ACZA 3PUZF 3OVUA 3DJBA 2X66A 2CXLA 2RA1A 2JJ9A 3AA1B 1J5WA 5J0ZA 3N9MA 1NEKA 1X9BA 3RYFE 3WAKA 5CA0E 2WS3A 2UXDT 4MLKA 4PJLA 4UM3A 2YKSA 2UUAT 3QUJA 4JI5T 5J5FA 3TLUA 4TX5A 1OEDE 1KNPA 3MACA 2K9AA 2HPJA 2IUBA 5JDHA 3KBTA 4CI2B 2N2NA 4YHJA 4LFCT 5J5HA 1DU2A 3F31A 4L5GA 2WAUA 2ACXA 4H9QC 2XZEA 4AI6A 2E9XC 4IDNA 3HKDE 1YKEB 1HNXT 2BG9E 3C64A 1MIYA 2OLTA 4PW8A 5EK2A 2K5BB 4NIQA 3SWHA 4H9SE 4DMWA 5HAXA 3AE9A 3PUVF 3ZJ2A 5BMVE 4AQYT 4UELA 3SRZA 1BR1A 2OV9A 2XAJB 2I6HA 4EEBA 5H6QB 2CBJA 4FI5A 4JI6T 4DMVA 3AEAA 1T7SA 3PUSA 5AQQB 4XHEA 3N9PA 3L8RA 5FVKA 2DLRA 4QXCB 4DV0T 2W62A 2VWAA 3LJCA 3LBXA 1ZEEA 1D1CA 2XYTA 4OHFA 2LOSA 4PFPA 5ADXL 5HEUA 4LFBT 2CEAA 2X51A 1AJ3A 3TLSA 2KXPB 4HFDA 2BR8A 1Y64B 1NWMX 3N5LA 5L47A 4IDQA 3SS1A 4YSXA 1LRZA 3Q2MA 1WCRA 2AE9A 4TUYE 4DR1T 2CE7A 3P7IA 1S35A 2LSIA 2WN9A 4ADZA 4KX6A 3Q5XA 5KE4A 5JR9A 4JI2T 4B3RT 4G63A 3RIAA 4OFZA 3QK6A 1FJGT 3EUHA 3WTMA 3CX6B 1YD8G 4Q25A 1YQ4A 3K3QC 3OYZA 4AISA 3DP7A 3CQCB 2ZM8A 2ZMAA 5KXJA 5BRXA 1G8XA 2WDQA 4UVCB 2DWGA 1UUSA 4UM1A 3ANWB 1CHUA 3BQKA 5LG3A 2W00A 3PDYA 5LHHB 2X9XA 5CGMA 4LF5T 3U8NA 3B5MA 3GN5A 1VOMA 5L3BB 2QGSA 4JUYA 2XZ5A 2W8GA 4CXYA 2B1EA 2JRKA 3UUMA 3U3IA 5BP0A 3ZCIA 2XAGB 1B7TA 2SPCA 3B13A 1Y01A 4ZR6A 5HXRA 3ZT7A 2H3RA 3ONLC 2NTYA 2XQ8A 3M65A 4Z8XA 3C84A 4IT4A 2XAFB 5J2UE 3SFDA 2H88A 4TN7B 5A1LA 3RLFF 3LG7A 2H7VC 1UW6A 4IDZA 4QKNA 2BYQA 3PUXF 2BS3A 2XTLA 4L9IA 3PUGA 4JV5T 5IWAT 5FY0A 3RQWA 5JDGA 5L3EB 5EZYE 3A5XA 3ZLIA 4TNVA 3WTHA 4DR2T 4IL4A 3GMIA 1OEDA 4UXNB 2MTQA 4YHHT 3IBPA 2J62A 4QXHB 2E9XD 3UU6A 1YW0A 5LBQB 1KF6A 2BS2A 5JDFA 1ZP0A 3GN5B 2XASB 3UU3A 5FXXA 3QOFA 3AAAB 3RH3A 5AFHA 3AEBA 4AFGA 3QC9A 4B3MT 1ZOYA 2X68A 2DHRA 4B3TT 2BR7A 2LKHA 2VASA 2Q9QB 3AEEA 4CZZB 2DWKA 5HCJA 1BR4A 2ZM2A 2XNVA 5HWYA 5AFLA 2BKPA 5JMEA 4HWHA 2D5UA 2E5LT 4IGUA 4EEDA 4O2AE 4U2YA 3N2OA 2PJQA 4EV6A 2QRXA 3PV0F 2KNDA 4B6XA 3HI2A 2XHEB 2HH7A 5J5GA 3MXZA 2XQ6A 2XM1A 1KEYA 2KSRA 5F3JA 3LFMA 4I55E 1JNRA 2Z6EA 3P4QA 4U72A 1HNWT 3OKQA 5LA6E 4YT0A 1WR6A 4DV5T 4P1NA 3SH1A 5TVCA 3ZC1A 2V5DA 5HWXA 1XNQT 1I9BA 3KFWX 4PAGA 4G2AA 4EAHA 2BJ0A 4FRRA 2W2UA 4CQIA 4IL9A 5EK3A 2V6XA 2E9XA 1MNEA 3N9LA 3PMZA 5LOVE 3E0ZA 5L3CB 4ZK1A 3KVBA 5HYAA 2V5CA 2WU2A 2I0MA 3BK9A 1T8BA 1MNDA 5JDQA 4L0RA 3TLTA 3MKDA 4HFEA 3FXDB 4H9OC 4QH5A 1GQEA 4ZK4A 3ZN0B 4JI7T 4ASKA 2BG9B 3V5UA 5FL1A 1XDOA 5DJQC 1UX2A 2WZYA 5LP6E 4MFRA 2K24A 4U31A 1XMQT 3NRYA 2C5IT 3ZYKA 3ZEFB 3E08A 1UCUA 2VB6A 1T72A 3UU4A 4JBWF 2VQFT 1OWAA 2M67A 3AA0B 2RPAA 2KT9A 5KMGP 2V6YB 5LGTB 3L3PA 3ZKRA 5HXHA 2BYPA 2ZJUA 1XDPA 5LMNT 3AXJA 4ZZCA 3FZLB 2K3WA 2Y58A 3R84B 2PH9A 4XAXB 4AIUA 4D01A 1M7KA 4YSZA 1VCTA 2BZBA 3AE3A 4PK6A 1E2AA 2LSYA 2Q9QC 3RIFA 3N9QA 3UT5E 2XSBA 1HCIA 3O4XE 2XJ7A 3PUWF 4ISSA 1QSDA 3FZFB 4LMKA 4EIWA 3J9X1 2LRKA 4P09A 3CKDA 3SFEA 5L3GB 5HEOA 5AFNA 1HG5A 4IREA 2X9HA 5DQVA 3KINB 2A72A 3ZPOA 4UEMA 2V7KA 2W0GA 3AAIA 3EI0A 4LMJA 4LMLA 2V7IA 2ZJVA 2JQQA 1OEDC 5FXWA 4J2CA 4NUUA 2KINB 3P4PA 4DUYT 3C79A 3MZKB 4PJJA 4CXWA 1R8IA 1MMAA 5JH7E 3EDVA 3U8LA 4IE7A 3EVYA 2PTFA 4IE6A 3ONJA 2ODVA 5AQRB 2C5KT 2QVAA 4H63V 4AQFA 2FJDA 2J1DG 4X65T 5HXEA 2LHRA 3CIRA 4DR6T 2WSSV 2V8SV 4HFHA 4AQGA 4OYKA 4YJ2E 4AKRB 2YU1A 2BG9C 3Q5EA 5LYJE 2V1DB 4UM3P 2PFVA 2XQ3A 2CCQA 2KWIB 2A2FX 1YKHB 2MAWA 3K1SA 3ZDGA 4YXDA 4EZ1A 2YU2A 4AFTA 4WZXA 4MHCA 3QB5K 5FYMA 1QUUA 3RC3A 2Y54A 1IJ5A 1LVFA 4ZJTA 5DABA 3O9XA 4ISTA 4O8SA 2Y48B 2BKNA 2CLYB 5HCMA 5FVLA 5LB7B 1Z0PA 1HNZT 2WQYA 4ZZBA 5AQMB 3PJAJ 4X62T 1VCSA 2E5VA 2L9QA 5AQJB 2CMRA 4H9PC 3HKCE 2X0YA 1UURA 1N34T 2UXNB 4CN1A 4EYUA 2UZ6A 3I9WA 4EZHA 5LGNB 2FJBA 2E2AA 2W66A 4AXPA 5FNVE 1HX1B 1N33T 3UUBA 3PUAA 4E7ZA 2F4VT 2CRBA 4DR4T 3UULA 4GKJT 2ZM0A 5AQOB 2LOPA 4WNKA 4ZHQE 3JAFA 5AFUL 3VRAA 4CN6A 3ANWA 2NP9A 3ABVA 4YJ3E 4I50E 3H3AA 5JTGA 2YMDA 5LGUB 2KWHA 3P50A 3L09A 4EOZB 4K0KT 3UU5A 3UUXB 4DNDA 3KV5A 3QNUA 4MALA 3Q5WA 5JQGE 4HTEA 5AQTB 5FKYA 5AFJA 2BYSA 2XSAA 3P4SA 1X79A 5L3DB 2Q9QD 3X1DA 4JI8T 3UTKA 3E22E 4YY3T 3ZT6A 3WIPA 4CN4A 3RKGA 2W63A 2YN6A 5AFKA 4JI3T 2X00D 4BAYB 4HGAA 4TWHA 1D0YA 3IA3A 3A7MA 4KBMB 2XAHB 4ALXA 1FMWA 2XQAA 4UIGA 2D2SA 3I0OA 2BS4A 5CA1E 1US7B 4PJNA 1U5PA 3IEEA
chains in the Genus database with same CATH topology
5L4EA 4HFBA 2M6BA 2ZJUA 4TNWA 5KZUA 5J5FA 5AINA 3UUBA 4ILCA 5J5GA 3TLUA 3SQ6A 3WTLA 3WTKA 2XQ6A 4ZR6A 3TLVA 4ZZCA 4AFHA 1OEDE 2KSRA 3ZDHA 4QABA 2LM2A 4HFHA 4TWDA 2Y58A 2XQ8A 3C84A 2PH9A 2XQ5A 3TLSA 5HEJA 4DBMA 5IUXA 4UM3S 4HFDA 3JAFA 2BR8A 2BG9C 3UQ7A 2XQ7A 2BG9A 4D01A 3RHWA 4B5DA 4NZBA 5L47A 3JADA 3SH1A 1UW6A 4UM3P 2XQ3A 5TVCA 5SYOA 2BYQA 4ZJSA 5J5HA 3GUAA 4ILBA 4BQTA 2MAWA 2YMDA 3P50A 4ILAA 1I9BA 2WN9A 3RIFA 3UU5A 3RI5A 2Y57A 3ZDGA 4EZ1A 4Z91A 3RQWA 2W8FA 2BJ0A 5HEHA 4FRRA 4A97A 2BYNA 4AFTA 4IL9A 2WNLA 3UQ4A 4COFA 2VL0A 5CFBA 2XNUA 3LSVA 2BYPA 4UXUA 5KE4A 5AFJA 5AFMB 3EHZA 2BYSA 3RIAA 4TNVA 2YMEA 2Y56A 4PIRA 2BYRA 3WTHA 3PMZA 3RQUA 4LMKA 3WTMA 3JAEA 2WNCA 2WNJA 4A98A 4IL4A 3SIOA 4ZK1A 5HEOA 2BG9E 1OEDA 2Y54A 5AFNA 4ZJTA 3TLWA 4UY2A 2Y7YA 4IREA 2XNTA 4QH4A 3T4MA 3WIPA 3P4WA 3UU6A 2X00A 3U8MA 3TLTA 4F8HA 3U8KA 4ZRUA 4HFEA 4QH5A 3UU3A 2PGZA 4HFIA 2YOEA 5BRXA 5FJVA 1UV6A 4NPPA 4ZK4A 3IGQA 2YN6A 5HCMA 4TWFA 2XYSA 5AFMA 2XQ9A 2XZ6A 5AFKA 5HEGA 2BG9B 3WTNA 3PEOA 5L4HA 2WZYA 3EI0A 1UX2A 4LMJA 4LMLA 2X00D 4UM1A 4ZZBA 2ZJVA 4WV9A 3WTJA 5AFHA 4AFGA 3SQ9A 4TWHA 4X5TA 1OEDC 5LG3A 4Z90A 2LLYA 2BR7A 2LKHA 5J0ZA 3UU8A 4BFQA 5J5IA 4XK9A 4HFCA 4ALXA 4XHEA 5BW2A 2XQ4A 3UU4A 4QACA 3U8NA 5HCJA 3C79A 3WTOA 2XQAA 4HQPA 5LXBA 2C9TA 2XNVA 5AFLA 4QH1A 5JMEA 2UZ6A 5CO5A 3U8JA 2XZ5A 2W8GA 3U8LA 3EAMA 2XYTA 5BP0A 2LKGA 4UM3A 2YKSA 4QAAA 3WTIA 3ZKRA 5HEUA 1OEDB 2QC1B 2M6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L4E A;  4HFB A;  2M6B A;  2ZJU A;  4TNW A;  5KZU A;  5J5F A;  5AIN A;  3UUB A;  4ILC A;  5J5G A;  3TLU A;  3SQ6 A;  3WTL A;  3WTK A;  2XQ6 A;  4ZR6 A;  3TLV A;  4ZZC A;  4AFH A;  1OED E;  2KSR A;  3ZDH A;  4QAB A;  2LM2 A;  4HFH A;  4TWD A;  2Y58 A;  2XQ8 A;  3C84 A;  2PH9 A;  2XQ5 A;  3TLS A;  5HEJ A;  4DBM A;  5IUX A;  4UM3 S;  4HFD A;  3JAF A;  2BR8 A;  2BG9 C;  3UQ7 A;  2XQ7 A;  2BG9 A;  4D01 A;  3RHW A;  4B5D A;  4NZB A;  5L47 A;  3JAD A;  3SH1 A;  1UW6 A;  4UM3 P;  2XQ3 A;  5TVC A;  5SYO A;  2BYQ A;  4ZJS A;  5J5H A;  3GUA A;  4ILB A;  4BQT A;  2MAW A;  2YMD A;  3P50 A;  4ILA A;  1I9B A;  2WN9 A;  3RIF A;  3UU5 A;  3RI5 A;  2Y57 A;  3ZDG A;  4EZ1 A;  4Z91 A;  3RQW A;  2W8F A;  2BJ0 A;  5HEH A;  4FRR A;  4A97 A;  2BYN A;  4AFT A;  4IL9 A;  2WNL A;  3UQ4 A;  4COF A;  2VL0 A;  5CFB A;  2XNU A;  3LSV A;  2BYP A;  4UXU A;  5KE4 A;  5AFJ A;  5AFM B;  3EHZ A;  2BYS A;  3RIA A;  4TNV A;  2YME A;  2Y56 A;  4PIR A;  2BYR A;  3WTH A;  3PMZ A;  3RQU A;  4LMK A;  3WTM A;  3JAE A;  2WNC A;  2WNJ A;  4A98 A;  4IL4 A;  3SIO A;  4ZK1 A;  5HEO A;  2BG9 E;  1OED A;  2Y54 A;  5AFN A;  4ZJT A;  3TLW A;  4UY2 A;  2Y7Y A;  4IRE A;  2XNT A;  4QH4 A;  3T4M A;  3WIP A;  3P4W A;  3UU6 A;  2X00 A;  3U8M A;  3TLT A;  4F8H A;  3U8K A;  4ZRU A;  4HFE A;  4QH5 A;  3UU3 A;  2PGZ A;  4HFI A;  2YOE A;  5BRX A;  5FJV A;  1UV6 A;  4NPP A;  4ZK4 A;  3IGQ A;  2YN6 A;  5HCM A;  4TWF A;  2XYS A;  5AFM A;  2XQ9 A;  2XZ6 A;  5AFK A;  5HEG A;  2BG9 B;  3WTN A;  3PEO A;  5L4H A;  2WZY A;  3EI0 A;  1UX2 A;  4LMJ A;  4LML A;  2X00 D;  4UM1 A;  4ZZB A;  2ZJV A;  4WV9 A;  3WTJ A;  5AFH A;  4AFG A;  3SQ9 A;  4TWH A;  4X5T A;  1OED C;  5LG3 A;  4Z90 A;  2LLY A;  2BR7 A;  2LKH A;  5J0Z A;  3UU8 A;  4BFQ A;  5J5I A;  4XK9 A;  4HFC A;  4ALX A;  4XHE A;  5BW2 A;  2XQ4 A;  3UU4 A;  4QAC A;  3U8N A;  5HCJ A;  3C79 A;  3WTO A;  2XQA A;  4HQP A;  5LXB A;  2C9T A;  2XNV A;  5AFL A;  4QH1 A;  5JME A;  2UZ6 A;  5CO5 A;  3U8J A;  2XZ5 A;  2W8G A;  3U8L A;  3EAM A;  2XYT A;  5BP0 A;  2LKG A;  4UM3 A;  2YKS A;  4QAA A;  3WTI A;  3ZKR A;  5HEU A;  1OED B;  2QC1 B;  2M6I A; 
#chains in the Genus database with same CATH topology
 2N1G A;  3MK7 C;  2DCF A;  4HFB A;  5FY7 A;  4DV7 T;  2JQK A;  2C0S A;  5FY1 A;  4LFA T;  3WTL A;  1H7C A;  1O3X A;  2LM2 A;  4TWD A;  2LSJ A;  3Q9D A;  2CLY C;  1W0A A;  3N9N A;  2KZ7 B;  3NWI A;  3RKO A;  4NZB A;  1MIV A;  5F8P A;  3K3N A;  4ILB A;  1XMO T;  4I0U A;  4AQF C;  3K3O A;  2FJA A;  4X1I E;  2Q9Q A;  3AEG A;  1IBK T;  5HEH A;  3PUY F;  4A97 A;  1UGO A;  3LK2 B;  1WR0 A;  3K8P C;  3M3Z B;  2UXB T;  1D0Z A;  2V7M A;  3AED A;  2XNT A;  2MPK A;  2X00 A;  2V7L A;  3HL6 A;  2BBH A;  4QHO A;  2YDR A;  2Y8D A;  1KFY A;  2XQ9 A;  4YLH A;  3WAJ A;  1Z8U A;  4DV1 T;  5L2L A;  3FB2 A;  2HHH T;  2OA5 A;  3SQ9 A;  2LLY A;  3R6N A;  4IE5 A;  2VKD A;  4OX9 T;  3ZMS B;  4QAC A;  5JDM A;  4ERR A;  3AE1 A;  4PJM A;  3ZJ1 A;  3LK3 B;  2AXD S;  2FBW A;  4U33 A;  4BJM A;  5AIN A;  2CM0 A;  2C5J A;  4AFH A;  3TLV A;  1D1B A;  5LG4 A;  4P0B A;  3RPU A;  2HN1 A;  4DBM A;  3PE0 A;  5ABF B;  3CWZ B;  3AEC A;  2BG9 A;  3ZYM A;  3T1H T;  4M1P A;  4IIJ E;  1W0B A;  1ZKE A;  3N9O A;  4UV8 B;  4V1A v;  2KLQ A;  2XNU A;  1W9R A;  3VR9 A;  1LKX A;  2X9W A;  2Y56 A;  3F57 A;  2V6Y A;  4GYR A;  2PG8 A;  4GK0 E;  5AQL B;  2ZM6 T;  2IC9 A;  2WB5 A;  4HEA A;  3CML A;  1J1J A;  2H7O A;  5FJV A;  3RC8 A;  5AFM A;  2EHO B;  3CPZ A;  4C90 A;  5HEG A;  4QX8 B;  4GYS A;  3T1Y T;  3OBV E;  1XZY A;  3RIU A;  4KUM B;  1WFD A;  5BW2 A;  3RRC A;  4UF0 B;  4TZ4 C;  3P4R A;  5J2T E;  1U4Q A;  4LF8 T;  5J1G A;  2XQY A;  5FXZ A;  3WTI A;  5LNK A;  2YEV C;  3OTO T;  3AE7 A;  3NZQ A;  2M6B A;  2JMK A;  2I59 A;  2NWB A;  3GWH A;  5AQF B;  4DBQ A;  1M62 A;  3ETU A;  2WDV A;  4ZXL A;  3EAB A;  2JMH A;  2IDO B;  3GUA A;  4BQT A;  3AE2 A;  4DID B;  1UK5 A;  4KI0 F;  1WRD A;  4Z91 A;  4U3C A;  2BYN A;  5CFB A;  3LSV A;  4UXU A;  2LHN A;  4LF9 T;  5AFM B;  4IDP A;  3ZSS A;  1MMG A;  3Q5D A;  5LJM A;  3ZT5 A;  3FZK B;  4DV2 T;  4WW0 A;  4IE4 A;  4E7S A;  4UY2 A;  3PJA A;  4ZS2 A;  3DTO A;  2UUB T;  3ZMU B;  1HR0 T;  1E1H B;  3CX8 B;  4JI1 T;  1T98 A;  4JI4 T;  2P9B A;  1I94 T;  4QWN B;  2X0L B;  3VHL A;  4KHZ F;  4B3S T;  2NR4 A;  4X5T A;  2UXX B;  4BJN A;  4H9R C;  2XQ4 A;  2YK0 A;  2WZI A;  1SUM B;  4QH1 A;  4JLE A;  2W67 A;  4O2B E;  5LHG B;  2VVS A;  5AQN B;  4QAA A;  3KDS E;  2WU5 A;  4PK5 A;  3WI3 A;  2XM2 A;  1MMD A;  3PU8 A;  3SOL A;  3VKG A;  3VR8 A;  2VKH A;  3VU7 H;  3FZM B;  2CA5 A;  3CVR A;  2EHO C;  3UQ7 A;  4DUZ T;  2QA7 A;  5JRC A;  2VUR A;  2LT3 A;  1WYB A;  2BVM A;  4ZJS A;  5LBM A;  4ILA A;  2V7J A;  2VL8 A;  2W8F A;  4O4L E;  3AA7 B;  3KV9 A;  2VL0 A;  3ZN1 B;  4HWC A;  3AE6 A;  4I4T E;  2KMF A;  1XWM A;  3C98 B;  4PIR A;  4LF6 T;  2JPF A;  3JAE A;  4PFO A;  2JQH A;  3SIO A;  3LK4 2;  5FL0 A;  1NEN A;  2XPK A;  2XY8 B;  3T4M A;  5GON E;  3KV4 A;  2LM9 A;  2LSK A;  2WCA A;  3P8C D;  2CXD A;  1LVK A;  1UX5 A;  3RF1 A;  4ZRU A;  4I43 B;  3JC6 C;  1VRB A;  1SA0 E;  4TV8 E;  3AE8 A;  5LMU T;  3I1A A;  4AKG A;  4HWI B;  2MYS A;  4YTP A;  4U2Z A;  3C4Z A;  3C4X A;  4LF4 T;  3ONX A;  5CO5 A;  4JYA T;  2VKO A;  2FUP A;  5JRC B;  5AQG B;  5JVD E;  3FBZ A;  3RIU C;  1HX8 A;  4O4H E;  3SQ6 A;  3ZC0 A;  3OJA A;  4DV4 T;  2CBI A;  3NKZ A;  4GK5 E;  3N2K E;  4A56 A;  2XUE A;  4U7Y A;  2XQ5 A;  1HF8 A;  1HTJ F;  1WYC A;  3V5S A;  4C91 A;  4DVD A;  4KMC A;  2IAK A;  3IF8 B;  2JIW A;  5IYZ E;  4DV3 T;  2DL1 A;  3N2G E;  5CJ5 A;  3KV6 A;  5L3F B;  2Y57 A;  2CWO A;  2A3D A;  2WNL A;  4HE8 A;  3RYH E;  1IBM T;  2BYR A;  3RQU A;  3AE4 A;  4A98 A;  5LJN A;  4X20 E;  2Y7Y A;  4YFS A;  2BDE A;  3OPC A;  3RYC E;  3PUR A;  2BBJ A;  5AQI B;  2VVN A;  4DR7 T;  2WWU A;  3BQI A;  3AEF A;  4N78 D;  2ZLY A;  5FXV A;  1FMV A;  4H63 H;  5E0O A;  4HFI A;  5HXS A;  4OK0 A;  3S4U A;  2XYS A;  2IC6 A;  5HXC A;  3O1I A;  1MMN A;  4ILU A;  3ESL A;  2G0U A;  5JRE A;  1IJ6 A;  5DQW A;  2NOX A;  3W15 B;  1FIO A;  5AQH B;  2J47 A;  5LXT E;  1FEW A;  3CK6 A;  4DO0 A;  3WTO A;  5LXB A;  4AKI A;  3IHR A;  2D9D A;  4WBO A;  4X64 T;  3EAM A;  3NVO A;  2L8K A;  5KX5 E;  1MIW A;  2R6G F;  3HA4 A;  1WLX A;  2M6I A;  2QC1 B;  1KK7 A;  3ZDH A;  2WWV A;  5AQV B;  1IZN B;  2L3L A;  3NZP A;  4U7I A;  3UFG A;  2J4G A;  4H9N C;  4X1Y E;  5C2T A;  3AE5 A;  4EYY R;  3AVR A;  3F2E A;  1HFA A;  2EHO D;  5ABE A;  4EGW A;  4K0U A;  4EZ4 A;  2QYW A;  3FZH B;  3LBX B;  3HKE E;  4O4I E;  2NW9 A;  1IBL T;  2D0T A;  3HR0 A;  2WNC A;  1BR2 A;  5AQS B;  2CWY A;  1QLB A;  4WBN E;  3U8M A;  3FBL A;  1SE7 A;  5ETW A;  4DR5 T;  3U8K A;  4ANJ A;  2YOE A;  2CXF A;  4X1K E;  3C51 A;  5ABF A;  4ZI3 C;  5L4H A;  2UXC T;  4FJO A;  5JDL A;  1IAP A;  4UVB B;  4DR3 T;  5AQK B;  4Z90 A;  1V9D A;  3ETV A;  4NXM T;  3UU8 A;  2ES0 A;  4XK9 A;  3AA6 B;  3JC6 D;  4HKA A;  1ZHC A;  5TAO A;  2IHR 1;  1G73 A;  4OYJ A;  2D0U A;  1N32 T;  2X9Y A;  4XZC A;  2LEH A;  5JR9 B;  2NW8 A;  3J7Y q;  4EXT A;  2K48 A;  2GK9 A;  2A9U A;  4CI3 B;  2LE8 A;  2WMN A;  1XNR T;  4ZI7 E;  3ZMV B;  5HEJ A;  1L0V A;  5IUX A;  4UM3 S;  2WY2 A;  2EHO A;  2X0H A;  5ABH A;  3QB5 A;  5SYO A;  3L39 A;  2MBG A;  4ZEY A;  5ABG A;  4MBQ A;  4HWF A;  2B76 A;  4QX7 B;  3AB3 B;  3U78 A;  4UF0 A;  4LF7 T;  4IE0 A;  3EHZ A;  4KP3 C;  2LRL A;  3FHN A;  5AQU B;  5LCY A;  1UX4 A;  2YIN A;  1YXR A;  4ZI2 C;  2WNJ A;  4CI1 B;  1CUN A;  4HWD A;  3P4W A;  2DNX A;  1OXZ A;  2V26 A;  4A5X A;  3UUN A;  4F8H A;  2LSG A;  3ZST A;  4O4J E;  4GIW A;  2PGZ A;  2YDQ A;  4EB6 E;  2IML A;  2VK9 A;  2UU9 T;  3WTJ A;  3NRX A;  4ZS3 A;  3KVA A;  4UR9 A;  3D0T A;  3CX7 B;  2HN2 A;  2RP4 A;  1KNR A;  5J5I A;  4HFC A;  2IW5 B;  1SHZ C;  4JI0 T;  3TKL B;  5BR8 T;  3NBX X;  5AQP B;  2WDR A;  2H89 A;  1N36 T;  2WBL A;  2C9T A;  4YSY A;  3C50 A;  3U8J A;  4GKK T;  4NXN T;  2NW7 A;  3JCF A;  4P0A A;  4WYV A;  3AVS A;  2WM9 A;  5FMN A;  1OED B;  5L4E A;  5KZU A;  4KHP T;  4YTN A;  1D0X A;  3CQX C;  4YTM A;  4AKL A;  2Y6X A;  3EDU A;  2VKJ A;  1BR0 A;  3I0Q A;  3CQG B;  3VRB A;  4AKH A;  1ZV4 X;  2XQ7 A;  4TV9 E;  2MOZ A;  3RHW A;  3VKH A;  2WMO A;  3H37 A;  2XAQ B;  3MA9 A;  5C8Y E;  4JEH B;  2X67 A;  1YQ3 A;  1JNZ A;  3RI5 A;  1NAF A;  2E8I A;  2W4X A;  5JR9 C;  2FJE A;  3O1J A;  4UVA B;  2CPT A;  2ODU A;  3TLW A;  3ZYL A;  3ZMT B;  1I6Z A;  5IHY A;  4QH4 A;  5F5W A;  2IIU A;  3I9Y A;  3H3M A;  4F6R C;  3FXE B;  4ZOL E;  3B57 A;  1UV6 A;  3IGQ A;  4TWF A;  5FP3 A;  3PU3 A;  4DBR A;  3WTN A;  3PEO A;  3BQL A;  3PUQ A;  2LJL A;  2VQE T;  4WV9 A;  3MJX A;  5EK4 A;  3UFE A;  4BFQ A;  2N9D A;  1S94 A;  4ZI3 D;  2CHO A;  1D1A A;  4HQP A;  5M4Y A;  4XBF B;  4NUV A;  5JDN A;  2UUC T;  2WP9 A;  3PTR B;  2WZH A;  3LDQ B;  3ZCJ A;  2E9X B;  4UV9 B;  2LKG A;  2NTX A;  2YDS A;  4TNW A;  4IDO A;  2HPL A;  4ILC A;  3WTK A;  3AAE B;  3C4W A;  3A8Y C;  4DV6 T;  4HN9 A;  3HKB E;  4QAB A;  2CHN A;  5LHI B;  4PNI A;  3G06 A;  4JEU B;  3RYI E;  5CB4 E;  2PBI A;  4B5D A;  3JAD A;  2W61 A;  4PK4 A;  3O1H A;  1W09 A;  3ZMZ B;  4CXX A;  1KNZ A;  3RRW A;  2BKO A;  3RX6 A;  1EZ3 A;  5H6R B;  3T8O A;  3RGL A;  1HG2 A;  3UQ4 A;  4COF A;  4IHJ E;  1HS7 A;  2YME A;  3GA8 A;  4BA9 A;  4U74 A;  4GOU A;  3KBU A;  3AXJ B;  2JQ9 A;  5C3J A;  2BVL A;  1J5E T;  4QXB B;  3OYX A;  4ZI2 D;  4X66 T;  4HFV A;  5KDM C;  4NPP A;  1E7P A;  2DI4 A;  2XZ6 A;  2ACZ A;  3PUZ F;  3OVU A;  3DJB A;  2X66 A;  2CXL A;  2RA1 A;  2JJ9 A;  3AA1 B;  1J5W A;  5J0Z A;  3N9M A;  1NEK A;  1X9B A;  3RYF E;  3WAK A;  5CA0 E;  2WS3 A;  2UXD T;  4MLK A;  4PJL A;  4UM3 A;  2YKS A;  2UUA T;  3QUJ A;  4JI5 T;  5J5F A;  3TLU A;  4TX5 A;  1OED E;  1KNP A;  3MAC A;  2K9A A;  2HPJ A;  2IUB A;  5JDH A;  3KBT A;  4CI2 B;  2N2N A;  4YHJ A;  4LFC T;  5J5H A;  1DU2 A;  3F31 A;  4L5G A;  2WAU A;  2ACX A;  4H9Q C;  2XZE A;  4AI6 A;  2E9X C;  4IDN A;  3HKD E;  1YKE B;  1HNX T;  2BG9 E;  3C64 A;  1MIY A;  2OLT A;  4PW8 A;  5EK2 A;  2K5B B;  4NIQ A;  3SWH A;  4H9S E;  4DMW A;  5HAX A;  3AE9 A;  3PUV F;  3ZJ2 A;  5BMV E;  4AQY T;  4UEL A;  3SRZ A;  1BR1 A;  2OV9 A;  2XAJ B;  2I6H A;  4EEB A;  5H6Q B;  2CBJ A;  4FI5 A;  4JI6 T;  4DMV A;  3AEA A;  1T7S A;  3PUS A;  5AQQ B;  4XHE A;  3N9P A;  3L8R A;  5FVK A;  2DLR A;  4QXC B;  4DV0 T;  2W62 A;  2VWA A;  3LJC A;  3LBX A;  1ZEE A;  1D1C A;  2XYT A;  4OHF A;  2LOS A;  4PFP A;  5ADX L;  5HEU A;  4LFB T;  2CEA A;  2X51 A;  1AJ3 A;  3TLS A;  2KXP B;  4HFD A;  2BR8 A;  1Y64 B;  1NWM X;  3N5L A;  5L47 A;  4IDQ A;  3SS1 A;  4YSX A;  1LRZ A;  3Q2M A;  1WCR A;  2AE9 A;  4TUY E;  4DR1 T;  2CE7 A;  3P7I A;  1S35 A;  2LSI A;  2WN9 A;  4ADZ A;  4KX6 A;  3Q5X A;  5KE4 A;  5JR9 A;  4JI2 T;  4B3R T;  4G63 A;  3RIA A;  4OFZ A;  3QK6 A;  1FJG T;  3EUH A;  3WTM A;  3CX6 B;  1YD8 G;  4Q25 A;  1YQ4 A;  3K3Q C;  3OYZ A;  4AIS A;  3DP7 A;  3CQC B;  2ZM8 A;  2ZMA A;  5KXJ A;  5BRX A;  1G8X A;  2WDQ A;  4UVC B;  2DWG A;  1UUS A;  4UM1 A;  3ANW B;  1CHU A;  3BQK A;  5LG3 A;  2W00 A;  3PDY A;  5LHH B;  2X9X A;  5CGM A;  4LF5 T;  3U8N A;  3B5M A;  3GN5 A;  1VOM A;  5L3B B;  2QGS A;  4JUY A;  2XZ5 A;  2W8G A;  4CXY A;  2B1E A;  2JRK A;  3UUM A;  3U3I A;  5BP0 A;  3ZCI A;  2XAG B;  1B7T A;  2SPC A;  3B13 A;  1Y01 A;  4ZR6 A;  5HXR A;  3ZT7 A;  2H3R A;  3ONL C;  2NTY A;  2XQ8 A;  3M65 A;  4Z8X A;  3C84 A;  4IT4 A;  2XAF B;  5J2U E;  3SFD A;  2H88 A;  4TN7 B;  5A1L A;  3RLF F;  3LG7 A;  2H7V C;  1UW6 A;  4IDZ A;  4QKN A;  2BYQ A;  3PUX F;  2BS3 A;  2XTL A;  4L9I A;  3PUG A;  4JV5 T;  5IWA T;  5FY0 A;  3RQW A;  5JDG A;  5L3E B;  5EZY E;  3A5X A;  3ZLI A;  4TNV A;  3WTH A;  4DR2 T;  4IL4 A;  3GMI A;  1OED A;  4UXN B;  2MTQ A;  4YHH T;  3IBP A;  2J62 A;  4QXH B;  2E9X D;  3UU6 A;  1YW0 A;  5LBQ B;  1KF6 A;  2BS2 A;  5JDF A;  1ZP0 A;  3GN5 B;  2XAS B;  3UU3 A;  5FXX A;  3QOF A;  3AAA B;  3RH3 A;  5AFH A;  3AEB A;  4AFG A;  3QC9 A;  4B3M T;  1ZOY A;  2X68 A;  2DHR A;  4B3T T;  2BR7 A;  2LKH A;  2VAS A;  2Q9Q B;  3AEE A;  4CZZ B;  2DWK A;  5HCJ A;  1BR4 A;  2ZM2 A;  2XNV A;  5HWY A;  5AFL A;  2BKP A;  5JME A;  4HWH A;  2D5U A;  2E5L T;  4IGU A;  4EED A;  4O2A E;  4U2Y A;  3N2O A;  2PJQ A;  4EV6 A;  2QRX A;  3PV0 F;  2KND A;  4B6X A;  3HI2 A;  2XHE B;  2HH7 A;  5J5G A;  3MXZ A;  2XQ6 A;  2XM1 A;  1KEY A;  2KSR A;  5F3J A;  3LFM A;  4I55 E;  1JNR A;  2Z6E A;  3P4Q A;  4U72 A;  1HNW T;  3OKQ A;  5LA6 E;  4YT0 A;  1WR6 A;  4DV5 T;  4P1N A;  3SH1 A;  5TVC A;  3ZC1 A;  2V5D A;  5HWX A;  1XNQ T;  1I9B A;  3KFW X;  4PAG A;  4G2A A;  4EAH A;  2BJ0 A;  4FRR A;  2W2U A;  4CQI A;  4IL9 A;  5EK3 A;  2V6X A;  2E9X A;  1MNE A;  3N9L A;  3PMZ A;  5LOV E;  3E0Z A;  5L3C B;  4ZK1 A;  3KVB A;  5HYA A;  2V5C A;  2WU2 A;  2I0M A;  3BK9 A;  1T8B A;  1MND A;  5JDQ A;  4L0R A;  3TLT A;  3MKD A;  4HFE A;  3FXD B;  4H9O C;  4QH5 A;  1GQE A;  4ZK4 A;  3ZN0 B;  4JI7 T;  4ASK A;  2BG9 B;  3V5U A;  5FL1 A;  1XDO A;  5DJQ C;  1UX2 A;  2WZY A;  5LP6 E;  4MFR A;  2K24 A;  4U31 A;  1XMQ T;  3NRY A;  2C5I T;  3ZYK A;  3ZEF B;  3E08 A;  1UCU A;  2VB6 A;  1T72 A;  3UU4 A;  4JBW F;  2VQF T;  1OWA A;  2M67 A;  3AA0 B;  2RPA A;  2KT9 A;  5KMG P;  2V6Y B;  5LGT B;  3L3P A;  3ZKR A;  5HXH A;  2BYP A;  2ZJU A;  1XDP A;  5LMN T;  3AXJ A;  4ZZC A;  3FZL B;  2K3W A;  2Y58 A;  3R84 B;  2PH9 A;  4XAX B;  4AIU A;  4D01 A;  1M7K A;  4YSZ A;  1VCT A;  2BZB A;  3AE3 A;  4PK6 A;  1E2A A;  2LSY A;  2Q9Q C;  3RIF A;  3N9Q A;  3UT5 E;  2XSB A;  1HCI A;  3O4X E;  2XJ7 A;  3PUW F;  4ISS A;  1QSD A;  3FZF B;  4LMK A;  4EIW A;  3J9X 1;  2LRK A;  4P09 A;  3CKD A;  3SFE A;  5L3G B;  5HEO A;  5AFN A;  1HG5 A;  4IRE A;  2X9H A;  5DQV A;  3KIN B;  2A72 A;  3ZPO A;  4UEM A;  2V7K A;  2W0G A;  3AAI A;  3EI0 A;  4LMJ A;  4LML A;  2V7I A;  2ZJV A;  2JQQ A;  1OED C;  5FXW A;  4J2C A;  4NUU A;  2KIN B;  3P4P A;  4DUY T;  3C79 A;  3MZK B;  4PJJ A;  4CXW A;  1R8I A;  1MMA A;  5JH7 E;  3EDV A;  3U8L A;  4IE7 A;  3EVY A;  2PTF A;  4IE6 A;  3ONJ A;  2ODV A;  5AQR B;  2C5K T;  2QVA A;  4H63 V;  4AQF A;  2FJD A;  2J1D G;  4X65 T;  5HXE A;  2LHR A;  3CIR A;  4DR6 T;  2WSS V;  2V8S V;  4HFH A;  4AQG A;  4OYK A;  4YJ2 E;  4AKR B;  2YU1 A;  2BG9 C;  3Q5E A;  5LYJ E;  2V1D B;  4UM3 P;  2PFV A;  2XQ3 A;  2CCQ A;  2KWI B;  2A2F X;  1YKH B;  2MAW A;  3K1S A;  3ZDG A;  4YXD A;  4EZ1 A;  2YU2 A;  4AFT A;  4WZX A;  4MHC A;  3QB5 K;  5FYM A;  1QUU A;  3RC3 A;  2Y54 A;  1IJ5 A;  1LVF A;  4ZJT A;  5DAB A;  3O9X A;  4IST A;  4O8S A;  2Y48 B;  2BKN A;  2CLY B;  5HCM A;  5FVL A;  5LB7 B;  1Z0P A;  1HNZ T;  2WQY A;  4ZZB A;  5AQM B;  3PJA J;  4X62 T;  1VCS A;  2E5V A;  2L9Q A;  5AQJ B;  2CMR A;  4H9P C;  3HKC E;  2X0Y A;  1UUR A;  1N34 T;  2UXN B;  4CN1 A;  4EYU A;  2UZ6 A;  3I9W A;  4EZH A;  5LGN B;  2FJB A;  2E2A A;  2W66 A;  4AXP A;  5FNV E;  1HX1 B;  1N33 T;  3UUB A;  3PUA A;  4E7Z A;  2F4V T;  2CRB A;  4DR4 T;  3UUL A;  4GKJ T;  2ZM0 A;  5AQO B;  2LOP A;  4WNK A;  4ZHQ E;  3JAF A;  5AFU L;  3VRA A;  4CN6 A;  3ANW A;  2NP9 A;  3ABV A;  4YJ3 E;  4I50 E;  3H3A A;  5JTG A;  2YMD A;  5LGU B;  2KWH A;  3P50 A;  3L09 A;  4EOZ B;  4K0K T;  3UU5 A;  3UUX B;  4DND A;  3KV5 A;  3QNU A;  4MAL A;  3Q5W A;  5JQG E;  4HTE A;  5AQT B;  5FKY A;  5AFJ A;  2BYS A;  2XSA A;  3P4S A;  1X79 A;  5L3D B;  2Q9Q D;  3X1D A;  4JI8 T;  3UTK A;  3E22 E;  4YY3 T;  3ZT6 A;  3WIP A;  4CN4 A;  3RKG A;  2W63 A;  2YN6 A;  5AFK A;  4JI3 T;  2X00 D;  4BAY B;  4HGA A;  4TWH A;  1D0Y A;  3IA3 A;  3A7M A;  4KBM B;  2XAH B;  4ALX A;  1FMW A;  2XQA A;  4UIG A;  2D2S A;  3I0O A;  2BS4 A;  5CA1 E;  1US7 B;  4PJN A;  1U5P A;  3IEE A; 
#chains in the Genus database with same CATH homology
 5L4E A;  4HFB A;  2M6B A;  2ZJU A;  4TNW A;  5KZU A;  5J5F A;  5AIN A;  3UUB A;  4ILC A;  5J5G A;  3TLU A;  3SQ6 A;  3WTL A;  3WTK A;  2XQ6 A;  4ZR6 A;  3TLV A;  4ZZC A;  4AFH A;  1OED E;  2KSR A;  3ZDH A;  4QAB A;  2LM2 A;  4HFH A;  4TWD A;  2Y58 A;  2XQ8 A;  3C84 A;  2PH9 A;  2XQ5 A;  3TLS A;  5HEJ A;  4DBM A;  5IUX A;  4UM3 S;  4HFD A;  3JAF A;  2BR8 A;  2BG9 C;  3UQ7 A;  2XQ7 A;  2BG9 A;  4D01 A;  3RHW A;  4B5D A;  4NZB A;  5L47 A;  3JAD A;  3SH1 A;  1UW6 A;  4UM3 P;  2XQ3 A;  5TVC A;  5SYO A;  2BYQ A;  4ZJS A;  5J5H A;  3GUA A;  4ILB A;  4BQT A;  2MAW A;  2YMD A;  3P50 A;  4ILA A;  1I9B A;  2WN9 A;  3RIF A;  3UU5 A;  3RI5 A;  2Y57 A;  3ZDG A;  4EZ1 A;  4Z91 A;  3RQW A;  2W8F A;  2BJ0 A;  5HEH A;  4FRR A;  4A97 A;  2BYN A;  4AFT A;  4IL9 A;  2WNL A;  3UQ4 A;  4COF A;  2VL0 A;  5CFB A;  2XNU A;  3LSV A;  2BYP A;  4UXU A;  5KE4 A;  5AFJ A;  5AFM B;  3EHZ A;  2BYS A;  3RIA A;  4TNV A;  2YME A;  2Y56 A;  4PIR A;  2BYR A;  3WTH A;  3PMZ A;  3RQU A;  4LMK A;  3WTM A;  3JAE A;  2WNC A;  2WNJ A;  4A98 A;  4IL4 A;  3SIO A;  4ZK1 A;  5HEO A;  2BG9 E;  1OED A;  2Y54 A;  5AFN A;  4ZJT A;  3TLW A;  4UY2 A;  2Y7Y A;  4IRE A;  2XNT A;  4QH4 A;  3T4M A;  3WIP A;  3P4W A;  3UU6 A;  2X00 A;  3U8M A;  3TLT A;  4F8H A;  3U8K A;  4ZRU A;  4HFE A;  4QH5 A;  3UU3 A;  2PGZ A;  4HFI A;  2YOE A;  5BRX A;  5FJV A;  1UV6 A;  4NPP A;  4ZK4 A;  3IGQ A;  2YN6 A;  5HCM A;  4TWF A;  2XYS A;  5AFM A;  2XQ9 A;  2XZ6 A;  5AFK A;  5HEG A;  2BG9 B;  3WTN A;  3PEO A;  5L4H A;  2WZY A;  3EI0 A;  1UX2 A;  4LMJ A;  4LML A;  2X00 D;  4UM1 A;  4ZZB A;  2ZJV A;  4WV9 A;  3WTJ A;  5AFH A;  4AFG A;  3SQ9 A;  4TWH A;  4X5T A;  1OED C;  5LG3 A;  4Z90 A;  2LLY A;  2BR7 A;  2LKH A;  5J0Z A;  3UU8 A;  4BFQ A;  5J5I A;  4XK9 A;  4HFC A;  4ALX A;  4XHE A;  5BW2 A;  2XQ4 A;  3UU4 A;  4QAC A;  3U8N A;  5HCJ A;  3C79 A;  3WTO A;  2XQA A;  4HQP A;  5LXB A;  2C9T A;  2XNV A;  5AFL A;  4QH1 A;  5JME A;  2UZ6 A;  5CO5 A;  3U8J A;  2XZ5 A;  2W8G A;  3U8L A;  3EAM A;  2XYT A;  5BP0 A;  2LKG A;  4UM3 A;  2YKS A;  4QAA A;  3WTI A;  3ZKR A;  5HEU A;  1OED B;  2QC1 B;  2M6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...