3P5YA

Crystal structure of the mutant t159a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSARPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 79
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3p5yA00
2DZUA 3IGUA 2Y61A 1IXOA 3NL3A 4EF8A 1ADOA 1M7PA 1DV7A 1KLZA 4JTUA 1L6SA 1CI1A 2FJKA 3FYPA 3NR0A 3OHIA 1JRBA 1R2SA 4DF2A 1TIMA 3WK3A 4MLRA 5J5RA 2F84A 4DF0A 3QSTA 2YYUA 4FX6M 4LV9A 2DZVA 3LV6A 4P61A 1KM2A 3L65A 2E68A 4EOUA 4S1FA 1YXCA 2LLEA 5LNSA 1LBLA 1KTBA 1YTDA 1TPH1 1Z48A 2QCLA 2OJPA 1WQ5A 2XFWA 4Q32A 1QMLA 1XBVA 2VFGA 1FWSA 4K39A 5D02A 2O7SA 2Q3OA 3STCA 1OG0A 4LVAA 2C16A 3HGSA 4RJEA 3IVUA 2Y6ZA 2GJNA 3L0GA 3NVTA 5FEXA 3W07A 3IVTA 1EIXA 5F1VA 2VOMA 3TW7A 3PSVA 1EWEA 3FOKA 2VFIA 3BK0A 3N9RA 4P2VA 3TFXA 3TUUA 1H7WA 1VRDA 2NV1A 1CW2A 4O54A 2CZEA 2NWSA 4UFHA 3ELFA 2VENA 2DJLA 3NG3A 4BWLA 4S2BA 3W1PA 1O5XA 3LCFA 4UXDA 2ZA1A 1OYCA 3EWXA 1Z41A 1ZNNA 2X1SA 3GAYA 1LZOA 3GDKA 5EBUA 1NF7A 3GIYA 5CZ0A 4LV4A 3R8RA 2ISWA 2CFFA 4IMDA 4RR4A 1B4KA 2QKFA 1R30A 4K38A 1W0MA 4CCCA 1XBYA 1G7UA 4YWIA 1FWRA 4O11A 2NX9A 2JK2A 1O5KA 1NF0A 2QCFA 1LOLA 2YX0A 2FTPA 1RPXA 5CPMA 1AMKA 4JDBA 2QCEA 4UC5A 2CZDA 4UMCA 2TMDA 2Y7EA 2X1RA 5D37A 1DKWA 3T55A 2V8ZA 1VLIA 3W1UA 1TRDA 3MHFA 1XDMA 3CIWA 2C6QA 3KRUA 2V2DA 3C3NA 4IWWA 1KFJA 1A5AA 2R91A 3SR7A 1BTMA 3BVJA 5G4EA 4XTIA 4Z1DA 3GLCA 4JYEA 4N6EA 4ADTA 1DORA 5CZTA 1YTEA 3O1NA 5HR7A 3DHDA 2V5LA 3IIZA 3LHTA 1RQEA 1SO6A 3LTYA 5LGZA 2RDTA 3TKFA 5DN1A 5IBXA 1B9BA 1A5CA 5DY2A 4D2JA 4A29A 4IX0A 5AOUA 2G97A 5LHEA 3CWOX 2Y85A 4C1LA 2B7NA 5D2TA 3PR2A 3CPRA 1JUKA 3GK0A 4Y8FA 1SZFA 4LVBA 4WD0A 3TV8A 1A5BA 1G69A 2PRLA 1GG1A 4MZYA 4JDYA 4FIRA 3KRSA 3GZ3A 5D2VA 3RF9A 4UTJA 2CWNA 5LSMA 4MYXA 3UWVA 5LGXA 1RQBA 1DJQA 2WO5A 2QCNA 4N9EA 4BFAA 3G1XA 4CQ8A 1MZHA 1YDNA 4DELA 3E02A 1I2NA 3I6RA 4OHQA 2A6NA 3EWUA 4CCDA 4FX8A 4IXHA 4FNRA 2CLMA 3ATZA 3LHYA 3TX9A 5I3FA 4OV4A 1W5NA 3IGSA 2A4AA 2C18A 3BPWA 2E77A 3DI1A 1VLWA 1OFRA 1KM1A 2V82A 5F2LA 3LCIA 5AC7A 1B3OA 1EP2A 3CQ0A 2C1HA 2YFOA 2YDAA 2VEKA 5EYWA 2W6RA 4UR7A 4L4LA 3M44A 4R33A 2FPVA 2P1FA 4LTSA 5AHFA 3IEBA 1GG0A 3T78A 1DHPA 4I9AA 3P74A 5TBOA 4RZ4A 1DQXA 3EWBX 5KINA 1U5JA 4DBEA 3HIJA 2NX1A 1VZWA 4K8HA 1EPXA 1DVJA 5LZLA 3KVJA 4MJMA 3H53A 1H7XA 2NXHA 4JY8A 3W2MA 3G8RA 1W56A 3P67A 4Z08A 3NM1A 1JQXA 3HG3A 3G24A 5ABTA 3Q94A 3W7DA 4K6AA 3LBCA 5HJLA 2CLOA 3FFSA 3I7RA 1RR2A 2QAFA 3DBPA 1G67A 3LBMA 5DCDA 3QYQA 4AWTA 1VHCA 2NWRA 3PB2A 3TAOA 4MIMA 4FB7A 4NT0A 1GWJA 4GC4A 3S5NA 1JUEA 4MOZA 1LTDA 3W1LA 1SU5A 2YW3A 1EUNA 1OFEA 3SW6A 4AHOA 3G1VA 4UFMA 1TTPA 4NX5A 1FCQA 1UASA 3LB0A 3DKJA 4PODA 3EX3A 4XTDA 3M0ZA 4M6PA 1MSSA 3S8HA 3TE9A 4CNPA 4B5NA 3NPWA 3VI2A 1ZHAA 1SFLA 4Q33A 1N7KA 3TSBA 1TSIA 3W1RA 4OGZA 5FESA 3FS2A 5KZMA 1B57A 2ZRZA 4QJ1A 4Z1BA 1QO5A 1I2QA 5FF3A 3CC1A 1F6KA 4LUJA 3DXIA 2OT1A 2A5HA 3NA8A 4OE7A 3BV4A 3W7QA 3TSDA 1O60A 1LROA 1SSGA 4H4IA 3S5YA 1GZGA 5F2MA 5AHIA 2I1OA 3P5ZA 2C13A 1I2RA 5C6MA 4PCFA 2NXIA 2X1UA 5D04C 2BXVA 1SPQA 1WOAA 4CQAA 4MY8A 1JCXA 2QJHA 3EX6A 1C8VA 1K02A 1QPQA 3BG9A 4RXFA 2FPTA 5G1TA 2FLIA 1TPFA 3QW4B 4ZQCA 3W7IA 3L68A 3G0UA 3DH7A 3M9YA 1J4EA 4AEOA 1IIHA 3NZRA 2EAWA 5KTLA 2DZPA 4QNEA 1KW1A 3W2KA 4JTJA 4LVFA 2VFHA 3L67A 3T40A 1I2PA 1YADA 5FEWA 5C55A 5G5IA 4UMBA 2Q8ZA 3WK2A 3H55A 2KZHA 2NUYA 3GDTA 3W2JA 2Z0IA 2XN1A 2EKCA 1ZAHA 5CKSA 3NPVA 3NEVA 2OMAA 5K9XA 2GOUA 3GXTA 2V30A 1H1YA 4HIBA 1Q6LA 1G4PA 2DORA 4E38A 3NQEA 4LVDA 3SGUA 3HO8A 4RCXA 4I7VA 5CZJA 4JX5A 2DZTA 4U28A 3O05A 4NJKA 1QO2A 4LS0A 1WBHA 3CB8A 3UXDA 1MO0A 3W72A 4ZZ9A 3HMJG 4JNMA 1R2RA 3BW4A 3G0XA 5H91A 3C2VA 4HNTA 4NU7A 3GXNA 3NQGA 1A5SA 1TQXA 1YXDA 2QEZA 2BLEA 3N2XA 1G6CA 2WKJA 4IMEA 2FB2A 4Y6GA 1I45A 4NQ1A 3NL5A 4MFEA 1SZGA 1SSDA 3C2RA 3IRDA 1HO4A 4ZQPA 3CHVA 2DJXA 4O15A 4A3UA 3O8AA 3EWZA 3FKRA 4M5PA 1SW3A 2QCCA 2GQ8A 1TPB1 1QCWA 4E2BA 2YFNA 1KM3A 1LLZA 3HJZA 4WOZA 4ONVA 4G1KA 3P8JA 1MXSA 1XKYA 2RFGA 3B8DA 3PUEA 2V9DA 3HG4A 5D2YA 4AHQA 2PURA 4K37A 1TCDA 3EX1A 3NL6A 2BX7A 4A22A 2I14A 3FIGA 2ZRYA 3W6YA 1QAPA 5I3GA 3A9IA 5HWMA 1TTQA 1IGSA 4MY1A 3W23A 1DQWA 3W76A 5HNRA 2E6FA 1GVQA 1LRTA 1LP6A 4CLMA 3W1XA 3NXFA 1W31A 3ABQA 1OFQA 3KX6A 4RKAA 4C1KA 3D0CA 5F2IA 3CM4A 2ISVA 3IVSA 2BZNA 4BF9A 1TPVA 3L2IA 1OX6A 3T44A 4O0KA 3QFEA 5DLCA 1LOQA 5BMXA 3S0CA 4LS1A 4PL1A 3W7PA 2ALDA 4DF1A 3S1VA 1O95A 4JS3A 1KV5A 1TPEA 3TW6A 1XC4A 5LNUA 3MUXA 4WZHA 4L4MA 2A6LA 4X22A 4ALDA 1XUUA 3ZS4A 4GUHA 4QAIA 1YPFA 4KFPA 1KV8A 3M5VA 3A5VA 4NX0A 4FIQA 1W54A 4FNQA 4XUGA 2YXGA 2OCZA 3SFKA 1JCMP 2Y63A 4RX0A 3E0IA 1H61A 3W2LA 1KFLA 3ABOA 2ZTJA 3BW2A 3F4NA 2OX1A 3LHZA 3VE9A 1IXQA 2WSYA 3DENA 4JD4A 1P4CA 1FCBA 1SW0A 1OYBA 3A5FA 4NZFA 5LNWA 2B0MA 1FY6A 1H7RA 3QH2A 4IX2A 3QM3A 1V5XA 4R53A 4O53A 3LRMA 4EVZA 5TIMA 2DZWA 5IM51 3TA6A 3C8FA 3L0KA 2X16A 4UTWA 1JCYA 1AL7A 1H62A 4OT7A 1ME7A 2ZA2A 3OEXA 3O15A 1N8FA 1YXYA 1XCFA 1I4NA 3E96A 3C56A 3G1HA 3KFTA 2J6XA 5AYYA 3EX4A 5D03A 2E09A 1EX5A 5LNVA 3RLUA 4DO5A 2ZZ7A 2ABAA 3CEUA 4Z1AA 3GR7A 2NXGA 4UTMA 1WOBA 1QWGA 4O16A 4YMZA 2NLIA 1X1ZA 4JTLA 7TIMA 4TR9A 4MVAA 3LCHA 1C9DA 3WJZA 3GNNA 5CPLA 2J9ZA 4GXMA 2QCDA 3GR8A 4BWLC 3W7EA 1GVFA 1SFJA 2JGQA 3ANYA 3DFOA 3LGEA 2B7OA 5J5DA 1ME8A 4N9DA 3JRKA 3P81A 1PHQA 4HHPA 1KTNA 2JBMA 3IGXA 2IQTA 1CX9A 4EWND 4FNTA 1OF8A 1H7NA 2ZRWA 4Y90A 1JCJA 3OIXA 1K7FA 4YLWA 1VCGA 3M47A 1WYIA 2ZBTA 1RZMA 3OVQA 2V5BA 3QRHA 3UZJA 1Q3NA 3BG3A 3STFA 1L6YA 3OVPA 2VEIA 1RV8A 1NEYA 1GEQA 1TPC1 2EGZA 4DXVA 2RKXA 4JTSA 5FF0A 3TROA 1ICQA 3N9SA 1SW7A 1XM3A 4YXGA 3N34A 3HF3A 1VYRA 3UNDA 3V75A 3M43A 2YSWA 4JGDA 4JX6A 3NOEA 2OT0A 3S42A 3BLIA 1AW5A 3PBUA 3CEPA 3S6DA 4U4MA 5BNKA 1SUXA 1VYSX 4KFNA 5IBXC 5KSWA 3BGGA 4N6FA 1B4EA 3PG9A 1UUOA 3F03K 4O4WA 1P5BA 3S9YA 1W37A 2C0AA 1ZFJA 3S5OA 1EWDA 1BKSA 1OABA 4K7YA 4FXSA 2QCDB 3T7VA 3GDLA 4GE8A 3TMLA 4AAJA 3EXTA 4NNCA 4X3ZA 1XI3A 2ABBA 2HMCA 1LRNA 4QISA 4JTTA 1J2WA 4TX9A 1Q6OA 3FA5A 4N4PA 4O50A 3RMJA 2QDGA 3W7LA 5D38A 4JTEA 3MYOA 3O06A 2CZFA 2CLLA 1LOSA 1M5WA 3NQ6A 2ZQ0A 2Y7GA 1HTIA 2ZFAA 1L9WA 4XZ9A 4JTKA 3MJYA 3T4CA 4ZQRA 2WNZA 4NNBA 3PVFA 4PEKA 3QC3A 1JR1A 3PM6A 4OQVA 2PRMA 3GAKA 3KRZA 1ZCOA 1F6PA 5KITA 3P5YA 3OVRA 3LLFA 2QUTA 1Z42A 4IMGA 3QQ0A 1W8SA 3ABSA 4RXGA 4O57A 1TV8A 4QSHA 1UUMA 1XBZA 2P0OA 2A2IA 4O12A 3RK8A 5LKYA 1LLWA 4RK8A 4ZL1A 1FX6A 1GYLA 1T96A 4O52A 3TC7A 4BI7A 2FIQA 1QOPA 4M6QA 4GUJA 3MMTA 2DZSA 4JR5A 3LOTA 4PH6A 2B7QA 2WNNA 5D30A 1FWTA 3BO9A 4LU0A 3G18A 2VFDA 3HGOA 1H63A 5HR6A 2G5WA 3PB0A 2A7PA 4X2RA 5D09A 2RDWA 2C14A 3UWUA 3L21A 3MO7A 4HSNA 1TB3A 4NJIA 5HUPA 1A53A 4LC6A 4XQ6A 3LCWA 1ZAIA 1LM1A 4NUWA 2FQIA 2AGKA 2RHGA 5CPNA 3C6CA 1E51A 3G1SA 4OBTA 1F74A 3IIPA 3UQNA 4HT3A 2PCQA 2ZTKA 5AC8A 4CNNA 3HOJA 5L9FA 1LBMA 4MKNA 4TU1A 4O1CA 2QUVA 3NQDA 3P60A 3L5AA 4KWVA 3WJWA 1Q45A 4TMBA 3W7NA 2I9EA 1TMHA 1FQ0A 1I8JA 1TRIA 4X9SA 1GYNA 3A24A 3QMSA 2EF9A 3C4UA 4IUOA 3QMTA 4IQLA 2JKAA 1D9EA 4XKYA 3W2NA 2QR6A 3W75A 5EA9A 2QCMA 3W3OA 2Z6JA 5DCBA 3THQA 4JIPA 5G2IA 1KFEA 3DFSA 2ZRXA 3G3MA 4K8EA 2E1DA 3LXCA 2EPHA 4RLIA 4ZMGA 3W1TA 5A8GA 1WA3A 2QJIA 3NQ8A 4N2YA 4WY0F 3UD6A 3HPXA 1OK6A 3W70A 1HFBA 1RD5A 1A50A 2PE4A 3CIXA 3I68A 1TV5A 2WNQA 3TIMA 3SIZA 4H3DA 1FCVA 3GYEA 1ZENA 4FNSA 4CCEA 3P62A 4O19A 3F1QA 4OU1A 4IOTA 3WK1A 4HNUA 3IIOA 4GUGA 4K36A 3NNTA 3F4WA 3E9AA 4O8RA 5HWNA 4HN4A 5FEPA 1EA0A 2TYSA 3DAQA 4GUFA 3UYCA 3THAA 4YCOA 1VYPX 2JKPA 1TPDA 4O0ZA 5DBUA 1DBTA 1KFCA 2DP3A 3HG5A 3USBA 3UPBA 1KFKA 3DHFA 2XN0A 4FXRA 1QFEA 1WBJA 3OA3A 4UR8A 3LXBA 1K7EA 3B04A 2WQPA 1OF6A 3R13A 4JXCA 5AN7A 4DQWA 5HWJA 2A21A 1W5QA 5I3JA 3B06A 2CW6A 2GVGA 3FEMA 3W7GA 2GVLA 4W9TA 1PS9A 3QF0A 1R47A 3HGRA 4O17A 4LRSA 1TJRA 3UY8A 3RU6A 1VR6A 1GTHA 5DXXA 3B05A 3PBVA 4JTIA 1NAL1 3NQ7A 3LHVA 3M41A 3M7WA 4MYAA 4EIVA 2WV8A 4JTGA 2Y88A 1PE1A 3B0VC 1ZALA 5T26A 2C3ZA 2R8WA 1GVRA 2GJLA 3RNDA 3TQ0A 3VKJA 4AMAA 1O4UA 5AYXA 3UWWA 2ZYFA 3S1WA 2H8ZA 3MP5A 1L2UA 3NDOA 4O1AA 2E6DA 1QOQA 2E5DA 3G1DA 1F76A 3ZR4A 3W1QA 2EHHA 5DELA 3L0NA 1KFBA 2YCEA 3CLMA 3OBKA 4M7SA 1SO4A 3G1YA 3O16A 3PS7A 4A2RA 1TO3A 4ADSA 1VS1A 3W7CA 4LVGA 3KVMA 1EP1A 3G8EA 2AQWA 4HPJA 3NZ1A 1H50A 5C2XA 3K30A 4MFDA 4QITA 3R89A 3NQMA 3TJLA 4LT9A 4GFSA 5FF7A 2NUWA 5EPDA 3H54A 4BR1A 1G4EA 3M5XA 3MBDA 2TSYA 2VC6A 3N19B 3VFLA 5LHFA 1P0NA 2VXNA 4GNJA 4JX4A 1WXJA 3IIVA 5K7JA 4ORMA 1DOSA 4N4QA 1W3TA 5EY5A 3W74A 1UJPA 2QAPA 2GVJA 3SJ3A 4UFIA 3C2FA 3SECA 1MEIA 4LOCA 4OWGA 3UPWA 1VJIA 3PBWA 3G3DA 3TAKA 5HQEA 1X8FA 3G1AA 3PF3A 3SZ8A 2CLEA 3O07A 3W7HA 2C19A 5AC6A 3NPUA 3TDFA 2CLFA 4ZQMA 2FB3A 2A85A 1XUZA 3UWZA 3NQAA 5AB3A 3GNDA 4DO4A 1Q6RA 4HKPA 1BEUA 3UWYA 3HQ1A 1FCUA 3V1PA 3W1AA 4AF0A 4JYDA 1XDLA 4KFOA 4NJHA 4IPIA 3QZEA 5TQLA 1FWNA 4UUIA 3NGJA 1JUBA 3W2UA 4UTUA 1KBJA 2GUUA 1MEWA 3MBFA 4EF9A 2PRHA 4IPJA 3KVKA 3LDVA 1X1OA 3W73A 3W1MA 5DXYA 6TIMA 1H60A 4PL2A 2E6YA 2J9YA 2ZZ1A 3NYZA 2A1YA 1NSJA 1F2JA 2NZLA 4ORIA 3GKFA 1OK4A 4FF7A 4Y96A 4UTTA 1BWKA 1W5PA 1UB3A 4UMAA 2WJZA 1TTIA 5C54A 3C61A 4I7WA 4WOQA 4UTWC 5FF2A 1FDZA 3DI0A 4ZQNA 4UNKA 4FHAA 2ZDRA 2ZZ2A 1TV7A 3LLDA 1OFOA 2H6RA 4TO8A 1THFD 1M6JA 5C5YA 3W22A 4WX2A 3M1ZA 3CWNA 4JN6A 1IXNA 2ATSA 1F5ZA 2V81A 3VCRA 3MHUA 4TIMA 2OZ0A 2J24A 4UCGA 3B0UX 3P80A 1GVOA 3BARA 3CT7A 3QSRA 3HPZA 3LXAA 3TMQA 3U6WA 1KM0A 5HULA 4BI5A 3LHWA 1XBXA 4FEZA 2V2HA 3NL2A 1TYGA 3W7KA 4NJGA 4WJEA 1DJNA 1VHNA 5AHMA 5A5WA 2FDSA 4AF0B 4RZ6A 4JTFA 1AW1A 1H7OA 5FI8A 1AG1O 4AWUA 4BK9A 3TC6A 2E5CA 3LERA 2YZRA 3MHGA 4O28A 5D33A 2H8XA 2J9XA 4PTNA 1JJKA 1UCWA 1WAUA 2HSAA 4RZ5A 1ALDA 1QDSA 5CGQA 1SQ7A 2B7PA 1LYXA 2R14A 3NPXA 2Y7DA 3CTLA 1VC4A 4FO4A 3HPSA 4M6VA 1K8ZA 3JS3A 2QF7A 3MP4A 3SSJA 4CQ9A 2O7QA 3E12A 4Z0SA 2PC4A 1XXXA 3DZ1A 3L9CA 2Q3RA 3VNDA 4A2SA 3QPZA 3PUOA 3QPYA 1TTJA 1PIIA 1GVSA 1HO1A 1K8YA 6ALDA 3N14A 2ATMA 5BOOA 3W71A 1YTKA 2W79A 1K8XA 2B4GA 3EEGA 3N73A 3B4UA 4UFKA 5E93A 2X30A 3R2GA 3GVGA 1K7XA 3O6YX 4CNOA 3MWAA 1EUAA 4K7VA 4AVFA 1M7OA 4M19A 1S5VA 4GBUA 1W3IA 3LX9A 2VEMA 4ML9A 3MI3A 1K03A 3TSMA 4E0CA 4QNWA 4LWWA 4AH7A 3LRLA 5F4XA 3FJ6A 1OFAA 3HG2A 3P7YA 3ZWTA 1X6UA 2Z2UA 4N02A 2TPSA 4LW7A 4IGHA 1LORA 5K4ZA 5F4SA 2Q8LA 4KKXA 4QIUA 4NNAA 3IV3A 1ZJIA 2VKZG 1VPXA 3EXRA 1ICPA 5I3KA 4HNNA 2CZ5A 3HB9A 1KBIA 4O13A 5D2WA 3O6CA 3NQVA 3KXQA 1P1XA 1JCNA 4ADUA 2C15A 1JULA 2RH9A 3C0JA 1IF2A 2QJGA 3KOFA 2E5BA 3PUDA 1OX5A 2QDHA 1AL8A 3GX9A 3R5EA 2H90A 3NM3A 4NXKA 2GQAA 3W83A 3FLUA 5G2HA 3PY2A 3I65A 3C2EA 5HMSA 5FEZA 3KAOA 3G0SA 4R34A 3N3MA 3IIXA 3WJXA 5AFDA 3NAVA 2ZCGA 4PA8A 3MI2A 2P10A 4ICNA 3C52A 5D32A 2Y89A 3EKLA 4XBKA 3SI9A 3JR2A 4DPPA 3BG5A 4UTHA 3DFPA 2FFCA 5F2GA 5EL1A 4DPQA 5BW6A 3ZWSA 1TQJA 3P8IA 3G1FA 3EXSA 5G4WA 3TH6A 1AK5A 5E1QA 4IJBA 3QQ1A 2X1TA 4PC8A 1QPRA 1AW2A 4XBSA 1SO5A 1FDJA 3FJLA 3PSWA 4UFLA 3PAJA 1ZY9A 4GJ1A 3TQVA 3DKLA 3N2MA 4N9CA 1BWLA 2A7NA 2QUUA 4QM1A 3QJAA 4J9JA 1YPIA 4JIQA 3W7OA 3M5ZA 1LCOA 5AHEA 3ATYA 4JYFA 4UFJA 1X7FA 5DY3A 1TJPA 3STGA 2ZRVA 5G2WA 3BGJA 1H7PA 1GTEA 1WV2A 3DFTA 2FPYA 3KHJA 2Y62A 5K9DA 2YPIA 5I3HA 4DEFA 4H6KA 3W9ZA 3PG8A 3LCXA 4DBDA 2YYTA 2UV8G 4TMCA 1QPNA 3BW3A 3I7SA 2XN2A 4ZVJA 3GKAA 4IMFA 3TNOA 4JY9A 4IMCA 5AYZA 3LCLA 1GJPA 1SZNA 2F7FA 1XFBA 4FNPA 3TXZA 2DU2A 4IXXA 2V0TA 2Z6IA 4FNUA 3LI1A 3TR2A 3I7QA 3A22A 4WUIA 3P61A 1TPUA 3STEA 5EKYA 3TXVA 3WJYA 3ZFHA 3M5YA 1NVMA 2Y7FA 1N55A 2WPBA 1KTCA 2CLIA 1QNVA 1D3GA 4JICA 1W5MA 4MPQA 5MHBA 1T8XA 1S5WA 4MUZA 3MYPA 2HTMA 2VFEA 5CZSA 3U2OA 1YYAA 1G7VA 2BSLA 5K2ZA 5E0KA 3YPIA 1U83A 2H3BA 1ZAJA 1VH7A 3P84A 1SO3A 2VFFA 4MLJA 1FUYA 2ZZ3A 4NZJA 3W86A 4A21A 1K3UA 1J5TA 3AO0A 1PVNA 4O1BA 1V7YA 1ICSA 5D05A 1EP3A 3GB6A 3O63A 2D73A 4POCA 5CG7A 4UTIA 4JTHA 2CLKA 5CSSA 3W85A 4ZQOA 4NVTA 1ML1A 1SR9A 2Y70A 3A23A 4O4VA 3WK0A 4HNVA 3L5MA 3TFCA 2YGYA 3LV5A 2J27A 5KMYA 2WOQA 1QR7A 3U8GA 1UBSA 3BLFA 5FF4A 1PCWA 3S5ZA 1FDYA 3M16A 1C29A 1O94A 1RQHA 4UTKA 4WQ6A 2A0NA 3SGZA 2E6AA 2TRSA 4O18A 2DZXA 1R46A 3PULA 3HGJA 3MI6A 1GPWA 1GQNA 1JRCA 2HS8A 2ZA3A 5L6UA 3FKKA 1OJXA 1VCFA 3TJXA 1KM6A 3RLVA 5I3IA 5AHNA 3DU0A 2QCGA 3W7JA 4WY0A 4DO6A 1PCKA 1D3HA 1LBFA 4XKYB 4AHPA 4LNYA 1FWWA 1L6WA 3B03A 4HPXA 4O10A 4I7UA 3VE7A 4XWUA 3AJXA 3B0PA 3UZ5A 3Q58A 2GPTA 3DFQA 1W5OA 1R2TA 3DGRA 3DFNA 5KZEA 3G22A 3LTPA 2JGYA 1ONRA 4MJZA 3EB2A 1OX4A 2NX3A 4UNLA 1G4TA 2W0UA 4HSOA 5K4XA 3LHUA 3NQ2A 3INPA 3PC0A 4R7JA 3PBYA 4GWEA 3NQCA 1I2OA 3NQFA 4NJJA 2GQ9A 1XL9A 5F4WA 3L66A 3WJSA 2NUXA 2VELA 3P82A 4GRSA 4JEQA 3ABRA 2G96A 1W1ZA 3NO5A 1GOXA 4Y9AA 1KM5A 4M7TA 2CU0A 2ZZ5A 1KA9F 1G4SA 3EWWA 4WXYA 2ZRUA 1HL2A 4O14A 1PV8A 3S1UA 1F73A 4LRTA 1IIGA 1OHLA 1YDOA 1Z44A 1EEPA 4MY9A 5BMWA 3W7MA 1W3NA 1JCLA 2HS6A 4LC8A 5F1UA 1DL3A 2V2CA 3W84A 5HINA 3TU9A 1IXPA 1MEHA 2X2GA 3A21A 1Q6QA 1F05A 4LS2A 4E2DA 4YCPA 5LNRA 1T99A 1H51A 3L5LA 3LI0A 3KVLA 3LTSA 3LRKA 4KWWA 4YL2A 3EX2A 4WY0B 3CU2A 4RV8A 3W1NA 2VEPA 3LCGA 3GDMA 1YLVA 5SWUA 4MZ8A 1LRQA 3QEZA 1KLYA 1HUVA 5CSRA 3M6YA 3UY7A 4PFMA 3UWQA 5U4NA 4AXKA 2WSRA 3PWAA 4S2CA 5D2XA 4BI6A 1SZEA 2RDUA 5U7SA 1LDCA 4Z0JA 1TPWA 2AAMA 3Q37A 1OX4B 4QQ3A 5G1YA 3C2OA 1VQTA 1Y0EA 2H3DA 5DBTA 4Z1CA 5EMUA 2YW4A 1WX0A 3GXPA 3FYOA 1T0OA 4O1DA 1GT8A 4NXSA 1ME9A 2ZZ6A 3TQKA 3E49A 4LUIA 1YDVA 5DCEA 3Q2DA 5K9CA 2A7RA 5HUOA 1NFBA 3WFAA 3HBLA 1H5YA 4AB4A 2J88A 1QPOA 5GVJA 3RFAA 1S5TA 3O6DA 3GDRA 2BWGA 2ZZ4A 3TK7A 1JVNA 5BRBA 3BLEA 1P0KA 3LM7A 5K3VA 3MP3A 5KZDA 4N9BA 1H1ZA 1RVGA 3QMRA 4UTLA 2YR1A 3OG3A 2Z1BA 1VCVA 3UXAA 2BTMA 1OFPA 1TREA 2JKEA 2NV2A 4OV9A 1PL9A 4UTTC 3SY5A 4UIOA 3W88A 1KM4A 3TCEA 5H2ZA 3W87A 1FBAA 3MW7A 1EB3A 3R12A 1OVDA 1WDWA 1PHWA 8TIMA 4FX7A 5AHLA 1OYAA 3QW3A 3W7RA 2G95A 3EKZA 4Q4KA 1OFDA 3S1XA 2QCHA 1F7BA 2WSQA 1JQVA 2ISSA 5CPOA 4MZ1A 4GUIA 1OFBA 4WXZA 4LY8A 3EWYA 1S3HA 4AWSA 2R94A 1FXQA 2CLHA 1HG3A 1FXPA 1VGAA
chains in the Genus database with same CATH superfamily
1WKEA 2JFEX 2Y61A 1E3ZA 1KLZA 2CCRA 3CUHA 4JTUA 3ZM8A 1L6GA 3ZSTA 4TUFA 1DYSA 3IJIA 3PP7A 3BSHA 2F84A 4DF0A 4KCVA 2NT1A 2YYUA 3MZ2A 2DZVA 1RA5A 4P61A 4XAZA 2XGZA 3VX1A 5LNSA 1LBLA 4GZEA 1KTBA 3PJXA 1C92A 3W38A 1U5HA 1QMLA 1XBVA 1FWSA 2GJNA 1EIXA 1IT8A 1BYDA 3H7UA 1EWEA 2UY3A 3E0FA 2VFIA 1XICA 4P2VA 3TFXA 1K77A 4KWSA 3UGVA 2CZEA 3GG0A 4R27A 4FLRA 3LCFA 4UXDA 2Z00A 1LG1A 4J3VA 2ZICA 3J7HA 1ZNNA 3ZJ7A 2HE5A 5BRPA 1LZOA 1P43A 3GIYA 1GOMA 1H3GA 4IPLA 3GBEA 2CFFA 1UPPA 1UW9A 4DIAA 4RR4A 2TAAA 1R30A 4TV5A 2PTXA 4CCCA 1QI0A 2I16A 1WB0A 1WDDA 1W2VA 2NX9A 3UP8A 2JK2A 1NF0A 4GZIA 2PTYA 2QCFA 1KNWA 1LOLA 2XG9A 5CPMA 2VCBA 2QCEA 2Y7EA 4HGXA 2X1RA 1DTNA 2BBFA 3T55A 3JW7A 2WHJA 3W1UA 3C3NA 2F2KA 4IWWA 1KFJA 3BVJA 2QQ6A 4JYEA 3ABZA 4CD7A 1NTHA 3HPAA 5CZTA 1YTEA 3O1NA 4GNVA 2V5LA 4WGXA 2CBJA 1SO6A 3R0DA 2J7HA 2Z28A 2XZ9A 1Q66A 3KZSA 5DY2A 4D2JA 3MSYA 1QW9A 2G97A 3UA3A 4HMEA 3CWOX 2Y85A 1RVKA 1EIBA 3PR2A 1JUKA 3ARVA 2BVDA 3OZYA 2E25A 4Y8FA 4M8UA 4LVBA 5H8MA 3VFCA 2PDLA 4AIEA 3NCOA 4JDYA 1PXGA 4FIRA 4F66A 2VGGA 1KWGA 5TF0A 1Q65A 3MUY1 5BWAA 2CWNA 5LSMA 3UWVA 3PZQA 3LSBA 5IHRA 3SQLA 4H6QA 3GD6A 2QCNA 4GJIA 4QG9A 3WN6A 4FPSA 1G0CA 4MHBA 3U7BA 1JPDX 7ENLA 3JZUA 1CBGA 3D5HA 4CCDA 4FX8A 4GPNA 1J12A 3F5LA 1CECA 3TX9A 2VI0A 2GK1A 2XVPA 1W5NA 2Y2WA 2C18A 3FX4A 4I5UA 4DLMA 2V82A 4MDOA 3F4VA 5A8QA 1B3OA 1CGVA 1N2VA 4TX6A 2YFOA 1TUFA 1ZJBA 4PUJA 3WFZA 3GS6A 4DWSA 2VEKA 2W6RA 4A6GA 4L4LA 4R33A 2FPVA 3W6LA 4LTSA 4P8XA 3GY1A 3BAXA 5AHFA 1V4YA 3H26A 1V6TA 4GG9A 4EE9A 3UVIA 9XIMA 3OIHA 5KINA 5A6BA 4HZ8A 3T8QA 4TV6A 1HJVA 4Z17A 2NX1A 1XHGA 1J18A 1DVJA 3TTYA 3W2MA 3G8RA 4Q7BA 2GQ3A 3OO2A 2X0SA 4ZO7A 2ANUA 4HOWA 3W37A 4K6AA 3WBAA 2CLOA 3LBMA 5DCDA 5A3HA 2WVVA 3QYQA 1BXNA 3K8KA 4AWTA 2NWRA 5E0CA 4ML4A 3H2EA 4NT0A 3S5NA 5DX7A 1ONEA 3UBPC 3BMXA 1UASA 3DKJA 4M6PA 4H04A 3TE9A 3GTHA 5A6BD 4CNPA 4Q8VA 5DMMA 1N7KA 2ACSA 2WKGA 3N12A 3GW3A 1JZ5A 5FESA 2G3JA 1EC7A 3WQWA 1Q13A 3TZFA 2Z27A 3ITOA 3B8UA 3MS8A 3W82A 1I2QA 1TJ0A 3CC1A 1TKKA 1UR1A 3GNXA 2XIIA 3W01A 2OT1A 3EMQA 1EJSC 3W7QA 3WDRA 2VM8A 3CUZA 1P1MA 2D0GA 2INZA 2O9OA 2ONEA 2VYOA 2HK0A 4R3UA 1LWJA 1GZGA 5A1AA 1ZB5A 2QIIA 3IJQA 2NXIA 4PN2A 5D04C 1SPQA 1WOAA 1QPQA 1P7TB 3BG9A 4S3EA 3LPPA 4J2PA 4RXFA 4GX8A 3W7IA 3RG6A 2PPGA 3PZ9A 4A35A 4W8LA 3P2VA 3EZ4A 2H9AB 4FS9A 1OINA 1KW1A 4GXPA 4JTJA 4LVFA 3WF4A 5FEWA 2D20A 3GR4A 1TUXA 2HEJA 3VGHA 2NUYA 3GDTA 4RV3A 3VNZA 5FSEC 2Z0IA 1X96A 2EKCA 1OT2A 1ZAHA 2PI6A 1NELA 3NEVA 3FVMA 1WKFA 4PMOA 3GXTA 1G4PA 3NQEA 1U1UA 4I7VA 3TQPA 1H11A 5CZJA 3UJSA 3WUEA 2F2HA 4NJKA 5I06A 1H09A 1NOFA 4WEVX 4ZZ9A 1R2RA 3CL7A 5H91A 3EOUA 4HNTA 3LLXA 3NQGA 1YXDA 2QEZA 1AZ1A 2WHMA 2WKJA 3PTMA 3WZ0E 3BQ5A 3PZNA 3U9IA 3H12A 4NQ1A 1EZWA 3NL5A 4YWSA 4AD5A 1SSDA 3C2RA 3IRDA 4ZQPA 4EWJA 2Q02A 3O8AA 3FKRA 2B31A 1ITUA 4Y7EA 4LB3A 1LLZA 3ZR6A 4GA8A 3E5BA 1C93A 1MXSA 4L65A 2V3GA 4CVWA 1KKOA 2UY2A 3SIMA 3AYVA 3VOFA 2PDHA 2PURA 3AIUA 2PFHA 2ZRYA 1L8NA 4D6EA 1TTQA 4FOJA 4MY1A 2A79A 3SAZA 4FLOA 3NOYA 4TOQA 1QXLA 2E6FA 1LG2A 3BSMA 3AQUA 1LRTA 1LP6A 2ZXQA 2AMXA 3MVTA 4GH1A 1QK0A 3AMDA 1V6VA 4EACA 2CBVA 3CM4A 1RA0A 5CC6A 4BF9A 3L2IA 3OHMB 1AJ0A 1XR2A 4X0VA 4O0KA 3T0TA 3TR9A 3SCWA 5TNVA 4LYKA 3S0CA 2P8CA 2EG6A 1N82A 2ZE0A 3NTYA 4HPHA 4L4MA 3EMCA 1NQKA 3VOIA 4HB7A 4X22A 1XUUA 5E9AA 2W67A 4QAIA 2QMJA 1KV8A 3M5VA 1IEVA 1TWWA 1W54A 3E2VA 3QKZA 2OCZA 2Y63A 1S5MA 2XVGA 2WMIB 1JYWA 3ABOA 4WKFA 4BHYA 2WSPA 1H0IA 3LHZA 1SJAA 2WSYA 3WF2A 1JYNA 4J1OA 3UVAA 1FCBA 3AWOA 3A5FA 2VTFA 3VNYA 2G50A 1FY6A 2WANA 3T6CA 7CGTA 4IX2A 3QM3A 5C7VA 3OU8A 3K8LA 2HXTA 3E5PA 2XVNA 2DZWA 2VCCA 1X8CA 3OEXA 1TMQA 1NQ6A 1RP8A 2V68A 1XCFA 3CZLA 2D0FA 3G1HA 3KFTA 2QW5A 3G1RA 3AOFA 3TYZA 5LNVA 1ZL1A 3RLUA 3FDGA 4ZO8A 2NXGA 4UTMA 3PZTA 1QWGA 1TX2A 3LCHA 1E0TA 3AC0A 3EOOA 5JBDA 1MQRA 2QPXA 4LXFA 2IKJA 4GXMA 1JZ8A 2XJ7A 3GR8A 4BWLC 1W9BM 2JGQA 1JD7A 2OX4A 3ANYA 3DFOA 3HURA 5J5DA 1V93A 7TAAA 1DWGM 3P81A 1TE6A 4CEUC 2Z1WA 2JBMA 4WJ8A 4FNTA 3BANA 3PNUA 3KTXA 3THUA 3MMWA 3OYXA 4YLWA 1RY8A 1VCGA 1RZMA 3OVQA 2IKGA 3VIFA 1HKIA 1TX0A 1L6YA 2NSXA 1Z8AA 1FOBA 5XIAA 3H6OA 1HX0A 7ODCA 4DXVA 2Q01A 3EA2A 4JTSA 1QI5A 3TROA 4OFCA 3UETA 3N9SA 4C6BA 1XM3A 3UESA 1PWLA 3T05A 4MWAB 4DNHA 4IP7A 4H6RA 2V5KA 4PR4A 4RZBA 3MQTA 1MZRA 1EOKA 3WBEA 2REQB 3NOEA 3PBUA 3CEPA 3S6DA 4L7ZA 3FXGA 2PDCA 5IBXC 1WE5A 4PBFA 2J7FA 1EWDA 3S2MA 4J3UA 2WXDM 1OABA 4XB3A 1E40A 2QCDB 2BODX 1Q7QA 3GDLA 2D2GA 4GE8A 1HKWA 2EXOA 4AAJA 1XPYA 4NNCA 2DUZA 2WHLA 3MSRA 2ABBA 3VCNA 3DN5A 3UR2A 2AGTA 4NYYA 2V3EA 2QDGA 3T8LA 2VNCA 4KESA 2NVDA 4JTEA 2CZFA 4NASA 5FJTA 2CLLA 1LOSA 4W8AA 1HTIA 5I09A 4DJDA 3BLPX 4D6IA 4PEKA 2WMJA 3UA4A 2XISA 2PBOA 3P0WA 4OQVA 2AL2A 3KRZA 1XQKA 3JVAA 2QUTA 4F79A 4V1YA 3RCMA 2HQAA 2WC4A 4EPKA 3RILA 1TV8A 2P0OA 5C9UA 1GHRA 3MMDA 4U2YA 4IL2A 4DUOA 1KB3A 1MYRA 2FZ8A 2PDPA 1GYLA 3TC3A 4BZYA 4BI7A 3CV7A 4M6QA 1W9VA 2FGLA 5CLTA 1FWTA 4ZBCA 1VP5A 2WM0A 3HGOA 5D09A 3GFXA 3KBMA 2XGBA 5HBFA 3GIPA 4QDPA 3CV2A 3RUBL 1E6QM 3F2BA 4C7DA 1S5NA 2BVTA 3M4HA 2BASA 2PDQA 3KS6A 3LCWA 4DZAA 1GQJA 1CGUA 1V3IA 3EB4A 1F74A 2HDJA 1GVYA 1EA9C 2PCQA 3ZO9A 1J6OA 5L9FA 3QLDA 3WNOA 3BMVA 3WLTA 2QUVA 3NQDA 1BXBA 1A3HA 3L5AA 3F4DA 2E4TA 2I9EA 4NAFB 4GISA 1M03A 1I8JA 3H24A 3TWBA 1TRIA 1TV2A 4X9SA 4BEQA 1GYNA 2VOTA 3A24A 1OWQA 3QMSA 1A5OC 4ZODA 1AJ2A 1SZRA 4M82A 1J8VA 4CQBA 3VOHA 4U5KA 4IUOA 4GMEA 1OQFA 4WDWA 3H2AA 3QMTA 3V5CA 5EA9A 2XSBA 2ZUNA 1E9ZB 3CZKA 3UF9A 2Z6JA 2F9RA 4KPLA 5DCBA 1R7AA 3THQA 4JIPA 4B3ZA 3G3MA 2ZRXA 2EPHA 1WA3A 4N2YA 4WY0F 5DMLA 4IHCA 2DY3A 3UD6A 2A3AA 2PE4A 2O4MA 2C0HA 1Z89A 1WDRA 1BSIA 4WIWA 3B40A 1KRMA 4H3DA 3GYEA 1ZENA 2BGSA 3RLHA 1ODZA 5I00A 3SQMA 3GFYA 5ECVA 4GUGA 3F4WA 4AEFA 5HWNA 2TYSA 3UYCA 2BP1A 1PEZA 1GKQA 1IHIA 2JQXA 3M0HA 4AYSA 4O0ZA 1I75A 4JFWA 3VD3A 1VBUA 1CXEA 3ERPA 3P14A 3USBA 3UPBA 2RDXA 4JCMA 4FAMA 1KFKA 4WRHA 1PJ9A 2EQDA 2ISDA 1JZ2A 1VD6A 2OSYA 3A4JA 4B5WA 5CXPA 3OA3A 4OIFA 3EWCA 4C5ZA 5EMLA 3R13A 5AN7A 4NG3A 4YS1A 4JHOA 2A21A 1W5QA 3VD9A 5JMUA 3KP1A 1R0MA 3ZLGA 3DG3A 2J7EA 3QF0A 2PLCA 1HGYA 1K70A 4DN1A 3RU6A 5CPQA 1VR6A 3N04A 4Y9MA 1JPIA 1J96A 1NAL1 1KRAC 4PRRA 3LHVA 1FWHC 4AU0A 4MYAA 4LQ1A 2WV8A 1GJWA 2Y88A 2IPJA 1TIWA 5T26A 1K6AA 2ZUVA 3WDQA 3RNDA 2PWEA 2XFYA 3VKJA 3S2NA 5C70A 3UWWA 2XU2A 4PUMA 4GYPC 4O1AA 3MB9A 2VR4A 4DI9A 2G4JA 1H5VA 2E5DA 5I5RA 3GG8A 3DHUA 1LUCB 1AJZA 3REQA 3GXMA 4M7SA 4A2RA 1TO3A 1VS1A 1DWJM 2J8TA 1EP1A 5C2XA 3K30A 3FA4A 3VIJA 2PDMA 1FH9A 3RO6A 3V5FA 3DC8A 1U1HA 1BF6A 2JIWA 3N9KA 1XH2A 2NUWA 2TSYA 1E9YB 3VIMA 1P0NA 1OZMA 3SJNA 4JX4A 1WXJA 5K7JA 3GH5A 4PMUA 3GQYA 4ZO6A 2PP1A 1H4PA 3W74A 4DBUA 2GVJA 1HP5A 3C2FA 5A2BA 3UPWA 3TAKA 9RUBA 3G1AA 3AISA 1YBQB 2D2JA 4DAIA 1LT7A 3WQVA 5FAGA 3W7HA 3NPUA 4AZCA 2CLFA 2A85A 3ECQA 2UY4A 1Q6CA 2VQUA 1EPVA 1A4LA 4DO4A 2CBUA 2FGZA 1BQCA 4GNKB 3UWYA 1CLVA 2YL8A 2BGQA 3W1AA 2D2HA 4FF5A 4KFOA 1T5AA 3D6NA 5TQLA 3VIIA 2RJGA 1AH4A 3OA5A 4L1XA 2GUUA 1MEWA 2WHKA 2Y5JA 2POZA 4PUUA 1PKYA 1H60A 3R25A 4KIRA 1XISA 2J9YA 2ZZ1A 3NYZA 3O2LA 5EMYA 4ORIA 2WBKA 2XVLA 3FGCA 4B5VA 3ARRA 2WJZA 5C54A 4ERAA 4BQ3A 4UTWC 1FDZA 3DI0A 4ZSTA 4ZQNA 4XX6A 2PU0A 5FJOA 1E1CB 1KCXA 4TO8A 1FHVA 1THFD 1H0GA 5C5YA 3W22A 3WKZA 2OO6A 1FVPA 2CERA 1XKJA 3VCRA 3OLDA 5A6LA 3B0UX 3P80A 3CT7A 2E8YA 1BPLB 3QSRA 4RDWA 3R10A 5JIPA 3U6WA 1KM0A 3LHWA 4FEZA 2PDJA 3NL2A 1SJDA 3W7KA 5D8WA 2RAGA 2GOKA 4LNCA 1DJNA 1VHNA 4GC3A 4F48A 4V1XA 2NQ5A 3R0KA 4AF0B 4RZ6A 1RK5A 2GGJA 5FI8A 5DF0A 2PDGA 4F8XA 5HK4A 3ITGA 2YZRA 1GNXA 3MHGA 1NOUA 3RM9A 4ERGA 1ENUA 4D8AA 4B90A 3WNKA 2WVUA 4XIAA 1WAUA 2X41A 1QDSA 4DJFA 5CGQA 4AX6A 2R14A 2Y7DA 2YXXA 1VC4A 4FO4A 3JS3A 1RXOB 4C1NB 2QVHA 2QZRA 2QF7A 3MP4A 4QS6A 4CQ9A 3D3AA 2ODOA 4O0QA 2Q3RA 4GQRA 1XJBA 3QPYA 4RDVA 5ABFB 3KOWA 1HO1A 3CL6A 1FHDA 3N14A 3URNA 3W71A 1YTKA 4I9JA 2W79A 1K8XA 4YPJA 3GVGA 1K7XA 1GW1A 1HL8A 3R7MA 1UIPA 1YEYA 1BRLA 1CYGA 3LSCA 3ZJKA 5GJPA 4CEXC 3GC4A 3VGEA 3CYJA 2WWDA 4QDMA 4LWWA 1UC4A 1TVLA 3D3FA 5JQ9A 3FJ6A 3CBWA 3SUWA 3ZWTA 1Y8BA 3N17A 4PMJA 2E9LA 1LORA 5F4SA 3KLKA 2DZBA 3GU1A 3AYTA 3IV3A 3PPGA 4HMDA 1ICPA 1EF3A 4MB3A 4Q8UA 3HB9A 4O13A 3M0VA 3O6CA 3NQVA 4GK8A 3VGFA 4K8GA 1JCNA 4XVDA 1J0YA 1VBRA 3SCNA 1P0EA 3PUDA 4MGGA 3GVQA 1GQLA 1K4GA 2H90A 3V4BA 3A64A 3TYAA 1BSLA 3ANVA 5G2HA 4AEEA 1T8QA 3TJ4A 3I65A 3C2EA 3BH4A 2AKMA 1DWAM 3G0SA 3SCPA 3IIXA 4PA8A 3MI2A 2AQVA 4ICNA 2Y89A 1AQMA 3BG5A 3DFPA 4W88A 4H9YA 5EL1A 5BW6A 3T2QA 1R9YA 3G1FA 1M53A 3WQ4A 1AK5A 5G4HC 4ZE4A 4I90A 5E1QA 3VKKA 4HZ7A 5AZ1A 4FXFA 3I3BA 3F2CA 3SCOA 3WF1A 1FWJC 4BF7A 4KEMA 1EC8A 5A2AA 3RJXA 4PC8A 2I9UA 1PZ0A 1HVQA 1V0MA 4MADA 3VIOA 1FDJA 2BOGX 1ZY9A 4GJ1A 3B8WA 1GOIA 3DKLA 3N2MA 3QVQA 2OZ8A 1DJZA 4J9JA 3W02A 1SFTA 4JIQA 3W7OA 3M5ZA 1OCBA 4JYFA 4DYEA 4DXKA 1TJPA 3STGA 4R7WA 1H7PA 3S5SA 3VABA 4LPCA 2GJRA 2FPYA 3KHJA 2Y62A 5K9DA 4H6KA 1XH1A 1JDAA 3ITXA 1AZ2A 3IS4A 4ZVJA 3GKAA 2DVXA 1IEXA 3CPUA 1IZCA 4IMCA 1H1NA 1SZNA 3E2RA 4EX4A 4IXXA 3SSZA 4XD6A 1DTUA 3TXVA 3M5YA 2Y7FA 2WPBA 1KTCA 5JXQA 1CGWA 5MHBA 2XFFA 4JFSA 1S5WA 1ZU8A 1XX1A 2XDFA 4MKVA 3SEPA 4YHEA 3V16A 2C1IA 2CPUA 4IFOA 5A94A 2A3LA 4HQVA 5DQPA 2ZE3A 1ZSXA 2QVNA 2PD9A 4MLJA 1EFZA 3CUFA 4NZJA 1KCKA 2E9MA 1BQGA 3I6EA 4B2DD 3W86A 4A21A 1RJPA 5E70A 2PGRA 5DFAA 2GGHA 3K8MA 1W3LA 3M64A 1KBBA 3KL5A 4P8UA 4POCA 4ZQOA 1WAWA 1ML1A 4O4VA 2Y70A 3A23A 4HNVA 3L5MA 2YGYA 3AU2A 1T41A 3EB3A 5FF4A 1PCWA 2E0PA 1L0PA 4KCWA 3M0JA 1C29A 4UTKA 2A0NA 3SGZA 5IFPA 2VJXA 2TRSA 2WCGA 2DZXA 4W89A 1UUQA 5I3DA 3HGJA 5FJJA 3CXOA 3GH4A 3AIBA 4IQJA 4W7VA 4YHGA 1A47A 2FVMA 1VCFA 3TJXA 4G6CA 5AHNA 3DU0A 1NY1A 3PZUA 4ATWA 3BV7A 4H01A 3U57A 1IQ8A 3PUGA 4I7UA 3RGTA 1UA7A 4NL1A 2OO0A 1UMYA 1VAHA 4QJ4B 3DFQA 1W5OA 1PDYA 3CH9A 3DGRA 1GOQA 3KCOA 4P7LA 3HV8A 1OX4A 4UNLA 3AI0A 3LHUA 3AAMA 4R7JA 3E6EA 3R4IA 1U1JA 5M03A 4NJJA 3O0FA 2GQ9A 2Y8VA 3E74A 2NUXA 4TVCA 2G4FA 1XLHA 2V5JA 3PN8A 2P76A 3CNYA 3LD5A 3VIGA 1KXVA 4AZGA 1G4SA 4WXYA 5T91A 1HL2A 1PV8A 5KETA 1F73A 5I77A 4LRTA 1YDOA 4MY9A 3W7MA 4MAVA 3N18A 4LC8A 4XAFA 1DWFM 3GHUA 4W5ZA 1DL3A 3W84A 1S2TA 3VD7A 6CGTA 1SVDA 3TZNA 4EK7A 4WY0B 3CU2A 4RV8A 2DGAA 4IGSA 2J62A 2O9RA 1IWPA 3VZXA 3UWQA 3AMKA 2WSRA 3SCVA 4BI6A 1YQ2A 2ZC8A 1JYXA 3UZXA 3GVVA 2EEXA 1FH7A 1Q7ZA 2YW4A 3ZVHB 1UG6A 1WX0A 3K46A 4INFA 3ID7A 4GI8A 2A7RA 3QOKA 3WFAA 4P8VA 1XLDA 1F3TA 3HBLA 1P6CA 4AB4A 3QGVA 4ZXOA 5AC4A 3GDRA 2BWGA 3TK7A 3VGGA 3DIPA 4DZIA 5BRBA 4ZSUA 1MQPA 3QMRA 4TVDA 3IUDA 1PIFA 3LS9A 5HMDA 1JXKA 3LGGA 2JKEA 3SY5A 3UXLA 2WZIA 1YHTA 3W88A 1KM4A 3TCEA 2Z2BA 5HPCA 1EB3A 2O55A 5LIUX 3ITLA 4FX7A 1OYAA 1JGIA 3QW3A 1TELA 3H4XA 3S1XA 5CBBA 3AHVA 3L4XA 4WXZA 4G9PA 4LY8A 3G77A 3EWYA 1W1TA 2DSWA 4G7EB 2R94A 1FXQA 2CLHA 1GUVA 1VGAA 2DZUA 3IGUA 3V0UA 4C90A 4XZIA 1IXOA 3VC6A 1M7PA 2V67A 4F0SA 1QW7A 1A5MC 2PD5A 3LGDA 4LEQA 5CAKA 3WK3A 2NVCA 4WVXA 1GHSA 3WLQA 4MPKA 4CNTA 1TZ7A 4MLRA 3HN3A 4DJEC 5J5RA 2QDEA 3QSTA 4IL0A 3AIVA 1XSJA 4FX6M 4UQAA 3LV6A 2EPOA 1R8LA 1M04A 1KM2A 3C0LA 4EOUA 3VNJA 1YXCA 4LCSA 3ZLFA 2ACRA 1Z48A 2QCLA 4C65A 4PMXA 4K39A 5D02A 3STCA 1BG4A 1OG0A 4LVAA 2C16A 5TD4A 4AZ6A 3IVUA 2Y6ZA 3L0GA 3W07A 3VUSA 4CQDA 5F1VA 2VOMA 2ZUWA 3F2DA 3WL1A 4YTSA 3PSVA 4NY2A 2CYGA 5AC5A 4FXJA 1H7WA 2FMNA 3IGHX 3L7RA 4O54A 1FHUA 2NWSA 1VENA 1ZLPA 4JHZA 4UFHA 2VENA 3W1PA 1O5XA 4B5UA 4HK5A 3GUWA 1OYCA 2YCKX 4AFYA 3IANA 3PBMA 5AECA 1CXFA 1Z41A 3GDKA 3QHNA 1QJWA 5EBUA 4HU4A 3DG7A 1RJRA 4LV4A 1XINA 3P6LA 1B4KA 4K38A 1XF0A 1XBYA 1G7UA 4HNOA 4YWIA 4LALA 3VZYA 1MFVA 4LBUA 4L9XA 2YX0A 3ARXA 2TODA 3SN1A 3ENLA 4P7RA 4UC5A 4F0MA 5M3WA 1IGWA 5D37A 1W32A 2GSEA 1VLIA 1TRDA 3CIWA 3PFMA 2C6QA 3KRUA 3SR7A 3QY6A 1BTMA 5G4EA 3TA9A 2XH4A 4J40A 1DORA 4OBRA 5HR7A 1RQEA 3LTYA 2RDTA 2PLJA 3TKFA 1MNZA 1VF8A 1EJRC 4IT1A 3CAVA 1B9BA 1HVXA 3MTWA 1UKSA 2I7GA 3K4AA 1E3XA 2BY3A 4C1LA 2B7NA 3CPRA 3OLGA 1BVNP 1MW3A 5EU9A 2IXVA 4JKKA 2E28A 5CBJA 3EGJA 2VZSA 2MUCA 4I9TA 2J77A 1PPIA 1CT5A 2HZGA 3I6TA 2VP8A 3OPSA 4BY3A 4UTJA 1HZYA 5LYRA 4I9MA 2O56A 2PGWA 5LGXA 5HJXA 1RQBA 2WO5A 4N9EA 5DT7A 4BFAA 3G1XA 3CAWA 5FKYA 4DELA 4BA0A 2W92A 3FSUA 3I6RA 4B4HA 4V28A 4D9PA 2BGNE 3NQBA 3OBEA 2GVYA 1OSEA 4LB4A 2Z29A 5C9XA 1ISVA 3T0BA 2A4AA 4AZHA 3DI1A 1U5VA 5F2LA 1KM1A 3S46A 3GU9A 1EP2A 3CQ0A 2YDAA 2Q09A 4RNJA 5EYWA 4UR7A 4Q8PA 3M44A 2P1FA 4PTXA 4GQBA 3IEBA 3T78A 1DHPA 2X2YA 2MANA 1R6WA 4RW5A 2UBPC 4CD6A 1HKKA 4DBEA 3HIJA 4R5EA 4K8HA 4NP7A 1F3WA 3W27A 1H7XA 2NXHA 4FOUA 4JY8A 1W8GA 4KW2A 3P67A 4Z08A 1TVNA 3NM1A 4IGMA 1EJTC 1LF1A 3HG3A 4ACZA 5ABTA 2DT3A 3Q94A 2GDQA 3LBCA 2FGBA 3DBPA 1UH4A 3CIVA 3QPEA 3N11A 5A6SA 4GHRA 3NEHA 4MIMA 3SFWA 2ACUA 2DSKA 4CU6A 3TVAA 2FH6A 3W1LA 2OELA 4J3XA 5A8OA 3WLKX 3SW6A 5A8NA 1TTPA 1UHVA 4NX5A 2GK1B 3LB0A 1GKRA 1GW9A 3EX3A 4XTDA 3TTEA 3M0ZA 3KUMA 3V35A 1G5AA 3NPWA 4PB5A 2RGMA 4DWSB 2PEVA 3L4VA 1UZ1A 1UPMB 3G5EA 1TSIA 3W1RA 3N4AA 4WDUA 5KZMA 1B57A 4E8GA 1DJIA 2ZRZA 4H9VA 1FH8A 1HGWA 1QO5A 4F3HA 2WYSA 3KBVA 3DXIA 2A5HA 3NA8A 3WLMA 1O60A 1BVZA 1O5QA 3S5YA 5RUBA 4M6UA 5T8GA 3P5ZA 1XQLA 3EA1A 3CHFA 4NYUA 2C13A 3HV9A 8RUCA 2VWTA 2W27A 2J8GA 3KBJA 3UR8A 3VINA 2Z1XA 1JCXA 4GABA 2QJHA 3EX6A 1JPHA 4JL2A 1C8VA 2Y1HA 2PDKA 1EO5A 5G1TA 2FLIA 1TPFA 1GGOA 1M9HA 3DH7A 1ONXA 3M9YA 1PIGA 2WVVB 3E2QA 4AEOA 2NQ9A 1IIHA 1XCWA 3OLEA 3WQDA 3HA1A 2EAWA 3QXBA 4EANA 3M6DA 4H41A 2JIEA 2VFHA 3L67A 2HROA 3T40A 1GKPA 1YADA 2OKTA 5I03A 3FEQA 3H55A 4H8VA 5E6ZA 5AZ0A 5CKSA 4DYJA 3LMZA 4R9OA 1QOXA 4HIBA 1Q6LA 5FJIA 3RLGA 2QPSA 2A3CA 4RCXA 4JX5A 2DZTA 3BAYA 4U28A 3DCPA 1QO2A 4AY8A 1MO0A 3BW4A 2NW0A 1WCGA 4NU7A 3ES7A 2D2OA 1A5SA 1TQXA 1YBQA 2XIQA 2FB2A 4H2HA 4Y6GA 2QGHA 2QJMA 1I45A 1UZ4A 1S3TC 2DW6A 3WG6A 1CXIA 1SZGA 2Z26A 1HO4A 3KOXA 3GVWA 1UIOA 4HCDA 1SW3A 1TPB1 4X0NA 2DT2A 4R85A 3PAOA 3HJZA 4WOZA 2NQLA 3BOLA 4D6CA 4G1KA 2ZUUA 3P8JA 1V3HA 1DIKA 2WK2A 1M3UA 1KRCC 4NZCA 2RFGA 5C9RA 4RE0A 3B8DA 3AICA 2GL5A 3PUEA 2OEJA 4IIBA 3NL6A 3FW6A 5HANA 4LUTA 4A22A 3WQFA 2PSNA 2I14A 1QAPA 2V38A 3R1ZA 1IGSA 4AQLA 2CKRA 1US3A 3SN4A 1GVQA 4CLMA 2C91A 3NXFA 3W1XA 1PYFA 4Y8EA 2HPIA 4M0XA 3KX6A 1JGMA 3EDDA 3SCSA 2VZOA 3T44A 3QFEA 5DLCA 1LOQA 3ARUA 4LS1A 1HW6A 2ALDA 3PZIA 1TMLA 4O1EA 4JS3A 2WZHA 2QIWA 3TW6A 3W6MA 5HOSA 4W87A 4MJ2A 2A6LA 4XO7A 2QV5A 2VZVA 1FWDC 4GUHA 1YNPA 2PDYA 4WLCA 4KFPA 2ZOXA 4MKSA 3S2JA 4NX0A 4W84A 5C9ZA 1U30A 3SFKA 3D47A 4RX0A 3TOYA 3UERA 3GIQA 3A6OA 2ZTJA 3HQOA 1Q85A 5GQBA 4GVHA 4S3AA 4NZFA 2WKLA 1Q4NX 5DO8A 1KCZA 2B0MA 3LN3A 5LNWA 4YTRA 2J47A 5HPOA 3R58A 4HA0A 4C1NA 1BWVA 2CZVA 2BVWA 3MKCA 3WD3A 4JOMA 3O6AA 4O53A 3LRMA 3WQ5A 5TIMA 1MW2A 1G1YA 4LAMA 4OUIA 3TA6A 1ZBWA 3C8FA 3QN3A 3MMUA 5FAJA 2QYGA 2BB0A 1V0NA 3I4EA 2ZA2A 3O15A 1W9PA 4XK2A 3AROA 1AQHA 2J6XA 4QLLA 3EX4A 2E09A 3O7UA 2ZZ7A 4PRTA 3GR7A 4YMZA 1TG7A 2YDSA 4JTLA 2IKHA 7TIMA 3AHZA 2XH0A 3KEHA 4JTQA 4RE2A 3GNNA 2QV4A 3DYMA 2VD9A 2C79A 4DVOA 3UPMA 1GVFA 1SFJA 5EGRA 1XLJA 3P93A 1O1ZA 1PHQA 1ITCA 4Q4PA 3LQGA 2YJQA 4HHPA 2ZWYA 2XM1A 3IGXA 3OGSA 2IQTA 4EWND 1JCJA 3OIXA 4F0HA 4NI3A 1FKXA 4HD5A 3M47A 1WYIA 2ZBTA 1VFUA 4ZFCA 5D4YA 5DMYA 3LEPA 3PJWA 3OVPA 3TN5A 1GORA 5BRQA 1GZ1A 2EKGA 1NEYA 1TA3A 4NHVA 2EGZA 4PE8A 4XSMA 3UCQA 2R1LA 4MMWA 3N3TA 4TX8A 3IACA 1SW7A 4DJED 2WSKA 1VYRA 3V75A 4BQ5A 1BFNA 1HKVA 2MNRA 4M29A 1REQA 2C71A 4IIFA 5AVHA 3AMLA 1VYSX 4KFNA 1DHKA 5KSWA 2WB5A 2WJDA 3F03K 4QLJA 3S5OA 2V5CA 1BKSA 4CKQA 4FXSA 2WQDA 4ENLA 3ZIZA 1XV8A 4QR6A 2OQYA 1XI3A 2HMCA 1LRNA 4AD1A 1J2WA 1Q6OA 4N4PA 4O50A 2BHUA 1R3WA 3CB3A 2Q71A 4S38A 3O06A 3AXXA 1M5WA 2ZQ0A 2Y7GA 8A3HA 1E6NA 2ZFAA 2DIKA 3AU6A 1SYTA 4A05A 3LM3A 3WLHA 2WNZA 2Y8KA 1C8XA 4Q4QA 5FL0A 5FACA 3Q65A 5EBAA 4KETA 4N7QA 4HU0A 3GAKA 3R8HA 5AYBA 1Z69A 3OVRA 3BOFA 1VEOA 2HPMA 3VU2A 4IMGA 4IGNA 3ABSA 4O57A 3NXLA 1EX1A 1BGAA 3RJYA 1XBZA 3S47A 1G01A 3AALA 1LLWA 3KBWA 4RK8A 4DWSC 3UR5A 2FIQA 1QOPA 1ITXA 4QHRA 3RYSA 3MMTA 4JR5A 4PH6A 5GPRA 2BHZA 2B7QA 1XGZA 5D30A 2PF0A 1H63A 3K1GA 5HR6A 3KWSA 3PB0A 2A7PA 4X2RA 1I0BA 1V3JA 4HSNA 3B9EA 3NZQA 4QJ5B 1D8WA 1A53A 4Z42C 3WBXA 5JBEA 1ZAIA 1LM1A 2V5DA 5CPNA 3W0KA 3G1SA 3UQNA 4LH8A 5AC8A 3IUHA 1LBMA 1X6NA 2X42A 2W91A 4O1CA 3MKVA 1IEQA 5FSDC 1Q45A 1TMHA 2AL2B 3MDUA 3NVDA 2EF9A 5C0QA 5IXEA 4ZOAA 1H49A 1NWRA 1XIJA 3H4WA 4IFKA 3W75A 4C6MA 3VDCA 4GLEA 3SQSA 2QCMA 4FK9A 4QEEA 3NGFA 1UR9A 2E1DA 3LXCA 1EBHA 1VFTA 2CXGA 4ZMGA 4YVPA 3W1TA 5A8GA 4C6OA 2QJIA 3NQ8A 3AZTA 7REQA 2VT0A 1A50A 3WNPA 3WYZA 3CIXA 5M5DA 2YCLA 4C7GA 3VNIA 3TIMA 2E9BA 3SIZA 3B4YA 4J7RA 4PMYA 4O19A 3F1QA 3WK1A 4IOTA 1HJUA 3E9AA 4GQQA 1PKMA 4O8RA 4Q4SA 4GZJA 5DRCA 1EA0A 3PZVA 1A0CA 2E1WA 3BZGA 2NVAA 3CWHA 4FR1A 1KFCA 2DP3A 1TWIA 1PZ1A 3H7RA 4JIEA 2Y5EA 4Q8MA 3NSMA 3S6OA 3VMOA 3WSUA 1E0VA 1WBJA 2FZMA 3LXBA 4A8IA 2J7BA 2WQPA 1D7KA 3VCCA 3PTKA 4FOKA 5IDIA 2CW6A 3W7GA 3FEMA 1VFSA 2GVLA 1PS9A 3WNMA 3I4KA 4GCAA 2QHAA 4Z2JA 3MC5A 3UY8A 2PDFA 3C0SA 1TZ9A 4B5TA 1GTHA 2XIOA 3QC0A 5DXXA 1NFGA 3TWAA 1R9XA 3ZVHA 1HT6A 4ZXLA 4EIVA 1ZBVA 4JTGA 1PE1A 3IJ9A 3B0VC 2X0HA 2DVTA 2HK1A 1ZALA 2VX4A 2VCAA 4H8HA 4D72A 1UQYA 1KRBC 2GJLA 3ARSA 4DUVA 3MDWA 1EJWC 5AYXA 1HJWA 2ZYFA 2H8ZA 1TWSA 3AFBA 5GNYA 1HJSA 2E6DA 5LIYX 1QOQA 1EH9A 1F76A 3ZR4A 3W1QA 1XD1A 5DELA 4CD4A 2YCEA 3OBKA 1SO4A 3O16A 4F2TA 2ZX8A 4GBDA 1UR8A 4JKMA 3W7CA 4DXXA 1FRBA 2R82A 4QE5A 2XVKA 3NZ1A 1H50A 4NZ3A 1R3SA 2HISA 3GZAA 3PNZA 2Y4SA 4HCLA 1QI2A 4REQA 3HQNA 3NDZA 3MBDA 2F8QA 2VZTA 2VC6A 1PX4A 3N19B 4BKNA 3VFLA 4G7EA 2GYIA 4ORMA 1M7JA 1POKA 1VKFA 4HPNA 5B80A 5EY5A 3CT2A 3RU8X 1O7AA 1UJPA 2X40A 1E4IA 4A3QA 2PTWA 3SJ3A 4OWGA 1VJIA 3PBWA 3G3DA 4MNJA 3PF3A 3SZ8A 2FVKA 1F07A 3O07A 2YDRA 3F5KA 1W1PA 3M0IA 2FB3A 1GQKA 3VNKA 1E5JA 4HKPA 1ZQ5A 4UB9A 3VIPA 5I6SA 2Z24A 1RP9A 4NJHA 4EXBA 2VQTA 1FWNA 1K4HA 4UTUA 4GIAA 3PZMA 3MKKA 3REQB 4IPJA 1XYAA 3LDVA 1TFVA 3W73A 4CGTA 4NIRA 4WJXA 3W1MA 4GIEA 5DXYA 4PL2A 2ESCA 1EDTA 3VC5A 3VD4A 4L6DA 4S3DA 3SDOA 3DC0A 1NSJA 1F2JA 4FF7A 4Y96A 4GACA 2YB1A 3OQ8A 1ITQA 1UB3A 1MXGA 3GC2A 4I7WA 1YE6A 3OOQA 1TV7A 4NZ4A 2YKKA 3LLDA 4K68A 1OFOA 3NO3A 1RD6A 3VDHA 3WL0A 2WJEA 1M6JA 3EDJA 2VC7A 4LBRA 2FHBA 1W1IE 5LIKX 3BWWA 3S9ZA 3RX3A 1IXNA 2F6XA 4AZ5A 1F5ZA 2V81A 3MHUA 2Z2AA 1ISYA 4TIMA 2OZ0A 3S1GA 1F61A 3BARA 1X97A 4PULA 3GTNA 4AZCB 1W2PA 2XTKA 2YOCA 1UD5A 1Q8JA 1TYGA 2C7FA 4AZ7A 3TOPA 1EBGA 3QZAA 3ZYZA 4JTFA 1E0WA 1H7OA 2XGIA 1AG1O 4BK9A 4JNZA 2E5CA 1J0HA 2DT1A 4O28A 3GO2A 4UBPC 3QLLA 4PTNA 4XZMX 2HSAA 4RZ5A 1ALDA 1CLXA 4GY7A 4L9YA 1WKYA 1GYMA 4JQ2A 1SQ7A 3IJLA 4M51A 2B7PA 1LYXA 4J28A 3FGCB 5CEWA 3CASA 1VFHA 4GD0A 3VK5A 3ZJ8A 4Z0SA 1I60A 4I5XA 1VBJA 4AG0A 3DZ1A 3BTNA 3L9CA 5REQA 3VNDA 2OFJA 4HPGA 3LBOA 3VM7A 1TTJA 2R1MA 2O9TA 4ZOBA 5I24A 4UFKA 3KBSA 5E93A 3O6YX 4CNOA 3MWAA 4Q6XA 1EUAA 4B9ZA 2OXNA 5KEZA 2X1IA 3E0LA 1SFSA 3LX9A 2VEMA 3L4TA 3MI3A 3RRXA 1K03A 2OLHA 4US6A 3LPGA 4QNWA 2J4GA 3EPMA 2VWSA 4JEJA 1F4HA 4AH7A 2Z25A 1XS2A 5F4XA 1OFAA 4QQUA 4AC1X 4MF4A 1FA2A 3HG2A 4N02A 4IGHA 5K4ZA 3NSNA 5A95A 4KKXA 5IRPA 2P3ZA 2YA1A 1ZJIA 2VKZG 1VPXA 3EXRA 1NDZA 3PWGA 4HNNA 1GQIA 4P7OA 2CZ5A 4DJDC 5C2GA 4UWMA 2YA2A 3U2CA 3KXQA 4ADUA 2QJGA 1EF2A 1AQFA 3E0WA 3KLLA 1OEPA 2QMKA 4KERA 1R87A 4JTAA 3GX9A 1SMDA 3LYEA 4C6QA 3UZYA 4LEFA 3FLUA 4O8AA 1JDCA 3CUGA 1B3XA 4PSRA 1OT1A 3AUOA 4EXQA 5HMSA 5FEZA 3N2CA 4IIHA 4FZIA 3N3MA 2WW5A 5AFDA 3IK2A 3NAVA 1S2WA 2ZCGA 1BRLB 4WHBA 1C91A 3QV8A 2ISFA 5CLWA 1GOKA 3EKLA 4DPPA 3SI9A 1IEWA 4L5ZA 3JUGA 1QHZA 4MB1A 5F2GA 4DPQA 1KQZA 1TQJA 3P8IA 3DYOA 3TH6A 1OB0A 3QQ1A 1QPRA 1J0JA 3PSWA 1CZ1A 2PWDA 4UFLA 3PAJA 1B3ZA 4S3FA 4N9CA 3BLDA 3QJAA 1OIFA 1E73M 1GCYA 1J01A 1IZKA 3GNRA 4UFJA 1X7FA 1XP3A 5DRIA 3GE7A 2ZRVA 2BNJA 1GTEA 4RNFA 3DFTA 4UNIA 2YPIA 5I3HA 2NLYA 4DEFA 3W9ZA 3PG8A 3LCXA 4DBDA 4PTWA 1QPNA 1MDLA 3U3HA 1U2YA 2JEPA 3VMNA 1C7SA 4JY9A 1GJPA 3OG2A 1XFBA 5D9MA 1TJ1A 5E09A 1LLOA 2V0TA 3ANUA 4H9TA 2NQZA 1TPUA 3STEA 2UY5A 3VOGA 1BAGA 3EA3A 3UFYA 4XZLX 1J79A 2XH2A 1RSCA 3EEZA 2HTMA 4DWSD 3FSTA 1J0KA 3SY1A 2BSLA 1PDZA 1CB7B 5E0KA 2DVUA 1Y5VA 1V02E 1GPFA 2VFFA 1P6WA 3SCUA 4CVUA 6REQA 4DLFA 2VC5A 3BDKA 4O1BA 4JTDA 4OUEA 5CSUA 2PWUA 1MWOA 1E0XA 4B3KA 5CG7A 5CSSA 3SCRA 3WK0A 2VGFA 3TFCA 3FAXA 3B3DA 2DIEA 5KMYA 3RX4A 2WM1A 5CCZA 1DJGA 3BLFA 4B16A 1FDYA 3WMLA 1XLGA 4GO9A 3N4EA 3PULA 1UJQA 1ZBKA 1JNDA 2YZ5A 2D23A 1C9WA 4D6FA 1GOOA 1GQNA 1JRCA 2HS8A 4C6EA 2ZA3A 1KM6A 3HFTA 4Z1YA 3AXMA 1AA1B 5CC5A 1D3HA 1LBFA 4XKYB 4ZA0A 3WQCA 4LNYA 1DJXA 1FWWA 4O10A 2FH8A 3KS5A 3AJXA 4L1GA 5A6TC 3B0PA 3Q58A 2A3BA 2GPTA 3GW0A 1ZJHA 5KZEA 3WDIA 3LTPA 2JGYA 1W6TA 2BVYA 1G4TA 5K4XA 4F0KA 3SRDA 1KXHA 3PBYA 4GWEA 1QI3A 3NQFA 1D2KA 2EO7A 3BICA 4WDXA 4V2XA 1EHAA 1MUMA 4Y9NA 4LBSA 2VELA 1QNQA 1PB0A 3ARZA 2PC8A 1GOXA 1O68A 1P6BA 2OGJA 2GDVA 2PLMA 1ZTVA 1CB2A 3EWWA 1IEIA 4PCSA 1XWYA 1KFWA 2ZRUA 4O14A 4D8LA 3S1UA 4JQ3A 1NWUA 1EEPA 1W3NA 4PUDA 1JCLA 5F1UA 4ZTXA 4ZOCA 1QATA 1EGVA 2F61A 4W85A 1Q8AA 1F05A 3VKBA 4YCPA 5LNRA 4PCPA 1T99A 1H51A 3LI0A 3LTSA 4X9YA 4YL2A 3W1NA 4HK7A 3LCGA 4HOXA 3VX0A 1V3MA 5SWUA 4MZ8A 4W8BA 3UJ2A 1KLYA 1JFHA 3D46A 3UY7A 2QT3A 5U4NA 4AXKA 3PWAA 4S2CA 4CQCA 3CMGA 3R0UA 4GIRA 2OVLA 1LDCA 1AFSA 5U7SA 1TPWA 1OX4B 1VB9A 3B8VA 1EKOA 1VQTA 3C2OA 5EMUA 3CS2A 2Y8UA 4S3CA 1DWIM 3WD0A 1GT8A 4NXSA 2ZZ6A 5EB8A 4U3AA 4Y2WA 5DCEA 5CGMA 4LUSA 1FTXA 5HUOA 1OBAA 3UJRA 4UOJA 1H5YA 3QFWA 1EDGA 1LT8A 5GVJA 3VKDA 3BE7A 4J2MA 1I1WA 5KZDA 4E5TA 4QCEA 4UTLA 5I78A 3OG3A 1JF5A 1XH0A 1MW0A 1VCVA 3UXAA 1UKOA 3AXHA 2NV2A 4ES4A 4U3CA 5H2ZA 3W87A 4Q8NA 1R3QA 3MW7A 3R12A 1WDWA 4JL1A 4YTTA 8TIMA 3OYZA 5AHLA 2QULA 2G95A 4GIYA 4QE4A 1F3XA 4MB5A 2V69A 2QCHA 1F7BA 4GUIA 1A5UA 1R7OA 3R8GA 1S3HA 3QKEA 3UG5A 4FIQA 2HBVA 1B3VA 1ZS2A 4QXIA 3NL3A 1DV7A 1CI1A 4HN8A 3TN6A 3NR0A 1JRBA 1QPKA 1ECEA 1R2SA 3GNPA 1TIMA 3ALGA 4JIHA 3QR3A 3M0MA 4J3TA 3WQGA 5HATA 1EGZA 4JQAA 2OSXA 4LV9A 3S9IA 3KL3A 3L65A 2E68A 2ON3A 4S1FA 2W4XA 3IAPA 1BTCA 2YA0A 1YTDA 3THDA 1B5TA 2DQWA 5JH1A 2XFWA 4Q32A 2VFGA 4ZB0A 2Q3OA 3RIKA 4IP5A 3AHXA 4D71A 4RJEA 3ES8A 3SB0A 2IQDA 3FXYA 3IVTA 3TW7A 1Y5XA 4DJFC 2YL9A 2D22A 3WFLA 1PZ2A 1PO9A 1Z6KA 3BK0A 5I0DA 1VRDA 2NV1A 1CW2A 4Q8TA 3LPFA 4LX4A 3ELFA 3NG3A 4S2BA 1MI3A 1S2UA 5EMMA 4GI9A 4QSFA 4R9XA 1JZ4A 2ALRA 1NF7A 2ZUTA 4CNUA 4PSPA 4IMDA 4PUNA 2QKFA 3AS0A 5I2UA 1FWRA 3KBNA 3MVIA 3FAWA 3TW9A 2G8ZA 2IXUA 3THCA 7A3HA 4XD3A 3DFYA 5JIWA 1RPXA 3UJFA 4JDBA 3TP4A 3T0DA 3BGAA 1A49A 2TMDA 3MUZ1 3LNPA 4D6GA 3MHFA 2V2DA 4H00A 4AD2A 1A5AA 1RH9A 1S39A 4Q4RA 5C71A 4RL3A 4N6EA 1HIZA 4ADTA 3BURA 3IIZA 2E67A 3MUCA 5LGZA 4I6VA 4YTQA 5DN1A 2FTYA 1A5CA 4GI6A 4TQTA 4EPDC 4QLKA 3IJ6A 4IMAA 1JZ7A 4IX0A 5LHEA 5D2TA 3GXIA 3GK0A 2X09A 3EYPA 1SZFA 4WD0A 3TN3A 2X7VA 1A5BA 3EWDA 1G69A 3UCCA 2PRLA 1GG1A 3SUUA 4C6LA 2WMHA 3KRSA 1W91A 2OODA 3GZ3A 4OOZA 3RF9A 1PUDA 4MYXA 4H9UA 3NUKA 1V0KA 4H7ZA 3ARWA 3GWQA 4CQ8A 1KCLA 4NAEB 4KCUA 1MZHA 2JE8A 4A3YA 1YDNA 2OU4A 3E02A 1I2NA 2WLZA 1OM0A 2INFA 4OHQA 2A6NA 3HMCA 4IXHA 4S39A 2DSZA 5I3FA 3CZGA 4OV4A 3O9NA 3BPWA 4M56A 1VLWA 1R3TA 1OFRA 1EQCA 3LCIA 1PYMA 5AC7A 3W28A 2DH3A 3VYLA 1MUCA 1JIBA 1OCNA 3PTQA 4AIUA 4I9AA 3B9NA 4RZ4A 1Q6GA 3EWBX 5BXRA 1U22A 4DJDD 3OVGA 7XIMA 1GZJA 2CESA 1VZWA 2W63A 3V7PA 1ZRQA 4L56A 1E15A 2FZ9A 1W56A 3M0XA 3LA4A 2I5QA 4S3KA 2WPGA 4EKJA 2VMFA 3C2YA 2PA6A 2CXEA 1EYEA 1L8PA 3I7RA 3DDMA 2YL6A 2CITA 3VO0A 2VX6A 4PB3A 4GZ7A 4PMRA 2HRWA 3PB2A 1W3JA 3TAOA 1GWJA 4F2UA 1G94A 3LENA 3DOPA 2YW3A 3MPGA 1E55A 4AHOA 3G1VA 4UFMA 2Z7GA 1OC7A 2DUAA 4KGLA 1V6YA 4M1BA 4JTCA 5XIMA 1O5RA 3FJNA 3S8HA 2DQXA 2I56A 4HYRA 3VI2A 4H83A 3VPLA 1CEOA 1V7AA 1B30A 2C8NA 3T2OA 2VRKA 4M1RA 1F6KA 1CWYA 2WNWA 3BJFA 5BYWA 2OTDA 4LUJA 4OE7A 3BV4A 4H4IA 5DMNA 4K2SA 4PEEA 5F2MA 1XSKA 1UBPC 2WZTA 3PFRA 4PCFA 1V02A 2PTDA 2BXVA 4ACZB 4AY1A 2F6UA 4CQAA 4MY8A 4E3VA 1S38A 4QFUA 4JN7A 2AAAA 4ZQCA 3G0UA 3QGAC 1B2YA 4AUBA 4ICCX 3HFYA 4NZ1A 1PSCA 3NZRA 3WD1A 5I7GA 5KTLA 2DZPA 1QI4A 5HA7A 1EDQA 4QNEA 4C6CA 1YX1A 3W2KA 5CPTA 3UNTA 1I2PA 5BXTA 1J5SA 5G5IA 4UMBA 2Q8ZA 2W9MA 3W2JA 2ZADA 3NPVA 4J27A 2OMAA 5K9XA 2GOUA 2V30A 1H1YA 2DORA 4E38A 3SGUA 3SN0A 3VAVA 4LS0A 1WBHA 3CB8A 3UXDA 4OVXA 5A8MA 3HMJG 3G0XA 3N15A 6ENLA 2IMRA 2HVMA 3C2VA 2PWHA 1LJYA 3PTDA 4E4UA 4NILA 3N2XA 5BWFA 3MV11 1G6CA 2DJXA 3A4AA 4O15A 4A3UA 1K9DA 2X7WA 4M5PA 2J7DA 2QCCA 4AXNA 2GQ8A 2QS8A 1QCWA 2PLKA 4E2BA 2YFNA 1DJHA 1KM3A 3V0SA 1UKTA 4I3GA 1W9XA 2D24A 4ONVA 3UXIA 1WP6A 3QR0A 2WVTA 3RPDA 2CETA 4AISA 4EXAA 3FNDA 1E56A 1QU4A 3RPTA 2V9DA 3HG4A 1IT0A 2ASHA 1TCDA 1B3WA 1GONA 1Z7AA 2NQJA 4I8DA 5HWMA 2R24A 2RUSA 2Z1KA 3W23A 1DQWA 3W76A 3TTSA 1F3EA 4PUKA 5KZ6A 3EOSA 4BCEA 4L4PA 4BQ2A 1P48A 2DDXA 3UEQA 4C1KA 5F2IA 4US5A 2ISVA 3IVSA 1UWSA 3ALFA 3MCNA 1TPVA 4H19A 1OX6A 5HMEA 4IZGA 3W7PA 4HSHA 4DF1A 3S1VA 1O95A 1KV5A 2PGFA 1XPGA 2YBVA 1XC4A 4PZVA 4K3ZA 1B54A 5LNUA 3MUXA 5C8BB 1HXJA 3WDJA 9CGTA 4DYKA 1XG4A 4UQCA 3OZMA 4D1IA 4LFYA 2YB4A 4QTGA 4OOUA 3AXIA 1A5KC 4RPQA 2WMKA 3A4WA 3WLRA 3A5VA 1ISXA 5GNZA 1B3YA 3ZT7A 2J7CA 1JCMP 1JAEA 2IS7A 3ITYA 4XZHA 4ZB5A 4WDTA 2PGEA 1KFLA 3AHYA 1VEMA 4FMVA 2OX1A 1Q2SA 3DENA 4JD4A 3KM8A 3OP2A 1RHCA 1SW0A 1DE6A 1JXJA 3IJ7A 3WNLA 1PTGA 4LUTB 3URQA 1SJBA 4M24A 1H7RA 3QH2A 3VMPA 3L4WA 3UT0A 1SGJA 1V5XA 5ABHA 1FWBC 4EVZA 1WDQA 5D8ZA 1NDWA 2X16A 1ZP3A 4KGJA 4E6MA 1H62A 1PX3A 4OT7A 3CV1A 4AYGA 4GFIA 3HZ3A 1N8FA 2UZ9A 3IJ8A 5EMJA 5AYYA 2FJUB 4J5NA 4DO5A 4H7CA 3WQOA 1RALA 2ABAA 3EDKA 4PRWA 3CEUA 4Z1AA 2BHYA 4L1WA 3CHCA 4O16A 1UWUA 1X1ZA 4UTFA 1WZMA 4MVAA 4NI8A 1C9DA 4QROA 4QDWA 2J9ZA 3R94A 4GYJA 1UA3A 4PMDA 5M2FX 3KRBA 2R6OA 4XSLA 3VUPA 4UCFA 1QK2A 1YDYA 2PDNA 1ME8A 4N9DA 1LWHA 1CX9A 1OD8A 2DH2A 3MCMA 5HNNA 1OF8A 1TV3A 2ZRWA 4XZWA 3EDEA 1K7FA 1O6IA 4YVXA 2RGLA 5A6KA 4AMCA 4IIEA 3H2MA 3APTA 3QRHA 2HNHA 3UZJA 2Q8XA 1XYLA 3STFA 2DPEA 2VEIA 1RV8A 4KEVA 5I02A 1GEQA 3FDKA 3QR1A 2PWVA 1JYVA 4L6HA 3F4CA 4IIGA 1ICQA 4YXGA 2DT0A 3N34A 3HF3A 3UNDA 3F7JA 3M43A 3WLJA 2YSWA 1EC9A 2I5IA 3MCOA 4ZO9A 4JGDA 4JX6A 1A5NC 3SRHA 3WLLA 3BLIA 2D3LA 2OGYA 3APGA 1SUXA 3HQPA 5BNKA 4YYFA 1IWAA 1DPMA 3S2LA 1UUOA 4DAFA 1I6NA 1ZFJA 2C0AA 1L2QA 4OBSA 1IR2A 2PMQA 4DJFD 4GOAA 4XVEA 3T7VA 2HVNA 4WK9A 4AVNA 2VZUA 4UZUA 3SBFA 4X3ZA 2VDGA 3UGRA 4QISA 1PKNA 4HTYA 1NFPA 2KX9A 2VUYA 1T40A 1TR1A 4HMCA 4HU3A 3G2GA 2AKZA 1CPUA 3W7LA 3UW6A 5D38A 3MYOA 3RHGA 4DI8A 1E4LA 4I6KA 1L9WA 3EOEA 4JTKA 3MJYA 3T4CA 1B1YA 1F8MA 4NNBA 3COTA 3PVFA 3OB8A 3QC3A 1JR1A 1US2A 1TA3B 3PM6A 1V8EA 2PRMA 1V3KA 2OZ3A 3KHDA 3KWXA 3P5YA 3EPOA 4H9XA 9XIAA 3VDAA 4G7FA 1Z42A 1ELSA 3QQ0A 1W8SA 3K1DA 3H21A 4XBJA 5I79A 3FHQA 3IK4A 5CG0A 2A2IA 2JEQA 4IG2A 1CXHA 3RK8A 1BF2A 5LKYA 2W5FA 4JFTA 5H8PA 3TC7A 1YNQA 3WX7A 1REQB 3IARA 2J7GA 2DZSA 3LOTA 1RPKA 4U10A 2WNNA 4ZE5A 3G18A 2VFDA 3SY8A 2C14A 5ABEA 1QVBA 1GVEA 2F6KA 3L21A 3MO7A 1UP3A 3AHTA 1TB3A 4HA3A 2IW0A 3N6JA 1XRSA 4LC6A 3PANA 3VVGA 2FQIA 2AGKA 2RHGA 1Q2RA 4GCXA 2INEA 4PCTA 3C6CA 1E51A 2XUCA 1E9IA 2BY0A