3P4YA

Helicase domain of reverse gyrase from thermotoga maritima - p2 form
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
408
structure length
407
Chain Sequence
AAEFWNEYEDFRSFFKKKFGKDLTGYQRLWAKRIVQGKSFTMVAPTGVGKTTFGMMTALWLARKGKKSALVFPTVTLVKQTLERLQKLADEKVKIFGFYSSMKKEEKEKFEKSFEEDDYHILVFSTQFVSKNREKLSQKRFDFVFVDDVDAVLKASRNIDTLLMMVGIPEEIIRKAFSTIKQGKIYERPKNLKPGILVVSSATAKPRGIRPLLFRDLLNFTVGRVSVARNITHVRISSRSKEKLVELLEIFRDGILIFAQTEEEGKELYEYLKRFKFNVGETWSEFEKNFEDFKVGKINILIGVQAYYGKLTRGVDLPERIKYVIFWGTPSGPDVYTYIQASGRSSRILNGVLVKGVSVIFEEDEEIFESLKTRLLLIAEEEIIEEAEANWKELVHEVEESRRRSER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conformational Flexibility of the Helicase-like Domain from Thermotoga maritima Reverse Gyrase Is Restricted by the Topoisomerase Domain.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Isomerase
molecule keywords reverse gyrase helicase domain
total genus 146
structure length 407
sequence length 408
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3p4yA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3p4yA02
2IYYA 4XWKA 3SDZA 721PA 2FGJA 4KYIB 4MH0R 3ADDA 1NIPA 4LYHA 2HYIC 3FYHA 1L4UA 1YQTA 3ONWA 2R9VA 3CRVA 4RCZA 3SYKA 5FR1A 1NVXQ 2PMDA 4OQMA 1KAOA 5JHGB 5KNCA 3NH6A 3MUFA 2Q0HA 2VHTA 1CF4A 4F4CA 4K81B 5SZKB 4H9GA 3ZS9A 1NMZA 2CVHA 2PH1A 2REOA 4N3NA 5F2EA 3DM9B 4DKXA 1FX0A 1CXZA 3FTQA 1N0UA 3L8ZA 4ZCLA 2QTHA 5CK4A 2CDNA 3LXRA 2CK3D 4P3YA 5FL7D 5FUVA 2WBLC 1FUUA 2DFNA 2F1JA 4DEYA 3GLFE 3DPUA 1JB1A 4Q4HB 3LV8A 2VP2A 3ZQ6A 1KI3A 1KI6A 1G8HA 1RRCA 1OH6A 1J8YF 4A0FA 1DG1G 5HR5A 2V8OA 4MITA 4B75A 1BMFA 4L8GA 2QMOA 3WBKA 3U7HB 1JR6A 3SEAA 2F55A 2YNMA 3AVXA 2BCJQ 2F9MA 3DKVA 4LV8B 4V0MA 5DO9A 2QTFA 4PSKA 3WNCA 3LAWA 1TF2A 5FOXA 4BZQA 4D4LA 4IDPA 2A5GA 2F1IA 1M7GA 2J0SA 1US8B 3DMNA 3X1WA 3LW7A 4GMDA 4JMPA 4JLNA 2OCYC 1ETUA 4PHGA 3QXSA 3W3ZB 5EP1A 5EXPA 3DVLA 3SOPA 4KV9A 4C7OA 3RS0A 2IYZA 3Q3JB 4C0LA 1TADA 3A1TA 4OJKA 2P65A 1EX6A 3IHLA 2ZETA 3AVQA 5TVKA 4LC0A 4O3MA 3TSZA 1VECA 1J2JA 4GBMA 2O0KA 4Q1BA 4A0RA 1OF1A 1SGWA 1Z2AA 4PO9A 1P7CA 1IY2A 2WPDA 2IS6A 4RFSB 5BW8A 1E99A 1XMVA 2JJ2D 1MR3F 1XTJA 2D2FA 5AR1A 5FPKA 4B6FA 2GVDC 4EJSA 5J4KA 1BMFD 3DMDA 2AFHE 4FMDB 4LCBA 4O2LA 5JRZA 1JAHA 2H57A 4KCGA 1CBUA 1HE8B 4ZDJA 1YKSA 4IDOA 1YVDA 3AVWA 4QL3A 3W8NA 3AUYA 1A4RA 4XD7D 1R5NA 2FA9A 4JYBA 2RGBA 4PC6A 4TZ6A 5BN3A 1SVKA 2ZI6A 3CX6A 3EARA 1DEKA 1DVRA 4BFTA 1R2QA 4KFRA 3PENA 4Q00A 4GOJA 4JS0A 5L3RA 1KI8A 1W1WA 2PL3A 4HLUC 4GZMA 3RS7A 1W36D 4AWXA 4EFNA 3IIKA 2EU8A 4GRAA 2IK8A 3K0EA 1XTRA 2XEXA 1T3LA 5EJEA 2ZR7A 4M4SA 1R8QA 1XD2B 4QJ3A 2QMHA 3CF0A 3MAAC 5B58C 2GCOA 3GLHA 5EUQB 2VP6A 1IXRC 1X3SA 2C8VA 4MDEA 2GCPA 5EXXA 4NCHA 1T5IA 5GVRA 2QQEA 2V1XA 1I2DA 4FXPA 3PJRA 3FPAA 4B76A 4B33A 2RB4A 4GI7A 4TT3A 3P20A 4LDJA 3F5FA 2NO1A 3A4LA 2CLSA 2I4IA 5JFGA 1WBDA 4JZKA 2VPPA 4JVSB 4LJYA 3F8TA 4M1MA 3T06B 4URVR 4G5SA 4CIDA 1Z6YA 1QVAA 1AQYA 1G7CA 3GLIE 1E3MA 1GNQA 1IN4A 1P2VA 1R6BX 2WWWA 5BYKA 1LNZA 1TQ6A 2XOKA 4TL6A 4R98A 4LUCA 1ZU4A 1YRBA 5IK2D 1QHXA 3AGQA 2JLSA 2NZJA 1U0HC 1GL9B 2Q9BA 4KI0A 2C98A 1UF9A 2OBLA 2HCBA 2N42A 4TMKA 2R6AA 3DHWC 5HKKD 1Z6TA 4QGFA 4NKRA 2LKCA 5LB4A 1GVNB 1XXHB 3WNDA 4KODA 2WSSA 5CIQA 3QPUA 2D7CA 2VP0A 3NTUA 2O8DB 2ZUDA 1TMKA 2H18A 2OCPA 1IONA 1RVDA 3I5XA 3EA5A 1WE2A 2VHJA 2QTVB 2C9YA 4E07A 2HEIA 3K70C 1CTQA 1O87A 3AF3A 3MD0A 1A1VA 2GJ8A 3FGNA 1JBKA 4TLAA 3EZ6A 3UATA 3U44A 3BERA 1CIPA 3GJ5A 3OEEA 3O8RA 1YR9A 5C4MA 3WRXC 4Q47A 4MA4A 2H92A 4AK9A 3W90A 1NMXA 1P9RA 2NOAA 3H84A 2X77A 2J0VA 1NVVQ 4TSFD 2XZPA 3V00A 1IJEA 2ODEA 4RSGA 1W5TA 1RPZA 4B3DA 1SXJB 2A30A 2R6FA 1JR3D 1P2UA 2Q6TA 2QPOA 2ZYUX 2IS2A 1P9NA 3D3QA 4Q1AA 2GXQA 1D2EA 4KLZA 4OKSA 3U5ZB 3C4JA 2D2EA 421PA 1OFHA 5CITA 4ESVA 5J4HA 4QNRA 4GFDA 1RIFA 4E03A 2RH5A 4NYMQ 2ZITA 4TQAA 4DCUA 1XP8A 2JJ1A 4Q4JB 1DAMA 1M8PA 3QJYA 4RKFA 1WQ1R 2RAPA 4M0LA 1JEDA 4EPWA 1Q1EA 5SZHB 4CYMA 1WB9A 2IWRA 1FFHA 3TW8B 3ZVLA 2GZHA 4AKGA 2ONKA 4MRVA 5J5CA 1UKEA 1MH1A 2XB4A 1P72A 3OHMA 4UNNA 3AEZA 4DB2A 2Y8EA 1AGPA 1ZNYA 3KFXA 3E70C 5JWRA 1ZUNB 2B8WA 2FFHA 1X1SA 2QQ0A 4RFSA 5AUQA 1JXOA 2HV8A 1GNRA 2G77B 1Q3HA 3PUVA 2WSSD 1Z28A 3PG5A 3QEOA 3RS3A 2BC9A 3FMOB 5JSZB 4H1VA 1WA5A 1VIAA 2R8RA 2G1JA 2IC5A 4KSCA 6Q21A 2V3CC 2OFOA 5E7MA 5JLJA 2VO1A 1KSGA 1M7BA 2D74A 2QBYA 4D25A 1LW7A 1BO6A 5JI2E 2O8FA 2AWOA 1ANKA 1OIXA 1NN5A 4ZDIA 3QKSB 5FPTA 3W9YA 2OG2A 1EGAA 2XNDD 2O8CB 4S2EA 2VIIA 521PA 1FTSA 3T34A 1OT3A 3IGFA 1BH2A 1G3IA 5FR2A 3MWYW 1KK1A 1YR6A 3HU1A 3NHBA 3SS8A 5F9FA 5HE8A 2YWHA 3VTKA 5GVSA 4B3FX 1RYFA 2ZE5A 3TAHA 1MV5A 3IDQA 4IKEA 4Q7MB 1KI9A 1W5SA 2NO7A 3AF1A 4P0TA 1VYVA 4OHYA 4LV5B 2OBMA 2D06A 5F9HA 5JWOA 3AVYA 1SVIA 2E1RA 5CM9C 2R6CA 3GD7A 4D0NA 5IT5A 4Q9HA 2JLQA 1TU3A 1QHSA 3QKUA 2DFTA 1KMQA 2HJVA 4JT2A 1D5CA 2DCUA 3TJZA 3MGCA 4UQOA 4CEJB 1BKDR 1ZP6A 2N46A 1Q1QA 3EZ7A 3IQXA 3CRRA 1QHHB 3Q5EA 4A1FA 2ZR9A 2GK6A 2MMGA 2REXB 4QOSA 4JVMA 4JBWA 5KTYA 5KYKA 4C0QC 3VNUA 1E2EA 3RLFA 3IHWA 4ZCIA 4Q9IA 1U9IC 3TSOA 1NVWQ 1F2TB 2H5EA 3FWYA 4EJSC 3ND9A 2IYWA 1XJQA 621PA 5LDDC 1GFIA 4HAZA 4D6PA 3GLIA 1P61B 4DSOA 4JLPA 4ABYA 4IOJA 4Q4HA 4KJZA 3U3JA 1PVOA 3RC8A 1KI6B 1LS6A 4Z1MA 4GT1A 1OE0A 1W4CA 2FGKA 5SZIA 2CNWD 4JL8A 1Z0AA 1ELOA 1M1YE 2AX4A 4C2UA 4AC9A 1E2MA 2GF0A 1FZQA 1XXHE 1FUKA 5JRJA 2IS1A 4NU0A 4AKHA 1H8EA 3BH0A 3QPWA 1CU1A 4DB4A 3QIAA 1VMAA 4OHXA 2IYLD 3MJRA 3ZVNA 4MQBA 3WMFA 3U4QB 3VKWA 2BMJA 1JEEA 5FTLA 2CE7A 4NP6A 5FOWA 2J7PD 3VU9A 2EYUA 3G82C 5JJIA 4I1SA 5K8LA 1PUIA 3BC1A 3FOZA 1MABB 2W58A 4JSYA 1E2GA 2DPXA 3ECCA 4NL4H 3AVTA 5AUNB 2XTNA 5FPYA 1QRAA 4ZDKA 1OXXK 3UMRA 4D4JA 3RAPR 3NDPA 5CJ2A 4NDZA 5JJKA 2BM0A 4RJLA 1NY5A 3B1YA 4B44A 4B3XA 2KSQA 1P60A 1FQKA 2FMXA 1AK2A 3BS4A 2A5YB 1XEWX 4JLBA 5FL3A 3M1IA 3QVVA 2DWOA 4D82A 1R0XA 4DIDA 1J99A 1Z0IA 3IBGA 2BKUA 3TRFA 1N6KA 4CF7A 2PEZA 3EZFA 3WBJA 3I61A 3AKEA 2UVQA 1U94A 1VCNA 5BN4A 2FOLA 2GRJA 4AKEA 4OI4A 1SVWA 2WMNB 3CO5A 1BOFA 5FTKA 2J1LA 3CRMA 5CDFA 2ZTSA 1ZAKA 1Z0FA 1E4YA 1X1RA 5KHOC 4U7DA 3EC2A 4C0BA 1XJ0A 2QA5A 3AP2A 3RC3A 1BYIA 2QUZA 2PT7A 2IXEA 2JASA 4MRRA 4PO8A 1E6CA 1E79D 2R65A 1KDRA 4S35A 1VTKA 2CL0X 2JAQA 1AKEA 3X1YA 3OAAA 3CB4A 4GOKA 1FP6A 3B1XA 4EFMA 3MLEA 3BBPA 4LPSA 1HA3A 2O52A 5KSOA 4JVNA 2BM1A 1JXMA 2ZJYA 5C18A 4ARZA 1ZC4A 1JJVA 4A6XA 4LI0A 2VP4A 4TL8A 1SXJA 3LXXA 1AA9A 2WWGA 1GKYA 1OXSC 3QVUA 2PZEA 3LLMA 3K8YA 3EIEA 2VTKA 1Q20A 2ZSBA 4MKFA 4LBVA 3E1SA 5ANRB 2GCOB 8OHMA 1IOZA 1W4AA 2ZJBA 4E09A 2JLYA 1N6PA 1U9IA 3QKSA 3I8SA 4KU4A 4D0LB 2QM8A 4NCJA 3I1FA 2GEVA 3AF0A 1ZBDA 1MRNA 1ZM3A 3B8HA 2EFGA 4AKIA 4QC2A 1I2MA 3LBHA 3DDCA 1Z5ZA 1TEVA 3K09C 5L3VA 5FOSA 1K5GA 1IN7A 2V7QD 1ZUHA 2QMEA 1K8RA 2J0UA 1GZSA 3JZAA 4Q7LA 1V43A 4URWR 3CBQA 4RZ2A 1F6BA 1II8A 4PQRA 3DOEA 2ZRKA 3C7KA 3UPUA 3FB4A 5JEDA 2QP3A 4PQYA 4D80A 2LCFA 1XMIA 2CLCX 4WBSA 2FFAA 2WHXA 1SKQA 1E1RA 5A4JA 2G1KA 4X8LA 2Q21A 2P3SA 2IEYA 3M0EA 2WOOA 2UKDA 1HEIA 4IVRA 2GJ9A 2ZS7A 4LBYA 4RD2A 3N2IA 2FG5A 2WWFA 1QG2A 1QHNA 1RRGA 5JSZA 5H8WA 5B57C 3VR4A 1ZM9A 4B2IA 1VIYA 2BBTA 3ZIAA 4M1SA 4Q4LA 1G3RA 4F92B 2VHCA 2VF8A 2J45A 2ZR0A 1SZPA 4GOXA 1F48A 3LX8A 3VAAA 1GOTA 1UJ2A 2YWEA 1TEXA 2WWXA 4L16A 4TMXA 2QENA 2EFDB 1XEXA 3ASYA 3EIQA 1XPRA 3U3KA 2IL1A 1KJWA 2ZAOA 4QG7A 3OFND 3NDBB 3DL0A 1AM4D 4QBHA 1E69A 1DG3A 4BFVA 1XB2A 2ODNA 2OAQ1 4BFYA 3GLIB 2PT5A 4URZR 1RRFA 4KVAA 4L9SA 5TARA 3TK1A 1J8MF 1ZINA 5HTKA 3THWB 1CLUA 3SYNA 2R62A 3WP1B 3LBNA 1NVVR 1VG1A 2XJ9A 4RD1A 4TL9A 3HWSA 3KDSE 1E1RD 1NP6A 1E2NA 5IF9A 4DLRA 1E0JA 1AS2A 4HYYA 3TH5A 3K0FB 3AKCA 3GP8A 2ZRNA 2OLJA 1EFRD 3KJHA 1U8YA 1QZXA 1ZNWA 3BFKA 2ANBA 2EVWX 3B13B 1CR0A 3U4QA 1DPFA 2H1LA 2JJ1D 2ZVPX 3QBVA 2O8BB 2C96A 2J0UB 4LJAA 1CJVC 4W5JA 3CKLA 4PPFA 1E98A 4TMVA 4O2RA 3UANA 4A6PA 1UBEA 2V7QA 3AKDA 1UFQA 3KTAB 3M6AA 1DBSA 5J4VA 4B48A 4KXFB 4FI3C 4G5OA 1HYQA 1KO5A 4I81A 4M1KA 3W34A 2DYKA 4U5XA 1CKEA 1Z0DA 2D7DA 4FCWA 2C04A 4URUR 1T3HA 3UIEA 3A6PC 5FOVA 3RYTC 3GLGB 4JKYA 2PJZA 4IXNA 4Q18A 4RD3A 5D3MB 2ZSEA 4Y0VA 3ADKA 2AHOA 2JDIA 2CHGA 5GADl 2LWIA 1EXMA 3B9PA 2HT6A 4KVGA 2J0QA 5H70A 5TV2A 2BWJA 2Z6VA 3B9QA 1KO1A 2CCGA 1VCMA 2BJWA 4LHZA 4OBEA 4P4SB 5FBRB 4CEIA 1XNJA 4EKDA 4JVLA 1UBGA 1XMJA 4X8OA 2YOHA 1GAJA 4BRUA 1F5NA 1IN6A 1KYIA 3B2EA 4Q1CA 2GWHA 4MGZR 1T3SA 1E79A 3GFTA 1GTVA 3AUXA 2VHQA 3W3AA 2ZRLA 4CZ2A 5CB6A 1UAAA 4M53A 4A0GA 4DDUA 3PQCA 5E7IA 4L4UA 3FHCB 1WBBA 1SQ5A 1E4VA 2ERYA 3P4XA 3K0AB 4XVUA 2Z4SA 2C03A 1QF9A 2G9NA 3VU9B 1R8SA 1ZIPA 2ZJ8A 2BCGY 1G7RA 4ARZB 2GESA 1E2KA 1KTVA 1D2NA 4HB2A 4HDOB 3RHFA 4R7ZA 4NCKA 2WAYA 3SE0A 2JLZA 2Q3FA 1P9WA 2F1RA 3AGPA 3D31A 3HU2A 2XX3A 5KSYA 4TYPA 3SQWA 2MSCB 2GAAA 1L2TA 3GJ0A 1R5OA 2F1HA 3PEUA 1CJTC 3THXA 4LK2A 3Q9LA 4ON9A 4A8JA 1EFUA 3GQBA 4IDNA 1XTSA 2BBWA 1G4AE 3OE7A 2V9PA 1Q44A 2GILA 1TF7A 1YHNA 1IY1A 2JJ2A 1IAQA 4PZYA 3CNNA 4DUGA 5HZHA 1ZJ6A 3KQNA 1OH5A 3OIVA 4FIDA 2ZPTX 4MRSA 4W9MC 2QG6A 2RGXA 2ODBA 2KI5A 4HB4A 2BMFA 4JLDA 1KDTA 2O8EB 4NONA 3U6BA 4A92A 1NN0A 2P0EA 2FH5B 3G0HA 1JECA 5L3QB 3KX2A 5LBIA 2CMKA 4TYQA 1ZM2A 1XPOA 1IJFA 1Y3AA 3W6OA 2QAJA 5EZ6B 1WRBA 2E87A 4C30A 1FQJA 5JS7A 1IXZA 1PLKA 4FWTA 4HAXA 3E5HA 1QHYA 3HDTA 3Q7QA 1G8PA 4UNSA 3ZVRA 1XF9A 1F2TA 4BECA 2N1BA 2F7SA 4NH0A 1XCMA 1LTQA 2J59A 2Q3HA 3K9HA 4XTCS 1D9XA 4Y0AA 2FFBA 3A4NA 4Q4AB 3PEWA 2ZYWX 4RZUA 3O8BA 4C0JA 3FHOA 1DAEA 4NE2A 3QOFA 1CR2A 3OIWA 1AGRA 2BMEA 5FBLB 1TQ2A 1XMSA 2YC2C 3AB3A 4QFMA 4GP6A 3CH5A 2W83A 2ZQ5A 2NTYC 5CYPA 4A82A 1BIFA 5F98A 5HCNA 4DUGD 3KB1A 5UKDA 4KBGA 2CHVA 4ITRC 1ZNZA 4P32A 4Q21A 1P3JA 2ZI3A 3K0AA 4PPGA 1ZVQA 3LA6A 4FW9A 1XZPA 4DDTA 4G5QA 3JZMA 2IXGA 2O0HA 4LJ8A 2F3RA 2OHFA 1KGDA 1ZD8A 5E4FA 3CNOA 4BZPA 3B1WA 2JLXA 3PFIA 5G53C 3THWA 2QE7D 4G1UC 2W2XA 2FJUA 5DNYB 5BYJA 5FPHA 3LY5A 3R8FA 4TYWA 1SXJC 2A3RA 2VA8A 2FDCA 1TL7C 3BH6A 3PUWA 3W5IA 1XEWY 4UXJA 2C5LA 3ZZUA 2AL7A 4GDFA 4MDFA 1G1MA 2IW3A 5FI0B 3KQHA 4PC1A 2WWHA 2H7VA 1JPJA 3CWZA 2IYVA 3G5UA 2P5TB 1X86B 4LHYA 3AV0B 2B7CA 2BOVA 1E2DA 1OXUA 1W4RA 2ZRFA 3LDAA 4DLUA 4PXAA 4B74A 2G88A 1NLFA 3FVQA 2Z83A 5EP3A 1NLYA 2ZAMA 5EE9A 1JPNA 5JZVA 2VBCA 4DIEA 2JCSA 1TUIA 5KDLA 5FUWA 2CLDX 4XSGA 3BFVA 4B73A 2NO9A 3T12A 1RZ3A 3AVPA 4BPBA 1C9KA 3VR1A 2FF7A 3PXGA 4U00A 4PHFA 2G3YA 4US2R 1TTTA 1VHLA 3GCGA 3OIYA 2W0MA 1L7VC 2AKYA 4Q02A 1U2RA 2WAXA 4FCVA 3A8TA 1VG0B 4L5BA 3ZH9B 3U3MA 1N6RA 1U8AA 4RD0A 4A36A 3DOFA 3H1TA 5BWMA 5CM8B 3K53A 2OT3B 1YJ5A 3HPQA 3ZDQA 1WCV1 2ATXA 1E2JA 4BWYA 2WVJA 3WXMA 4DLTA 4F4JA 1KHTA 3K70D 4FWIB 2A7QA 4KYUA 3ICEA 4GPTA 1U99A 2ECKA 1K6MA 2XTZA 3NG1A 1SHKA 3RRZA 3TQCA 1Z6GA 3TUZC 4G0NA 4QBIA 3RS5A 4C0HA 3SN6A 2IEZA 3E2IA 4NYIR 1RJ9B 2VSXA 1NY6A 1CR4A 3AM1A 2QROA 2VEDA 2XNDA 2ZROA 1UEIA 4UXHA 5B64A 3KJEA 2QAGC 2V6JA 3KJIA 1KDOA 3TNFA 5CB8A 2P67A 3IBYA 2YHSA 2XXAA 4B47A 1ESNA 2QN6A 4M21A 1E2QA 1DO0A 2EW1A 3VKHA 2F3TA 1Z0KA 4N0EA 4NYJR 5DI9A 4O25A 2PX3A 2VLIA 2C2HA 3S1AB 3IUYA 3GFOA 2XGJA 3QKTA 1CRPA 2WJJA 2QL6A 3BORA 1N6NA 5AK0A 3CRQA 3AQ4A 4ZO4A 2ZREA 4G5RA 3U2QA 5JCZA 5LD2C 4G01B 3VNVA 4KHZA 3A36A 3OE7D 2FNAA 4RZXA 3SJZA 1G8GA 2PZFA 4ACBA 4JYCA 4ZI3A 2O8EA 3ZIAD 2W00A 4XJXA 5BXQC 3KQKA 4CT4B 2Q3MA 1TU4A 2RMKA 1T8UA 5C2JB 4II7A 3FKSD 1W7AA 1G6OA 4QRHA 2ERXA 1Q12A 5KSZA 2HLDD 1OB2A 2OE2A 3X1DA 4A0HA 1NF3A 4G5GA 1EK0A 1PLLA 1EWRA 4B3CA 4HAUA 3CZQA 2A5DA 4V02A 1NSTA 4MUBA 3R9WA 3TE6A 2D62A 1COWA 2GVZC 1S4QA 1YZKA 3CPHA 4RZ3A 5EQTA 2CCJA 1Z0JA 1DTSA 4ZPXA 1TAGA 1S9DA 5TXGA 2PLFA 2QGZA 3DEFA 2B7BA 4QHSA 1AIPA 1G20E 2W6JA 1HY3A 5GJWC 3WYAA 3L0IB 3GLHB 4V0LA 3MWJA 2REBA 5IK2A 2YOFA 1ZM7A 4OI0A 4Z54A 4HATA 3LQRA 4NCIA 1BYUA 3GEIA 2OESA 4ASUD 1II9A 3L82B 3GJ6A 4C0SA 3GJXC 3QXXA 5EZ5A 1EX7A 4JKIA 2YJTD 4DEXA 2G83A 1Z6AA 2ZU0C 4QGGA 1TPZA 2ZJ2A 4PTLA 3QG1A 3LO5A 2RGDA 2DHRA 3EA0A 1DOAA 1N25A 4R9UC 3LQQA 4TLCA 1G8YA 3KTAA 5FBQB 3BE4A 1U90A 3M4YA 3CUEF 1AZTA 1CJKC 3UKDA 1N3BA 4HDQB 3R7WA 2BHRA 2NQ2C 3H4MA 3PEYA 1SHZA 5HE9A 4TLBA 4Q9LA 1N5JA 2KJQA 4B3BA 2GJKA 5CIWA 1P62B 1W36C 1SXJD 1DO2A 3EC1A 3I5YA 2R6GA 1IBRA 3TIFA 5LD2B 3TQFA 1S3GA 3R8CA 3TKLA 1ZRHA 2UZIR 3MFYA 1EFRA 1VCOA 1XD2A 1XTIA 2AXNA 5EP2A 4BEBA 1S8FA 2HLDA 1WP9A 3CH4B 4B43A 1G41A 1W4BA 3VR6A 5P21A 1T91A 2NG1A 4DRZA 4B32A 2OXRA 2FPLA 2KBFA 4HDCA 2CJWA 1AKYA 1HURA 2TMKA 5FUXA 2P6RA 2XNSA 5IHPA 1G16A 1W0KA 3PR1A 1GUAA 1RRPA 1T6NA 3HR7A 1U8ZA 2Z4RA 3KQUA 2BEKA 1EFHA 2X2EA 1W0JA 3QKRA 5DISB 1EFTA 4LZZA 2GETA 1P2SA 5L8VA 1TUEA 4OL0A 4QGAA 4ZI2A 1XFAA 1EWQA 1KO8A 4GMXA 3QY0A 2YKGA 2QMUA 4TZ0A 2JIZA 4AD8A 121PA 2LKDA 5KPJA 2OCBA 4J0QA 2WSMA 2ONJA 5KDOA 3QF4A 3SNHA 4B34A 2GHIA 2I1VB 2W2VA 2JJ8A 4TTRA 1UBCA 2DFKB 2NO6A 2QNRA 1RYHA 4WZ6A 4XSHA 5EUMA 1QHHA 3DKPA 2X8AA 4Q7JB 2ZS8A 1I4LD 2J41A 4DLVA 3R9XA 4PHTA 2QP4A 5BQ5A 1Q57A 4HZIA 2OZEA 2ZRJA 2YINC 2Q9AA 1SVMA 4LJ6A 4RD4A 1SVOA 4TMZA 3ZD6A 2DBYA 3ICQB 3CWQA 4XWOA 2L0XA 4LJ7A 2OSBA 1W36B 2H17A 2IA5A 2CHQA 1YR8A 3KXKA 3THYA 3R20A 1EFCA 2IYQA 2AN9A 1G4UR 4WXPA 1GITA 1QHGA 4OJQA 2XB2A 4UJ3A 4C3ZA 3RWMB 4DLYA 3NVAA 1VHTA 1VYUA 1SULA 4C9BA 2CL6X 5F3WB 3P32A 1OIVA 2ZYTX 3CIOA 1F3OA 4Q66C 4D81A 3FMFA 5A0FA 2W6ID 3P27A 1B23P 1OFTA 4BFXA 5DGXA 3UK6A 2V6IA 5EXSA 1KMHA 2VSOA 2O8CA 1EESA 5DLQC 3FFAA 3ETLA 3SZRA 3QQ5A 3OZXA 1Z6XA 1VYTA 4A2PA 3EASA 2IYUA 2WJYA 2ODWA 4MYCA 1MABA 3I4LA 1IHUA 1GILA 2UZ3A 1CP2A 1KI2A 4V0NA 5DHAA 2CEAA 4KITB 3C8UA 3LX5A 1J70A 1Z47A 3PCRB 4LRWA 1ZIOA 2A5FA 5L3SA 4KSBA 1RW4A 2JLUA 5EXTA 1E1QA 2J46A 2RKOA 3WHLA 3S1AA 1XZQA 5FPSA 5KDDA 2MSEB 2OXCA 2FX3A 1XPUA 3DM5A 4MYUA 3LW8A 5G41A 3IEVA 1AQUA 4AIIA 4CEJA 5JECA 1YZTA 1Z22A 5IDVA 4OI2A 5KOYA 4QNMA 1CJUC 4HLQB 3KKOA 4JJZA 1JALA 2BVNA 4M1WA 5JS8A 2O8DA 2FZLA 2GZAA 4LPKA 1ZCBA 2RGNC 3B60A 4I1OA 1LF0A 1ZM4A 2OFWA 3VR2A 2GK7A 2IF0A 4ESHA 4YDHB 1E9EA 3RS2A 4EPXA 2QY9A 3OF5A 4EQ6B 4CGZA 2AD1A 3R7WB 1CEEA 3U7EB 3U44B 3K9GA 4MKGA 4WVFA 4DXAA 1NMYA 4BFZA 2HF9A 4F91B 3QEJA 4NYMR 2Z5FA 3RRMA 3EPJA 2GAOA 3MWKA 2ZIAA 4GNKA 2F9LA 4POAA 1CR1A 2QGNA 1NIJA 4WW0A 1RKBA 3QXHA 2VP9A 1DAGA 2CBZA 2PMKA 4A2WA 4JJKA 3ZZ0A 4AG5A 4EAQA 4EIWA 3JVUA 5AJZA 1D8TA 2ZRCA 2YYZA 4XVRA 4B3GA 3EG5A 5DI3B 2PJRA 1XRJA 2IBMA 1ZNXA 2GF9A 4EUNA 3C41J 4LJ9A 3BIFA 3LBIA 4PQFA 3U7GA 2J5XA 3MG9A 1CJMA 1L4YA 1GSIA 3UXMA 3VR3A 5TY0A 221PA 4KFUA 2WKQA 1XWIA 1ZD1A 2ZANA 4PAOA 2EFEB 3L0SA 3QXCA 3GJ4A 1AZSC 1OIWA 2D3WA 2WM9B 2DR3A 2F6RA 1NL3A 3AP3A 4DT1A 2B92A 1G19A 4RD6A 3U61B 4YDSA 4IFBA 1JR3A 4KO8A 4NMMA 3TVDA 2RGEA 4FINA 1OPXA 3B78A 2ZVQX 4B35A 2XSZD 4BASA 1SVLA 1XD9A 4IOLA 4WAUA 3QE0A 4RVCA 3T5GA 1IN5A 5B2ZA 5EE3A 1F2UA 4URYR 4XTRA 5G3ZA 1ZMXA 3IEUA 5FBWB 1GNPA 3NBXX 4IW3B 4W5WA 1A2BA 4DSUA 2JIZD 2ZRHA 4IOMA 4V0OA 1N6OA 3I72A 1W49A 2WMOB 3VMFA 1ODFA 2IUTA 1SKYE 5GJCA 4ACAA 1FPMA 1NBMD 2MSDB 1H8HA 4TN1A 2R2AA 2AWNA 2PBRA 3K0CA 4I99A 4KBFA 3MWLA 4O0MA 4PAMA 3KXLA 3A58B 4Q1DA 3UG7A 4OQXA 2XOKD 5FTMA 1UBFA 2R6DA 3N2EA 1MT0A 3BRWD 3CPEA 3IO5A 3CLVA 1D9ZA 4LX0A 1JQLB 1UKYA 4F4IA 4NCNA 3AVUA 4CDGA 1HT2E 5CDFE 2IUSA 4MRPA 4Q9KA 4R2HA 3A1WA 5HKKA 3X1XA 3IPXA 4EPTA 5JJLA 2NZ8A 1UDWA 1KK2A 5D3QA 3RSOA 1P75A 3QI2A 3T1VA 4EDHA 4U02A 4DSTA 3MSXA 2WWIA 4OYHA 3PUXA 4HUQA 3KKPA 1YZQA 2JLWA 3AP1A 3OESA 4YLGA 4TQ9A 5DHFA 1OLOA 3GJ3A 3U6KA 3SFZA 4MGKR 4TT3D 1Z83A 1A7JA 1PV4A 2WJVA 4GL2A 3IQWA 1GRNA 3AF2A 1E32A 4PANA 4DLWA 1TX4B 4DT1B 3V4RA 2HT1A 3TW4A 2QRZA 4MKHA 4Q48A 4MUAA 4UJ5A 2EFHB 4Q01A 4R71A 2QM7A 1G5RA 1IXSB 5DYIA 1JQJC 4HAVA 4KAXA 1H65A 4A4DA 3PVSA 1T4GA 2BEJA 3SHWA 2NO0A 2YC4C 1DAIA 1KSHA 4CVNA 1F2UB 1P4SA 1OFIA 4DWJA 1XXHA 1MO5A 5ELXA 1XU4A 4MGIR 3SJBA 4BUJA 5K8IA 1GL6A 4DVGA 1NNEA 4MYHA 2ZI7A 1TQ4A 3QF7A 1KSFX 2FSGA 2WPDD 4ZIRB 5DN6A 1DARA 3SFVA 1N6IA 1FOEB 1OJLA 1N2CE 2ORIA 2IF2A 4FMDF 1H8HD 1XCGB 5AUPB 3U3RA 3GLGE 1HQYE 4IVQA 4OHZA 4HLCA 2FFQA 5H1YA 2EFCB 2X19A 3D7MA 3K09A 4PC2A 4US1R 1KI7A 3PIRA 4BLSA 3GPLA 2VH5R 3BAFA 4TL7A 5LB2A 4AYXA 1R0YA 2KBEA 1M7HA 4B2PA 1OW3B 1G3QA 2JGNA 1OYWA 3NBYC 4FD2A 4D0GA 1G17A 4PAQA 2BIFA 1G6HA 1U0LA 3Q85A 2OBNA 1KOFA 1GG2A 3QKRB 4DLZA 3TVTA 4MRNA 2HF8A 3L0OA 4A8JC 1E2HA 1KI1A 1NG9A 1G9XA 2GJSA 4LHVA 5DI3A 2CL7X 2V4ZA 4UNPA 3BGWA 3AKYA 2VHUA 1NSFA 4B2LA 1R5BA 1ZU5A 3BK7A 2GXSA 4YXWD 4IEEA 4GSYA 1KKLA 2IYSA 2RGCA 5DN6D 2ZRGA 1MO6A 1Z06A 5FOTA 2OO7A 1DELA 3EZ2A 4BFUA 1UADA 3THOA 5FTNA 1U98A 1E9RA 5L3QA 3HU3A 1KKMA 2P5SA 3AVOA 4US0R 3W6NA 3D8BA 5AJVB 4C4PA 2ZJZA 3EX7C 2WKPA 1XCPA 3QXJA 2BMDA 1FX0B 2OM2A 4FMCF 1LY1A 2ZYVX 3IKJA 3TAUA 3OEED 2FEMA 4YQFA 2QAGA 4IDHA 4HSEA 3CR7A 2C78A 3NH9A 4X8MA 2XAUA 3NXSA 1G21E 1W48A 1YZNA 1M2OB 4FCTA 4Q03A 3TUJC 5JHHB 3AH8A 1NI3A 2JEOA 5FL7A 1W0JD 2ZEJA 821PA 5TMPA 4YMVA 2QT1A 5J40A 3B7GA 2WWYA 4ZIRA 5LPNA 1VPLA 1B0UA 5C1BA 4P33A 3C5CA 5J47A 3IO3A 4V0KA 3QSYA 1E0KA 2A2ZA 1GRRA 3B85A 4QM6A 1N5KA 4B71A 4DCTA 1A5TA 3W8RA 4TMTA 1YRAA 3I32A 4PPNA 2F43B 4WZAE 2KE5A 1HE1C 3X1ZA 1OXTA 2X1VA 3Q8XB 1NJFA 1C4OA 4DDVA 4A15A 4IXMA 1G5TA 2EWVA 1KAGA 3H0KA 4DCNA 1OB5A 2YV5A 2ZRPA 1US8A 4LV6A 3F3YA 3MJHA 4FN5A 2VRWA 1Q22A 4HB3A 1N6LA 4M8NE 1X6VA 4HEJA 1ONBA 3DO6A 2WIAA 1FNMA 1KIMA 1YR7A 4LC1A 4LY6A 3TUIC 2YWGA 4HAYA 4JLJA 1G3MA 1OSNA 3J81k 3ZJYA 5CLQA 4CEHA 1Z07A 2BV3A 1XD8A 4DC9A 4A8JB 1AS3A 3TR0A 1OHHD 4BZXA 3C5HA 2W6JD 3Q5DA 2QEQA 2BKEA 4QBFA 3LRPA 1IQPA 3QBTA 2JA1A 5J4LA 1JNYA 1RE0A 3ASZA 3O47A 4P4UA 1G7TA 2GNOA 4Z8YA 3B6EA 3ZGXA 3K0CC 2IHBA 2G6BA 3WMEA 3C14C 2C9OA 4JBXA 1IN8A 4FMBB 4UKDA 5DYGA 1J7KA 3T35A 2AD5A 4LBWA 1Q21A 5A5GA 3AF4A 1W44A 4UNRA 4OHWA 3OEHD 1C1YA 4QHTA 1T0HB 2K5UA 1NBMA 3OAAD 1TNDA 2ZRIA 3A37A 3N70A 1R0WA 2BBSA 1XEXB 3D6TB 4MYTA 2PEYA 3UMSA 3LNCA 3EWSA 4DSNA 3K9LA 2QRNA 5E3HA 4E22A 5HZKA 1W2HA 4M2LA 4A9AA 3UWOA 3EAQA 3RRNA 1GKIA 4DLXA 5JBQA 1P2TA 4I1UA 3WYFA 2H16A 4I4LA 3RWOA 5CJPA 3I73A 1DS6A 4GZLA 5KSPA 4ZKDA 4L15A 1FW6A 2B6HA 4NBSA 2ZI9A 4URXR 2OAP1 1A2KC 1ZW6A 3BOSA 3L0PA 3K0FA 2F43A 3LVQE 3KZ1E 1Z29A 5DH9A 5GJBA 3CONA 3T1OA 2ZJ5A 4HLUA 1YZGA 2BDTA 4Q4JA 3FKSA 4L9WA 4LYJA 4IRUB 2WOJA 4YMTA 1MKYA 3LFUA 4HUTA 3O8DA 1NKTA 1U0JA 2QI9C 3EZ9A 4QXAA 1E9AA 3BJIC 4ZKEA 1T0JB 3B1ZA 1G64A 4TSFA 4QM7A 3WRYC 3CX8A 4JL5A 3ZS8A 1Q1ZA 2E9SA 4TTPA 2VP5A 3UWKA 4IVPA 2FV8A 4JT4A 1R0ZA 2ZI4A 3MRSA 3P26A 1VG8A 3TBKA 3FHTA 2FZ4A 3X2SA 4TTQA 4X8HA 3ZVMA 4IDQA 3PEVA 2ZRBA 4AYTA 3HYRA 4F93B 3PUYA 3U7FB 4BFWA 5KPDA 1CULC 3IPYA 1UDXA 5E95A 3BD9A 2JDID 4BLTA 1LF5A 4RFVA 4BQSA 4HB0A 2C77A 2P6NA 1JAIA 3NC0C 2PZGA 4OQNA 3ZZTA 2V54A 4YC7A 3EW9A 1L8QA 1VKJA 4ILEA 4Q1EA 2Z0MA 4BLOA 4P4SA 4CEIB 2VSFA 2ZU6A 5EE0A 2JATA 4OK6A 3SR0A 4LJ5A 5KUTA 3O8CA 4Q5IA 1S2MA 2ZJAA 4BLRA 2QAGB 3A1VA 3GMTA 3MMPA 4YMSA 2JLVA 2AKAB 1KK0A 3HR8A 4EPYA 3V9PA 1X8KA 2ZUCA 3GFPA 3NEJA 4D4KA 1G8FA 2ZXUA 4XH9B 1P5ZB 5KNBA 4QGHA 3ADCA 1SVSA 1KK3A 2OFXA 4I1VA 4OQFA 2R44A 4D26A 1XJCA 1IM2A 2DFLA 3SBDA 1Z63A 1EG7A 2FEOA 1NN3A 4NHOA 3ZYCA 4LYAA 3P1JA 1N0VC 2YWFA 2ZM5A 3AVVA 5DSZA 2HXYA 4P31A 4TMWA 4JLOA 5H68A 1KNXA 3MCAA 2W6IA 4YMWA 1LFDB 1VG9B 3I92A 4D4MA 1LVGA 2WJGA 2GXUA 3GJ7A 1UPTA 3EPLA 1T9HA 3BB1A 1RJ9A 3BB3A 4F7WA 4PPQA 4N1AA 4ERNA 5HPYB 4HZUA 1UKVY 4XIGS 2ZJOA 3B1VA 1CRQA 4B6EA 2QE7A 1PUJA 1K5DA 1HV8A 2GDJA 2XXAB 2VL7A 2B21A 4DBLC 1NN1A 1ZD9A 1WF3A 3GLHE 4NYJQ 2P2LA 3KL4A 2WTUA 4LSGA 1D2MA 3TGPA 1E2LA 2RGGA 3FKQA 4M1TA 4M9XA 1KJYA 4V0ME 2RHMA 2QPAA 3U3OA 2SHKA 1G3UA 2AK3A 4W7SA 1COWD 1N0WA 1OYYA 3CF2A 5AJXA 3T1TA 1DE0A 2OUKA 3U60B 2FSIA 2ZUBA 3EWAA 4JLAA 1MO4A 1NVUQ 2W0SA 4DCSA 2PLRA 4K8OA 4Z1MD 1NLZA 2PCLA 4UNQA 1XTKA 1E2PA 1KO7A 1W46A 2QBYB 3LD9A 2QZ4A 3GLFA 1BS1A 2O8FB 3NHAA 2G0NA 2ZSFA 4G3XA 3W6PA 4LJ4A 3UMFA 4KLNA 1N6HA 4TWZA 3Q7PA 2A5JA 3I3SR 2ZSDA 2D4HA 2HYDA 4PO1A 2EQBA 2XSZA 1YZUA 1JI0A 2IYTA 3FMIA 3K70B 4JLVA 1SXJE 5FFMA 1R4AA 1S3SA 2IWHA 1VDZA 1WDTA 4Q19A 1E9CA 1VCIA 4LOAA 1KSJA 4EFLA 5EP4A 3WY9A 2FPKA 3TSWA 1G5PA 2CK3A 1KNQA 3EIHA 5CYOA 3QENA 2O0JA 5J4YA 5JMTA 4LWZA 3EPKA 4LBZA 2IHYA 3OIUA 4Q7KA 4Z8XA 3SQXA 2GEDA 3B5JA 3QUSA 1LS1A 4FMCB 1Z08A 4HAWA 4NTZA 4OI1A 1FTNA 1II8B 3EXAA 5FBVB 3EPHA 4QHYA 4PZLA 4DCVA 1XTQA 2GTPA 4KFTA 3NEYA 3H2YA 1AN0A 1E0SA 5FOUA 3OEHA 4DHEA 3ADBA 1IY0A 2WJHA 1T8TA 3T61A 3KFVA 1W2GA 1E94E 1QBKC 4DLSA 1DAFA 4M9SA 5K8TA 1XBTA 3GLGA 5E7JA 4YMUA 4WOPA 2WKRA 4Q1FA 4JSTA 3HJNA 4R2IA 2I3BA 1QHIA 3V4FA 1QG4A 2ORVA 2X2FA 1N5LA 2HCJB 3GJ8A 3A1UA 2XZOA 5JCPA 1GWNA 2B8TA 1U81A 2P6UA 2QPTA 3KB2A 3RNLA 1YZLA 2XITA 3CM0A 3HPRA 2GXAA 2IS4A 3KUCA 5CK5A 2BBOA 2WICA 4DZZA 3TLXA 1A82A 1M74A 3FDIA 1E1QD 4IJMA 1OKKA 1S1CA 1TF5A 5B30A 1KJZA 2FU5C 4QKQA 3F0TA 3CW2A 3FE2A 5CLLA 1FMLA 1UKZA 3KKQA 4UXIA 2XZLA 2VF7A 1XEFA 3NKVA 1OV4A 3QNUA 2J7KA 3KKNA 1AS0A 2GKSA 2GBLA 4LHXA 4D2IA 2EYQA 3REGA 2FPMA 2PX0A 4NYIQ 4OK3A 1JR3E 1M6NA 4PX9A 5AJYA 5AJWA 4C7OB 2DWPA 2QU8A 2VYFA 4A2QA 4AY2A 1E9DA 2J9RA 4IEIA 2AR7A 4KFSA 3Q72A 3ZLJA 3THXB 2FSHA 2FE4A 3RABA 1Y63A 2IYXA 5M04A 4CEHB 5AUOB 2OCAA 2W2TA 3L8YA 1OXVA 3SBEA 2I1QA 1Q3TA 4LYFA 5JI3E 4RY2A 2JLRA 2WV9A 1P6XA 2CNWA 4V03A 3T5DA 1RC8A 3LH5A 2WIBA 4QJ5A 4JBYA 3T1QA 2C9CA 4EJSB 1UEJA 2GA8A 4YXWA 1KI4A 2HDNB 2QSZA 4M9ZA 3RRYA 4HZUB 3VR5A 1GIAA 4GP7A 3KUDA 4NPHA 2PCJA 1KY3A 2IT1A 1S1MA 1V5WA 2YZ2A 2CCKA 3P4YA 3I8XA 1Z2CA 3CRW1 4JIMA 4Z51A 2DB3A 3IIMA 2EWWA 1W47A 1GKUB 4XD7A 3JVVA 4DDWA 1W0KD 2WJIA 2ZE8A 1PJRA 2OV2A 4PFSA 4M1YA 4E5UA 3PV0A 1G18A 2YVUA 5C4GB 4Q4AA 4JLKA 1T5LA 3THYB 4XOIA 3C15C 1ZYUA 1LB1B 2GEUA 4OK5A 5C46F 5DIFA 3K1JA 1KDPA 2QP9X 1D6JA 4PC7A 2AXPA 2DY1A 5BN5A 4JL6A 3GLFB 4QJ4A 4BFSA 2ZI5A 2CE2X 3A1SA 4IOKA 4QBGB 4TLDA 1PZNA 2CVFA 1HUQA 4MKIA 3W5JA 1P73A 2NGRA 3VQTA 2QORA 2HUPA 3CX7A 5DE3A 2Z43A 1KMHB 4PZZA 2A9KA 3VX4A 4BGDA 4IHQA 2YOGA 5FTJA 4BE7B 3GEHA 3QF4B 1NJGA 1OH8A 4M1OA 3CR8A 5AWFC 1X8JA 1I4DD 3BB4A 3NBZC 4C0AC 5EE5B 1S0UA 4AG6A 2ZE6A 5TB5A 2ZRMA 3LVRE 2MMCA 3WP0A 2GJAA 3QPVA 1NBME 1HTWA 4XVQA 5FH9A 4M9QA 4LGMA 1DAKA 1YE8A 4PSAA 4XWAA 4Q9JA 1AJEA 3DZ8A 1NG1A 1ZC3A 2GCNA 4F38A 1E96A 2VQSA 2IYRA 5D3MA 2RGNA 4PSVA 2OLKA 3TR5A 3REFA 1KZGB 4AI6A 1HH4A 3VKGA 4MGYR 3UG6A 1ZCAA 1FL9A 2J87A 3HP1A 3QG5A 2V1UA 4YONB 4W5HA 1ESMA 3SI7A 3T15A 2C99A 1OKKD 2NIPA 3CNLA 4LHWA 1MRSA 2IXFA 3SJAA 2ORWA 4PR0A 1Q1BA 3CZPA 4WIAA 3WYGA 1E9BA 1Q0UA 4CT5A 3LLUA 1GL7A 2O5VA 1HT1E 4BRWA 3WMGA 4EPVA 2OILA 3RVBA 3BWDD 4ZDWA 1CS4C 4RCYA 1S9HA 5G40A 3R9IA 3GEEA 2KB0A 3C16C 3SHFA 1WXQA 4ZV4A 2V55B 2CJWB 1MOZA 2GZDA 3SJCA 3LWNA 1DAHA 5JEEA 3WHKA 3L43A 2H8KA 1SKYB 1XDBA 1G291 4OQLA 4PC3A 4TQUS 1DADA 1NRJB 2ZRDA 4BLPA 5L3SB 1MO3A 2KWIA 4RKEA 4WA7A 1OFUX 1GM5A 4HUQB 1FNNA 1GDDA 3ZD7A 4HI0E 1FP7A 1RFLA 1HQCA 5TDHA 3KJGA 5GJVC 5FI1B 5G3YA 1Z8FA 1M34E 3FFBA 1KZ7B 1G7SA 3WNBA 3RANA 4BLQA 3DZDA 1H8ED 3CPJB 2HJGA 3BH7A 5FUYA 3I62A 1Z3IX 4AYWA 4ASUA 1E2FA 1E9SA 3OFNA 2J3EA 2O8BA 2ATVA 4WXRA 2CXXA 1GP2A 1KO4A 3NC1C 1II0A 4HLDA 4ZCMA 2J7PA 3BXZA 2G0TA 4M22A 2BJVA 1E9FA 5KU1A 3SC3A 2FN4A 3NBFA 1I4TD 3SYLA 4DJTA 2AK2A 3NIBA 1KY2A 3K9NA 1PLJA 4EQ6A 1UM8A 2HXSA 4TLEA 2ZRAA 2FSFA 4BEJA 2ZSAA 1ZUIA 1E0AA 4WZBE 1S96A 2ASEA 4N0DA 3KXIA 4K46A 2AFIE 5K8UA 5EE1A 3KQLA 3A4MA 3HYTA 1O3YA 5JWHA 5KNDA 2Q9CA 5HCIA 4C0KA 2NPFA 3VHLB 3VFDA 3PUZA 3VHXA 3N5CA 1QVRA 1J90A 2GBLC 4PHHA 1NKSA 2A78A 2RGAA 2XJ4A 1E2IA 2FWRA 3RDPA 3IIJA 1LV7A 2XTMA 3KKMA 4JLMA 4NZYA 1N5IA 2RHDA 2ZE7A 3RSLA 1JJ7A 2WZQA 4IFEA 1GRQA 1R7RA 4AURA 1XX6A 3ZQJA 2C95A 3BFXA 1R10A 2ZS9A 1WMSA 2NPIA 2OEPA 3SU8A 2IUUA 3B82A 3PITA 3CF6R 4TYNA 3TMKA 1F60A 3IILA 3L2OB 2DWQA 3NWJA 4OHVA 1QDEA 1X8LA 4EPRA 2ANCA 3FMPB 3VX3A 1FMJA 5IRCD 3H86A 1TQDA 4CW7A 1YU9A 5SZJA 4P4TA 3RS4A 4H1UA 2IX3A 2RCNA 1OHHA 4TYYA 1OH7A 5KO2A 4CRWB 3K0SA 2QSYA 2NMVA 2QT0A 3ND8A 4C2TA
chains in the Genus database with same CATH superfamily
2NVWA 1FU8A 1V0JA 1K0UA 2E2WA 3R3YA 4E11A 2OXEA 4XWKA 3KB8A 5JSHA 5DLYA 2PAAA 3DPIA 2HYIC 1YVPA 1QSGA 2GHQA 4MUIA 4YQYA 1YQTA 3JVEA 4AICA 3KAQA 3L0ZA 4BL5A 4E13A 4FSHA 3SHQA 2GLXA 5JHGB 5F12A 4P93A 2GD1O 1Y3IA 3GGOA 2YQ4A 2X41A 5DM1A 2R6JA 4F4CA 3NHUA 3K72B 3M4JA 3PQ8A 3ZS9A 1GQSA 5F2EA 1EM8B 3KZKA 1PF7E 3AJEA 2Q2NA 3KUUA 1C0KA 4LOHA 5G0VA 2GAIA 4M1ZA 4XM1A 3PR2B 1FX0A 4Q0MA 3WR5A 3FTQA 1XQVA 4KDRA 2I6TA 1VFNA 4MVJP 2A7XA 4FDLA 5HMMA 3T0GA 1YJCA 4W99A 3HXTA 4X84A 2H2AA 3WRWA 4DJEC 5CK4A 1UC8A 3OLQA 1IRIA 1GZ5A 1SQ0A 3LXRA 4YIHA 2BI7A 2XCTB 5HFNA 3VOBA 4DEYA 5LU8A 3GLFE 1PJ4A 2DG2A 3DPUA 3LV8A 2VP2A 4Q4HB 4R9VA 1KI3A 4RSHA 4U8GA 4LFCB 1J07A 1FFSA 4O4IB 2QUAA 3RYIA 1Z13A 4MVJH 5EKSA 2PX8A 2V8OA 3C6XA 4CQLB 4F1WA 1P4HA 1TYBE 3K8ZA 2VBGA 4F97A 2ASVA 4IZIA 5H0IA 1F9AA 4W6QA 4O8CA 3AVXA 5JS1A 2BCJQ 3IODA 4YGYA 1BKYA 2XYGA 1WABA 4V0MA 2VLBA 3CMCO 3A11A 3MPOA 4UUQA 4PSKA 4ER3A 2NUPA 1HDRA 4LDQA 3O38A 4D4HA 1TF2A 3LC1O 4PZAA 4BZQA 2WHYA 2B98A 2I4OA 1UFKA 1WDKA 2X2PA 2XUZA 3AI2A 3Q8KA 1J0BA 3L1UA 4FJ1A 2WRZA 4PCLA 1KVTA 3MJEA 1H0KA 3QXSA 3UH0A 5EP1A 3DVLA 4KG7A 1OI4A 3RS0A 4LGCA 2F3PA 3MBOA 4FKZA 2CFCA 3A1TA 4EENA 3AVQA 1NBHA 5JBNA 3AOGA 1N0IA 5E2AA 1VECA 4EGAA 5IDXA 4Q1BA 1EG2A 3GMDA 5HF6A 1Q7TA 4C6TB 1OF1A 3H2KA 3A9WA 3KSBC 4FOOA 4FB5A 4QQKA 2H1WA 2IS6A 2PX5A 2RHCA 2GPSA 3WGQA 2H31A 1P4RA 4RF3A 4CN9A 4ZAFA 1K06A 3OCWA 4AMZA 2F2TA 1PYDA 4B6FA 1WNFA 4J0CA 5FPKA 1SEPA 4MV0A 3DMDA 3OQVA 1B1CA 5DWDA 4HYQA 4O2LA 5LJLA 1NR5A 1WEKA 1HFJA 4FR2A 4F1JA 2CMFA 4YRLA 1HRKA 3GZNB 1YE3A 2QDXA 4LCEA 1NW5A 2VK1A 3QE2A 4IDOA 2DT8A 1KY4A 3RV3A 4M99A 1QCDA 1YHYA 2JFQA 3UMBA 1HEYA 1TVKB 3JVIA 2YY6A 4F9TA 1SVKA 2B1RA 3MT0A 3WLKX 1CUSA 2OORC 2Z5GA 1R2QA 1GV1A 3PK0A 1HSOA 4OXRA 4P4GA 4UDNA 3SDBA 3WQSB 3R3ZA 1MT3A 3J7AC 1KI8A 1W1WA 4MVJG 2ACKA 3EOBI 4MI9A 4EFNA 1OJ7A 2EU8A 1RAGA 3AR3A 3I2GA 3W79A 3HGMA 3ESYA 4ZYYA 1UP7A 4NOLA 4QNNA 1I24A 2ZR7A 3OE4A 1R8QA 2B99A 2G82A 3UOGA 3FMVA 2H1CA 2RGUA 4R8VA 3R4CA 5I9MA 2GCOA 3KLMX 5M29A 1UMBB 2A9QA 3GLHA 2R3SA 5EUQB 2OQIA 3BK1A 1Z4PX 4C1BA 5HTOA 2DTXA 2ZZMA 1V3TA 1HM5A 1X3SA 1OZGA 2BRUC 3FPKA 2GCPA 3QEAZ 3KV1A 4MDEA 1EB8A 1QP0A 2FSVC 1FDUA 4BGIA 1T5IA 2WJPA 3NHMA 5A62A 1KTIA 3I64A 2V1XA 4PXSA 2D5IA 4FXPA 4B76A 4V0RA 4TT3A 4LVOA 4LDJA 3KQSA 3F5FA 5ETJA 2F3SA 2I4IA 4HN4B 1WBDA 3BWVA 3I05A 1YTUA 2JANA 4JZKA 2P8JA 3F8TA 1GL3A 1NUUA 4RMGA 4URVR 3HB5X 4Y6RA 5JXHA 5MFZA 2ADMA 1FQOA 2XQIA 3M6VA 4G1BA 1E3MA 1PT7A 4FUTA 2PXXA 1P2VA 1IFXA 1O96B 1VJTA 1LNZA 2DVMA 1TQ6A 1EFVB 4G07A 5EKDA 3SFTA 2B2CA 3I6IA 4GICA 4LUCA 1I2CA 2YDYA 1YRBA 4ICIA 3TQTA 1I6KA 2RJ3A 5BYAA 1EK6A 1U0HC 2ZGVA 3M6LA 1ZJJA 5LQDA 2J6HA 1GYQA 2OBLA 2ZT6A 3QH4A 4OV6B 4BLPA 3DHWC 3WLSA 1EVIA 4KR3A 2A4MA 4NKRA 1I3OA 2DOKA 2LKCA 3LYUA 2YMQA 1XXHB 4UDXX 5B1EA 2WSSA 2G67A 3WSWA 1Y8QA 2EFYA 3QPUA 2D7CA 2VP0A 4MIKA 1Z4JA 5DK6A 3CBGA 3TD6A 5HQ3B 2R5FA 1ILEA 1GQ2A 4I50B 2OCPA 1XJ5A 3USZA 4N41A 3H8JA 1SUEA 2ZKLA 3EA5A 4UAUA 4ZOAA 2JLBA 4LA4A 1Z3CA 1KYQA 2CLOB 4BHTA 5JNRA 3K70C 3WLPA 3RW9A 1J5XA 3AF3A 4KE8A 1QOQB 1A1VA 2GJ8A 4PM4A 1Z88A 1J1IA 1AK1A 1JBKA 1UBUS 1C0LA 1LW6E 2RONA 3E15A 1FLDA 1M34A 3EZ6A 4MW5A 4O4JA 5HGXA 3U44A 4YJ3A 1CIPA 1HXHA 3JQ7B 1K6IA 3IULA 3T4XA 1N9KA 2ZBVA 2V6BA 3WRXC 2ZWMA 3R5TA 2H92A 1P5RA 2PUAA 2XIQA 4OU4A 3WBFA 4L02A 2BMVA 4GMHA 1KC3A 1ABEA 1P9RA 4GVLA 4RJKA 2J0VA 3KHTA 3F4KA 5CX1B 1IJEA 1L6IA 4XYEA 1NQ5A 2AC4A 1UBMS 3H7AA 1OX4A 2VJKA 2RJOA 3GRKA 3ILHA 3K6KA 3MS2A 4RVUA 4XFDA 3ZX4A 2R6FA 3D4OA 2IH4A 3LWBA 3D43A 3VO8A 5I9LA 2QPOA 3Q6MA 4MV5A 3MS4A 2X0FA 4IVNA 4Q1AA 5EPEA 3WLIA 4E3WA 1N75A 2D2EA 3B5EA 1QOPB 3C4JA 4MV3A 4DM3A 1FVFA 3K96A 3RAFC 2IP4A 3K73O 4I46A 4ESVA 1VIMA 1Z75A 1ID8A 3RV4A 2W8ZA 1NTOA 2NUPB 4EJ0A 4DCUA 1T6BY 2ZITA 1XP8A 2NUTB 4Q4JB 2H7CA 4TZTA 1L5ZA 3H2BA 1KXJA 1T8WA 1M8PA 1QUEA 1C8KA 2HO5A 3DAYA 3E0QA 5GIOE 2BKAA 5KX5B 4IIYA 4TTJA 3LKVA 2RAPA 4IRXA 2GI4A 4L27A 2E48A 4M0LA 3DOIA 1CS0B 4R2XA 3PNOA 3CYFA 5T4BA 4EPWA 1MH9A 1U2EA 2P2SA 2XMDA 1LLCA 2RCYA 3RIXA 2GZHA 3ZVLA 3N2KA 2J3HA 3VSEA 1V8FA 5FO0A 5H9WA 2W42A 1K75A 4WCFB 2F67A 4QEKA 4W5OA 5JH7B 3NBUA 3OTHA 1MH1A 4I9HA 4JJ6A 2DHDA 1HL7A 3SICE 3WS7A 5CVCA 3UQYS 3NKLA 5JAQA 1Z15A 4DB2A 2JCYA 3OUTA 1THGA 2O6HA 3ZCSA 1SHTX 5KZMB 1M1YB 3GBSA 2FWBA 4BO0A 1EE1A 2FFHA 1OU0A 2QQ0A 2CNLA 2HV8A 4P38A 4WCVA 1Q3HA 1N92A 2PD6A 2WSSD 5KKAA 2PIAA 4NAUA 3IE0A 5TJHA 2BC9A 3IHKA 1G2PA 1Y4DE 3PFGA 3JRXA 5B1YA 1KJJA 4KSCA 1AE1A 2HJHA 3L07A 2ZQYA 1KSGA 4YO8A 2DP4E 4BJ1A 1M7BA 2QTVA 2D74A 3F2IA 4KXLA 4OCZA 3SM9A 4R2KA 2QBYA 5TPWB 1BO6A 5JI2E 3CUVA 3ZXUB 3T3HA 3MQFA 1QIGA 2EZ4A 5C5EA 3M82A 4R6WA 2VYNA 4UW9A 3UJ6A 3OZUA 1RP7A 3OOJA 4QYWA 3W9YA 2OG2A 4E0BA 1BX1A 1IM5A 1IL0A 1ESZA 2AN4A 4MR9A 4S2EA 2VIIA 4GDMA 4TVOA 5AVSA 3I1YA 5BV2P 3LFTA 2WTEA 1OT3A 3T34A 6GPBA 5FR2A 5JVDA 4D8XA 5CMLA 2YWHA 1Y81A 2YS7A 3ESXA 4P5DA 1N8NA 4B1FA 1R6DA 2RE8A 4LNHA 3VXKA 3ROXA 2O2HA 2MWMA 1Y5LA 4IKEA 5DP1A 2F9FA 2AMVA 4MIYA 3TQSA 4J0JA 3WJ1A 2R8EA 3OJOA 4LV5B 4U7WA 5C8ZA 4B3TB 5I7EA 1TLFA 3P2KA 4URFA 4KO3S 1PJSA 2DBVO 3B52X 1SVIA 5A4AA 5FB3A 1AHPA 4F2PA 3TTTA 2APJA 4JQZA 2X5XA 1IEQA 3VNRA 4KGVA 4D0NA 4BMOB 3Q9NA 1EVJA 5IT5A 1P4JA 1USUA 3HKCA 2FLWA 3NM5A 1KMQA 2XB9A 3ZTWA 1Y5RA 1OMOA 2DCUA 2VP3A 3DH0A 3TB6A 2HI0A 2GF2A 3TZBA 1P29A 1BKDR 3R6TA 3HABA 4BFCA 1U9YA 4K3VA 1CUGA 1YOVA 4X60A 4J90A 5FA6A 4B82A 1YONA 3IQXA 4FFSA 4ZT3A 1S2LA 4QUDA 1X19A 4RMJA 3WB1A 1PFQA 3W9SA 1EE9A 4A1FA 4TKUA 1UKBA 3VVLA 1C4WA 2MMGA 2REXB 2Y1OA 4PAGA 4UREA 4UU0A 4JBWA 5E4TA 3WSVA 1FNCA 2ZT8A 1TEZA 1EP3B 3FCXA 1E2EA 4MEJA 2FSUA 4YBZA 3IHWA 3DOCA 3KWLA 2XNKA 2E5FA 1MFPA 1NVWQ 3ETDA 4JHLA 5I5GA 2H5EA 2GPBA 4PY2A 4ETMA 1ZVVA 3SBXA 1CQIA 3MWDB 5D5QA 4M76B 4RWEA 2IYWA 2PS9A 5LDDC 5JJBA 5EQDA 1ISRA 3MB5A 1QOZA 1RCTE 2BI8A 4IOJA 4MP6A 5KCZA 3VKFA 1U0BB 4Z1MA 3QWHA 1W4CA 4JC8A 2FGKA 2FPPA 2Z9DA 4JL8A 4RY0A 4I50A 2WR8A 1ELOA 5SZIA 1KAHA 1H2XA 3D8SA 4CFZA 2AX4A 2FWAA 1JYSA 1SU6A 2ZWPA 5AKKA 1D0VA 4MEBA 2WP8J 3DFFA 1FZQA 4NMXB 2E82A 3VR0A 2QW0X 5JRJA 2ILVA 2PA0A 3CSDA 3YASA 4PO3X 1A5AB 1Y3DE 2P9HA 4RA9A 1CYEA 1GPYA 1NW4A 2DBQA 3F6YA 4TWIA 4BBJA 5C4IA 3ZVNA 4MQBA 4UDOA 4S1NA 1WSWA 2CE7A 2FPGA 4WBNA 1PT8A 2QR5A 2J7PD 4PN7A 2X1LA 5KOJA 3CKKA 1UPXA 3E8SA 4NF2A 4KXYA 3L4SO 4RMIA 4BKRA 3EVGA 2NM0A 3JASA 5K8LA 1OXBB 1DFIA 1Y8RA 4W1SA 1PN3A 3STXA 1HYEA 1L1QA 3PLNA 4JSYA 3FUUA 4YJKA 3EAFA 3QPAA 1P74A 3LUAA 5AUNB 4CU5A 4F3YA 3UMRA 4Q3CA 2B94A 3RAPR 4D4JA 1TAUA 2RG7A 4IWXA 1RJGA 2VSQA 1FS6A 2QYHA 4RJLA 3UT5B 2VJMB 3ZCUA 5GONF 2A5YB 1XEWX 4JSRA 5CDHA 1Z7GA 3M1IA 3QVVA 2K2WA 3S2IA 2ZCVA 1R0XA 2R5NA 1J99A 3MMNA 3MJCA 1BS2A 1IWOA 2VI5A 1N6KA 5INTA 3WBJA 2BFDA 4NJMB 3AKEA 2D0PB 3I61A 2UVQA 4ECAA 1JHPA 5DBOA 2ZB7A 4KMOA 1VCNA 1IVNA 2NXWA 1NBOA 5JZ9A 2I1LA 2P4QA 2J1LA 4LZZA 1PO7A 2ZTSA 4Y6SA 1YQ9A 4I7EA 4FPXA 3E58A 1BCSA 3EC2A 4P3NA 5KHOC 1GNVA 2BL4A 2FE1A 2O3UA 3G9ZA 3ES9A 1WDWB 3HRHA 2PT7A 4M8IA 4MRRA 1FVHA 3EEBA 2PXHA 4HXYA 1KXZA 1KDRA 3DFZA 1OX6A 4G89A 1W59A 2CL0X 4S35A 3X1YA 2QV0A 2WY2D 4N0PA 3CB4A 4GOKA 1D2CA 3IP8A 2FPRA 3NANA 4GP9A 5JPIA 4Z99A 2ZYDA 4LPSA 3M6MD 1PL0A 4RIEA 1HA3A 1SG9A 4KUHA 5KSOA 4JVNA 2BM1A 2NYUA 2ZJYA 4BNGA 5C18A 1OYVA 1QANA 1R88A 2HGZA 3I53A 1JLSA 3OZSA 4IDBA 4ARZA 4LI0A 2VP4A 2RHTA 2K87A 2I4MA 5L4NA 1U4OA 1RYMA 3OU7A 2WWGA 1GKYA 2R4UA 4F5ZA 1SIOA 5PGMA 5THXA 2ZBUA 4JA2A 2BYTA 4X7BA 4G8JA 1X7DA 1R6XA 1V8ZA 1FRZA 3FYUA 1CVLA 2ZYSA 3LIIA 2ON6A 4AO7A 5ANRB 1Y9JA 3QLEA 1GV0A 3HCWA 4J07A 4KU4A 4X3PA 4FYJA 1ECCA 1T36B 1XTUA 3I1FA 3CLHA 4KXMA 3WIDA 1LPBB 1MRNA 1RC1A 3SZGA 3WV5A 3AHJA 2Z1MA 1I30A 5K0LA 4EITA 2GJ4A 4KQ1A 3DDCA 3ER8A 1Z5ZA 3W9UA 5DIZA 2FUEA 4ZVQA 3HJGA 2CD9A 1QPGA 1ZUHA 2QMEA 1K8RA 4XPIA 4WBXC 1OILA 2C42A 3CCFA 3JZAA 1V43A 3HXOA 1EJ0A 3PFWO 1II8A 4PQRA 5LNK6 1FLVA 2FY8A 2ZRKA 4LTMA 1FB5A 2BDEA 4A5SA 4CM6A 2GHTA 1ESDA 4PQYA 3BICA 2Y3IA 3PR3A 1APBA 2FFAA 2GT1A 3H5RA 4Y2TA 4YCCA 5L7YA 1E1RA 1V11A 1XKXA 2BHSA 1XDUA 5A4JA 4I9UA 4W6ZA 1OOEA 1P17A 1UBOS 4DMCA 5T8KA 1R3DA 1T1SA 2QWXA 3LRXA 2P35A 4HMQA 1HEIA 4R1PA 2PNJA 4B3XA 2HF7A 1C4XA 5KNDD 5EINA 4OMUA 4QO7A 2CVOA 5ITSA 1HKHA 3C3CA 4B2IA 5G1NA 3ZIAA 1JG2A 1KYVA 4PLPA 4LW8A 1RXIA 2GN2A 4R8LA 3ZD9A 2JPDA 3RG2A 1TLLA 4BC0A 5JAUA 1W93A 1SZPA 2ZR0A 16PKA 3VAAA 1JUDA 1HDOA 1UJ2A 5LP1A 3MRVA 3ZIDA 2I8AA 3HDQA 4L8VA 5AW3A 1HORA 2YWEA 5FUBA 4KN8A 6AT1A 3D4NA 2EFDB 1XEXA 3ASYA 1LDNA 1RPAA 4JQYA 3M4ZA 4CV1A 4MUHA 1ZOOA 1RJFA 4ZRMA 4MV4A 3GRVA 4XCQA 4TTAA 3HVUA 1IC6A 2XBUA 4GH5A 4MV1A 2DR0A 1O6GA 2PT5A 1VSTA 1RRFA 3ZY6A 4AP5A 4PSUA 5FV4A 1WETA 5TARA 4KDEA 2MYTA 1P81A 2VDWB 4EVIA 1NOJA 4F72A 1VLJA 2R62A 2MIIA 1B0AA 1V16A 1VG1A 3O1JC 5AYVA 3VZSA 5JD4A 3KDSE 3H5LA 3ENWA 5FBHA 3CH7A 1IG3A 3T9BA 5IF9A 5JNLA 4IILA 1M8GA 4HYYA 2ZAGA 3TH5A 1Z34A 2GZ3A 3K0FB 4G5FA 3GP8A 3FIUA 2ZRNA 4R8KA 3FZNA 4L4YA 1IB6A 3VPXA 1ZMTA 2BGLA 3EAGA 4BO8A 3GQBB 3U16A 1FYVA 1Q7RA 2EX1A 1MOQA 1DPFA 2PKWA 2HDOA 1TYDE 2JJ1D 3H16A 4GGPA 3AESB 5K3AA 3U1TA 4E2YA 4W5JA 2VAMA 3DL7A 3DTYA 3V8NA 4KWIA 2X6QA 4FYXA 4TMVA 1JZTA 2J3DA 5AO9A 2Y71A 2OSVA 3SGLA 3NVDA 4GQIA 4D9FA 3WTCA 2KM1A 2P1ZA 1RXSA 1UBEA 3C6BA 3KTAB 3M6AA 4TOIA 5J4VA 4B48A 4UZSA 3I2IA 2QN3A 4LVCA 4FI3C 3UWSA 5FPQA 4QOGA 4LVUA 3SYMA 2WG0A 3E61A 1L3IA 4KAFA 1FU7A 4CL3A 3HADA 3KJXA 4V24A 4N47A 2RGYA 3GL9A 3UIEA 4E88A 4IQFA 4JJIA 3NHSA 5FOVA 3ZDBA 3FUVA 4C3UA 2QTWB 4JKYA 4CDRA 3BMOA 3DQPA 2ERCA 1UAGA 2G9QA 2XODA 5D2CA 2JDIA 2PUBA 2XF2A 3KQVA 1ND6A 4OLJA 1MP0A 3BE5A 1Y7HA 1XLTA 1ZN8A 3OPQA 3FA2A 2BWJA 4O63O 4U3JB 4YALA 3B9QA 5H70A 3BSYA 1ODJA 4ZT6A 1JHQA 2BJWA 4LHZA 4P4SB 4WECA 4MUFA 3S2UA 3M70A 1BDHA 2YOHA 4IL5A 4TUYF 4BRUA 2ZM6B 1F5NA 1IN6A 2DKNA 2Q3BA 4YS6A 2GWHA 1KYWA 4H4EA 1J9ZA 1T3SA 3MTDA 4ENQA 1GTVA 1USIA 3AUXA 4CL8A 3W8FA 2VHQA 3W3AA 1VP3A 4RHTA 3Q9UA 4K28A 5CB6A 3PZRA 4A0GA 2CZGA 3B53X 5EHGA 1WBBA 2ERYA 3R44A 3K0AB 4GXRA 1P7VA 5C52B 3AF6A 1H1TA 4BQRA 5B4UA 2WVAA 3VU9B 1NLMA 4RPGA 2QTLA 3FBTA 1U0FA 4G1EB 6NULA 5I51A 5EXDA 2BCGY 1G7RA 5EZSA 1BVHA 2P2DA 4HB2A 5IJWA 4TKZA 4R7ZA 3G1TA 4TLLB 1HQKA 2VTDA 2Q3FA 1V4VA 2FG7C 2VDRB 3RRXA 1Q17A 2MSCB 3A9UA 5C34B 3ZGNA 4UPVA 3F6SA 4LK2A 5J23A 3C3YA 4A8JA 1EFUA 4BX2A 4R51A 3TTUA 3QU9A 2BBWA 1G4AE 4P6VF 2FK7A 1E3EA 5E3IA 4DUGA 2FEWB 4QVIA 5HZHA 1EI9A 2GK4A 4BNLA 4UQPA 4F4FA 3FCSB 3NI2A 4DMGA 4BPRA 1OH5A 4CL2A 4D4IA 2JG3A 5F7XA 4W9MC 3NV7A 2RGXA 4HB4A 4CCYB 4D9CA 5CG2A 5EMHA 3U6BA 2OMKA 2FH5B 1MNQA 3OM1A 1QCYA 2CMKA 3ZGLA 3SZUA 1Y3AA 1G8MA 4AW9A 1NHGA 1WRBA 1HI9A 2E87A 2WJAA 1T43A 2YHIB 3CUWA 3K0KA 1PLKA 1R27A 1KQFA 1JQEA 2R84A 3K92A 3U3DA 1S02A 1G8PA 1HO3A 3MF4A 5HIMA 3SQLA 1XF9A 3ZVRA 2V58A 2H7XA 1CF2O 4BECA 6CHYA 3OFSA 2N1BA 2F7SA 4NXNB 2H1SA 3FZYA 4XTCS 1L4GA 1K63A 2Q3HA 1Z36A 4L4SA 3BIWA 3EQ9A 3DMHA 3QOWA 4O4IF 3KWJA 3ED1A 3O8BA 5LFAA 2JLAA 3CLSD 2P27A 1CR2A 2XNHA 1HOTA 4MW7A 3BA1A 1N2SA 4BNYA 2BMEA 5FBLB 1CQWA 4WXEA 3AB3A 1E6WA 1GLNA 4NZ9A 1ESEA 3CH5A 2VPYA 3VU0A 3R77A 3E48A 4AROA 3GDHA 1BIFA 1BFUA 1TKCA 2CDRA 3KB1A 4L6IA 4KBGA 1EXWA 3HGTA 4CM7A 1Q6YA 1Q77A 4DNPA 2PO7A 3L7DA 5L95A 5CXQA 2GEFA 3C98A 4OEHA 1ODLA 4UTXA 4FW9A 1ISGA 1JZQA 3PX2A 3EULA 3K5WA 3JZMA 4PWYA 3ZG6A 2O0HA 1OBHA 4LJ8A 2PLWA 1F17A 1XQYA 3CNOA 2WYOA 1VE6A 2GFHA 2VNJA 2WFLA 3HCAA 3SP1A 4K40A 1A95A 2QE7D 5AW8A 1FYWA 2HADA 4N5LA 5DHQA 3OQ6A 3H5AA 3RTEA 2IPOA 1E6KA 2YS6A 2YXBA 2H9YA 1Y1TA 4HYTA 4PYOA 1AQLA 3TZEA 4BXOA 1JILA 1XEWY 1C50A 3JQCA 1H4QA 2J30A 5E9JA 4TXHA 4MDFA 1DSSG 3TJMA 1G1MA 5DTRA 4O4HA 2WHEA 2VNKA 3F5SA 4MR7B 1B1AA 4CT0A 1JPJA 2IYVA 10MHA 2C0CA 2WU0A 2PT9A 5AHKA 1BU8A 3SVTA 1N3LA 3IS3A 5GM1A 5HVNA 4OXNA 1IPFA 2A0XA 5DXAA 4HWKA 5IXJA 1ZSVA 2GNAA 2IVFA 3N8IA 4Z3KA 3JQGA 5TRTA 3VU3A 2H6EA 4RTLA 3FVQA 1ACJA 1NI4A 2Z83A 4CM5A 3C3JA 3LUJA 4S2UA 4PLTA 5ALPA 1A9OA 1ZGGA 3L6RA 4B73A 2CLDX 3SQDA 3BFVA 1AGYA 1QH0A 2E4WA 4RDCA 2WFMA 3EDCA 5F78A 4BVLA 3SMQA 1SC3A 2XYPA 3TKAA 4XLZA 1E5LA 3IAAA 1C9KA 1QAOA 4P83A 1R9JA 3HV0A 1ACMA 1JLRA 1NW8A 1RRVA 4RZIA 5JD5A 3MWEA 2QZJA 2OFPA 5E9QA 2W0MA 4YWJA 1IBSA 4L74A 4DARA 1U2RA 3CNBA 7AT1A 4FCVA 2R7LA 4YCBA 4RACA 1VG0B 2BSXA 1NVFA 4U5QA 3PS9A 1JEJA 4NENB 4LE1A 5EJIA 3RVJA 1B0ZA 5BWMA 4IIHA 5CM8B 4IO0A 2F8TA 1FUIA 2E18A 5IKEA 3HK2A 3AETB 1CRZA 2ATXA 2H4JA 1T0UA 2O2GA 3MTEA 3OA2A 4XIJA 4BMNA 1H3EA 1JBQA 4GG1A 1KHTA 1UIRA 3EZYA 3CCBA 4KR0A 4GPTA 3VMMA 3KOZA 1K6MA 2OY0A 1A9ZA 2XTZA 2EL9A 1VM6A 3OJCA 4WFIA 4GXNA 1NZFA 3DDHA 4QBIA 4DRXA 5IXSA 4NULA 3JQRA 3N86A 2VK4A 3R40A 3L7IA 1ZS9A 4MKRA 4KOEC 3ZHYA 4J0IA 2EP7A 2I71A 2WA1A 2R8BA 4WPGA 3GOHA 3QW2A 1IB0A 2XNDA 3FPGA 4IH4A 1UEIA 4EUEA 2AZTA 5BRNA 3G0GA 1MMFB 2P67A 1XFDA 3WYEA 2L82A 4NH4A 2BISA 5LQNA 2XXAA 3W2IA 5DTJA 1ESNA 2C5GA 5B4VA 3WV4A 3B5IA 3E3LA 4ZCSA 1OAAA 1DO0A 2QX8A 4M46A 1IIBA 1S2OA 4N65A 2ZT5A 3GI1A 2AJBA 1Z0KA 2AUMA 3GVXA 3MERA 1EUCA 2ZB8A 4NYJR 2VLIA 5DI9A 4ARAA 3G5AA 3B7WA 5H16A 2B20A 2GTHA 2XGJA 1Z4OA 1J8FA 2VTEA 2EQAA 3D5EA 3W5VA 2X8JB 2PRSA 4DREA 1H4SA 4WNCA 5JIBA 3IMKA 5JCZA 4WXMA 5IUKC 3PE4A 1ZMRA 5IAEA 4D9HA 5KYWB 5BSGA 1BAPA 4B31A 3RWBA 1R1DA 2J9XB 3PLAE 2CZQA 1ULBA 3BMNB 3F5DA 4RVGA 4W9NA 3NBAA 4YV2A 4DA0A 4CT4B 1TIPA 3NQ41 2AOXA 4CR8A 2M2IA 2RMKA 3RUPA 1SC6A 5C2JB 4JUBA 3TQIA 2YZNA 1CY0A 4LXXA 2OCIA 5KSZA 1OB2A 5ARDA 4OKIA 1BXKA 2H59A 3X1DA 4A0HA 3ZXXA 1E18A 1EK0A 1PLLA 4K9OA 3HA2A 4M0PA 2XGMA 2YJGA 4HAUA 3CZQA 3K32A 4R05A 1AKVA 4MUBA 2PSJA 1J22A 1F0KA 3AHIA 1COWA 3HV2A 5B7QA 2BFNA 5AM3A 1W5AA 2HB6A 3L7NA 4XEUA 3P9CA 4RZ3A 5JCOC 2J6CA 3I9NA 5JW6A 2H85A 3OPYA 4W1PA 4WUTA 4LYDA 4DXDA 2QLTA 2BEVA 5EERA 3VNAA 2XE4A 1LWOA 3H5WA 1O6CA 2B7BA 3G2NA 2YXNA 4EMTA 5JJ5A 5FLEX 1OA1A 2OR3A 1UMBA 2OHXA 3GLHB 3L0IB 1GR0A 3LKDA 5DP2A 3W05A 1OT5A 3G6WA 1MX3A 3ONNA 4N5NA 1XLVA 3HO6A 3L82B 3KRTA 4ALMA 2YJ6A 3GJXC 3QXXA 1MAWA 1VE1A 2UYCA 2JCGA 4ZCRA 2ZULA 2PPVA 4L8LA 2G83A 1YD7A 4AJLA 1JEYB 4KTVE 3QG1A 2NAFA 2E37A 2J3LA 1T2DA 2B4TO 3LQQA 5FBQB 1VXRA 1XAGA 5ITZA 1N2XA 1LRJA 4FEEA 1RPNA 2XTAA 2F59A 3M4YA 1O96A 1AZTA 3G8YA 4S0ZA 5ELMA 4B0OA 3ZHQA 1JEQB 2VC2B 4JXZA 4W82A 3UKDA 1Q15A 4XLTA 1N3BA 2QYTA 4OKNA 1VMEA 4LQCA 1PDOA 1GUZA 3SHVA 1N5JA 2Q99A 1ID1A 1U2ZA 2EEPA 3DDNA 3L0YA 3OE5A 4FMPA 3LBYA 4R1LA 5CIWA 5DULA 2Q1TA 3Q2KA 2WSBA 3FNGA 4BC1A 1SXJD 5AESA 4WE3A 4UATA 5E0KB 1DO2A 2CJXA 5HF9A 3O4JA 4JJAA 3U4HA 3T7DA 1ECBA 1OBVA 2R6GA 2X5JO 3ELUA 3JYOA 2VXOA 4PZ9A 3VRHA 2V7EA 2JVKA 2PH7A 3PI7A 4LZJA 3TKLA 5AVQA 1ZRHA 2UZIR 2B82A 3WIVA 4FKMA 3V6MA 2R8PA 3NIDB 3ZDDA 2AXNA 5EP2A 2NU7A 1S8FA 4CKCA 1IBLB 1A1SA 2XA9A 2J9ZB 4NXMB 1EH5A 2VJBA 1H2HA 3CFYA 1GR1A 3CH4B 3PC4A 4YP7A 3UK0A 1XZ8A 5E8JA 1J9EA 1T91A 1QV9A 1DKPA 1OZFA 1P3DA 1TZ2A 3F98A 1BC5A 3QBJA 2OXRA 2FPLA 2WKWA 2H9AA 1J5EB 2GH1A 1JYEA 3HCOA 4ZPJA 1ODSA 2BFAA 4QXPA 5AVTA 2RBKA 3O73A 3TTWA 4QELA 3OU2A 4YO7A 2ZOSA 5AQ1A 1RRPA 3TZHA 1T8RA 2G4LA 1U8ZA 2Z4RA 3KQUA 5K51A 1NXPA 1ZK4A 2ID9A 4EUFA 3C45A 4YCLA 2X2EA 1W0JA 2HJSA 2I87A 3OF3A 4RBNA 1T2FA 2YZKA 3PHLA 3D6JA 8GPBA 1RPTA 1EXDA 3BAZA 3V5NA 3RT7A 2H5JA 1TUEA 2WG2A 4U2KA 4ZI2A 5LYJF 3MGKA 1JDUA 1DWUA 1Q16A 4TV9F 4Q1VA 5G0UA 1IOLA 2KQUA 4IDDA 4J0QA 2AEMA 4Y2JA 2LCQA 1AHNA 1XHFA 5EJMA 2ONJA 4FEAA 4GR5A 3QF4A 3MCTA 4B34A 4DA4A 1RAEA 1GN8A 2B4YA 2XDAA 2VHYA 2XOXA 2W2VA 3O8QA 1PW7A 2Q1SA 2QNRA 3OZFA 4HDKB 3EVCA 1RYHA 4HNAB 4JIGA 5F51A 2PGJA 4ZHQB 2X5NA 2HIAA 4WZ6A 4XI9A 2W6ZA 3DKPA 4KNWA 5F4ZA 3G7SA 1QO0A 2CLLB 3ZHXA 2Z8ZA 3R9XA 3RC8A 3BGIA 3N0RA 2OZEA 3G23A 3RSGA 1HC7A 2YINC 4QDOA 4RZQA 1TE2A 3MS7A 2WMYA 2R1TB 3CRZA 4PRZA 2ZAYA 4JVOA 4LJ6A 4M0EA 1X7WA 5HXAA 1EFPA 4UQLA 4AJJA 4WJKB 4C04A 3I45A 2Q41A 4HSGA 4R69A 1QQ5A 4BNDA 2X8JA 1L7XA 4WN9B 4RHXA 4FD3A 2OSBA 2VK2A 2H17A 3VO9A 1RLUA 3V8QA 2CHQA 1YR8A 2BGUA 2YUIA 1I1OA 3R20A 4C05A 5DF1A 1G4UR 3LGSA 1GITA 1I8TA 1PG0A 3L4BA 1QHGA 2Q2QA 1FY2A 3JZDA 3DQZA 3PHHA 4OJQA 3S1LA 2EDCA 1VPDA 4BNZA 3H1FA 1BU5A 3NVAA 1N0HA 1SULA 3GDOA 4NBUA 4P58A 3ZXYA 4D3ZA 4BJ6A 4PLZA 3P32A 1F4PA 2ZYTX 5B6PA 3WYBA 2X76A 2GPJA 1NUSA 1T9CA 3FMFA 1D5WA 2W6ID 2QQ5A 3CLTC 1JFLA 3C6QA 5GOTA 3FGNA 3FZGA 3ESAA 4BFXA 4K6HA 4RK7A 1QRTA 1TVCA 2R8XA 1DC3A 2I22A 5EXSA 2VSOA 1B16A 2O8CA 5DLQC 3ETLA 3RYFB 1JSLA 1Z6XA 2OCGA 1BMDA 4B6SA 4A2PA 1XRLA 4JOCA 1L9XA 5EWLB 3TFWA 5AVXA 4C29A 3IXLA 3OJ0A 1S7GA 1X39A 2B5WA 3I4LA 4LHSA 1GGMA 1GILA 1CP2A 3GB9A 3OPXA 3SDSA 5HFAA 3ELDA 5EYPB 3T7KA 2CEAA 3L6BA 3TW8A 1E3TA 2CGEA 4KITB 3N6RA 2UYQA 2IZOA 3C8UA 4TS9A 3PCRB 2H54A 3JTMA 4UUPA 1TAQA 2IP2A 3P9IA 4HNVA 5KWSA 3VJKA 4L5IA 2FRVA 4BAZA 1XLUA 2Z2IA 2JFWA 1NR1A 4GRIA 3ZIUA 2UVPA 4Y1EA 5TQJA 3ZWMA 4L6AA 1AKUA 2OORA 3HYCA 5JOQA 2KW5A 3RB8A 3SLRA 4UD2A 2FX3A 1M0SA 5IZCC 3GVHA 3DM5A 4LRSB 3JD4A 2WJ4A 4X9XA 2XEDA 1NXOA 1HG0A 1O08A 1XMXA 3H3FA 4B8ZA 1Z8HA 2IIPA 2OOKA 5IDVA 1LUAA 1EDBA 1ZLYA 4OI2A 5D87A 4C22A 1CJUC 4JBNA 5CFZA 3ANLA 2BVNA 3L6DA 3SVZA 4C07A 2EBFX 4BMXA 1ZCBA 3RHZA 1MJHA 4A03A 3FNHA 1KEZA 3TQRA 4F45A 5K3DA 5JXGA 4HPJB 4KYTA 2GK7A 1HZJA 3G2QA 4EPXA 1E9EA 4ESHA 5KVSA 2HLHA 2X23A 1NSYA 3OE1A 3KUKA 4HFMA 3ORYA 4TS4A 1B74A 2VRCA 2YW9A 4PLWA 3RFUA 2BGRA 5HK9A 3K9GA 5C8XA 4WVFA 1EAYA 1UOOA 2C5SA 3ZWVA 1DC5A 4UD6A 3AR9A 5CH3A 4K6OA 4BFZA 2C4UA 1DCKA 2HF9A 2PHZA 4F91B 3QEJA 5HX7A 5JANA 4NYMR 5JDIC 3RRMA 1TFRA 5E6SA 4NSNA 4GNKA 3GFVA 1ZGCA 2IHTA 2F9LA 3RUIA 2QGNA 1NIJA 1WMDA 2B5OA 2GPTA 3JCZA 3KPJA 3DSRA 4WW0A 1WU7A 3QXHA 1NU8A 4AJ2A 4R1QA 4OLAA 4D6XA 2PMKA 3LY8A 2I9KA 4JJKA 3ZZ0A 3R5JA 4V2UA 4EIWA 3JVUA 3GNSA 1D8TA 4HTFB 4F5EA 2XKAA 2X40A 4KXVA 4RV5A 1JSCA 3EG5A 1SCUB 1XRJA 2IBMA 2W2MA 2V03A 3M5CA 4DCMA 4EUNA 4IJUA 1CE8A 1C3VA 1G8AA 1V5GA 5EIEA 5FLYA 2J5XA 3LUKA 3MG9A 1L4YA 4L3OA 3UXMA 3KSAC 3SY8A 3VR3A 2WU1A 3LT0A 221PA 1EZ1A 1ACLA 1E8DA 2XTJA 2ZANA 1Y4UA 3HJBA 4G8CA 3E2MA 1AZSC 4X91A 2PRJA 1M1XB 1G5HA 2D3WA 2I6QA 3RO7A 3AP3A 3NOXA 1G19A 3AFOA 4RD6A 3EDQA 4RHUA 2JW5A 5BSUA 3T99A 1CQXA 4TKMA 1D6SA