3P5MA

Crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
253
structure length
250
Chain Sequence
GSMNGISVEHDGAVLRIRLDRPEKLNAVDTPMLEELSVHIRDAEADESVRAVLLTGAGRAFCSGGDLDTAGAADAANRVVRAITSLPKPVIAGVHGAAVGFGCSLALACDLVVAAPASYFQLAFTRVGLMPDGGASALLPLLIGRARTSRMAMTAEKISAATAFEWGMISHITSADEYESVLTDVLRSVSGGPTLAFGWTKRALAAATLAELEPVQAIEAEGQLALVETADFREGARAFRERRTPNFRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Isomerase
molecule keywords Enoyl-CoA hydratase/isomerase
total genus 89
structure length 250
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3p5mA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3p5mA01
4Q0GA 1XX4A 4JVTA 4HC8A 4FJWD 4IZBA 5FUSA 1Y7OA 5JBWA 3Q0GA 4ZDEA 4GHNA 3TDCA 4JYLA 4ZDFA 2VX2A 3QYRA 3TLFA 3U9TB 1EF9A 3R0OA 2A81A 3GF7A 3T88A 4JOTA 4FNDA 4KPKA 5DTPA 2J5II 3Q7HA 3ST9A 4JCSA 3ZWCA 4K3WA 4I52A 3LKEA 3ZW9A 1UYRA 1PJHA 4ELXA 5KJPA 3ZWBA 4NEKA 3KTHA 4JYJA 2PBPA 1WDMA 5E0NX 4ASIA 3KTIA 1XNYA 1OD4A 3PZKA 5DU4A 1N6DA 3RSTA 3HP0A 4K29A 4OG1A 2IEXA 2J5GD 3NJDA 3QREA 3VIVA 3N6RB 4QIIA 2F9IA 5INFA 3R9QA 4Z0MA 3U9RB 3FDUA 5DL1A 1K39A 3SWXA 4DI1A 2HW5A 4KWBA 1JXZA 4MXIA 1Q52A 3V5EA 2FBMA 3K50A 5INGA 1NZYB 3IBBA 4FZWC 3H0SA 5DUCA 5MGBA 4WYOB 1WDKA 2ZL4A 4OLQA 3KTKA 4OMRA 3TT7A 5DUFA 3JU1A 2GTRA 4FNBA 5KDRB 3OT6A 1FC7A 4MI2A 2ZQQA 1YG6A 3OMEA 3OC7A 1HNUA 1DUBA 3KTJA 1DCIA 4KNPA 2C8TA 5G1RA 3HINA 2CBYA 5JBXA 3MFMA 2F9IB 1XNWA 4U0HA 2VSUA 3BEZA 1FC9A 3QMJA 5DZKH 2Q2XA 4IZCA 4FN8A 3GMAA 4JCTA 2W3PA 1EY3A 2X24A 4B3IA 1NZYA 4U1AA 3KTGA 3SLLA 3T3WA 1O8UA 3PEAA 1N6FA 5INIA 4ZDCA 2PPYA 1UYTA 4RYFH 5G1SA 1RJMA 2X58A 1VRGA 4NNQA 4FN7A 4F47A 1WDLA 3MT6A 1MJ3A 5G1QA 3U9SB 2DEOA 1TG6A 2VSUC 1YG8A 5DZKA 1X0UA 3BF0A 5E0SH 4EMPA 4JSBA 3WG5A 3DJAA 3Q0JA 1N6EA 3LAOA 3STAA 2PG8A 4QFEA 2F9YB 1TYFA 3ISAA 3G64A 3P5MA 1EF8A 5DU8A 3DORA 2ZL3A 4IZDA 2CE3A 2VSSF 4MOUA 3QXIA 3R9TA 5DTWA 2J5IA 3P2LA 1J7XA 3Q1TA 5C9GA 4ELWA 4JCQA 1W2XA 1K32A 3K8XA 2VSSE 2F6IA 3ZWAA 2VSSA 3R9SA 2BZRA 3M6MA 5CTBA 2NP9A 4GM2A 1FCFA 2FW2A 2Q35A 4U19A 4KD6A 1RJNA 3V5IA 4ZDBA 4I4ZA 3HLN1 1UYSA 4Q1IA 2WTBA 1HNOA 3GKBA 2ZL0A 2J5SA 4HNKA 2FZSA 4RYFA 3QK8A 4EMLA 3M6NA 4B3JA 3R6HA 5KDRA 3L3SA 4RCNA 3HRXA 3NJBA 3QKAA 1UIYA 3TZ3A 5C90A 1XO6A 3PE8A 2QQ3A 4L6WA 3MOYA 4FB8A 2VREA 4FZWA 4QIJA 3BPPA 4WCZA 5FIFA 3QXZA 3GLMA 4YLHA 4JWVA 4JJTA 2J5GA 4I42A 3RSIA 2F6QA 3TT6A 3T8AA 3H81A 4WZ8B 3H0JA 1OD2A 1Q51A 3TVWA 4LK5A 3ZW8A 3TV5A 4ZU2A 3P85A 1WZ8A 3IB9A 4ZDDA 3KQFA 4JFCA 4L8KA 2ZL2A 4B3HA 4U0GA 4JCRA 4K2NA 1UYVA 2DUBA 3I47A 2A7KA 2D3TA 3QWDA 5IKLB 1ON3A 4U18A 2Q34A 5DU6A 5CTCA 3TVUA 3RRVA 3T8BA 1FC6A 3H0UA 3MYBA 2A7SA 4G2RA 2VSUF 4ELSA 1SZOA 3TRRA 5DKPA 2EJ5A 1HZDA 3FF6A 1PIXA 3T89A 4EMMA 2UZFA 3H02A 2ZQRA 1ON9A 1SG4A 1XNVA 3PGQA 2VSUE 3IAVA 4U0GH 2J5IB 3H0QA 3GF3A 3HE2A 2F9YA 5E0SA
chains in the Genus database with same CATH superfamily
4Q0GA 1XX4A 4JVTA 4HC8A 4GEHB 4FJWD 4IZBA 5FUSA 1Y7OA 5JBWA 3Q0GA 4ZDEA 4GHNA 3TDCA 4JYLA 4ZDFA 3W8HB 2VX2A 3QYRA 3TLFA 3U9TB 1EF9A 3R0OA 2A81A 3GF7A 3AJMA 3T88A 4JOTA 4FNDA 4KPKA 5DTPA 2J5II 3Q7HA 3ST9A 4JCSA 3ZWCA 4K3WA 4I52A 3LKEA 3ZW9A 1UYRA 1PJHA 4ELXA 5KJPA 3ZWBA 4NEKA 3KTHA 4JYJA 2PBPA 1WDMA 5E0NX 4ASIA 3KTIA 1XNYA 1OD4A 3PZKA 5DU4A 1N6DA 3RSTA 3HP0A 4K29A 4OG1A 2IEXA 2J5GD 3NJDA 3QREA 3VIVA 3N6RB 4QIIA 2F9IA 5INFA 3R9QA 4Z0MA 3U9RB 3FDUA 5DL1A 1K39A 3SWXA 4DI1A 1Y64B 2HW5A 4KWBA 1JXZA 3A4NA 4MXIA 1Q52A 3V5EA 2FBMA 3K50A 5INGA 1NZYB 3IBBA 4FZWC 3H0SA 4NARA 5DUCA 5MGBA 4WYOB 1WDKA 2ZL4A 4OLQA 3KTKA 4OMRA 3TT7A 5DUFA 3JU1A 2GTRA 4FNBA 5KDRB 3OT6A 1FC7A 4MI2A 2ZQQA 1YG6A 3OMEA 3OC7A 1HNUA 1DUBA 3KTJA 1DCIA 4KNPA 2C8TA 5G1RA 3HINA 2CBYA 5JBXA 3MFMA 2F9IB 1XNWA 4U0HA 2VSUA 3BEZA 1FC9A 3QMJA 5DZKH 2Q2XA 4IZCA 4FN8A 3GMAA 4JCTA 2W3PA 2YJGA 1EY3A 2X24A 4B3IA 1NZYA 4U1AA 3KTGA 3RQFA 3SLLA 3T3WA 1O8UA 3PEAA 1N6FA 5INIA 4ZDCA 2PPYA 1UYTA 3L8IA 1UX5A 4RYFH 5G1SA 1RJMA 2X58A 1VRGA 4NNQA 4FN7A 3O4XE 4F47A 1WDLA 3MT6A 1MJ3A 5G1QA 3ADDA 3RQGA 2DEOA 3U9SB 1TG6A 2VSUC 1YG8A 4J2UA 5DZKA 1X0UA 3BF0A 5E0SH 4EMPA 4JSBA 3WG5A 3DJAA 3Q0JA 1N6EA 3LAOA 3STAA 2PG8A 4QFEA 2F9YB 3ADCA 1TYFA 3ISAA 3IRBA 3G64A 3P5MA 1EF8A 5DU8A 3DORA 2ZL3A 4IZDA 2CE3A 2VSSF 4MOUA 3QXIA 3R9TA 5DTWA 2J5IA 3P2LA 1J7XA 3Q1TA 2P63A 5C9GA 4ELWA 4JCQA 1W2XA 1K32A 3K8XA 2VSSE 2F6IA 3ZWAA 2VSSA 3R9SA 2BZRA 3M6MA 5CTBA 2NP9A 4GM2A 1FCFA 2FW2A 3W8IB 2Q35A 4U19A 4KD6A 1RJNA 3V5IA 4ZDBA 4I4ZA 3A4MA 3HLN1 1UYSA 4Q1IA 2WTBA 1HNOA 3GKBA 2ZL0A 2J5SA 4HNKA 3L8JA 2FZSA 4RYFA 3QK8A 4EMLA 3M6NA 4B3JA 3R6HA 5KDRA 3L3SA 4RCNA 3HRXA 3NJBA 5HUQA 3QKAA 3A4LA 1UIYA 3TZ3A 5C90A 1XO6A 3PE8A 2QQ3A 4L6WA 3MOYA 4FB8A 2VREA 4FZWA 4QIJA 3BPPA 4HDTA 4WCZA 5FIFA 3QXZA 3GLMA 3RQEA 4YLHA 4JWVA 4JJTA 2J5GA 4I42A 3RSIA 2F6QA 3TT6A 3T8AA 3H81A 4WZ8B 3H0JA 1OD2A 1Q51A 3TVWA 4LK5A 3ZW8A 3TV5A 4ZU2A 3AM1A 3BPTA 3P85A 1WZ8A 3IB9A 4ZDDA 3KQFA 4JFCA 4L8KA 2ZL2A 4B3HA 4U0GA 4JCRA 4K2NA 1UYVA 2DUBA 3I47A 2A7KA 2D3TA 3QWDA 5IKLB 1ON3A 4U18A 3ADBA 2Q34A 5DU6A 5CTCA 3TVUA 3RRVA 3T8BA 1FC6A 3H0UA 3MYBA 2A7SA 4G2RA 2VSUF 4ELSA 1UX4A 1SZOA 3TRRA 5DKPA 2EJ5A 1HZDA 3FF6A 1PIXA 3T89A 4EMMA 2UZFA 3H02A 2ZQRA 1ON9A 1SG4A 1XNVA 3PGQA 2VSUE 3IAVA 4U0GH 2J5IB 3H0QA 3GF3A 3HE2A 2F9YA 5E0SA
chains in the Genus database with same CATH topology
4Q0GA 1XX4A 4JVTA 4HC8A 4FJWD 4IZBA 5FUSA 1Y7OA 5JBWA 3Q0GA 4ZDEA 4GHNA 3TDCA 4JYLA 4ZDFA 2VX2A 3QYRA 3TLFA 3U9TB 1EF9A 3R0OA 2A81A 3GF7A 3T88A 4JOTA 4FNDA 4KPKA 5DTPA 2J5II 3Q7HA 3ST9A 4JCSA 3ZWCA 4K3WA 4I52A 3LKEA 3ZW9A 1UYRA 1PJHA 4ELXA 5KJPA 3ZWBA 4NEKA 3KTHA 4JYJA 2PBPA 1WDMA 5E0NX 4ASIA 3KTIA 1XNYA 1OD4A 3PZKA 5DU4A 1N6DA 3RSTA 3HP0A 4K29A 4OG1A 2IEXA 2J5GD 3NJDA 3QREA 3VIVA 3N6RB 4QIIA 2F9IA 5INFA 3R9QA 4Z0MA 3U9RB 3FDUA 5DL1A 1K39A 3SWXA 4DI1A 2HW5A 4KWBA 1JXZA 4MXIA 1Q52A 3V5EA 2FBMA 3K50A 5INGA 1NZYB 3IBBA 4FZWC 3H0SA 4NARA 5DUCA 5MGBA 4WYOB 1WDKA 2ZL4A 4OLQA 3KTKA 4OMRA 3TT7A 5DUFA 3JU1A 2GTRA 4FNBA 5KDRB 3OT6A 1FC7A 4MI2A 2ZQQA 1YG6A 3OMEA 3OC7A 1HNUA 1DUBA 3KTJA 1DCIA 4KNPA 2C8TA 5G1RA 3HINA 2CBYA 5JBXA 3MFMA 2F9IB 1XNWA 4U0HA 2VSUA 3BEZA 1FC9A 3QMJA 5DZKH 2Q2XA 4IZCA 4FN8A 3GMAA 4JCTA 2W3PA 2YJGA 1EY3A 2X24A 4B3IA 1NZYA 4U1AA 3KTGA 3SLLA 3T3WA 1O8UA 3PEAA 1N6FA 5INIA 4ZDCA 2PPYA 1UYTA 4RYFH 5G1SA 1RJMA 2X58A 1VRGA 4NNQA 4FN7A 4F47A 1WDLA 3MT6A 1MJ3A 5G1QA 3U9SB 2DEOA 1TG6A 2VSUC 1YG8A 4J2UA 5DZKA 1X0UA 3BF0A 5E0SH 4EMPA 4JSBA 3WG5A 3DJAA 3Q0JA 1N6EA 3LAOA 3STAA 2PG8A 4QFEA 2F9YB 1TYFA 3ISAA 3G64A 3P5MA 1EF8A 5DU8A 3DORA 2ZL3A 4IZDA 2CE3A 2VSSF 4MOUA 3QXIA 3R9TA 5DTWA 2J5IA 3P2LA 1J7XA 3Q1TA 5C9GA 4ELWA 4JCQA 1W2XA 1K32A 3K8XA 2VSSE 2F6IA 3ZWAA 2VSSA 3R9SA 2BZRA 3M6MA 5CTBA 2NP9A 4GM2A 1FCFA 2FW2A 2Q35A 4U19A 4KD6A 1RJNA 3V5IA 4ZDBA 4I4ZA 3HLN1 1UYSA 4Q1IA 2WTBA 1HNOA 3GKBA 2ZL0A 2J5SA 4HNKA 2FZSA 4RYFA 3QK8A 4EMLA 3M6NA 4B3JA 3R6HA 5KDRA 3L3SA 4RCNA 3HRXA 3NJBA 5HUQA 3QKAA 1UIYA 3TZ3A 5C90A 1XO6A 3PE8A 2QQ3A 4L6WA 3MOYA 4FB8A 2VREA 4FZWA 4QIJA 3BPPA 4HDTA 4WCZA 5FIFA 3QXZA 3GLMA 4YLHA 4JWVA 4JJTA 2J5GA 4I42A 3RSIA 2F6QA 3TT6A 3T8AA 3H81A 4WZ8B 3H0JA 1OD2A 1Q51A 3TVWA 4LK5A 3ZW8A 3TV5A 4ZU2A 3BPTA 3P85A 1WZ8A 3IB9A 4ZDDA 3KQFA 4JFCA 4L8KA 2ZL2A 4B3HA 4U0GA 4JCRA 4K2NA 1UYVA 2DUBA 3I47A 2A7KA 2D3TA 3QWDA 5IKLB 1ON3A 4U18A 2Q34A 5DU6A 5CTCA 3TVUA 3RRVA 3T8BA 1FC6A 3H0UA 3MYBA 2A7SA 4G2RA 2VSUF 4ELSA 1SZOA 3TRRA 5DKPA 2EJ5A 1HZDA 3FF6A 1PIXA 3T89A 4EMMA 2UZFA 3H02A 2ZQRA 1ON9A 1SG4A 1XNVA 3PGQA 2VSUE 3IAVA 4U0GH 2J5IB 3H0QA 3GF3A 3HE2A 2F9YA 5E0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0G A;  1XX4 A;  4JVT A;  4HC8 A;  4FJW D;  4IZB A;  5FUS A;  1Y7O A;  5JBW A;  3Q0G A;  4ZDE A;  4GHN A;  3TDC A;  4JYL A;  4ZDF A;  2VX2 A;  3QYR A;  3TLF A;  3U9T B;  1EF9 A;  3R0O A;  2A81 A;  3GF7 A;  3T88 A;  4JOT A;  4FND A;  4KPK A;  5DTP A;  2J5I I;  3Q7H A;  3ST9 A;  4JCS A;  3ZWC A;  4K3W A;  4I52 A;  3LKE A;  3ZW9 A;  1UYR A;  1PJH A;  4ELX A;  5KJP A;  3ZWB A;  4NEK A;  3KTH A;  4JYJ A;  2PBP A;  1WDM A;  5E0N X;  4ASI A;  3KTI A;  1XNY A;  1OD4 A;  3PZK A;  5DU4 A;  1N6D A;  3RST A;  3HP0 A;  4K29 A;  4OG1 A;  2IEX A;  2J5G D;  3NJD A;  3QRE A;  3VIV A;  3N6R B;  4QII A;  2F9I A;  5INF A;  3R9Q A;  4Z0M A;  3U9R B;  3FDU A;  5DL1 A;  1K39 A;  3SWX A;  4DI1 A;  2HW5 A;  4KWB A;  1JXZ A;  4MXI A;  1Q52 A;  3V5E A;  2FBM A;  3K50 A;  5ING A;  1NZY B;  3IBB A;  4FZW C;  3H0S A;  5DUC A;  5MGB A;  4WYO B;  1WDK A;  2ZL4 A;  4OLQ A;  3KTK A;  4OMR A;  3TT7 A;  5DUF A;  3JU1 A;  2GTR A;  4FNB A;  5KDR B;  3OT6 A;  1FC7 A;  4MI2 A;  2ZQQ A;  1YG6 A;  3OME A;  3OC7 A;  1HNU A;  1DUB A;  3KTJ A;  1DCI A;  4KNP A;  2C8T A;  5G1R A;  3HIN A;  2CBY A;  5JBX A;  3MFM A;  2F9I B;  1XNW A;  4U0H A;  2VSU A;  3BEZ A;  1FC9 A;  3QMJ A;  5DZK H;  2Q2X A;  4IZC A;  4FN8 A;  3GMA A;  4JCT A;  2W3P A;  1EY3 A;  2X24 A;  4B3I A;  1NZY A;  4U1A A;  3KTG A;  3SLL A;  3T3W A;  1O8U A;  3PEA A;  1N6F A;  5INI A;  4ZDC A;  2PPY A;  1UYT A;  4RYF H;  5G1S A;  1RJM A;  2X58 A;  1VRG A;  4NNQ A;  4FN7 A;  4F47 A;  1WDL A;  3MT6 A;  1MJ3 A;  5G1Q A;  3U9S B;  2DEO A;  1TG6 A;  2VSU C;  1YG8 A;  5DZK A;  1X0U A;  3BF0 A;  5E0S H;  4EMP A;  4JSB A;  3WG5 A;  3DJA A;  3Q0J A;  1N6E A;  3LAO A;  3STA A;  2PG8 A;  4QFE A;  2F9Y B;  1TYF A;  3ISA A;  3G64 A;  3P5M A;  1EF8 A;  5DU8 A;  3DOR A;  2ZL3 A;  4IZD A;  2CE3 A;  2VSS F;  4MOU A;  3QXI A;  3R9T A;  5DTW A;  2J5I A;  3P2L A;  1J7X A;  3Q1T A;  5C9G A;  4ELW A;  4JCQ A;  1W2X A;  1K32 A;  3K8X A;  2VSS E;  2F6I A;  3ZWA A;  2VSS A;  3R9S A;  2BZR A;  3M6M A;  5CTB A;  2NP9 A;  4GM2 A;  1FCF A;  2FW2 A;  2Q35 A;  4U19 A;  4KD6 A;  1RJN A;  3V5I A;  4ZDB A;  4I4Z A;  3HLN 1;  1UYS A;  4Q1I A;  2WTB A;  1HNO A;  3GKB A;  2ZL0 A;  2J5S A;  4HNK A;  2FZS A;  4RYF A;  3QK8 A;  4EML A;  3M6N A;  4B3J A;  3R6H A;  5KDR A;  3L3S A;  4RCN A;  3HRX A;  3NJB A;  3QKA A;  1UIY A;  3TZ3 A;  5C90 A;  1XO6 A;  3PE8 A;  2QQ3 A;  4L6W A;  3MOY A;  4FB8 A;  2VRE A;  4FZW A;  4QIJ A;  3BPP A;  4WCZ A;  5FIF A;  3QXZ A;  3GLM A;  4YLH A;  4JWV A;  4JJT A;  2J5G A;  4I42 A;  3RSI A;  2F6Q A;  3TT6 A;  3T8A A;  3H81 A;  4WZ8 B;  3H0J A;  1OD2 A;  1Q51 A;  3TVW A;  4LK5 A;  3ZW8 A;  3TV5 A;  4ZU2 A;  3P85 A;  1WZ8 A;  3IB9 A;  4ZDD A;  3KQF A;  4JFC A;  4L8K A;  2ZL2 A;  4B3H A;  4U0G A;  4JCR A;  4K2N A;  1UYV A;  2DUB A;  3I47 A;  2A7K A;  2D3T A;  3QWD A;  5IKL B;  1ON3 A;  4U18 A;  2Q34 A;  5DU6 A;  5CTC A;  3TVU A;  3RRV A;  3T8B A;  1FC6 A;  3H0U A;  3MYB A;  2A7S A;  4G2R A;  2VSU F;  4ELS A;  1SZO A;  3TRR A;  5DKP A;  2EJ5 A;  1HZD A;  3FF6 A;  1PIX A;  3T89 A;  4EMM A;  2UZF A;  3H02 A;  2ZQR A;  1ON9 A;  1SG4 A;  1XNV A;  3PGQ A;  2VSU E;  3IAV A;  4U0G H;  2J5I B;  3H0Q A;  3GF3 A;  3HE2 A;  2F9Y A;  5E0S A; 
#chains in the Genus database with same CATH topology
 4Q0G A;  1XX4 A;  4JVT A;  4HC8 A;  4GEH B;  4FJW D;  4IZB A;  5FUS A;  1Y7O A;  5JBW A;  3Q0G A;  4ZDE A;  4GHN A;  3TDC A;  4JYL A;  4ZDF A;  3W8H B;  2VX2 A;  3QYR A;  3TLF A;  3U9T B;  1EF9 A;  3R0O A;  2A81 A;  3GF7 A;  3AJM A;  3T88 A;  4JOT A;  4FND A;  4KPK A;  5DTP A;  2J5I I;  3Q7H A;  3ST9 A;  4JCS A;  3ZWC A;  4K3W A;  4I52 A;  3LKE A;  3ZW9 A;  1UYR A;  1PJH A;  4ELX A;  5KJP A;  3ZWB A;  4NEK A;  3KTH A;  4JYJ A;  2PBP A;  1WDM A;  5E0N X;  4ASI A;  3KTI A;  1XNY A;  1OD4 A;  3PZK A;  5DU4 A;  1N6D A;  3RST A;  3HP0 A;  4K29 A;  4OG1 A;  2IEX A;  2J5G D;  3NJD A;  3QRE A;  3VIV A;  3N6R B;  4QII A;  2F9I A;  5INF A;  3R9Q A;  4Z0M A;  3U9R B;  3FDU A;  5DL1 A;  1K39 A;  3SWX A;  4DI1 A;  1Y64 B;  2HW5 A;  4KWB A;  1JXZ A;  3A4N A;  4MXI A;  1Q52 A;  3V5E A;  2FBM A;  3K50 A;  5ING A;  1NZY B;  3IBB A;  4FZW C;  3H0S A;  4NAR A;  5DUC A;  5MGB A;  4WYO B;  1WDK A;  2ZL4 A;  4OLQ A;  3KTK A;  4OMR A;  3TT7 A;  5DUF A;  3JU1 A;  2GTR A;  4FNB A;  5KDR B;  3OT6 A;  1FC7 A;  4MI2 A;  2ZQQ A;  1YG6 A;  3OME A;  3OC7 A;  1HNU A;  1DUB A;  3KTJ A;  1DCI A;  4KNP A;  2C8T A;  5G1R A;  3HIN A;  2CBY A;  5JBX A;  3MFM A;  2F9I B;  1XNW A;  4U0H A;  2VSU A;  3BEZ A;  1FC9 A;  3QMJ A;  5DZK H;  2Q2X A;  4IZC A;  4FN8 A;  3GMA A;  4JCT A;  2W3P A;  2YJG A;  1EY3 A;  2X24 A;  4B3I A;  1NZY A;  4U1A A;  3KTG A;  3RQF A;  3SLL A;  3T3W A;  1O8U A;  3PEA A;  1N6F A;  5INI A;  4ZDC A;  2PPY A;  1UYT A;  3L8I A;  1UX5 A;  4RYF H;  5G1S A;  1RJM A;  2X58 A;  1VRG A;  4NNQ A;  4FN7 A;  3O4X E;  4F47 A;  1WDL A;  3MT6 A;  1MJ3 A;  5G1Q A;  3ADD A;  3RQG A;  2DEO A;  3U9S B;  1TG6 A;  2VSU C;  1YG8 A;  4J2U A;  5DZK A;  1X0U A;  3BF0 A;  5E0S H;  4EMP A;  4JSB A;  3WG5 A;  3DJA A;  3Q0J A;  1N6E A;  3LAO A;  3STA A;  2PG8 A;  4QFE A;  2F9Y B;  3ADC A;  1TYF A;  3ISA A;  3IRB A;  3G64 A;  3P5M A;  1EF8 A;  5DU8 A;  3DOR A;  2ZL3 A;  4IZD A;  2CE3 A;  2VSS F;  4MOU A;  3QXI A;  3R9T A;  5DTW A;  2J5I A;  3P2L A;  1J7X A;  3Q1T A;  2P63 A;  5C9G A;  4ELW A;  4JCQ A;  1W2X A;  1K32 A;  3K8X A;  2VSS E;  2F6I A;  3ZWA A;  2VSS A;  3R9S A;  2BZR A;  3M6M A;  5CTB A;  2NP9 A;  4GM2 A;  1FCF A;  2FW2 A;  3W8I B;  2Q35 A;  4U19 A;  4KD6 A;  1RJN A;  3V5I A;  4ZDB A;  4I4Z A;  3A4M A;  3HLN 1;  1UYS A;  4Q1I A;  2WTB A;  1HNO A;  3GKB A;  2ZL0 A;  2J5S A;  4HNK A;  3L8J A;  2FZS A;  4RYF A;  3QK8 A;  4EML A;  3M6N A;  4B3J A;  3R6H A;  5KDR A;  3L3S A;  4RCN A;  3HRX A;  3NJB A;  5HUQ A;  3QKA A;  3A4L A;  1UIY A;  3TZ3 A;  5C90 A;  1XO6 A;  3PE8 A;  2QQ3 A;  4L6W A;  3MOY A;  4FB8 A;  2VRE A;  4FZW A;  4QIJ A;  3BPP A;  4HDT A;  4WCZ A;  5FIF A;  3QXZ A;  3GLM A;  3RQE A;  4YLH A;  4JWV A;  4JJT A;  2J5G A;  4I42 A;  3RSI A;  2F6Q A;  3TT6 A;  3T8A A;  3H81 A;  4WZ8 B;  3H0J A;  1OD2 A;  1Q51 A;  3TVW A;  4LK5 A;  3ZW8 A;  3TV5 A;  4ZU2 A;  3AM1 A;  3BPT A;  3P85 A;  1WZ8 A;  3IB9 A;  4ZDD A;  3KQF A;  4JFC A;  4L8K A;  2ZL2 A;  4B3H A;  4U0G A;  4JCR A;  4K2N A;  1UYV A;  2DUB A;  3I47 A;  2A7K A;  2D3T A;  3QWD A;  5IKL B;  1ON3 A;  4U18 A;  3ADB A;  2Q34 A;  5DU6 A;  5CTC A;  3TVU A;  3RRV A;  3T8B A;  1FC6 A;  3H0U A;  3MYB A;  2A7S A;  4G2R A;  2VSU F;  4ELS A;  1UX4 A;  1SZO A;  3TRR A;  5DKP A;  2EJ5 A;  1HZD A;  3FF6 A;  1PIX A;  3T89 A;  4EMM A;  2UZF A;  3H02 A;  2ZQR A;  1ON9 A;  1SG4 A;  1XNV A;  3PGQ A;  2VSU E;  3IAV A;  4U0G H;  2J5I B;  3H0Q A;  3GF3 A;  3HE2 A;  2F9Y A;  5E0S A; 
#chains in the Genus database with same CATH homology
 4Q0G A;  1XX4 A;  4JVT A;  4HC8 A;  4FJW D;  4IZB A;  5FUS A;  1Y7O A;  5JBW A;  3Q0G A;  4ZDE A;  4GHN A;  3TDC A;  4JYL A;  4ZDF A;  2VX2 A;  3QYR A;  3TLF A;  3U9T B;  1EF9 A;  3R0O A;  2A81 A;  3GF7 A;  3T88 A;  4JOT A;  4FND A;  4KPK A;  5DTP A;  2J5I I;  3Q7H A;  3ST9 A;  4JCS A;  3ZWC A;  4K3W A;  4I52 A;  3LKE A;  3ZW9 A;  1UYR A;  1PJH A;  4ELX A;  5KJP A;  3ZWB A;  4NEK A;  3KTH A;  4JYJ A;  2PBP A;  1WDM A;  5E0N X;  4ASI A;  3KTI A;  1XNY A;  1OD4 A;  3PZK A;  5DU4 A;  1N6D A;  3RST A;  3HP0 A;  4K29 A;  4OG1 A;  2IEX A;  2J5G D;  3NJD A;  3QRE A;  3VIV A;  3N6R B;  4QII A;  2F9I A;  5INF A;  3R9Q A;  4Z0M A;  3U9R B;  3FDU A;  5DL1 A;  1K39 A;  3SWX A;  4DI1 A;  2HW5 A;  4KWB A;  1JXZ A;  4MXI A;  1Q52 A;  3V5E A;  2FBM A;  3K50 A;  5ING A;  1NZY B;  3IBB A;  4FZW C;  3H0S A;  4NAR A;  5DUC A;  5MGB A;  4WYO B;  1WDK A;  2ZL4 A;  4OLQ A;  3KTK A;  4OMR A;  3TT7 A;  5DUF A;  3JU1 A;  2GTR A;  4FNB A;  5KDR B;  3OT6 A;  1FC7 A;  4MI2 A;  2ZQQ A;  1YG6 A;  3OME A;  3OC7 A;  1HNU A;  1DUB A;  3KTJ A;  1DCI A;  4KNP A;  2C8T A;  5G1R A;  3HIN A;  2CBY A;  5JBX A;  3MFM A;  2F9I B;  1XNW A;  4U0H A;  2VSU A;  3BEZ A;  1FC9 A;  3QMJ A;  5DZK H;  2Q2X A;  4IZC A;  4FN8 A;  3GMA A;  4JCT A;  2W3P A;  2YJG A;  1EY3 A;  2X24 A;  4B3I A;  1NZY A;  4U1A A;  3KTG A;  3SLL A;  3T3W A;  1O8U A;  3PEA A;  1N6F A;  5INI A;  4ZDC A;  2PPY A;  1UYT A;  4RYF H;  5G1S A;  1RJM A;  2X58 A;  1VRG A;  4NNQ A;  4FN7 A;  4F47 A;  1WDL A;  3MT6 A;  1MJ3 A;  5G1Q A;  3U9S B;  2DEO A;  1TG6 A;  2VSU C;  1YG8 A;  4J2U A;  5DZK A;  1X0U A;  3BF0 A;  5E0S H;  4EMP A;  4JSB A;  3WG5 A;  3DJA A;  3Q0J A;  1N6E A;  3LAO A;  3STA A;  2PG8 A;  4QFE A;  2F9Y B;  1TYF A;  3ISA A;  3G64 A;  3P5M A;  1EF8 A;  5DU8 A;  3DOR A;  2ZL3 A;  4IZD A;  2CE3 A;  2VSS F;  4MOU A;  3QXI A;  3R9T A;  5DTW A;  2J5I A;  3P2L A;  1J7X A;  3Q1T A;  5C9G A;  4ELW A;  4JCQ A;  1W2X A;  1K32 A;  3K8X A;  2VSS E;  2F6I A;  3ZWA A;  2VSS A;  3R9S A;  2BZR A;  3M6M A;  5CTB A;  2NP9 A;  4GM2 A;  1FCF A;  2FW2 A;  2Q35 A;  4U19 A;  4KD6 A;  1RJN A;  3V5I A;  4ZDB A;  4I4Z A;  3HLN 1;  1UYS A;  4Q1I A;  2WTB A;  1HNO A;  3GKB A;  2ZL0 A;  2J5S A;  4HNK A;  2FZS A;  4RYF A;  3QK8 A;  4EML A;  3M6N A;  4B3J A;  3R6H A;  5KDR A;  3L3S A;  4RCN A;  3HRX A;  3NJB A;  5HUQ A;  3QKA A;  1UIY A;  3TZ3 A;  5C90 A;  1XO6 A;  3PE8 A;  2QQ3 A;  4L6W A;  3MOY A;  4FB8 A;  2VRE A;  4FZW A;  4QIJ A;  3BPP A;  4HDT A;  4WCZ A;  5FIF A;  3QXZ A;  3GLM A;  4YLH A;  4JWV A;  4JJT A;  2J5G A;  4I42 A;  3RSI A;  2F6Q A;  3TT6 A;  3T8A A;  3H81 A;  4WZ8 B;  3H0J A;  1OD2 A;  1Q51 A;  3TVW A;  4LK5 A;  3ZW8 A;  3TV5 A;  4ZU2 A;  3BPT A;  3P85 A;  1WZ8 A;  3IB9 A;  4ZDD A;  3KQF A;  4JFC A;  4L8K A;  2ZL2 A;  4B3H A;  4U0G A;  4JCR A;  4K2N A;  1UYV A;  2DUB A;  3I47 A;  2A7K A;  2D3T A;  3QWD A;  5IKL B;  1ON3 A;  4U18 A;  2Q34 A;  5DU6 A;  5CTC A;  3TVU A;  3RRV A;  3T8B A;  1FC6 A;  3H0U A;  3MYB A;  2A7S A;  4G2R A;  2VSU F;  4ELS A;  1SZO A;  3TRR A;  5DKP A;  2EJ5 A;  1HZD A;  3FF6 A;  1PIX A;  3T89 A;  4EMM A;  2UZF A;  3H02 A;  2ZQR A;  1ON9 A;  1SG4 A;  1XNV A;  3PGQ A;  2VSU E;  3IAV A;  4U0G H;  2J5I B;  3H0Q A;  3GF3 A;  3HE2 A;  2F9Y A;  5E0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...