3P5MA

Crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
253
structure length
250
Chain Sequence
b'GSMNGISVEHDGAVLRIRLDRPEKLNAVDTPMLEELSVHIRDAEADESVRAVLLTGAGRAFCSGGDLDTAGAADAANRVVRAITSLPKPVIAGVHGAAVGFGCSLALACDLVVAAPASYFQLAFTRVGLMPDGGASALLPLLIGRARTSRMAMTAEKISAATAFEWGMISHITSADEYESVLTDVLRSVSGGPTLAFGWTKRALAAATLAELEPVQAIEAEGQLALVETADFREGARAFRERRTPNFRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Isomerase
total genus 89
structure length 250
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3p5mA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3p5mA01
2FZSA 3GLMA 1UYVA 4WZ8B 1XNWA 4YLHA 2C8TA 4U0HA 2W3PA 2IEXA 3FDUA 3ZWAA 3N6RB 4FN8A 5DUFA 3HRXA 3GF3A 3M6NA 4FB8A 4I4ZA 2VSSF 1ON9A 3H0QA 3ST9A 1SZOA 4K3WA 1XNYA 1RJMA 2DEOA 2UZFA 4HNKA 3PE8A 2ZQRA 3PEAA 5CTCA 4JCSA 4JCRA 1Y7OA 2Q35A 4IZBA 3IAVA 1EF8A 4ELSA 3ZWCA 4GHNA 2GTRA 3G64A 4L6WA 3OC7A 2DUBA 3ZW8A 5INGA 3K50A 5C9GA 2F9IA 3IB9A 4QIIA 5DU8A 3P85A 5E0SH 3KTGA 5G1QA 2VREA 3V5EA 5INIA 5CTBA 2J5II 1O8UA 1J7XA 1YG6A 2F9YA 3T3WA 2VSSE 1Q52A 3NJBA 3I47A 3TDCA 4JOTA 2ZL0A 2PG8A 2WTBA 1RJNA 1SG4A 5G1RA 1NZYA 4WCZA 3BPPA 3STAA 2F6IA 2F9YB 3JU1A 3RRVA 4EMPA 5KJPA 2VSUF 3H81A 3KTKA 3OT6A 1UYRA 5G1SA 2J5IA 1K32A 2VSSA 5E0NX 3BF0A 3L3SA 4B3HA 3QKAA 3VIVA 4ASIA 4FZWC 2ZL4A 1FCFA 3H0SA 3H0JA 4MXIA 3QWDA 4EMLA 3ZW9A 5MGBA 1WDMA 3TZ3A 1WZ8A 2PPYA 3V5IA 1W2XA 4JVTA 3DORA 3R9TA 3R0OA 4Z0MA 4ZDFA 5DU6A 2NP9A 3TLFA 4MOUA 3GMAA 4FJWD 1N6EA 3Q0GA 3DJAA 1HNUA 2F6QA 3PGQA 4MI2A 2VSUC 4ZDEA 1UYTA 1EF9A 4NEKA 1UIYA 1WDLA 3QYRA 3U9RB 5KDRA 3TVWA 1HZDA 4FNDA 3K8XA 2QQ3A 5DTWA 3RSIA 4WYOB 5DUCA 3OMEA 1Q51A 4RCNA 2F9IB 1OD2A 5JBWA 2D3TA 5DKPA 3KTHA 4G2RA 3Q0JA 4IZCA 4ELWA 3MT6A 5FIFA 3U9SB 4JYJA 3FF6A 3P5MA 4JYLA 3TRRA 2ZQQA 1DCIA 3P2LA 4OG1A 2FBMA 3R9QA 1FC7A 4U18A 1OD4A 3R6HA 4U0GH 4KD6A 4I42A 3ISAA 4KNPA 3QMJA 1NZYB 4JWVA 4U0GA 4K29A 4Q0GA 1JXZA 3IBBA 1N6FA 4ZDDA 2X58A 5DU4A 3M6MA 4FN7A 1FC9A 4KPKA 1X0UA 4U1AA 2J5IB 4JFCA 4OLQA 4ZDCA 3T88A 4ELXA 4K2NA 4I52A 1XO6A 3TT7A 1EY3A 1PIXA 2A7SA 3QXZA 2Q34A 4JCQA 2ZL3A 2PBPA 4L8KA 1HNOA 5DZKH 5FUSA 4U19A 2A7KA 3H0UA 3U9TB 1TYFA 4FZWA 5DZKA 3SWXA 3H02A 5JBXA 2VSUE 4RYFH 3TVUA 4F47A 3T8AA 4EMMA 3SLLA 3R9SA 3PZKA 2EJ5A 3MOYA 4RYFA 4KWBA 3ZWBA 1MJ3A 3LKEA 5C90A 4B3IA 1FC6A 3QREA 1XNVA 2BZRA 2CBYA 2J5SA 1XX4A 4QFEA 4IZDA 4FNBA 3Q1TA 3T8BA 2VSUA 5KDRB 3NJDA 5INFA 1WDKA 3Q7HA 3HLN1 4JJTA 4DI1A 4QIJA 2J5GA 3QK8A 5E0SA 3MYBA 3TV5A 2X24A 3HE2A 1YG8A 3KQFA 2A81A 5DTPA 2J5GD 4ZU2A 1UYSA 3WG5A 4Q1IA 2VX2A 3TT6A 1TG6A 1DUBA 2HW5A 1N6DA 4NNQA 4OMRA 4JCTA 4ZDBA 3KTIA 3HINA 4B3JA 3MFMA 2ZL2A 4GM2A 3RSTA 3GKBA 4JSBA 3LAOA 2CE3A 3KTJA 4LK5A 3GF7A 1PJHA 5IKLB 3BEZA 2FW2A 3T89A 3QXIA 1K39A 1ON3A 1VRGA 5DL1A 2Q2XA 3HP0A 4HC8A
chains in the Genus database with same CATH superfamily
2FZSA 3GLMA 1UYVA 4WZ8B 1XNWA 4YLHA 2C8TA 4U0HA 2W3PA 2IEXA 3FDUA 3ZWAA 3N6RB 4FN8A 5DUFA 3HRXA 3GF3A 3M6NA 4FB8A 4GEHB 3L8IA 4I4ZA 2VSSF 1ON9A 3H0QA 3ST9A 1SZOA 4K3WA 1XNYA 1RJMA 2DEOA 2UZFA 4HNKA 3PE8A 2ZQRA 3PEAA 5CTCA 4JCSA 3BPTA 2P63A 4JCRA 1Y7OA 2Q35A 3O4XE 4IZBA 3IAVA 1EF8A 4ELSA 3ZWCA 3A4NA 4GHNA 2GTRA 3G64A 4L6WA 3OC7A 2DUBA 3ZW8A 5INGA 3K50A 5C9GA 2F9IA 3IB9A 4QIIA 5DU8A 1UX4A 3P85A 5E0SH 3KTGA 5G1QA 2VREA 3V5EA 5INIA 5CTBA 2J5II 1O8UA 3L8JA 3RQFA 1J7XA 1YG6A 2F9YA 3T3WA 2VSSE 1Q52A 3NJBA 3I47A 3TDCA 4JOTA 2ZL0A 2PG8A 2WTBA 3RQEA 1RJNA 1SG4A 5G1RA 1NZYA 4WCZA 3BPPA 3STAA 2F6IA 2F9YB 3JU1A 3RRVA 4EMPA 5KJPA 2VSUF 3H81A 3KTKA 3ADCA 3OT6A 1UYRA 5G1SA 2J5IA 1K32A 2VSSA 2YJGA 3A4LA 5E0NX 3BF0A 3L3SA 4B3HA 3QKAA 3VIVA 4ASIA 4FZWC 2ZL4A 1FCFA 3H0SA 3H0JA 4MXIA 3QWDA 4EMLA 3ZW9A 5MGBA 1WDMA 3TZ3A 1WZ8A 2PPYA 3V5IA 1W2XA 4JVTA 3DORA 3R9TA 3R0OA 4Z0MA 4ZDFA 5DU6A 2NP9A 3TLFA 4MOUA 3GMAA 4FJWD 1N6EA 3Q0GA 3DJAA 1HNUA 2F6QA 3PGQA 4MI2A 2VSUC 4ZDEA 1UYTA 1EF9A 4HDTA 4NEKA 1UIYA 1WDLA 3QYRA 3U9RB 5KDRA 3ADBA 3TVWA 1HZDA 4FNDA 3K8XA 2QQ3A 5DTWA 3RSIA 4WYOB 5DUCA 3OMEA 1Q51A 1Y64B 4RCNA 2F9IB 1OD2A 5JBWA 2D3TA 5DKPA 3KTHA 4G2RA 3Q0JA 4IZCA 4ELWA 3MT6A 5FIFA 3U9SB 4JYJA 3FF6A 3P5MA 4J2UA 4JYLA 3TRRA 2ZQQA 1DCIA 3P2LA 4OG1A 2FBMA 3R9QA 1FC7A 4U18A 1OD4A 3R6HA 4U0GH 4KD6A 4I42A 3ISAA 4KNPA 3QMJA 1NZYB 4JWVA 4U0GA 4NARA 4K29A 4Q0GA 1JXZA 3IBBA 1N6FA 4ZDDA 2X58A 5DU4A 3M6MA 4FN7A 1FC9A 3RQGA 1UX5A 4KPKA 1X0UA 4U1AA 2J5IB 4JFCA 4OLQA 4ZDCA 3T88A 4ELXA 3ADDA 4K2NA 4I52A 1XO6A 3TT7A 1EY3A 1PIXA 2A7SA 3QXZA 2Q34A 4JCQA 2ZL3A 2PBPA 4L8KA 1HNOA 5DZKH 3A4MA 5FUSA 4U19A 2A7KA 3H0UA 3U9TB 1TYFA 4FZWA 5DZKA 3SWXA 3H02A 5JBXA 2VSUE 4RYFH 3TVUA 4F47A 3T8AA 4EMMA 3SLLA 3R9SA 3PZKA 2EJ5A 3MOYA 4RYFA 4KWBA 3ZWBA 1MJ3A 3LKEA 5C90A 4B3IA 1FC6A 3QREA 1XNVA 2BZRA 2CBYA 2J5SA 1XX4A 4QFEA 4IZDA 4FNBA 3Q1TA 3T8BA 2VSUA 3IRBA 3W8HB 5KDRB 3NJDA 5INFA 1WDKA 3Q7HA 3HLN1 4JJTA 4DI1A 4QIJA 2J5GA 3QK8A 5E0SA 3MYBA 3TV5A 2X24A 3HE2A 1YG8A 3KQFA 2A81A 5DTPA 2J5GD 4ZU2A 1UYSA 3WG5A 4Q1IA 2VX2A 5HUQA 3TT6A 3AM1A 1TG6A 1DUBA 2HW5A 3AJMA 1N6DA 4NNQA 4OMRA 4JCTA 4ZDBA 3KTIA 3HINA 4B3JA 3MFMA 2ZL2A 4GM2A 3RSTA 3GKBA 4JSBA 3LAOA 2CE3A 3KTJA 4LK5A 3GF7A 1PJHA 5IKLB 3BEZA 2FW2A 3T89A 3QXIA 1K39A 1ON3A 1VRGA 5DL1A 2Q2XA 3HP0A 4HC8A 3W8IB
chains in the Genus database with same CATH topology
2FZSA 3GLMA 1UYVA 4WZ8B 1XNWA 4YLHA 2C8TA 4U0HA 2W3PA 2IEXA 3FDUA 3ZWAA 3N6RB 4FN8A 5DUFA 3HRXA 3GF3A 3M6NA 4FB8A 4I4ZA 2VSSF 1ON9A 3H0QA 3ST9A 1SZOA 4K3WA 1XNYA 1RJMA 2DEOA 2UZFA 4HNKA 3PE8A 2ZQRA 3PEAA 5CTCA 4JCSA 3BPTA 4JCRA 1Y7OA 2Q35A 4IZBA 3IAVA 1EF8A 4ELSA 3ZWCA 4GHNA 2GTRA 3G64A 4L6WA 3OC7A 2DUBA 3ZW8A 5INGA 3K50A 5C9GA 2F9IA 3IB9A 4QIIA 5DU8A 3P85A 5E0SH 3KTGA 5G1QA 2VREA 3V5EA 5INIA 5CTBA 2J5II 1O8UA 1J7XA 1YG6A 2F9YA 3T3WA 2VSSE 1Q52A 3NJBA 3I47A 3TDCA 4JOTA 2ZL0A 2PG8A 2WTBA 1RJNA 1SG4A 5G1RA 1NZYA 4WCZA 3BPPA 3STAA 2F6IA 2F9YB 3JU1A 3RRVA 4EMPA 5KJPA 2VSUF 3H81A 3KTKA 3OT6A 1UYRA 5G1SA 2J5IA 1K32A 2VSSA 2YJGA 5E0NX 3BF0A 3L3SA 4B3HA 3QKAA 3VIVA 4ASIA 4FZWC 2ZL4A 1FCFA 3H0SA 3H0JA 4MXIA 3QWDA 4EMLA 3ZW9A 5MGBA 1WDMA 3TZ3A 1WZ8A 2PPYA 3V5IA 1W2XA 4JVTA 3DORA 3R9TA 3R0OA 4Z0MA 4ZDFA 5DU6A 2NP9A 3TLFA 4MOUA 3GMAA 4FJWD 1N6EA 3Q0GA 3DJAA 1HNUA 2F6QA 3PGQA 4MI2A 2VSUC 4ZDEA 1UYTA 1EF9A 4HDTA 4NEKA 1UIYA 1WDLA 3QYRA 3U9RB 5KDRA 3TVWA 1HZDA 4FNDA 3K8XA 2QQ3A 5DTWA 3RSIA 4WYOB 5DUCA 3OMEA 1Q51A 4RCNA 2F9IB 1OD2A 5JBWA 2D3TA 5DKPA 3KTHA 4G2RA 3Q0JA 4IZCA 4ELWA 3MT6A 5FIFA 3U9SB 4JYJA 3FF6A 3P5MA 4J2UA 4JYLA 3TRRA 2ZQQA 1DCIA 3P2LA 4OG1A 2FBMA 3R9QA 1FC7A 4U18A 1OD4A 3R6HA 4U0GH 4KD6A 4I42A 3ISAA 4KNPA 3QMJA 1NZYB 4JWVA 4U0GA 4NARA 4K29A 4Q0GA 1JXZA 3IBBA 1N6FA 4ZDDA 2X58A 5DU4A 3M6MA 4FN7A 1FC9A 4KPKA 1X0UA 4U1AA 2J5IB 4JFCA 4OLQA 4ZDCA 3T88A 4ELXA 4K2NA 4I52A 1XO6A 3TT7A 1EY3A 1PIXA 2A7SA 3QXZA 2Q34A 4JCQA 2ZL3A 2PBPA 4L8KA 1HNOA 5DZKH 5FUSA 4U19A 2A7KA 3H0UA 3U9TB 1TYFA 4FZWA 5DZKA 3SWXA 3H02A 5JBXA 2VSUE 4RYFH 3TVUA 4F47A 3T8AA 4EMMA 3SLLA 3R9SA 3PZKA 2EJ5A 3MOYA 4RYFA 4KWBA 3ZWBA 1MJ3A 3LKEA 5C90A 4B3IA 1FC6A 3QREA 1XNVA 2BZRA 2CBYA 2J5SA 1XX4A 4QFEA 4IZDA 4FNBA 3Q1TA 3T8BA 2VSUA 5KDRB 3NJDA 5INFA 1WDKA 3Q7HA 3HLN1 4JJTA 4DI1A 4QIJA 2J5GA 3QK8A 5E0SA 3MYBA 3TV5A 2X24A 3HE2A 1YG8A 3KQFA 2A81A 5DTPA 2J5GD 4ZU2A 1UYSA 3WG5A 4Q1IA 2VX2A 5HUQA 3TT6A 1TG6A 1DUBA 2HW5A 1N6DA 4NNQA 4OMRA 4JCTA 4ZDBA 3KTIA 3HINA 4B3JA 3MFMA 2ZL2A 4GM2A 3RSTA 3GKBA 4JSBA 3LAOA 2CE3A 3KTJA 4LK5A 3GF7A 1PJHA 5IKLB 3BEZA 2FW2A 3T89A 3QXIA 1K39A 1ON3A 1VRGA 5DL1A 2Q2XA 3HP0A 4HC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FZS A;  3GLM A;  1UYV A;  4WZ8 B;  1XNW A;  4YLH A;  2C8T A;  4U0H A;  2W3P A;  2IEX A;  3FDU A;  3ZWA A;  3N6R B;  4FN8 A;  5DUF A;  3HRX A;  3GF3 A;  3M6N A;  4FB8 A;  4I4Z A;  2VSS F;  1ON9 A;  3H0Q A;  3ST9 A;  1SZO A;  4K3W A;  1XNY A;  1RJM A;  2DEO A;  2UZF A;  4HNK A;  3PE8 A;  2ZQR A;  3PEA A;  5CTC A;  4JCS A;  4JCR A;  1Y7O A;  2Q35 A;  4IZB A;  3IAV A;  1EF8 A;  4ELS A;  3ZWC A;  4GHN A;  2GTR A;  3G64 A;  4L6W A;  3OC7 A;  2DUB A;  3ZW8 A;  5ING A;  3K50 A;  5C9G A;  2F9I A;  3IB9 A;  4QII A;  5DU8 A;  3P85 A;  5E0S H;  3KTG A;  5G1Q A;  2VRE A;  3V5E A;  5INI A;  5CTB A;  2J5I I;  1O8U A;  1J7X A;  1YG6 A;  2F9Y A;  3T3W A;  2VSS E;  1Q52 A;  3NJB A;  3I47 A;  3TDC A;  4JOT A;  2ZL0 A;  2PG8 A;  2WTB A;  1RJN A;  1SG4 A;  5G1R A;  1NZY A;  4WCZ A;  3BPP A;  3STA A;  2F6I A;  2F9Y B;  3JU1 A;  3RRV A;  4EMP A;  5KJP A;  2VSU F;  3H81 A;  3KTK A;  3OT6 A;  1UYR A;  5G1S A;  2J5I A;  1K32 A;  2VSS A;  5E0N X;  3BF0 A;  3L3S A;  4B3H A;  3QKA A;  3VIV A;  4ASI A;  4FZW C;  2ZL4 A;  1FCF A;  3H0S A;  3H0J A;  4MXI A;  3QWD A;  4EML A;  3ZW9 A;  5MGB A;  1WDM A;  3TZ3 A;  1WZ8 A;  2PPY A;  3V5I A;  1W2X A;  4JVT A;  3DOR A;  3R9T A;  3R0O A;  4Z0M A;  4ZDF A;  5DU6 A;  2NP9 A;  3TLF A;  4MOU A;  3GMA A;  4FJW D;  1N6E A;  3Q0G A;  3DJA A;  1HNU A;  2F6Q A;  3PGQ A;  4MI2 A;  2VSU C;  4ZDE A;  1UYT A;  1EF9 A;  4NEK A;  1UIY A;  1WDL A;  3QYR A;  3U9R B;  5KDR A;  3TVW A;  1HZD A;  4FND A;  3K8X A;  2QQ3 A;  5DTW A;  3RSI A;  4WYO B;  5DUC A;  3OME A;  1Q51 A;  4RCN A;  2F9I B;  1OD2 A;  5JBW A;  2D3T A;  5DKP A;  3KTH A;  4G2R A;  3Q0J A;  4IZC A;  4ELW A;  3MT6 A;  5FIF A;  3U9S B;  4JYJ A;  3FF6 A;  3P5M A;  4JYL A;  3TRR A;  2ZQQ A;  1DCI A;  3P2L A;  4OG1 A;  2FBM A;  3R9Q A;  1FC7 A;  4U18 A;  1OD4 A;  3R6H A;  4U0G H;  4KD6 A;  4I42 A;  3ISA A;  4KNP A;  3QMJ A;  1NZY B;  4JWV A;  4U0G A;  4K29 A;  4Q0G A;  1JXZ A;  3IBB A;  1N6F A;  4ZDD A;  2X58 A;  5DU4 A;  3M6M A;  4FN7 A;  1FC9 A;  4KPK A;  1X0U A;  4U1A A;  2J5I B;  4JFC A;  4OLQ A;  4ZDC A;  3T88 A;  4ELX A;  4K2N A;  4I52 A;  1XO6 A;  3TT7 A;  1EY3 A;  1PIX A;  2A7S A;  3QXZ A;  2Q34 A;  4JCQ A;  2ZL3 A;  2PBP A;  4L8K A;  1HNO A;  5DZK H;  5FUS A;  4U19 A;  2A7K A;  3H0U A;  3U9T B;  1TYF A;  4FZW A;  5DZK A;  3SWX A;  3H02 A;  5JBX A;  2VSU E;  4RYF H;  3TVU A;  4F47 A;  3T8A A;  4EMM A;  3SLL A;  3R9S A;  3PZK A;  2EJ5 A;  3MOY A;  4RYF A;  4KWB A;  3ZWB A;  1MJ3 A;  3LKE A;  5C90 A;  4B3I A;  1FC6 A;  3QRE A;  1XNV A;  2BZR A;  2CBY A;  2J5S A;  1XX4 A;  4QFE A;  4IZD A;  4FNB A;  3Q1T A;  3T8B A;  2VSU A;  5KDR B;  3NJD A;  5INF A;  1WDK A;  3Q7H A;  3HLN 1;  4JJT A;  4DI1 A;  4QIJ A;  2J5G A;  3QK8 A;  5E0S A;  3MYB A;  3TV5 A;  2X24 A;  3HE2 A;  1YG8 A;  3KQF A;  2A81 A;  5DTP A;  2J5G D;  4ZU2 A;  1UYS A;  3WG5 A;  4Q1I A;  2VX2 A;  3TT6 A;  1TG6 A;  1DUB A;  2HW5 A;  1N6D A;  4NNQ A;  4OMR A;  4JCT A;  4ZDB A;  3KTI A;  3HIN A;  4B3J A;  3MFM A;  2ZL2 A;  4GM2 A;  3RST A;  3GKB A;  4JSB A;  3LAO A;  2CE3 A;  3KTJ A;  4LK5 A;  3GF7 A;  1PJH A;  5IKL B;  3BEZ A;  2FW2 A;  3T89 A;  3QXI A;  1K39 A;  1ON3 A;  1VRG A;  5DL1 A;  2Q2X A;  3HP0 A;  4HC8 A; 
#chains in the Genus database with same CATH topology
 2FZS A;  3GLM A;  1UYV A;  4WZ8 B;  1XNW A;  4YLH A;  2C8T A;  4U0H A;  2W3P A;  2IEX A;  3FDU A;  3ZWA A;  3N6R B;  4FN8 A;  5DUF A;  3HRX A;  3GF3 A;  3M6N A;  4FB8 A;  4GEH B;  3L8I A;  4I4Z A;  2VSS F;  1ON9 A;  3H0Q A;  3ST9 A;  1SZO A;  4K3W A;  1XNY A;  1RJM A;  2DEO A;  2UZF A;  4HNK A;  3PE8 A;  2ZQR A;  3PEA A;  5CTC A;  4JCS A;  3BPT A;  2P63 A;  4JCR A;  1Y7O A;  2Q35 A;  3O4X E;  4IZB A;  3IAV A;  1EF8 A;  4ELS A;  3ZWC A;  3A4N A;  4GHN A;  2GTR A;  3G64 A;  4L6W A;  3OC7 A;  2DUB A;  3ZW8 A;  5ING A;  3K50 A;  5C9G A;  2F9I A;  3IB9 A;  4QII A;  5DU8 A;  1UX4 A;  3P85 A;  5E0S H;  3KTG A;  5G1Q A;  2VRE A;  3V5E A;  5INI A;  5CTB A;  2J5I I;  1O8U A;  3L8J A;  3RQF A;  1J7X A;  1YG6 A;  2F9Y A;  3T3W A;  2VSS E;  1Q52 A;  3NJB A;  3I47 A;  3TDC A;  4JOT A;  2ZL0 A;  2PG8 A;  2WTB A;  3RQE A;  1RJN A;  1SG4 A;  5G1R A;  1NZY A;  4WCZ A;  3BPP A;  3STA A;  2F6I A;  2F9Y B;  3JU1 A;  3RRV A;  4EMP A;  5KJP A;  2VSU F;  3H81 A;  3KTK A;  3ADC A;  3OT6 A;  1UYR A;  5G1S A;  2J5I A;  1K32 A;  2VSS A;  2YJG A;  3A4L A;  5E0N X;  3BF0 A;  3L3S A;  4B3H A;  3QKA A;  3VIV A;  4ASI A;  4FZW C;  2ZL4 A;  1FCF A;  3H0S A;  3H0J A;  4MXI A;  3QWD A;  4EML A;  3ZW9 A;  5MGB A;  1WDM A;  3TZ3 A;  1WZ8 A;  2PPY A;  3V5I A;  1W2X A;  4JVT A;  3DOR A;  3R9T A;  3R0O A;  4Z0M A;  4ZDF A;  5DU6 A;  2NP9 A;  3TLF A;  4MOU A;  3GMA A;  4FJW D;  1N6E A;  3Q0G A;  3DJA A;  1HNU A;  2F6Q A;  3PGQ A;  4MI2 A;  2VSU C;  4ZDE A;  1UYT A;  1EF9 A;  4HDT A;  4NEK A;  1UIY A;  1WDL A;  3QYR A;  3U9R B;  5KDR A;  3ADB A;  3TVW A;  1HZD A;  4FND A;  3K8X A;  2QQ3 A;  5DTW A;  3RSI A;  4WYO B;  5DUC A;  3OME A;  1Q51 A;  1Y64 B;  4RCN A;  2F9I B;  1OD2 A;  5JBW A;  2D3T A;  5DKP A;  3KTH A;  4G2R A;  3Q0J A;  4IZC A;  4ELW A;  3MT6 A;  5FIF A;  3U9S B;  4JYJ A;  3FF6 A;  3P5M A;  4J2U A;  4JYL A;  3TRR A;  2ZQQ A;  1DCI A;  3P2L A;  4OG1 A;  2FBM A;  3R9Q A;  1FC7 A;  4U18 A;  1OD4 A;  3R6H A;  4U0G H;  4KD6 A;  4I42 A;  3ISA A;  4KNP A;  3QMJ A;  1NZY B;  4JWV A;  4U0G A;  4NAR A;  4K29 A;  4Q0G A;  1JXZ A;  3IBB A;  1N6F A;  4ZDD A;  2X58 A;  5DU4 A;  3M6M A;  4FN7 A;  1FC9 A;  3RQG A;  1UX5 A;  4KPK A;  1X0U A;  4U1A A;  2J5I B;  4JFC A;  4OLQ A;  4ZDC A;  3T88 A;  4ELX A;  3ADD A;  4K2N A;  4I52 A;  1XO6 A;  3TT7 A;  1EY3 A;  1PIX A;  2A7S A;  3QXZ A;  2Q34 A;  4JCQ A;  2ZL3 A;  2PBP A;  4L8K A;  1HNO A;  5DZK H;  3A4M A;  5FUS A;  4U19 A;  2A7K A;  3H0U A;  3U9T B;  1TYF A;  4FZW A;  5DZK A;  3SWX A;  3H02 A;  5JBX A;  2VSU E;  4RYF H;  3TVU A;  4F47 A;  3T8A A;  4EMM A;  3SLL A;  3R9S A;  3PZK A;  2EJ5 A;  3MOY A;  4RYF A;  4KWB A;  3ZWB A;  1MJ3 A;  3LKE A;  5C90 A;  4B3I A;  1FC6 A;  3QRE A;  1XNV A;  2BZR A;  2CBY A;  2J5S A;  1XX4 A;  4QFE A;  4IZD A;  4FNB A;  3Q1T A;  3T8B A;  2VSU A;  3IRB A;  3W8H B;  5KDR B;  3NJD A;  5INF A;  1WDK A;  3Q7H A;  3HLN 1;  4JJT A;  4DI1 A;  4QIJ A;  2J5G A;  3QK8 A;  5E0S A;  3MYB A;  3TV5 A;  2X24 A;  3HE2 A;  1YG8 A;  3KQF A;  2A81 A;  5DTP A;  2J5G D;  4ZU2 A;  1UYS A;  3WG5 A;  4Q1I A;  2VX2 A;  5HUQ A;  3TT6 A;  3AM1 A;  1TG6 A;  1DUB A;  2HW5 A;  3AJM A;  1N6D A;  4NNQ A;  4OMR A;  4JCT A;  4ZDB A;  3KTI A;  3HIN A;  4B3J A;  3MFM A;  2ZL2 A;  4GM2 A;  3RST A;  3GKB A;  4JSB A;  3LAO A;  2CE3 A;  3KTJ A;  4LK5 A;  3GF7 A;  1PJH A;  5IKL B;  3BEZ A;  2FW2 A;  3T89 A;  3QXI A;  1K39 A;  1ON3 A;  1VRG A;  5DL1 A;  2Q2X A;  3HP0 A;  4HC8 A;  3W8I B; 
#chains in the Genus database with same CATH homology
 2FZS A;  3GLM A;  1UYV A;  4WZ8 B;  1XNW A;  4YLH A;  2C8T A;  4U0H A;  2W3P A;  2IEX A;  3FDU A;  3ZWA A;  3N6R B;  4FN8 A;  5DUF A;  3HRX A;  3GF3 A;  3M6N A;  4FB8 A;  4I4Z A;  2VSS F;  1ON9 A;  3H0Q A;  3ST9 A;  1SZO A;  4K3W A;  1XNY A;  1RJM A;  2DEO A;  2UZF A;  4HNK A;  3PE8 A;  2ZQR A;  3PEA A;  5CTC A;  4JCS A;  3BPT A;  4JCR A;  1Y7O A;  2Q35 A;  4IZB A;  3IAV A;  1EF8 A;  4ELS A;  3ZWC A;  4GHN A;  2GTR A;  3G64 A;  4L6W A;  3OC7 A;  2DUB A;  3ZW8 A;  5ING A;  3K50 A;  5C9G A;  2F9I A;  3IB9 A;  4QII A;  5DU8 A;  3P85 A;  5E0S H;  3KTG A;  5G1Q A;  2VRE A;  3V5E A;  5INI A;  5CTB A;  2J5I I;  1O8U A;  1J7X A;  1YG6 A;  2F9Y A;  3T3W A;  2VSS E;  1Q52 A;  3NJB A;  3I47 A;  3TDC A;  4JOT A;  2ZL0 A;  2PG8 A;  2WTB A;  1RJN A;  1SG4 A;  5G1R A;  1NZY A;  4WCZ A;  3BPP A;  3STA A;  2F6I A;  2F9Y B;  3JU1 A;  3RRV A;  4EMP A;  5KJP A;  2VSU F;  3H81 A;  3KTK A;  3OT6 A;  1UYR A;  5G1S A;  2J5I A;  1K32 A;  2VSS A;  2YJG A;  5E0N X;  3BF0 A;  3L3S A;  4B3H A;  3QKA A;  3VIV A;  4ASI A;  4FZW C;  2ZL4 A;  1FCF A;  3H0S A;  3H0J A;  4MXI A;  3QWD A;  4EML A;  3ZW9 A;  5MGB A;  1WDM A;  3TZ3 A;  1WZ8 A;  2PPY A;  3V5I A;  1W2X A;  4JVT A;  3DOR A;  3R9T A;  3R0O A;  4Z0M A;  4ZDF A;  5DU6 A;  2NP9 A;  3TLF A;  4MOU A;  3GMA A;  4FJW D;  1N6E A;  3Q0G A;  3DJA A;  1HNU A;  2F6Q A;  3PGQ A;  4MI2 A;  2VSU C;  4ZDE A;  1UYT A;  1EF9 A;  4HDT A;  4NEK A;  1UIY A;  1WDL A;  3QYR A;  3U9R B;  5KDR A;  3TVW A;  1HZD A;  4FND A;  3K8X A;  2QQ3 A;  5DTW A;  3RSI A;  4WYO B;  5DUC A;  3OME A;  1Q51 A;  4RCN A;  2F9I B;  1OD2 A;  5JBW A;  2D3T A;  5DKP A;  3KTH A;  4G2R A;  3Q0J A;  4IZC A;  4ELW A;  3MT6 A;  5FIF A;  3U9S B;  4JYJ A;  3FF6 A;  3P5M A;  4J2U A;  4JYL A;  3TRR A;  2ZQQ A;  1DCI A;  3P2L A;  4OG1 A;  2FBM A;  3R9Q A;  1FC7 A;  4U18 A;  1OD4 A;  3R6H A;  4U0G H;  4KD6 A;  4I42 A;  3ISA A;  4KNP A;  3QMJ A;  1NZY B;  4JWV A;  4U0G A;  4NAR A;  4K29 A;  4Q0G A;  1JXZ A;  3IBB A;  1N6F A;  4ZDD A;  2X58 A;  5DU4 A;  3M6M A;  4FN7 A;  1FC9 A;  4KPK A;  1X0U A;  4U1A A;  2J5I B;  4JFC A;  4OLQ A;  4ZDC A;  3T88 A;  4ELX A;  4K2N A;  4I52 A;  1XO6 A;  3TT7 A;  1EY3 A;  1PIX A;  2A7S A;  3QXZ A;  2Q34 A;  4JCQ A;  2ZL3 A;  2PBP A;  4L8K A;  1HNO A;  5DZK H;  5FUS A;  4U19 A;  2A7K A;  3H0U A;  3U9T B;  1TYF A;  4FZW A;  5DZK A;  3SWX A;  3H02 A;  5JBX A;  2VSU E;  4RYF H;  3TVU A;  4F47 A;  3T8A A;  4EMM A;  3SLL A;  3R9S A;  3PZK A;  2EJ5 A;  3MOY A;  4RYF A;  4KWB A;  3ZWB A;  1MJ3 A;  3LKE A;  5C90 A;  4B3I A;  1FC6 A;  3QRE A;  1XNV A;  2BZR A;  2CBY A;  2J5S A;  1XX4 A;  4QFE A;  4IZD A;  4FNB A;  3Q1T A;  3T8B A;  2VSU A;  5KDR B;  3NJD A;  5INF A;  1WDK A;  3Q7H A;  3HLN 1;  4JJT A;  4DI1 A;  4QIJ A;  2J5G A;  3QK8 A;  5E0S A;  3MYB A;  3TV5 A;  2X24 A;  3HE2 A;  1YG8 A;  3KQF A;  2A81 A;  5DTP A;  2J5G D;  4ZU2 A;  1UYS A;  3WG5 A;  4Q1I A;  2VX2 A;  5HUQ A;  3TT6 A;  1TG6 A;  1DUB A;  2HW5 A;  1N6D A;  4NNQ A;  4OMR A;  4JCT A;  4ZDB A;  3KTI A;  3HIN A;  4B3J A;  3MFM A;  2ZL2 A;  4GM2 A;  3RST A;  3GKB A;  4JSB A;  3LAO A;  2CE3 A;  3KTJ A;  4LK5 A;  3GF7 A;  1PJH A;  5IKL B;  3BEZ A;  2FW2 A;  3T89 A;  3QXI A;  1K39 A;  1ON3 A;  1VRG A;  5DL1 A;  2Q2X A;  3HP0 A;  4HC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...