3P6AA

Crystal structure of the dh/ph domains of p115-rhogef (r399e mutant)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
355
structure length
344
Chain Sequence
PKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 1
publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 128
structure length 344
sequence length 355
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3p6aA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3p6aA02
2NZ8B 2LOXA 5C16A 2I1JA 2R0DA 2D10A 2P8VA 2PZ1A 3ZVRA 1U5FA 2MWNB 2L1CA 3M1IB 1U29A 5CLQB 1EF1A 4WJ7A 3PP2A 2RUKB 2KUPA 4GOUA 1BY1A 1H10A 4GPTB 2DHIA 3ML4A 3N7CA 4HB2B 1WI1A 5KQ1A 4GMXB 3RCPA 2GJYA 5LONB 2GCJA 1FAOA 3QBVB 3PEGA 2MFQA 2YSZA 4DX90 1M7RA 3SUZA 2CAYA 2LKOA 2DHKA 2YS3A 1TQZA 1FHOA 2H7EA 2D9VA 4IAPA 3TCAA 2W2XC 1SGHA 3X23A 4YL8A 2W2WA 5HE0A 4GMVA 4GN1A 3VOQA 1X11A 3SV1A 1Y19B 2J0JA 1XCGA 2J59M 4KHOA 1UNPA 1WJ1A 2VRWB 1P5TA 3A8PA 2KGXB 2Z0OA 2X18A 2VSZA 1FGZA 1K5DB 4F7HA 1QQGA 3QIJA 2COAA 3QWMA 4DXAB 2OQBA 3GYOA 1K5GB 4L6EA 2DFKA 2RVBB 3G9WA 1XX0A 3KZ1A 1U5DA 5DH9B 2DA0A 1GG3A 1UEFA 2RSGA 1RJ2A 2COCA 3ULCA 5GOWB 1WG7A 1KZ7A 4EMOA 1MIXA 2DLWA 4Z2MB 2LOZA 2DHJA 3PSCA 1B55A 2CY5A 3DXCA 3D8DA 1BAKA 4C0AA 1EGXA 5HE3A 3AU5A 4H8SA 4TKNA 2ELBA 2EMTA 4HAXB 5JHGA 1ZC4B 2LG1A 2DYNA 2N0YA 2N23A 4HB0B 2H7DA 4A6KA 1RRPB 1NU2A 2YRYA 1V5UA 1DDMA 4HB3B 2HTHB 2HE7A 2K2UA 2V76A 4D0NB 1ZVRA 2YT1A 2EJ8A 3MPXA 3KRXA 3KRWA 1EVHA 3WYFB 1SHCA 2ELAA 1W1HA 3ZDTA 2Y8FA 4PNKA 1BTKA 3NSUA 4DX8A 2KCJA 1TJ6A 1QC6A 3CXBB 2G35A 3TVVA 1EAZA 1X86A 3A98B 4HAZB 1ZSQA 3CIKA 2ROZB 5EFXA 2RLOA 3TW1A 2XQNM 2MKRA 1DDVA 2D9ZA 3D8EA 1X1FA 3FSSA 2DX5A 2IYBA 4HDOA 5DIFB 1ZC3B 3JV3A 5C79A 2RNRB 2YF0A 1MK9B 1XR0B 2LYDA 3T06A 2P0DA 1MKEA 5HE1A 4CYEA 5JHHA 1WJMA 2Y8GA 4ZRIA 5JP4A 1TXDA 3ODXA 1AQCA 3PVWA 5JLJB 1U5EA 1IRSA 2E2XA 3KSYA 1H4RA 2K2JA 5KQ4A 2Y7BA 5J3YA 1DYNA 2W2XD 2NMBA 4A6FA 3BINA 3PG7A 4WVFB 3TO1A 1MK7B 1Z87A 4NY0A 3U8ZA 3KY9A 5D3XA 1XD4A 2KR9A 2D11A 2Z0QA 3PVUA 2FJLA 2Z0PA 2VKIA 2DYQA 2CY4A 3ODWA 2DX1A 1FB8A 1PMSA 5C5BA 1BWNA 1NTVA 3P7ZA 4BBKA 5J3QA 3P6AA 2GCLA 4KHBB 1X05A 2DKQA 5C6RA 4DBBA 1PFJA 1U2BA 4Z2NA 2I1KA 1WVHA 1OQNA 4HAWB 1M7EA 4TYZA 2COFA 4IFSA 4MY6A 1V88A 1UNRA 5D27A 1FHWA 1OY2A 1PLSA 2DN6A 3HK0A 1MIZB 5DHAB 4F7GA 3SYXA 1WGQA 2D2QA 3IVFA 5HE2A 2ADZA 3GYPA 3HQCA 4A6FB 1UPRA 3ODOA 1UPQA 4XWXA 4CHJA 1UNQA 1LW3A 2I5FA 4K2PA 1F5XA 1U5GA 1ZM0A 1DDWA 1KZGA 1P3RA 2K00A 1V5MA 1V61A 2ZPYA 2D9WA 4HATB 1FHXA 4K17A 2D9XA 3MDBC 4HAYB 2D4QA 1DROA 4YONA 5C5BB 4K81A 1OMWA 5D3YA 4GYVA 2LULA 4PQ0A 1J0WA 2ROVA 1XODA 4ZRJA 2MDXA 4HHVA 3TFMA 2QKLA 3V5WA 1DBHA 2D9YA 4IOYX 1WGUA 2YVCA 2YS1A 3FM8C 4KAXB 1V89A 3OANA 4EKUA 2RGNB 2I5CA 3HW2B 5J3TA 3O96A 5KCVA 2R09A 3FEHA 2EMSA 4K2OA 3DXDA 5D3VA 1W1DA 3LJUX 2M14A 1U27A 1FOEA 1I2HA 2DKPA 2M38A 4A5KA 1MPHA 1W1GA 5FI0A 3EO2A 4ZRKA 4CHMA 4MT7A 1GC6A 2J0MA 4A6HA 2Q13A 4HB4B 1LB1A 2UVMA 2YS5A 1X1GA 2DTCA 5DI9B 4D0OA 1J19A 2CRFA 3GF9A 2UZSA 1BTNA 4WSFA 5LOPB 2UZRA 1V5PA 3ULBA 1NTYA 3PZDA 4HAVB 4NSWA 4KHAA 1NI2A 1GC7A 2IFSA 1ISNA 5CLLB 5FI1A 4GXBA 1E5WA 2EC1A 4KVGB 1KI1B 3SO6A 1Q67A 3PVLA 3SNHA 3VIAA 2AEHA 3F5RA 1I7AA 4HDQA 4MK0A 2AL6A 4GZUA 3F0WA 4HAUB 2YT0A 5D3WA 1Y5OA 3A8QA 2QKMA 4F7UP 3D8FA 3DXEA 1XKEA 2J0KA 2CODA 4B6HA 4Y94A 2BCJA 3BJIA 2L2IA 2GS0A 2P0FA 4P7IA 2OTXA 5DHFB 1N3HA 1AWEA 3AJ4A 1FGYA 3WA0A 1P6SA 1MAIA 3U7DA 5L81A 3AU4A 2P0HA 2JP2A 4EJNA 3UZTA
chains in the Genus database with same CATH superfamily
2NZ8B 2LOXA 5C16A 2I1JA 2R0DA 3OHMB 2D10A 2P8VA 2PZ1A 3ZVRA 1U5FA 2MWNB 2L1CA 3M1IB 1MI1A 1U29A 5CLQB 1EF1A 4WJ7A 3PP2A 2RUKB 2KUPA 4GOUA 1BY1A 1H10A 4GPTB 2DHIA 4DIXA 3ML4A 3N7CA 4HB2B 1WI1A 5KQ1A 4GMXB 3RCPA 2GJYA 2K49A 5LONB 2GCJA 2KUQA 1FAOA 5I2MA 3QBVB 3PEGA 2MFQA 2YSZA 3FVCA 4DX90 1M7RA 3SUZA 2CAYA 2LKOA 2DHKA 2YS3A 1TQZA 1FHOA 2H7EA 2D9VA 4IAPA 3TCAA 2W2XC 2KR0A 3NWFA 1SGHA 3X23A 4YL8A 2W2WA 5HE0A 4GMVA 4GN1A 3VOQA 1X11A 3SV1A 1Y19B 2J0JA 1XCGA 2J59M 2Z13A 4KHOA 1UNPA 1WJ1A 2VRWB 1P5TA 3A8PA 2KGXB 2Z0OA 2X18A 2VSZA 1FGZA 1K5DB 4F7HA 1QQGA 3QIJA 2COAA 3QWMA 5LG4B 4DXAB 2OQBA 3GYOA 1K5GB 4L6EA 2DFKA 2RVBB 3G9WA 1XX0A 3KZ1A 1U5DA 3DCXA 5DH9B 2DA0A 1GG3A 1UEFA 4QJ4B 2RSGA 1RJ2A 2COCA 3ULCA 5GOWB 1WG7A 1KZ7A 4EMOA 1MIXA 2DLWA 4Z2MB 2LOZA 4QXAB 2DHJA 3PSCA 1B55A 2CY5A 3DXCA 3D8DA 1BAKA 4C0AA 1EGXA 5HE3A 3AU5A 4H8SA 4TKNA 2ELBA 2EMTA 4HAXB 5JHGA 1ZC4B 2LG1A 4OSNA 2DYNA 2N0YA 2N23A 4HB0B 2H7DA 2GUMA 4A6KA 1RRPB 1NU2A 2YRYA 1V5UA 1DDMA 4HB3B 2HTHB 2HE7A 2ZKMX 2K2UA 2V76A 4D0NB 1ZVRA 2YT1A 3NWAA 2EJ8A 3MPXA 2Z59A 3KRXA 3KRWA 1EVHA 3WYFB 3A58A 1SHCA 2ELAA 1W1HA 3NWDA 3ZDTA 2Y8FA 4PNKA 1BTKA 3NSUA 4DX8A 2KCJA 1TJ6A 1QC6A 3CXBB 2G35A 3TVVA 1EAZA 1X86A 3A98B 4HAZB 1ZSQA 5I2SA 3CIKA 2ROZB 5EFXA 2RLOA 3TW1A 2XQNM 2MKRA 1DDVA 2D9ZA 3D8EA 1X1FA 3FSSA 2DX5A 2IYBA 4HDOA 5DIFB 1ZC3B 3JV3A 5C79A 2RNRB 2YF0A 1MK9B 2YT2A 1XR0B 2LYDA 3T06A 2P0DA 1ZYIA 1MKEA 4KHBA 5HE1A 4CYEA 5JHHA 1WJMA 2Y8GA 2Z4DA 4ZRIA 5JP4A 1TXDA 3ODXA 1AQCA 3PVWA 2Z14A 5JLJB 1U5EA 1IRSA 2E2XA 3KSYA 2K8EA 1H4RA 2K2JA 5KQ4A 2Y7BA 5J3YA 1DYNA 2W2XD 2NMBA 4A6FA 3BINA 3PG7A 4WVFB 3TO1A 1MK7B 1Z87A 4NY0A 3U8ZA 3KY9A 5D3XA 1XD4A 4HSIA 2KR9A 2D11A 2Z0QA 2FJUB 4D6WA 3PVUA 2FJLA 2Z0PA 2VKIA 2DYQA 2CY4A 3ODWA 2DX1A 1FB8A 1PMSA 5C5BA 1BWNA 1NTVA 3P7ZA 4BBKA 5J3QA 3P6AA 4QJ5B 2GCLA 4KHBB 1X05A 2DKQA 5C6RA 4DBBA 1PFJA 1U2BA 4Z2NA 2I1KA 1WVHA 1OQNA 4HAWB 1M7EA 4TYZA 2COFA 4IFSA 4MY6A 1V88A 1UNRA 5D27A 1FHWA 1OY2A 3B77A 1PLSA 2DN6A 3HK0A 1MIZB 5DHAB 4F7GA 3SYXA 4CSQA 5IRSA 1WGQA 2D2QA 3IVFA 5HE2A 2ADZA 3GYPA 3HQCA 4A6FB 1UPRA 3ODOA 1UPQA 4XWXA 2NBVA 4CHJA 1UNQA 1LW3A 2I5FA 4K2PA 1F5XA 1U5GA 1ZM0A 1DDWA 3HSAA 4GNKB 1KZGA 1P3RA 2K00A 1V5MA 1V61A 2KIEA 2D9WA 2ZPYA 4HATB 1FHXA 4K17A 2D9XA 3MDBC 4HAYB 2D4QA 1DROA 4YONA 2KIGA 5C5BB 4K81A 1OMWA 5D3YA 4GYVA 2LULA 4PQ0A 1J0WA 2ROVA 1XODA 4ZRJA 2MDXA 4HHVA 2RRFA 3TFMA 2QKLA 3V5WA 1DBHA 2D9YA 4IOYX 1T77A 1WGUA 2YVCA 2YS1A 3FM8C 4KAXB 1V89A 3OANA 4EKUA 2RGNB 2I5CA 3HW2B 4QJ3B 5J3TA 3O96A 5KCVA 2R09A 3FEHA 2EMSA 4K2OA 3DXDA 5D3VA 1W1DA 3LJUX 2M14A 1U27A 1FOEA 1I2HA 2DKPA 2M38A 2R2YA 4A5KA 1MPHA 1W1GA 5FI0A 3EO2A 4ZRKA 4CHMA 4MT7A 1GC6A 2J0MA 4A6HA 2Q13A 4HB4B 1LB1A 2UVMA 2YS5A 1X1GA 2DTCA 5DI9B 4D0OA 1J19A 3NW8A 4L1RA 2CRFA 3GF9A 2UZSA 1BTNA 4WSFA 5LOPB 2UZRA 1V5PA 3HIEA 3ULBA 1NTYA 3PZDA 4HAVB 4NSWA 4KHAA 1NI2A 1GC7A 2IFSA 1ISNA 5CLLB 5FI1A 4GXBA 5M4YB 1E5WA 2EC1A 3U12A 4KVGB 1KI1B 3SO6A 1Q67A 3PVLA 3SNHA 3VIAA 2AEHA 3F5RA 1I7AA 4HDQA 4MK0A 2AL6A 4GZUA 3F0WA 4HAUB 2YT0A 5D3WA 1Y5OA 3A8QA 4OT1A 2QKMA 4F7UP 3D8FA 3DXEA 1XKEA 2J0KA 2CODA 4B6HA 4Y94A 2BCJA 3BJIA 2L2IA 2GS0A 2P0FA 4P7IA 2OTXA 5DHFB 1N3HA 1AWEA 3AJ4A 1FGYA 3WA0A 1P6SA 1MAIA 3U7DA 5L81A 3AU4A 2P0HA 2JP2A 4EJNA 3UZTA
chains in the Genus database with same CATH topology
2NZ8B 2LOXA 5C16A 2I1JA 2R0DA 2D10A 2P8VA 2PZ1A 3ZVRA 1U5FA 2MWNB 2L1CA 3M1IB 1U29A 5CLQB 1EF1A 4WJ7A 3PP2A 2RUKB 2KUPA 4GOUA 1BY1A 1H10A 4GPTB 2DHIA 3ML4A 3N7CA 4HB2B 1WI1A 5KQ1A 4GMXB 3RCPA 2GJYA 5LONB 2GCJA 1FAOA 3QBVB 3PEGA 2MFQA 2YSZA 4DX90 1M7RA 3SUZA 2CAYA 2LKOA 2DHKA 2YS3A 1TQZA 1FHOA 2H7EA 2D9VA 4IAPA 3TCAA 2W2XC 1SGHA 3X23A 4YL8A 2W2WA 5HE0A 4GMVA 4GN1A 3VOQA 1X11A 3SV1A 1Y19B 2J0JA 1XCGA 2J59M 4KHOA 1UNPA 1WJ1A 2VRWB 1P5TA 3A8PA 2KGXB 2Z0OA 2X18A 2VSZA 1FGZA 1K5DB 4F7HA 1QQGA 3QIJA 2COAA 3QWMA 4DXAB 2OQBA 3GYOA 1K5GB 4L6EA 2DFKA 2RVBB 3G9WA 1XX0A 3KZ1A 1U5DA 5DH9B 2DA0A 1GG3A 1UEFA 2RSGA 1RJ2A 2COCA 3ULCA 5GOWB 1WG7A 1KZ7A 4EMOA 1MIXA 2DLWA 4Z2MB 2LOZA 2DHJA 3PSCA 1B55A 2CY5A 3DXCA 3D8DA 1BAKA 4C0AA 1EGXA 5HE3A 3AU5A 4H8SA 4TKNA 2ELBA 2EMTA 4HAXB 5JHGA 1ZC4B 2LG1A 2DYNA 2N0YA 2N23A 4HB0B 2H7DA 4A6KA 1RRPB 1NU2A 2YRYA 1V5UA 1DDMA 4HB3B 2HTHB 2HE7A 2K2UA 2V76A 4D0NB 1ZVRA 2YT1A 2EJ8A 3MPXA 3KRXA 3KRWA 1EVHA 3WYFB 1SHCA 2ELAA 1W1HA 3ZDTA 2Y8FA 4PNKA 1BTKA 3NSUA 4DX8A 2KCJA 1TJ6A 1QC6A 3CXBB 2G35A 3TVVA 1EAZA 1X86A 3A98B 4HAZB 1ZSQA 3CIKA 2ROZB 5EFXA 2RLOA 3TW1A 2XQNM 2MKRA 1DDVA 2D9ZA 3D8EA 1X1FA 3FSSA 2DX5A 2IYBA 4HDOA 5DIFB 1ZC3B 3JV3A 5C79A 2RNRB 2YF0A 1MK9B 1XR0B 2LYDA 3T06A 2P0DA 1MKEA 5HE1A 4CYEA 5JHHA 1WJMA 2Y8GA 4ZRIA 5JP4A 1TXDA 3ODXA 1AQCA 3PVWA 5JLJB 1U5EA 1IRSA 2E2XA 3KSYA 1H4RA 2K2JA 5KQ4A 2Y7BA 5J3YA 1DYNA 2W2XD 2NMBA 4A6FA 3BINA 3PG7A 4WVFB 3TO1A 1MK7B 1Z87A 4NY0A 3U8ZA 3KY9A 5D3XA 1XD4A 2KR9A 2D11A 2Z0QA 3PVUA 2FJLA 2Z0PA 2VKIA 2DYQA 2CY4A 3ODWA 2DX1A 1FB8A 1PMSA 5C5BA 1BWNA 1NTVA 3P7ZA 4BBKA 5J3QA 3P6AA 2GCLA 4KHBB 1X05A 2DKQA 5C6RA 4DBBA 1PFJA 1U2BA 4Z2NA 2I1KA 1WVHA 1OQNA 4HAWB 1M7EA 4TYZA 2COFA 4IFSA 4MY6A 1V88A 1UNRA 5D27A 1FHWA 1OY2A 1PLSA 2DN6A 3HK0A 1MIZB 5DHAB 4F7GA 3SYXA 1WGQA 2D2QA 3IVFA 5HE2A 2ADZA 3GYPA 3HQCA 4A6FB 1UPRA 3ODOA 1UPQA 4XWXA 4CHJA 1UNQA 1LW3A 2I5FA 4K2PA 1F5XA 1U5GA 1ZM0A 1DDWA 1KZGA 1P3RA 2K00A 1V5MA 1V61A 2ZPYA 2D9WA 4HATB 1FHXA 4K17A 2D9XA 3MDBC 4HAYB 2D4QA 1DROA 4YONA 5C5BB 4K81A 1OMWA 5D3YA 4GYVA 2LULA 4PQ0A 1J0WA 2ROVA 1XODA 4ZRJA 2MDXA 4HHVA 3TFMA 2QKLA 3V5WA 1DBHA 2D9YA 4IOYX 1WGUA 2YVCA 2YS1A 3FM8C 4KAXB 1V89A 3OANA 4EKUA 2RGNB 2I5CA 3HW2B 5J3TA 3O96A 5KCVA 2R09A 3FEHA 2EMSA 4K2OA 3DXDA 5D3VA 1W1DA 3LJUX 2M14A 1U27A 1FOEA 1I2HA 2DKPA 2M38A 4A5KA 1MPHA 1W1GA 5FI0A 3EO2A 4ZRKA 4CHMA 4MT7A 1GC6A 2J0MA 4A6HA 2Q13A 4HB4B 1LB1A 2UVMA 2YS5A 1X1GA 2DTCA 5DI9B 4D0OA 1J19A 2CRFA 3GF9A 2UZSA 1BTNA 4WSFA 5LOPB 2UZRA 1V5PA 3ULBA 1NTYA 3PZDA 4HAVB 4NSWA 4KHAA 1NI2A 1GC7A 2IFSA 1ISNA 5CLLB 5FI1A 4GXBA 1E5WA 2EC1A 4KVGB 1KI1B 3SO6A 1Q67A 3PVLA 3SNHA 3VIAA 2AEHA 3F5RA 1I7AA 4HDQA 4MK0A 2AL6A 4GZUA 3F0WA 4HAUB 2YT0A 5D3WA 1Y5OA 3A8QA 2QKMA 4F7UP 3D8FA 3DXEA 1XKEA 2J0KA 2CODA 4B6HA 4Y94A 2BCJA 3BJIA 2L2IA 2GS0A 2P0FA 4P7IA 2OTXA 5DHFB 1N3HA 1AWEA 3AJ4A 1FGYA 3WA0A 1P6SA 1MAIA 3U7DA 5L81A 3AU4A 2P0HA 2JP2A 4EJNA 3UZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ8 B;  2LOX A;  5C16 A;  2I1J A;  2R0D A;  2D10 A;  2P8V A;  2PZ1 A;  3ZVR A;  1U5F A;  2MWN B;  2L1C A;  3M1I B;  1U29 A;  5CLQ B;  1EF1 A;  4WJ7 A;  3PP2 A;  2RUK B;  2KUP A;  4GOU A;  1BY1 A;  1H10 A;  4GPT B;  2DHI A;  3ML4 A;  3N7C A;  4HB2 B;  1WI1 A;  5KQ1 A;  4GMX B;  3RCP A;  2GJY A;  5LON B;  2GCJ A;  1FAO A;  3QBV B;  3PEG A;  2MFQ A;  2YSZ A;  4DX9 0;  1M7R A;  3SUZ A;  2CAY A;  2LKO A;  2DHK A;  2YS3 A;  1TQZ A;  1FHO A;  2H7E A;  2D9V A;  4IAP A;  3TCA A;  2W2X C;  1SGH A;  3X23 A;  4YL8 A;  2W2W A;  5HE0 A;  4GMV A;  4GN1 A;  3VOQ A;  1X11 A;  3SV1 A;  1Y19 B;  2J0J A;  1XCG A;  2J59 M;  4KHO A;  1UNP A;  1WJ1 A;  2VRW B;  1P5T A;  3A8P A;  2KGX B;  2Z0O A;  2X18 A;  2VSZ A;  1FGZ A;  1K5D B;  4F7H A;  1QQG A;  3QIJ A;  2COA A;  3QWM A;  4DXA B;  2OQB A;  3GYO A;  1K5G B;  4L6E A;  2DFK A;  2RVB B;  3G9W A;  1XX0 A;  3KZ1 A;  1U5D A;  5DH9 B;  2DA0 A;  1GG3 A;  1UEF A;  2RSG A;  1RJ2 A;  2COC A;  3ULC A;  5GOW B;  1WG7 A;  1KZ7 A;  4EMO A;  1MIX A;  2DLW A;  4Z2M B;  2LOZ A;  2DHJ A;  3PSC A;  1B55 A;  2CY5 A;  3DXC A;  3D8D A;  1BAK A;  4C0A A;  1EGX A;  5HE3 A;  3AU5 A;  4H8S A;  4TKN A;  2ELB A;  2EMT A;  4HAX B;  5JHG A;  1ZC4 B;  2LG1 A;  2DYN A;  2N0Y A;  2N23 A;  4HB0 B;  2H7D A;  4A6K A;  1RRP B;  1NU2 A;  2YRY A;  1V5U A;  1DDM A;  4HB3 B;  2HTH B;  2HE7 A;  2K2U A;  2V76 A;  4D0N B;  1ZVR A;  2YT1 A;  2EJ8 A;  3MPX A;  3KRX A;  3KRW A;  1EVH A;  3WYF B;  1SHC A;  2ELA A;  1W1H A;  3ZDT A;  2Y8F A;  4PNK A;  1BTK A;  3NSU A;  4DX8 A;  2KCJ A;  1TJ6 A;  1QC6 A;  3CXB B;  2G35 A;  3TVV A;  1EAZ A;  1X86 A;  3A98 B;  4HAZ B;  1ZSQ A;  3CIK A;  2ROZ B;  5EFX A;  2RLO A;  3TW1 A;  2XQN M;  2MKR A;  1DDV A;  2D9Z A;  3D8E A;  1X1F A;  3FSS A;  2DX5 A;  2IYB A;  4HDO A;  5DIF B;  1ZC3 B;  3JV3 A;  5C79 A;  2RNR B;  2YF0 A;  1MK9 B;  1XR0 B;  2LYD A;  3T06 A;  2P0D A;  1MKE A;  5HE1 A;  4CYE A;  5JHH A;  1WJM A;  2Y8G A;  4ZRI A;  5JP4 A;  1TXD A;  3ODX A;  1AQC A;  3PVW A;  5JLJ B;  1U5E A;  1IRS A;  2E2X A;  3KSY A;  1H4R A;  2K2J A;  5KQ4 A;  2Y7B A;  5J3Y A;  1DYN A;  2W2X D;  2NMB A;  4A6F A;  3BIN A;  3PG7 A;  4WVF B;  3TO1 A;  1MK7 B;  1Z87 A;  4NY0 A;  3U8Z A;  3KY9 A;  5D3X A;  1XD4 A;  2KR9 A;  2D11 A;  2Z0Q A;  3PVU A;  2FJL A;  2Z0P A;  2VKI A;  2DYQ A;  2CY4 A;  3ODW A;  2DX1 A;  1FB8 A;  1PMS A;  5C5B A;  1BWN A;  1NTV A;  3P7Z A;  4BBK A;  5J3Q A;  3P6A A;  2GCL A;  4KHB B;  1X05 A;  2DKQ A;  5C6R A;  4DBB A;  1PFJ A;  1U2B A;  4Z2N A;  2I1K A;  1WVH A;  1OQN A;  4HAW B;  1M7E A;  4TYZ A;  2COF A;  4IFS A;  4MY6 A;  1V88 A;  1UNR A;  5D27 A;  1FHW A;  1OY2 A;  1PLS A;  2DN6 A;  3HK0 A;  1MIZ B;  5DHA B;  4F7G A;  3SYX A;  1WGQ A;  2D2Q A;  3IVF A;  5HE2 A;  2ADZ A;  3GYP A;  3HQC A;  4A6F B;  1UPR A;  3ODO A;  1UPQ A;  4XWX A;  4CHJ A;  1UNQ A;  1LW3 A;  2I5F A;  4K2P A;  1F5X A;  1U5G A;  1ZM0 A;  1DDW A;  1KZG A;  1P3R A;  2K00 A;  1V5M A;  1V61 A;  2ZPY A;  2D9W A;  4HAT B;  1FHX A;  4K17 A;  2D9X A;  3MDB C;  4HAY B;  2D4Q A;  1DRO A;  4YON A;  5C5B B;  4K81 A;  1OMW A;  5D3Y A;  4GYV A;  2LUL A;  4PQ0 A;  1J0W A;  2ROV A;  1XOD A;  4ZRJ A;  2MDX A;  4HHV A;  3TFM A;  2QKL A;  3V5W A;  1DBH A;  2D9Y A;  4IOY X;  1WGU A;  2YVC A;  2YS1 A;  3FM8 C;  4KAX B;  1V89 A;  3OAN A;  4EKU A;  2RGN B;  2I5C A;  3HW2 B;  5J3T A;  3O96 A;  5KCV A;  2R09 A;  3FEH A;  2EMS A;  4K2O A;  3DXD A;  5D3V A;  1W1D A;  3LJU X;  2M14 A;  1U27 A;  1FOE A;  1I2H A;  2DKP A;  2M38 A;  4A5K A;  1MPH A;  1W1G A;  5FI0 A;  3EO2 A;  4ZRK A;  4CHM A;  4MT7 A;  1GC6 A;  2J0M A;  4A6H A;  2Q13 A;  4HB4 B;  1LB1 A;  2UVM A;  2YS5 A;  1X1G A;  2DTC A;  5DI9 B;  4D0O A;  1J19 A;  2CRF A;  3GF9 A;  2UZS A;  1BTN A;  4WSF A;  5LOP B;  2UZR A;  1V5P A;  3ULB A;  1NTY A;  3PZD A;  4HAV B;  4NSW A;  4KHA A;  1NI2 A;  1GC7 A;  2IFS A;  1ISN A;  5CLL B;  5FI1 A;  4GXB A;  1E5W A;  2EC1 A;  4KVG B;  1KI1 B;  3SO6 A;  1Q67 A;  3PVL A;  3SNH A;  3VIA A;  2AEH A;  3F5R A;  1I7A A;  4HDQ A;  4MK0 A;  2AL6 A;  4GZU A;  3F0W A;  4HAU B;  2YT0 A;  5D3W A;  1Y5O A;  3A8Q A;  2QKM A;  4F7U P;  3D8F A;  3DXE A;  1XKE A;  2J0K A;  2COD A;  4B6H A;  4Y94 A;  2BCJ A;  3BJI A;  2L2I A;  2GS0 A;  2P0F A;  4P7I A;  2OTX A;  5DHF B;  1N3H A;  1AWE A;  3AJ4 A;  1FGY A;  3WA0 A;  1P6S A;  1MAI A;  3U7D A;  5L81 A;  3AU4 A;  2P0H A;  2JP2 A;  4EJN A;  3UZT A; 
#chains in the Genus database with same CATH topology
 2NZ8 B;  2LOX A;  5C16 A;  2I1J A;  2R0D A;  3OHM B;  2D10 A;  2P8V A;  2PZ1 A;  3ZVR A;  1U5F A;  2MWN B;  2L1C A;  3M1I B;  1MI1 A;  1U29 A;  5CLQ B;  1EF1 A;  4WJ7 A;  3PP2 A;  2RUK B;  2KUP A;  4GOU A;  1BY1 A;  1H10 A;  4GPT B;  2DHI A;  4DIX A;  3ML4 A;  3N7C A;  4HB2 B;  1WI1 A;  5KQ1 A;  4GMX B;  3RCP A;  2GJY A;  2K49 A;  5LON B;  2GCJ A;  2KUQ A;  1FAO A;  5I2M A;  3QBV B;  3PEG A;  2MFQ A;  2YSZ A;  3FVC A;  4DX9 0;  1M7R A;  3SUZ A;  2CAY A;  2LKO A;  2DHK A;  2YS3 A;  1TQZ A;  1FHO A;  2H7E A;  2D9V A;  4IAP A;  3TCA A;  2W2X C;  2KR0 A;  3NWF A;  1SGH A;  3X23 A;  4YL8 A;  2W2W A;  5HE0 A;  4GMV A;  4GN1 A;  3VOQ A;  1X11 A;  3SV1 A;  1Y19 B;  2J0J A;  1XCG A;  2J59 M;  2Z13 A;  4KHO A;  1UNP A;  1WJ1 A;  2VRW B;  1P5T A;  3A8P A;  2KGX B;  2Z0O A;  2X18 A;  2VSZ A;  1FGZ A;  1K5D B;  4F7H A;  1QQG A;  3QIJ A;  2COA A;  3QWM A;  5LG4 B;  4DXA B;  2OQB A;  3GYO A;  1K5G B;  4L6E A;  2DFK A;  2RVB B;  3G9W A;  1XX0 A;  3KZ1 A;  1U5D A;  3DCX A;  5DH9 B;  2DA0 A;  1GG3 A;  1UEF A;  4QJ4 B;  2RSG A;  1RJ2 A;  2COC A;  3ULC A;  5GOW B;  1WG7 A;  1KZ7 A;  4EMO A;  1MIX A;  2DLW A;  4Z2M B;  2LOZ A;  4QXA B;  2DHJ A;  3PSC A;  1B55 A;  2CY5 A;  3DXC A;  3D8D A;  1BAK A;  4C0A A;  1EGX A;  5HE3 A;  3AU5 A;  4H8S A;  4TKN A;  2ELB A;  2EMT A;  4HAX B;  5JHG A;  1ZC4 B;  2LG1 A;  4OSN A;  2DYN A;  2N0Y A;  2N23 A;  4HB0 B;  2H7D A;  2GUM A;  4A6K A;  1RRP B;  1NU2 A;  2YRY A;  1V5U A;  1DDM A;  4HB3 B;  2HTH B;  2HE7 A;  2ZKM X;  2K2U A;  2V76 A;  4D0N B;  1ZVR A;  2YT1 A;  3NWA A;  2EJ8 A;  3MPX A;  2Z59 A;  3KRX A;  3KRW A;  1EVH A;  3WYF B;  3A58 A;  1SHC A;  2ELA A;  1W1H A;  3NWD A;  3ZDT A;  2Y8F A;  4PNK A;  1BTK A;  3NSU A;  4DX8 A;  2KCJ A;  1TJ6 A;  1QC6 A;  3CXB B;  2G35 A;  3TVV A;  1EAZ A;  1X86 A;  3A98 B;  4HAZ B;  1ZSQ A;  5I2S A;  3CIK A;  2ROZ B;  5EFX A;  2RLO A;  3TW1 A;  2XQN M;  2MKR A;  1DDV A;  2D9Z A;  3D8E A;  1X1F A;  3FSS A;  2DX5 A;  2IYB A;  4HDO A;  5DIF B;  1ZC3 B;  3JV3 A;  5C79 A;  2RNR B;  2YF0 A;  1MK9 B;  2YT2 A;  1XR0 B;  2LYD A;  3T06 A;  2P0D A;  1ZYI A;  1MKE A;  4KHB A;  5HE1 A;  4CYE A;  5JHH A;  1WJM A;  2Y8G A;  2Z4D A;  4ZRI A;  5JP4 A;  1TXD A;  3ODX A;  1AQC A;  3PVW A;  2Z14 A;  5JLJ B;  1U5E A;  1IRS A;  2E2X A;  3KSY A;  2K8E A;  1H4R A;  2K2J A;  5KQ4 A;  2Y7B A;  5J3Y A;  1DYN A;  2W2X D;  2NMB A;  4A6F A;  3BIN A;  3PG7 A;  4WVF B;  3TO1 A;  1MK7 B;  1Z87 A;  4NY0 A;  3U8Z A;  3KY9 A;  5D3X A;  1XD4 A;  4HSI A;  2KR9 A;  2D11 A;  2Z0Q A;  2FJU B;  4D6W A;  3PVU A;  2FJL A;  2Z0P A;  2VKI A;  2DYQ A;  2CY4 A;  3ODW A;  2DX1 A;  1FB8 A;  1PMS A;  5C5B A;  1BWN A;  1NTV A;  3P7Z A;  4BBK A;  5J3Q A;  3P6A A;  4QJ5 B;  2GCL A;  4KHB B;  1X05 A;  2DKQ A;  5C6R A;  4DBB A;  1PFJ A;  1U2B A;  4Z2N A;  2I1K A;  1WVH A;  1OQN A;  4HAW B;  1M7E A;  4TYZ A;  2COF A;  4IFS A;  4MY6 A;  1V88 A;  1UNR A;  5D27 A;  1FHW A;  1OY2 A;  3B77 A;  1PLS A;  2DN6 A;  3HK0 A;  1MIZ B;  5DHA B;  4F7G A;  3SYX A;  4CSQ A;  5IRS A;  1WGQ A;  2D2Q A;  3IVF A;  5HE2 A;  2ADZ A;  3GYP A;  3HQC A;  4A6F B;  1UPR A;  3ODO A;  1UPQ A;  4XWX A;  2NBV A;  4CHJ A;  1UNQ A;  1LW3 A;  2I5F A;  4K2P A;  1F5X A;  1U5G A;  1ZM0 A;  1DDW A;  3HSA A;  4GNK B;  1KZG A;  1P3R A;  2K00 A;  1V5M A;  1V61 A;  2KIE A;  2D9W A;  2ZPY A;  4HAT B;  1FHX A;  4K17 A;  2D9X A;  3MDB C;  4HAY B;  2D4Q A;  1DRO A;  4YON A;  2KIG A;  5C5B B;  4K81 A;  1OMW A;  5D3Y A;  4GYV A;  2LUL A;  4PQ0 A;  1J0W A;  2ROV A;  1XOD A;  4ZRJ A;  2MDX A;  4HHV A;  2RRF A;  3TFM A;  2QKL A;  3V5W A;  1DBH A;  2D9Y A;  4IOY X;  1T77 A;  1WGU A;  2YVC A;  2YS1 A;  3FM8 C;  4KAX B;  1V89 A;  3OAN A;  4EKU A;  2RGN B;  2I5C A;  3HW2 B;  4QJ3 B;  5J3T A;  3O96 A;  5KCV A;  2R09 A;  3FEH A;  2EMS A;  4K2O A;  3DXD A;  5D3V A;  1W1D A;  3LJU X;  2M14 A;  1U27 A;  1FOE A;  1I2H A;  2DKP A;  2M38 A;  2R2Y A;  4A5K A;  1MPH A;  1W1G A;  5FI0 A;  3EO2 A;  4ZRK A;  4CHM A;  4MT7 A;  1GC6 A;  2J0M A;  4A6H A;  2Q13 A;  4HB4 B;  1LB1 A;  2UVM A;  2YS5 A;  1X1G A;  2DTC A;  5DI9 B;  4D0O A;  1J19 A;  3NW8 A;  4L1R A;  2CRF A;  3GF9 A;  2UZS A;  1BTN A;  4WSF A;  5LOP B;  2UZR A;  1V5P A;  3HIE A;  3ULB A;  1NTY A;  3PZD A;  4HAV B;  4NSW A;  4KHA A;  1NI2 A;  1GC7 A;  2IFS A;  1ISN A;  5CLL B;  5FI1 A;  4GXB A;  5M4Y B;  1E5W A;  2EC1 A;  3U12 A;  4KVG B;  1KI1 B;  3SO6 A;  1Q67 A;  3PVL A;  3SNH A;  3VIA A;  2AEH A;  3F5R A;  1I7A A;  4HDQ A;  4MK0 A;  2AL6 A;  4GZU A;  3F0W A;  4HAU B;  2YT0 A;  5D3W A;  1Y5O A;  3A8Q A;  4OT1 A;  2QKM A;  4F7U P;  3D8F A;  3DXE A;  1XKE A;  2J0K A;  2COD A;  4B6H A;  4Y94 A;  2BCJ A;  3BJI A;  2L2I A;  2GS0 A;  2P0F A;  4P7I A;  2OTX A;  5DHF B;  1N3H A;  1AWE A;  3AJ4 A;  1FGY A;  3WA0 A;  1P6S A;  1MAI A;  3U7D A;  5L81 A;  3AU4 A;  2P0H A;  2JP2 A;  4EJN A;  3UZT A; 
#chains in the Genus database with same CATH homology
 2NZ8 B;  2LOX A;  5C16 A;  2I1J A;  2R0D A;  2D10 A;  2P8V A;  2PZ1 A;  3ZVR A;  1U5F A;  2MWN B;  2L1C A;  3M1I B;  1U29 A;  5CLQ B;  1EF1 A;  4WJ7 A;  3PP2 A;  2RUK B;  2KUP A;  4GOU A;  1BY1 A;  1H10 A;  4GPT B;  2DHI A;  3ML4 A;  3N7C A;  4HB2 B;  1WI1 A;  5KQ1 A;  4GMX B;  3RCP A;  2GJY A;  5LON B;  2GCJ A;  1FAO A;  3QBV B;  3PEG A;  2MFQ A;  2YSZ A;  4DX9 0;  1M7R A;  3SUZ A;  2CAY A;  2LKO A;  2DHK A;  2YS3 A;  1TQZ A;  1FHO A;  2H7E A;  2D9V A;  4IAP A;  3TCA A;  2W2X C;  1SGH A;  3X23 A;  4YL8 A;  2W2W A;  5HE0 A;  4GMV A;  4GN1 A;  3VOQ A;  1X11 A;  3SV1 A;  1Y19 B;  2J0J A;  1XCG A;  2J59 M;  4KHO A;  1UNP A;  1WJ1 A;  2VRW B;  1P5T A;  3A8P A;  2KGX B;  2Z0O A;  2X18 A;  2VSZ A;  1FGZ A;  1K5D B;  4F7H A;  1QQG A;  3QIJ A;  2COA A;  3QWM A;  4DXA B;  2OQB A;  3GYO A;  1K5G B;  4L6E A;  2DFK A;  2RVB B;  3G9W A;  1XX0 A;  3KZ1 A;  1U5D A;  5DH9 B;  2DA0 A;  1GG3 A;  1UEF A;  2RSG A;  1RJ2 A;  2COC A;  3ULC A;  5GOW B;  1WG7 A;  1KZ7 A;  4EMO A;  1MIX A;  2DLW A;  4Z2M B;  2LOZ A;  2DHJ A;  3PSC A;  1B55 A;  2CY5 A;  3DXC A;  3D8D A;  1BAK A;  4C0A A;  1EGX A;  5HE3 A;  3AU5 A;  4H8S A;  4TKN A;  2ELB A;  2EMT A;  4HAX B;  5JHG A;  1ZC4 B;  2LG1 A;  2DYN A;  2N0Y A;  2N23 A;  4HB0 B;  2H7D A;  4A6K A;  1RRP B;  1NU2 A;  2YRY A;  1V5U A;  1DDM A;  4HB3 B;  2HTH B;  2HE7 A;  2K2U A;  2V76 A;  4D0N B;  1ZVR A;  2YT1 A;  2EJ8 A;  3MPX A;  3KRX A;  3KRW A;  1EVH A;  3WYF B;  1SHC A;  2ELA A;  1W1H A;  3ZDT A;  2Y8F A;  4PNK A;  1BTK A;  3NSU A;  4DX8 A;  2KCJ A;  1TJ6 A;  1QC6 A;  3CXB B;  2G35 A;  3TVV A;  1EAZ A;  1X86 A;  3A98 B;  4HAZ B;  1ZSQ A;  3CIK A;  2ROZ B;  5EFX A;  2RLO A;  3TW1 A;  2XQN M;  2MKR A;  1DDV A;  2D9Z A;  3D8E A;  1X1F A;  3FSS A;  2DX5 A;  2IYB A;  4HDO A;  5DIF B;  1ZC3 B;  3JV3 A;  5C79 A;  2RNR B;  2YF0 A;  1MK9 B;  1XR0 B;  2LYD A;  3T06 A;  2P0D A;  1MKE A;  5HE1 A;  4CYE A;  5JHH A;  1WJM A;  2Y8G A;  4ZRI A;  5JP4 A;  1TXD A;  3ODX A;  1AQC A;  3PVW A;  5JLJ B;  1U5E A;  1IRS A;  2E2X A;  3KSY A;  1H4R A;  2K2J A;  5KQ4 A;  2Y7B A;  5J3Y A;  1DYN A;  2W2X D;  2NMB A;  4A6F A;  3BIN A;  3PG7 A;  4WVF B;  3TO1 A;  1MK7 B;  1Z87 A;  4NY0 A;  3U8Z A;  3KY9 A;  5D3X A;  1XD4 A;  2KR9 A;  2D11 A;  2Z0Q A;  3PVU A;  2FJL A;  2Z0P A;  2VKI A;  2DYQ A;  2CY4 A;  3ODW A;  2DX1 A;  1FB8 A;  1PMS A;  5C5B A;  1BWN A;  1NTV A;  3P7Z A;  4BBK A;  5J3Q A;  3P6A A;  2GCL A;  4KHB B;  1X05 A;  2DKQ A;  5C6R A;  4DBB A;  1PFJ A;  1U2B A;  4Z2N A;  2I1K A;  1WVH A;  1OQN A;  4HAW B;  1M7E A;  4TYZ A;  2COF A;  4IFS A;  4MY6 A;  1V88 A;  1UNR A;  5D27 A;  1FHW A;  1OY2 A;  1PLS A;  2DN6 A;  3HK0 A;  1MIZ B;  5DHA B;  4F7G A;  3SYX A;  1WGQ A;  2D2Q A;  3IVF A;  5HE2 A;  2ADZ A;  3GYP A;  3HQC A;  4A6F B;  1UPR A;  3ODO A;  1UPQ A;  4XWX A;  4CHJ A;  1UNQ A;  1LW3 A;  2I5F A;  4K2P A;  1F5X A;  1U5G A;  1ZM0 A;  1DDW A;  1KZG A;  1P3R A;  2K00 A;  1V5M A;  1V61 A;  2ZPY A;  2D9W A;  4HAT B;  1FHX A;  4K17 A;  2D9X A;  3MDB C;  4HAY B;  2D4Q A;  1DRO A;  4YON A;  5C5B B;  4K81 A;  1OMW A;  5D3Y A;  4GYV A;  2LUL A;  4PQ0 A;  1J0W A;  2ROV A;  1XOD A;  4ZRJ A;  2MDX A;  4HHV A;  3TFM A;  2QKL A;  3V5W A;  1DBH A;  2D9Y A;  4IOY X;  1WGU A;  2YVC A;  2YS1 A;  3FM8 C;  4KAX B;  1V89 A;  3OAN A;  4EKU A;  2RGN B;  2I5C A;  3HW2 B;  5J3T A;  3O96 A;  5KCV A;  2R09 A;  3FEH A;  2EMS A;  4K2O A;  3DXD A;  5D3V A;  1W1D A;  3LJU X;  2M14 A;  1U27 A;  1FOE A;  1I2H A;  2DKP A;  2M38 A;  4A5K A;  1MPH A;  1W1G A;  5FI0 A;  3EO2 A;  4ZRK A;  4CHM A;  4MT7 A;  1GC6 A;  2J0M A;  4A6H A;  2Q13 A;  4HB4 B;  1LB1 A;  2UVM A;  2YS5 A;  1X1G A;  2DTC A;  5DI9 B;  4D0O A;  1J19 A;  2CRF A;  3GF9 A;  2UZS A;  1BTN A;  4WSF A;  5LOP B;  2UZR A;  1V5P A;  3ULB A;  1NTY A;  3PZD A;  4HAV B;  4NSW A;  4KHA A;  1NI2 A;  1GC7 A;  2IFS A;  1ISN A;  5CLL B;  5FI1 A;  4GXB A;  1E5W A;  2EC1 A;  4KVG B;  1KI1 B;  3SO6 A;  1Q67 A;  3PVL A;  3SNH A;  3VIA A;  2AEH A;  3F5R A;  1I7A A;  4HDQ A;  4MK0 A;  2AL6 A;  4GZU A;  3F0W A;  4HAU B;  2YT0 A;  5D3W A;  1Y5O A;  3A8Q A;  2QKM A;  4F7U P;  3D8F A;  3DXE A;  1XKE A;  2J0K A;  2COD A;  4B6H A;  4Y94 A;  2BCJ A;  3BJI A;  2L2I A;  2GS0 A;  2P0F A;  4P7I A;  2OTX A;  5DHF B;  1N3H A;  1AWE A;  3AJ4 A;  1FGY A;  3WA0 A;  1P6S A;  1MAI A;  3U7D A;  5L81 A;  3AU4 A;  2P0H A;  2JP2 A;  4EJN A;  3UZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...