3P5TA

Cfim25-cfim68 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
publication title Structural basis of pre-mRNA recognition by the human cleavage factor Im complex
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 47
structure length 196
sequence length 196
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13869 NUDIX_2 Nucleotide hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3p5tA01
3J7Ye 4HFQA 2W4EA 1V8RA 4ZG0A 4N1TA 5ANTA 2DSDA 3X0NA 3X0JA 3FJYA 1VIQA 3P6YA 2DHOA 4KYXA 1HZTA 4YOQA 5GHJA 3O61A 3COUA 3ZR1A 4N1UA 3SHDA 1NFSA 3R03A 3X0SA 1XSBA 3BAPA 2I8UA 3O6ZA 5DD4A 1G0SA 2DSCA 3GRNA 4C9XA 3GZ6A 1VHGA 5BONA 2QJOA 1MR2A 3FSPA 2G73A 1K26A 3Q1PA 1U20A 5FSLA 2O1CA 3L85A 1NQZA 4KTBA 2A8SA 2B06A 1V8WA 2O5WA 3CNGA 5HZXA 2ICKA 2B2KA 2QJTA 2J8QA 4ILQA 3BHOA 4YPHA 1VHZA 3F6AA 1VIUA 5FSMA 4ICKA 2PQVA 2FMLA 4S2WA 1VC8A 1F3YA 2KDWA 4S2XA 4IJXA 1SOIA 1VC9A 3I9XA 3X0IA 1XSAA 4JZUA 5ANWA 5LPGA 3Q91A 5FSKA 1V8SA 2A8TA 1V8VA 3Q2SA 3MCFA 1X51A 1X83A 1MP2A 1V8LA 1KTGA 2YVNA 5I8UA 3Q2TA 3Q93A 3X0PA 2A6TA 1KHZA 2G74A 1JRKA 5IW4A 3GZ8A 4C9WA 4HVYA 1JKNA 3A6UA 3X0QA 3MDIA 1GA7A 3GZ5A 3SMDA 5GHMA 2KDVA 3G0QA 3O8SA 1OW2A 2O5FA 2Q9PA 3ACAA 3FCMA 4KG4A 2AZWA 2DUKA 4YPRA 3F13A 1R67A 3A6TA 3GG6A 2A8RA 5C7QA 2I8TA 3P5TA 3X0RA 5FSNA 1TUMA 5CFIA 5IW5A 4JZVA 5FSOA 2GT2A 2FKBA 1I9AA 1Q33A 3A6SA 1MQWA 2GB5A 1PPXA 5GHNA 5GHQA 3SONA 5DPKA 1X84A 2JVBA 4NFXA 1RRSA 1SZ3A 2RRKA 2YVMA 1MQEA 4MPOA 1MUTA 1RRQA 1PUNA 3H95A 3EESA 3E57A 3ID9A 4JZTA 5GHPA 2QKMB 4DYWA 5GHIA 1VCDA 1V8TA 2PNYA 2VNPA 1V8IA 3KVHA 2GT4A 5CFJA 3WHWA 1XSCA 5ANUA 1K2EA 1PUQA 5C8LA 4K6EA 3RH7A 1SJYA 5BS6A 2XSQA 1IRYA 3EEUA 2I6KA 3I7VA 3HYQA 3O69A 3MGMA 5ISYA 2FVVA 3AC9A 1V8MA 3I7UA 3FFUA 3X0KA 3ZR0A 5DDGA 3MDGA 3X0LA 4JZSA 1KT9A 2YYHA 3FK9A 2A8PA 2YVOA 2DSBA 5DEQA 5ANVA 5GHOA 5C7TA 1VK6A 1G9QA 3X0OA 1VRLA 1V8NA 1RYAA 1PPVA 1NQYA 1MK1A 2ICJA 4KG3A 1Q54A 1V8UA 2CL3A 2A8QA 1HX3A 1PPWA 1QVJA 5ANSA 1SU2A 3U53A 4S2YA 1NFZA 3OGAA 4V14A 2VNQA 3DKUA 3A6VA 2YVPA 3X0MA 1Q27A 1PUSA 3QSJA 5FSIA 3BM4A 3EXQA 4NFWA 1PVFA 3EF5A 3N9UA 3HHJA 4S2VA 2B0VA 1V8YA 3N77A 2R5WA 3Q4IA 3O52A 3DUPA 3GWYA
chains in the Genus database with same CATH superfamily
3J7Ye 4HFQA 2W4EA 1V8RA 4ZG0A 4N1TA 5ANTA 2DSDA 3X0NA 3X0JA 3FJYA 1VIQA 3P6YA 2DHOA 4KYXA 1HZTA 4YOQA 5GHJA 3O61A 3COUA 3ZR1A 4N1UA 3SHDA 1NFSA 3R03A 4J7GA 3X0SA 1XSBA 3BAPA 2I8UA 3O6ZA 5DD4A 1G0SA 2DSCA 3GRNA 4C9XA 3GZ6A 1VHGA 5BONA 2QJOA 1MR2A 3FSPA 2G73A 1K26A 3Q1PA 4J7HA 1U20A 5FSLA 2CZRA 2O1CA 3L85A 1NQZA 4KTBA 2A8SA 2B06A 1V8WA 2O5WA 3CNGA 5HZXA 2ICKA 2B2KA 2QJTA 2J8QA 4ILQA 3BHOA 4YPHA 1VHZA 3F6AA 1VIUA 5FSMA 4ICKA 2PQVA 2FMLA 4S2WA 1VC8A 1F3YA 2KDWA 4S2XA 4IJXA 1SOIA 1VC9A 3I9XA 3X0IA 1XSAA 4JZUA 5ANWA 5LPGA 3Q91A 5FSKA 1V8SA 2A8TA 1V8VA 3Q2SA 3MCFA 1X51A 1X83A 1MP2A 1V8LA 1KTGA 2YVNA 5I8UA 3Q2TA 3Q93A 3X0PA 2A6TA 1KHZA 2G74A 1JRKA 5IW4A 3GZ8A 4C9WA 4HVYA 1JKNA 3A6UA 3X0QA 3MDIA 1GA7A 3GZ5A 3SMDA 5GHMA 2KDVA 3G0QA 3O8SA 1OW2A 2O5FA 2Q9PA 3ACAA 3FCMA 4KG4A 2AZWA 2DUKA 4YPRA 3F13A 1R67A 3A6TA 3GG6A 2A8RA 5C7QA 2I8TA 3P5TA 3X0RA 5FSNA 1TUMA 5CFIA 5IW5A 4JZVA 5FSOA 2GT2A 2FKBA 1I9AA 1Q33A 3A6SA 1MQWA 2GB5A 1PPXA 5GHNA 5GHQA 3SONA 5DPKA 1X84A 2JVBA 4NFXA 1RRSA 1SZ3A 2RRKA 2YVMA 1MQEA 4MPOA 1MUTA 1RRQA 1PUNA 3H95A 3EESA 3E57A 3ID9A 4JZTA 5GHPA 2QKMB 4DYWA 5GHIA 1VCDA 1V8TA 2PNYA 2VNPA 1V8IA 3KVHA 2GT4A 5CFJA 3WHWA 1XSCA 5ANUA 1K2EA 1PUQA 5C8LA 4K6EA 3RH7A 1SJYA 5BS6A 2XSQA 1IRYA 3EEUA 2I6KA 3I7VA 3HYQA 3O69A 3MGMA 5ISYA 2FVVA 3AC9A 1V8MA 3I7UA 3FFUA 3X0KA 3ZR0A 5DDGA 3MDGA 3X0LA 4JZSA 1KT9A 2YYHA 3FK9A 2A8PA 2YVOA 2DSBA 5DEQA 5ANVA 5GHOA 5C7TA 1VK6A 1G9QA 3X0OA 1VRLA 1V8NA 1RYAA 1PPVA 1NQYA 1MK1A 2ICJA 4KG3A 1Q54A 1V8UA 2CL3A 2A8QA 1HX3A 1PPWA 1QVJA 5ANSA 1SU2A 3U53A 4S2YA 1NFZA 3OGAA 4V14A 2VNQA 3DKUA 3A6VA 2YVPA 3X0MA 1Q27A 1PUSA 3QSJA 5FSIA 3BM4A 3EXQA 4NFWA 1PVFA 3EF5A 3N9UA 3HHJA 4S2VA 2B0VA 1V8YA 3N77A 2R5WA 3Q4IA 3O52A 3DUPA 3GWYA
chains in the Genus database with same CATH topology
3J7Ye 4HFQA 2W4EA 1V8RA 4ZG0A 4N1TA 5ANTA 2DSDA 3X0NA 3X0JA 3FJYA 1VIQA 3P6YA 2DHOA 4KYXA 1HZTA 4YOQA 5GHJA 3O61A 3COUA 3ZR1A 4N1UA 3SHDA 1NFSA 3R03A 4J7GA 3X0SA 1XSBA 3BAPA 2I8UA 3O6ZA 5DD4A 1G0SA 2DSCA 3GRNA 4C9XA 3GZ6A 1VHGA 5BONA 2QJOA 1MR2A 3FSPA 2G73A 1K26A 3Q1PA 4J7HA 1U20A 5FSLA 2CZRA 2O1CA 3L85A 1NQZA 4KTBA 2A8SA 2B06A 1V8WA 2O5WA 3CNGA 5HZXA 2ICKA 2B2KA 2QJTA 2J8QA 4ILQA 3BHOA 4YPHA 1VHZA 3F6AA 1VIUA 5FSMA 4ICKA 2PQVA 2FMLA 4S2WA 1VC8A 1F3YA 2KDWA 4S2XA 4IJXA 1SOIA 1VC9A 3I9XA 3X0IA 1XSAA 4JZUA 5ANWA 5LPGA 3Q91A 5FSKA 1V8SA 2A8TA 1V8VA 3Q2SA 3MCFA 1X51A 1X83A 1MP2A 1V8LA 1KTGA 2YVNA 5I8UA 3Q2TA 3Q93A 3X0PA 2A6TA 1KHZA 2G74A 1JRKA 5IW4A 3GZ8A 4C9WA 4HVYA 1JKNA 3A6UA 3X0QA 3MDIA 1GA7A 3GZ5A 3SMDA 5GHMA 2KDVA 3G0QA 3O8SA 1OW2A 2O5FA 2Q9PA 3ACAA 3FCMA 4KG4A 2AZWA 2DUKA 4YPRA 3F13A 1R67A 3A6TA 3GG6A 2A8RA 5C7QA 2I8TA 3P5TA 3X0RA 5FSNA 1TUMA 5CFIA 5IW5A 4JZVA 5FSOA 2GT2A 2FKBA 1I9AA 1Q33A 3A6SA 1MQWA 2GB5A 1PPXA 5GHNA 5GHQA 3SONA 5DPKA 1X84A 2JVBA 4NFXA 1RRSA 1SZ3A 2RRKA 2YVMA 1MQEA 4MPOA 1MUTA 1RRQA 1PUNA 3H95A 3EESA 3E57A 3ID9A 4JZTA 5GHPA 2QKMB 4DYWA 5GHIA 1VCDA 1V8TA 2PNYA 2VNPA 1V8IA 3KVHA 2GT4A 5CFJA 3WHWA 1XSCA 5ANUA 1K2EA 1PUQA 5C8LA 4K6EA 3RH7A 1SJYA 5BS6A 2XSQA 1IRYA 3EEUA 2I6KA 3I7VA 3HYQA 3O69A 3MGMA 5ISYA 2FVVA 3AC9A 1V8MA 3I7UA 3FFUA 3X0KA 3ZR0A 5DDGA 3MDGA 3X0LA 4JZSA 1KT9A 2YYHA 3FK9A 2A8PA 2YVOA 2DSBA 5DEQA 5ANVA 5GHOA 5C7TA 1VK6A 1G9QA 3X0OA 1VRLA 1V8NA 1RYAA 1PPVA 1NQYA 1MK1A 2ICJA 4KG3A 1Q54A 1V8UA 2CL3A 2A8QA 1HX3A 1PPWA 1QVJA 5ANSA 1SU2A 3U53A 4S2YA 1NFZA 3OGAA 4V14A 2VNQA 3DKUA 3A6VA 2YVPA 3X0MA 1Q27A 1PUSA 3QSJA 5FSIA 3BM4A 3EXQA 4NFWA 1PVFA 3EF5A 3N9UA 3HHJA 4S2VA 2B0VA 1V8YA 3N77A 2R5WA 3Q4IA 3O52A 3DUPA 3GWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y e;  4HFQ A;  2W4E A;  1V8R A;  4ZG0 A;  4N1T A;  5ANT A;  2DSD A;  3X0N A;  3X0J A;  3FJY A;  1VIQ A;  3P6Y A;  2DHO A;  4KYX A;  1HZT A;  4YOQ A;  5GHJ A;  3O61 A;  3COU A;  3ZR1 A;  4N1U A;  3SHD A;  1NFS A;  3R03 A;  3X0S A;  1XSB A;  3BAP A;  2I8U A;  3O6Z A;  5DD4 A;  1G0S A;  2DSC A;  3GRN A;  4C9X A;  3GZ6 A;  1VHG A;  5BON A;  2QJO A;  1MR2 A;  3FSP A;  2G73 A;  1K26 A;  3Q1P A;  1U20 A;  5FSL A;  2O1C A;  3L85 A;  1NQZ A;  4KTB A;  2A8S A;  2B06 A;  1V8W A;  2O5W A;  3CNG A;  5HZX A;  2ICK A;  2B2K A;  2QJT A;  2J8Q A;  4ILQ A;  3BHO A;  4YPH A;  1VHZ A;  3F6A A;  1VIU A;  5FSM A;  4ICK A;  2PQV A;  2FML A;  4S2W A;  1VC8 A;  1F3Y A;  2KDW A;  4S2X A;  4IJX A;  1SOI A;  1VC9 A;  3I9X A;  3X0I A;  1XSA A;  4JZU A;  5ANW A;  5LPG A;  3Q91 A;  5FSK A;  1V8S A;  2A8T A;  1V8V A;  3Q2S A;  3MCF A;  1X51 A;  1X83 A;  1MP2 A;  1V8L A;  1KTG A;  2YVN A;  5I8U A;  3Q2T A;  3Q93 A;  3X0P A;  2A6T A;  1KHZ A;  2G74 A;  1JRK A;  5IW4 A;  3GZ8 A;  4C9W A;  4HVY A;  1JKN A;  3A6U A;  3X0Q A;  3MDI A;  1GA7 A;  3GZ5 A;  3SMD A;  5GHM A;  2KDV A;  3G0Q A;  3O8S A;  1OW2 A;  2O5F A;  2Q9P A;  3ACA A;  3FCM A;  4KG4 A;  2AZW A;  2DUK A;  4YPR A;  3F13 A;  1R67 A;  3A6T A;  3GG6 A;  2A8R A;  5C7Q A;  2I8T A;  3P5T A;  3X0R A;  5FSN A;  1TUM A;  5CFI A;  5IW5 A;  4JZV A;  5FSO A;  2GT2 A;  2FKB A;  1I9A A;  1Q33 A;  3A6S A;  1MQW A;  2GB5 A;  1PPX A;  5GHN A;  5GHQ A;  3SON A;  5DPK A;  1X84 A;  2JVB A;  4NFX A;  1RRS A;  1SZ3 A;  2RRK A;  2YVM A;  1MQE A;  4MPO A;  1MUT A;  1RRQ A;  1PUN A;  3H95 A;  3EES A;  3E57 A;  3ID9 A;  4JZT A;  5GHP A;  2QKM B;  4DYW A;  5GHI A;  1VCD A;  1V8T A;  2PNY A;  2VNP A;  1V8I A;  3KVH A;  2GT4 A;  5CFJ A;  3WHW A;  1XSC A;  5ANU A;  1K2E A;  1PUQ A;  5C8L A;  4K6E A;  3RH7 A;  1SJY A;  5BS6 A;  2XSQ A;  1IRY A;  3EEU A;  2I6K A;  3I7V A;  3HYQ A;  3O69 A;  3MGM A;  5ISY A;  2FVV A;  3AC9 A;  1V8M A;  3I7U A;  3FFU A;  3X0K A;  3ZR0 A;  5DDG A;  3MDG A;  3X0L A;  4JZS A;  1KT9 A;  2YYH A;  3FK9 A;  2A8P A;  2YVO A;  2DSB A;  5DEQ A;  5ANV A;  5GHO A;  5C7T A;  1VK6 A;  1G9Q A;  3X0O A;  1VRL A;  1V8N A;  1RYA A;  1PPV A;  1NQY A;  1MK1 A;  2ICJ A;  4KG3 A;  1Q54 A;  1V8U A;  2CL3 A;  2A8Q A;  1HX3 A;  1PPW A;  1QVJ A;  5ANS A;  1SU2 A;  3U53 A;  4S2Y A;  1NFZ A;  3OGA A;  4V14 A;  2VNQ A;  3DKU A;  3A6V A;  2YVP A;  3X0M A;  1Q27 A;  1PUS A;  3QSJ A;  5FSI A;  3BM4 A;  3EXQ A;  4NFW A;  1PVF A;  3EF5 A;  3N9U A;  3HHJ A;  4S2V A;  2B0V A;  1V8Y A;  3N77 A;  2R5W A;  3Q4I A;  3O52 A;  3DUP A;  3GWY A; 
#chains in the Genus database with same CATH topology
 3J7Y e;  4HFQ A;  2W4E A;  1V8R A;  4ZG0 A;  4N1T A;  5ANT A;  2DSD A;  3X0N A;  3X0J A;  3FJY A;  1VIQ A;  3P6Y A;  2DHO A;  4KYX A;  1HZT A;  4YOQ A;  5GHJ A;  3O61 A;  3COU A;  3ZR1 A;  4N1U A;  3SHD A;  1NFS A;  3R03 A;  4J7G A;  3X0S A;  1XSB A;  3BAP A;  2I8U A;  3O6Z A;  5DD4 A;  1G0S A;  2DSC A;  3GRN A;  4C9X A;  3GZ6 A;  1VHG A;  5BON A;  2QJO A;  1MR2 A;  3FSP A;  2G73 A;  1K26 A;  3Q1P A;  4J7H A;  1U20 A;  5FSL A;  2CZR A;  2O1C A;  3L85 A;  1NQZ A;  4KTB A;  2A8S A;  2B06 A;  1V8W A;  2O5W A;  3CNG A;  5HZX A;  2ICK A;  2B2K A;  2QJT A;  2J8Q A;  4ILQ A;  3BHO A;  4YPH A;  1VHZ A;  3F6A A;  1VIU A;  5FSM A;  4ICK A;  2PQV A;  2FML A;  4S2W A;  1VC8 A;  1F3Y A;  2KDW A;  4S2X A;  4IJX A;  1SOI A;  1VC9 A;  3I9X A;  3X0I A;  1XSA A;  4JZU A;  5ANW A;  5LPG A;  3Q91 A;  5FSK A;  1V8S A;  2A8T A;  1V8V A;  3Q2S A;  3MCF A;  1X51 A;  1X83 A;  1MP2 A;  1V8L A;  1KTG A;  2YVN A;  5I8U A;  3Q2T A;  3Q93 A;  3X0P A;  2A6T A;  1KHZ A;  2G74 A;  1JRK A;  5IW4 A;  3GZ8 A;  4C9W A;  4HVY A;  1JKN A;  3A6U A;  3X0Q A;  3MDI A;  1GA7 A;  3GZ5 A;  3SMD A;  5GHM A;  2KDV A;  3G0Q A;  3O8S A;  1OW2 A;  2O5F A;  2Q9P A;  3ACA A;  3FCM A;  4KG4 A;  2AZW A;  2DUK A;  4YPR A;  3F13 A;  1R67 A;  3A6T A;  3GG6 A;  2A8R A;  5C7Q A;  2I8T A;  3P5T A;  3X0R A;  5FSN A;  1TUM A;  5CFI A;  5IW5 A;  4JZV A;  5FSO A;  2GT2 A;  2FKB A;  1I9A A;  1Q33 A;  3A6S A;  1MQW A;  2GB5 A;  1PPX A;  5GHN A;  5GHQ A;  3SON A;  5DPK A;  1X84 A;  2JVB A;  4NFX A;  1RRS A;  1SZ3 A;  2RRK A;  2YVM A;  1MQE A;  4MPO A;  1MUT A;  1RRQ A;  1PUN A;  3H95 A;  3EES A;  3E57 A;  3ID9 A;  4JZT A;  5GHP A;  2QKM B;  4DYW A;  5GHI A;  1VCD A;  1V8T A;  2PNY A;  2VNP A;  1V8I A;  3KVH A;  2GT4 A;  5CFJ A;  3WHW A;  1XSC A;  5ANU A;  1K2E A;  1PUQ A;  5C8L A;  4K6E A;  3RH7 A;  1SJY A;  5BS6 A;  2XSQ A;  1IRY A;  3EEU A;  2I6K A;  3I7V A;  3HYQ A;  3O69 A;  3MGM A;  5ISY A;  2FVV A;  3AC9 A;  1V8M A;  3I7U A;  3FFU A;  3X0K A;  3ZR0 A;  5DDG A;  3MDG A;  3X0L A;  4JZS A;  1KT9 A;  2YYH A;  3FK9 A;  2A8P A;  2YVO A;  2DSB A;  5DEQ A;  5ANV A;  5GHO A;  5C7T A;  1VK6 A;  1G9Q A;  3X0O A;  1VRL A;  1V8N A;  1RYA A;  1PPV A;  1NQY A;  1MK1 A;  2ICJ A;  4KG3 A;  1Q54 A;  1V8U A;  2CL3 A;  2A8Q A;  1HX3 A;  1PPW A;  1QVJ A;  5ANS A;  1SU2 A;  3U53 A;  4S2Y A;  1NFZ A;  3OGA A;  4V14 A;  2VNQ A;  3DKU A;  3A6V A;  2YVP A;  3X0M A;  1Q27 A;  1PUS A;  3QSJ A;  5FSI A;  3BM4 A;  3EXQ A;  4NFW A;  1PVF A;  3EF5 A;  3N9U A;  3HHJ A;  4S2V A;  2B0V A;  1V8Y A;  3N77 A;  2R5W A;  3Q4I A;  3O52 A;  3DUP A;  3GWY A; 
#chains in the Genus database with same CATH homology
 3J7Y e;  4HFQ A;  2W4E A;  1V8R A;  4ZG0 A;  4N1T A;  5ANT A;  2DSD A;  3X0N A;  3X0J A;  3FJY A;  1VIQ A;  3P6Y A;  2DHO A;  4KYX A;  1HZT A;  4YOQ A;  5GHJ A;  3O61 A;  3COU A;  3ZR1 A;  4N1U A;  3SHD A;  1NFS A;  3R03 A;  4J7G A;  3X0S A;  1XSB A;  3BAP A;  2I8U A;  3O6Z A;  5DD4 A;  1G0S A;  2DSC A;  3GRN A;  4C9X A;  3GZ6 A;  1VHG A;  5BON A;  2QJO A;  1MR2 A;  3FSP A;  2G73 A;  1K26 A;  3Q1P A;  4J7H A;  1U20 A;  5FSL A;  2CZR A;  2O1C A;  3L85 A;  1NQZ A;  4KTB A;  2A8S A;  2B06 A;  1V8W A;  2O5W A;  3CNG A;  5HZX A;  2ICK A;  2B2K A;  2QJT A;  2J8Q A;  4ILQ A;  3BHO A;  4YPH A;  1VHZ A;  3F6A A;  1VIU A;  5FSM A;  4ICK A;  2PQV A;  2FML A;  4S2W A;  1VC8 A;  1F3Y A;  2KDW A;  4S2X A;  4IJX A;  1SOI A;  1VC9 A;  3I9X A;  3X0I A;  1XSA A;  4JZU A;  5ANW A;  5LPG A;  3Q91 A;  5FSK A;  1V8S A;  2A8T A;  1V8V A;  3Q2S A;  3MCF A;  1X51 A;  1X83 A;  1MP2 A;  1V8L A;  1KTG A;  2YVN A;  5I8U A;  3Q2T A;  3Q93 A;  3X0P A;  2A6T A;  1KHZ A;  2G74 A;  1JRK A;  5IW4 A;  3GZ8 A;  4C9W A;  4HVY A;  1JKN A;  3A6U A;  3X0Q A;  3MDI A;  1GA7 A;  3GZ5 A;  3SMD A;  5GHM A;  2KDV A;  3G0Q A;  3O8S A;  1OW2 A;  2O5F A;  2Q9P A;  3ACA A;  3FCM A;  4KG4 A;  2AZW A;  2DUK A;  4YPR A;  3F13 A;  1R67 A;  3A6T A;  3GG6 A;  2A8R A;  5C7Q A;  2I8T A;  3P5T A;  3X0R A;  5FSN A;  1TUM A;  5CFI A;  5IW5 A;  4JZV A;  5FSO A;  2GT2 A;  2FKB A;  1I9A A;  1Q33 A;  3A6S A;  1MQW A;  2GB5 A;  1PPX A;  5GHN A;  5GHQ A;  3SON A;  5DPK A;  1X84 A;  2JVB A;  4NFX A;  1RRS A;  1SZ3 A;  2RRK A;  2YVM A;  1MQE A;  4MPO A;  1MUT A;  1RRQ A;  1PUN A;  3H95 A;  3EES A;  3E57 A;  3ID9 A;  4JZT A;  5GHP A;  2QKM B;  4DYW A;  5GHI A;  1VCD A;  1V8T A;  2PNY A;  2VNP A;  1V8I A;  3KVH A;  2GT4 A;  5CFJ A;  3WHW A;  1XSC A;  5ANU A;  1K2E A;  1PUQ A;  5C8L A;  4K6E A;  3RH7 A;  1SJY A;  5BS6 A;  2XSQ A;  1IRY A;  3EEU A;  2I6K A;  3I7V A;  3HYQ A;  3O69 A;  3MGM A;  5ISY A;  2FVV A;  3AC9 A;  1V8M A;  3I7U A;  3FFU A;  3X0K A;  3ZR0 A;  5DDG A;  3MDG A;  3X0L A;  4JZS A;  1KT9 A;  2YYH A;  3FK9 A;  2A8P A;  2YVO A;  2DSB A;  5DEQ A;  5ANV A;  5GHO A;  5C7T A;  1VK6 A;  1G9Q A;  3X0O A;  1VRL A;  1V8N A;  1RYA A;  1PPV A;  1NQY A;  1MK1 A;  2ICJ A;  4KG3 A;  1Q54 A;  1V8U A;  2CL3 A;  2A8Q A;  1HX3 A;  1PPW A;  1QVJ A;  5ANS A;  1SU2 A;  3U53 A;  4S2Y A;  1NFZ A;  3OGA A;  4V14 A;  2VNQ A;  3DKU A;  3A6V A;  2YVP A;  3X0M A;  1Q27 A;  1PUS A;  3QSJ A;  5FSI A;  3BM4 A;  3EXQ A;  4NFW A;  1PVF A;  3EF5 A;  3N9U A;  3HHJ A;  4S2V A;  2B0V A;  1V8Y A;  3N77 A;  2R5W A;  3Q4I A;  3O52 A;  3DUP A;  3GWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...