3P6AA

Crystal structure of the dh/ph domains of p115-rhogef (r399e mutant)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
355
structure length
344
Chain Sequence
PKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 1
total genus 128
structure length 344
sequence length 355
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3p6aA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3p6aA02
4EMOA 4CYEA 2KR9A 2W2XC 3DXCA 2P0FA 5DHFB 2Y7BA 2D9XA 2NZ8B 2N23A 4HAXB 4K2PA 4GMXB 4HDQA 1M7RA 4IFSA 1BTKA 4A6FA 2E2XA 3DXEA 5JHGA 4KHOA 1U5EA 4IOYX 1FHOA 5HE3A 1GC7A 3A8PA 1ZM0A 1AWEA 4DXAB 1KZ7A 1FB8A 3ZVRA 5DIFB 4TYZA 1J0WA 3LJUX 1ZSQA 4P7IA 2GJYA 2GS0A 1MIXA 5C16A 2YRYA 3PEGA 2LOZA 3HW2B 1MKEA 4WJ7A 1UPRA 2CRFA 2DYNA 2CAYA 2VKIA 2UZSA 3O96A 5KCVA 2I1JA 2XQNM 3WA0A 4NSWA 2EMTA 3GF9A 1FGYA 1X1GA 4EJNA 1XODA 1BTNA 1I7AA 1P3RA 5C5BB 2YS5A 4HAYB 2EJ8A 1DYNA 1SGHA 2X18A 2OQBA 4KAXB 1V61A 2D9ZA 4DX8A 1SHCA 1EGXA 3D8FA 1EAZA 1ZVRA 4HDOA 1OY2A 4GN1A 4HB0B 3ODXA 5FI1A 3RCPA 2VSZA 2Z0QA 1V88A 4MY6A 3U7DA 3ZDTA 1BWNA 1EF1A 2D9VA 2MKRA 1IRSA 3CIKA 3F5RA 1FHWA 3TO1A 2N0YA 1ZC4B 2LULA 3PP2A 2KCJA 1P6SA 2LYDA 2DHKA 3G9WA 3A8QA 5DHAB 2P0HA 2K2JA 2UZRA 1QQGA 4IAPA 5L81A 1X86A 1FHXA 1MIZB 1U5DA 2DKQA 2ROVA 1WI1A 4D0NB 3KRWA 4DX90 3VIAA 1DDWA 4C0AA 2J0KA 2H7EA 1XD4A 1K5DB 1X11A 1U2BA 1TJ6A 4B6HA 1FAOA 3AU4A 1NTVA 3PG7A 4K2OA 5CLQB 4Z2NA 4BBKA 2PZ1A 2L1CA 3MDBC 5GOWB 2COFA 1U5FA 4F7HA 3SO6A 4WVFB 1GG3A 3KY9A 4ZRKA 2RSGA 1TQZA 2J59M 1Y5OA 4K81A 4CHJA 1WGUA 1XR0B 4A6KA 1RJ2A 5DH9B 2EC1A 2UVMA 5J3QA 5DI9B 3BINA 5C5BA 2YT0A 3A98B 1PMSA 1WG7A 1GC6A 2VRWB 2BCJA 2H7DA 4HHVA 5HE2A 1V5UA 4F7UP 3PZDA 1NU2A 1W1HA 4A6HA 3T06A 4ZRJA 5LOPB 5KQ4A 4Z2MB 3BJIA 3SUZA 4HATB 4D0OA 5CLLB 2V76A 4H8SA 2OTXA 2YVCA 2FJLA 1DBHA 2DTCA 1X1FA 3D8EA 5HE0A 3P7ZA 1J19A 5J3YA 2W2WA 2YF0A 1PFJA 4GZUA 2AL6A 3V5WA 4HB2B 4L6EA 4YONA 1UNRA 2K00A 3AU5A 2D2QA 1XCGA 2J0MA 3KRXA 2Z0PA 2LOXA 2P8VA 2AEHA 1W1DA 1FOEA 4A6FB 3SV1A 5D3YA 5D3WA 1V5MA 2ELBA 3OANA 4EKUA 4MT7A 4PNKA 2DX5A 2DHIA 3U8ZA 2Y8FA 1KZGA 1RRPB 2LG1A 4GMVA 3MPXA 2YSZA 3TVVA 1MK9B 2QKLA 5J3TA 2COCA 1X05A 2I5FA 3ULBA 1BAKA 1V5PA 1DDMA 3NSUA 1UPQA 1K5GB 2QKMA 2M14A 3M1IB 2RVBB 2ROZB 2YS3A 4GOUA 4ZRIA 2ZPYA 2COAA 3PVWA 1FGZA 2YS1A 1UEFA 2W2XD 3HK0A 2KUPA 1E5WA 2YT1A 3QBVB 4KHBB 1WVHA 1U29A 3PVUA 1OMWA 2RUKB 2HTHB 4F7GA 2DA0A 4GPTB 2LKOA 3ODWA 3WYFB 1EVHA 3IVFA 3SYXA 2RLOA 1W1GA 2D9WA 4KVGB 2MWNB 4KHAA 1KI1B 3X23A 3AJ4A 2KGXB 2DFKA 1TXDA 1H10A 3QWMA 1WJ1A 5HE1A 1Q67A 2MFQA 2K2UA 1N3HA 2R0DA 1LB1A 2Q13A 1DROA 3D8DA 2D10A 3TFMA 4Y94A 3ULCA 3KZ1A 1V89A 1ZC3B 1UNPA 2GCJA 4NY0A 1U5GA 2ELAA 5JP4A 1B55A 2CODA 2I5CA 5D3VA 1P5TA 3FSSA 3KSYA 4DBBA 4HAWB 2Y8GA 2IFSA 5D3XA 1Z87A 4WSFA 1NTYA 3GYOA 4XWXA 2DLWA 3FEHA 2L2IA 3TCAA 5C6RA 2DX1A 3N7CA 3HQCA 4GXBA 3ML4A 2HE7A 2P0DA 4A5KA 1AQCA 1DDVA 2IYBA 5JLJB 1U27A 4K17A 4HAZB 2ADZA 4PQ0A 5EFXA 3CXBB 2G35A 1OQNA 1WJMA 1MK7B 1H4RA 1WGQA 3GYPA 1NI2A 2DKPA 3TW1A 3F0WA 2DN6A 3P6AA 2RNRB 2RGNB 2D4QA 3DXDA 5JHHA 3QIJA 2M38A 3PVLA 4TKNA 3UZTA 1I2HA 2DHJA 2NMBA 3FM8C 1UNQA 3PSCA 5KQ1A 2D9YA 1MAIA 2I1KA 4HB4B 4HAUB 2EMSA 1QC6A 2DYQA 1ISNA 1XX0A 1MPHA 2R09A 1BY1A 3SNHA 5FI0A 1PLSA 3VOQA 2MDXA 4GYVA 2J0JA 1F5XA 4HAVB 4MK0A 2CY4A 4YL8A 1M7EA 5LONB 1XKEA 2JP2A 3EO2A 3ODOA 2CY5A 3JV3A 4CHMA 5C79A 2Z0OA 2GCLA 1LW3A 1Y19B 4HB3B 5D27A 2D11A
chains in the Genus database with same CATH superfamily
4EMOA 4CYEA 2KR9A 2W2XC 3DXCA 2P0FA 5DHFB 2Y7BA 2KUQA 2D9XA 2NZ8B 2N23A 4HAXB 4K2PA 4GMXB 4HDQA 1M7RA 4IFSA 1BTKA 4A6FA 2E2XA 3DXEA 5JHGA 2ZKMX 4KHOA 2KR0A 1U5EA 4IOYX 1FHOA 5HE3A 1GC7A 3A8PA 2RRFA 1ZM0A 1AWEA 4DXAB 1KZ7A 1FB8A 3ZVRA 2NBVA 5DIFB 4TYZA 1J0WA 3LJUX 1ZSQA 4P7IA 2GJYA 2GS0A 3OHMB 1MIXA 5C16A 4DIXA 2YRYA 3PEGA 2LOZA 3HW2B 1MKEA 4OSNA 4WJ7A 1UPRA 2CRFA 2DYNA 2CAYA 2VKIA 2Z13A 2UZSA 3O96A 5LG4B 2KIEA 5KCVA 2I1JA 2XQNM 3WA0A 4NSWA 2EMTA 3GF9A 1FGYA 1X1GA 2FJUB 1XODA 4EJNA 1BTNA 1I7AA 1P3RA 5C5BB 2YS5A 4HAYB 2Z4DA 2EJ8A 1DYNA 1SGHA 2X18A 2OQBA 4KAXB 1V61A 2D9ZA 4DX8A 1SHCA 1EGXA 3D8FA 1EAZA 1ZVRA 4HDOA 1OY2A 4GN1A 4HB0B 3ODXA 5FI1A 3RCPA 2VSZA 2Z0QA 1V88A 4MY6A 3U7DA 3ZDTA 4KHBA 1BWNA 1EF1A 2D9VA 2MKRA 1IRSA 3CIKA 3F5RA 1FHWA 3TO1A 2N0YA 1ZC4B 2LULA 3PP2A 2KCJA 1P6SA 2LYDA 2DHKA 2Z59A 3G9WA 3A8QA 3NWFA 5DHAB 2P0HA 2Z14A 2K2JA 3FVCA 2UZRA 1QQGA 3HSAA 4IAPA 5L81A 1X86A 1FHXA 1MIZB 1U5DA 2DKQA 2K8EA 2ROVA 2YT2A 3A58A 1WI1A 4D0NB 3KRWA 4DX90 3VIAA 1DDWA 4C0AA 2J0KA 2H7EA 1XD4A 1K5DB 1X11A 1U2BA 1TJ6A 4B6HA 1FAOA 3AU4A 3HIEA 1NTVA 3PG7A 4K2OA 5CLQB 4Z2NA 4BBKA 2PZ1A 2L1CA 3MDBC 5GOWB 2COFA 1U5FA 4F7HA 3SO6A 4WVFB 1GG3A 3KY9A 4ZRKA 2RSGA 1TQZA 2J59M 1Y5OA 4K81A 4CHJA 1WGUA 1XR0B 4A6KA 3U12A 1RJ2A 5DH9B 2EC1A 3DCXA 2UVMA 5J3QA 5DI9B 3BINA 5C5BA 2YT0A 3A98B 1PMSA 3NW8A 1WG7A 1GC6A 2VRWB 2BCJA 2H7DA 4HHVA 5HE2A 1V5UA 4F7UP 4L1RA 3PZDA 1NU2A 1W1HA 4A6HA 1ZYIA 3T06A 4ZRJA 5LOPB 5KQ4A 4Z2MB 3BJIA 3SUZA 4HATB 4D0OA 5CLLB 2V76A 4H8SA 2OTXA 2YVCA 2FJLA 1DBHA 2DTCA 1X1FA 3D8EA 5HE0A 2GUMA 3P7ZA 1J19A 5J3YA 2W2WA 2YF0A 4HSIA 1PFJA 4GZUA 2AL6A 3V5WA 4HB2B 4L6EA 4YONA 1UNRA 2K00A 3AU5A 2D2QA 1XCGA 2J0MA 3KRXA 2Z0PA 2LOXA 2KIGA 2P8VA 2AEHA 1W1DA 1FOEA 4A6FB 3SV1A 5D3YA 5IRSA 5D3WA 1V5MA 2ELBA 4CSQA 3OANA 4EKUA 4MT7A 4PNKA 2DX5A 2DHIA 3U8ZA 2Y8FA 1KZGA 1RRPB 2LG1A 4GMVA 5I2MA 3MPXA 2YSZA 3TVVA 1MK9B 2QKLA 5J3TA 2COCA 1X05A 2I5FA 3ULBA 1BAKA 1V5PA 1DDMA 3NSUA 1UPQA 1K5GB 2QKMA 2M14A 3M1IB 2RVBB 2ROZB 2YS3A 4GOUA 4ZRIA 5M4YB 2ZPYA 2COAA 3PVWA 1FGZA 2YS1A 1UEFA 2W2XD 3HK0A 2KUPA 1E5WA 2YT1A 3QBVB 4KHBB 1WVHA 1U29A 3PVUA 1OMWA 2RUKB 2HTHB 4D6WA 4F7GA 2DA0A 4GPTB 2LKOA 3ODWA 3WYFB 1EVHA 3IVFA 3SYXA 2RLOA 1W1GA 2D9WA 4KVGB 4OT1A 2MWNB 4KHAA 1KI1B 3B77A 3X23A 3AJ4A 2KGXB 2DFKA 1TXDA 1H10A 3QWMA 1WJ1A 5HE1A 1Q67A 2MFQA 2K2UA 1N3HA 2R0DA 1LB1A 2Q13A 1DROA 3D8DA 2D10A 3TFMA 4Y94A 3ULCA 3KZ1A 1V89A 1ZC3B 1UNPA 2GCJA 4NY0A 1U5GA 2ELAA 5JP4A 1B55A 2CODA 4GNKB 1T77A 2I5CA 5D3VA 1P5TA 3FSSA 3KSYA 4DBBA 4HAWB 2Y8GA 2IFSA 5D3XA 1Z87A 4WSFA 1NTYA 3GYOA 4XWXA 2DLWA 4QJ5B 3FEHA 2L2IA 3TCAA 5C6RA 2DX1A 3N7CA 3HQCA 4GXBA 3ML4A 2HE7A 2P0DA 4A5KA 1AQCA 1DDVA 2IYBA 5JLJB 1U27A 4K17A 4HAZB 2ADZA 4PQ0A 4QJ4B 5EFXA 3CXBB 2G35A 1OQNA 1WJMA 2R2YA 1MK7B 1H4RA 1WGQA 3GYPA 1NI2A 2DKPA 3TW1A 3F0WA 2DN6A 3P6AA 2RNRB 2RGNB 2D4QA 3DXDA 5JHHA 3QIJA 1MI1A 2M38A 3PVLA 4TKNA 3UZTA 1I2HA 2DHJA 3NWAA 2NMBA 3FM8C 1UNQA 3PSCA 5KQ1A 2D9YA 1MAIA 2I1KA 4HB4B 4HAUB 2EMSA 1QC6A 2DYQA 1ISNA 1XX0A 1MPHA 2R09A 1BY1A 3SNHA 5FI0A 1PLSA 2K49A 3VOQA 2MDXA 4GYVA 2J0JA 1F5XA 4HAVB 4MK0A 4QXAB 2CY4A 4YL8A 5I2SA 1M7EA 5LONB 1XKEA 2JP2A 3EO2A 3ODOA 2CY5A 4QJ3B 3JV3A 4CHMA 5C79A 2Z0OA 3NWDA 2GCLA 1LW3A 1Y19B 4HB3B 5D27A 2D11A
chains in the Genus database with same CATH topology
4EMOA 4CYEA 2KR9A 2W2XC 3DXCA 2P0FA 5DHFB 2Y7BA 2D9XA 2NZ8B 2N23A 4HAXB 4K2PA 4GMXB 4HDQA 1M7RA 4IFSA 1BTKA 4A6FA 2E2XA 3DXEA 5JHGA 4KHOA 1U5EA 4IOYX 1FHOA 5HE3A 1GC7A 3A8PA 1ZM0A 1AWEA 4DXAB 1KZ7A 1FB8A 3ZVRA 5DIFB 4TYZA 1J0WA 3LJUX 1ZSQA 4P7IA 2GJYA 2GS0A 1MIXA 5C16A 2YRYA 3PEGA 2LOZA 3HW2B 1MKEA 4WJ7A 1UPRA 2CRFA 2DYNA 2CAYA 2VKIA 2UZSA 3O96A 5KCVA 2I1JA 2XQNM 3WA0A 4NSWA 2EMTA 3GF9A 1FGYA 1X1GA 4EJNA 1XODA 1BTNA 1I7AA 1P3RA 5C5BB 2YS5A 4HAYB 2EJ8A 1DYNA 1SGHA 2X18A 2OQBA 4KAXB 1V61A 2D9ZA 4DX8A 1SHCA 1EGXA 3D8FA 1EAZA 1ZVRA 4HDOA 1OY2A 4GN1A 4HB0B 3ODXA 5FI1A 3RCPA 2VSZA 2Z0QA 1V88A 4MY6A 3U7DA 3ZDTA 1BWNA 1EF1A 2D9VA 2MKRA 1IRSA 3CIKA 3F5RA 1FHWA 3TO1A 2N0YA 1ZC4B 2LULA 3PP2A 2KCJA 1P6SA 2LYDA 2DHKA 3G9WA 3A8QA 5DHAB 2P0HA 2K2JA 2UZRA 1QQGA 4IAPA 5L81A 1X86A 1FHXA 1MIZB 1U5DA 2DKQA 2ROVA 1WI1A 4D0NB 3KRWA 4DX90 3VIAA 1DDWA 4C0AA 2J0KA 2H7EA 1XD4A 1K5DB 1X11A 1U2BA 1TJ6A 4B6HA 1FAOA 3AU4A 1NTVA 3PG7A 4K2OA 5CLQB 4Z2NA 4BBKA 2PZ1A 2L1CA 3MDBC 5GOWB 2COFA 1U5FA 4F7HA 3SO6A 4WVFB 1GG3A 3KY9A 4ZRKA 2RSGA 1TQZA 2J59M 1Y5OA 4K81A 4CHJA 1WGUA 1XR0B 4A6KA 1RJ2A 5DH9B 2EC1A 2UVMA 5J3QA 5DI9B 3BINA 5C5BA 2YT0A 3A98B 1PMSA 1WG7A 1GC6A 2VRWB 2BCJA 2H7DA 4HHVA 5HE2A 1V5UA 4F7UP 3PZDA 1NU2A 1W1HA 4A6HA 3T06A 4ZRJA 5LOPB 5KQ4A 4Z2MB 3BJIA 3SUZA 4HATB 4D0OA 5CLLB 2V76A 4H8SA 2OTXA 2YVCA 2FJLA 1DBHA 2DTCA 1X1FA 3D8EA 5HE0A 3P7ZA 1J19A 5J3YA 2W2WA 2YF0A 1PFJA 4GZUA 2AL6A 3V5WA 4HB2B 4L6EA 4YONA 1UNRA 2K00A 3AU5A 2D2QA 1XCGA 2J0MA 3KRXA 2Z0PA 2LOXA 2P8VA 2AEHA 1W1DA 1FOEA 4A6FB 3SV1A 5D3YA 5D3WA 1V5MA 2ELBA 3OANA 4EKUA 4MT7A 4PNKA 2DX5A 2DHIA 3U8ZA 2Y8FA 1KZGA 1RRPB 2LG1A 4GMVA 3MPXA 2YSZA 3TVVA 1MK9B 2QKLA 5J3TA 2COCA 1X05A 2I5FA 3ULBA 1BAKA 1V5PA 1DDMA 3NSUA 1UPQA 1K5GB 2QKMA 2M14A 3M1IB 2RVBB 2ROZB 2YS3A 4GOUA 4ZRIA 2ZPYA 2COAA 3PVWA 1FGZA 2YS1A 1UEFA 2W2XD 3HK0A 2KUPA 1E5WA 2YT1A 3QBVB 4KHBB 1WVHA 1U29A 3PVUA 1OMWA 2RUKB 2HTHB 4F7GA 2DA0A 4GPTB 2LKOA 3ODWA 3WYFB 1EVHA 3IVFA 3SYXA 2RLOA 1W1GA 2D9WA 4KVGB 2MWNB 4KHAA 1KI1B 3X23A 3AJ4A 2KGXB 2DFKA 1TXDA 1H10A 3QWMA 1WJ1A 5HE1A 1Q67A 2MFQA 2K2UA 1N3HA 2R0DA 1LB1A 2Q13A 1DROA 3D8DA 2D10A 3TFMA 4Y94A 3ULCA 3KZ1A 1V89A 1ZC3B 1UNPA 2GCJA 4NY0A 1U5GA 2ELAA 5JP4A 1B55A 2CODA 2I5CA 5D3VA 1P5TA 3FSSA 3KSYA 4DBBA 4HAWB 2Y8GA 2IFSA 5D3XA 1Z87A 4WSFA 1NTYA 3GYOA 4XWXA 2DLWA 3FEHA 2L2IA 3TCAA 5C6RA 2DX1A 3N7CA 3HQCA 4GXBA 3ML4A 2HE7A 2P0DA 4A5KA 1AQCA 1DDVA 2IYBA 5JLJB 1U27A 4K17A 4HAZB 2ADZA 4PQ0A 5EFXA 3CXBB 2G35A 1OQNA 1WJMA 1MK7B 1H4RA 1WGQA 3GYPA 1NI2A 2DKPA 3TW1A 3F0WA 2DN6A 3P6AA 2RNRB 2RGNB 2D4QA 3DXDA 5JHHA 3QIJA 2M38A 3PVLA 4TKNA 3UZTA 1I2HA 2DHJA 2NMBA 3FM8C 1UNQA 3PSCA 5KQ1A 2D9YA 1MAIA 2I1KA 4HB4B 4HAUB 2EMSA 1QC6A 2DYQA 1ISNA 1XX0A 1MPHA 2R09A 1BY1A 3SNHA 5FI0A 1PLSA 3VOQA 2MDXA 4GYVA 2J0JA 1F5XA 4HAVB 4MK0A 2CY4A 4YL8A 1M7EA 5LONB 1XKEA 2JP2A 3EO2A 3ODOA 2CY5A 3JV3A 4CHMA 5C79A 2Z0OA 2GCLA 1LW3A 1Y19B 4HB3B 5D27A 2D11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMO A;  4CYE A;  2KR9 A;  2W2X C;  3DXC A;  2P0F A;  5DHF B;  2Y7B A;  2D9X A;  2NZ8 B;  2N23 A;  4HAX B;  4K2P A;  4GMX B;  4HDQ A;  1M7R A;  4IFS A;  1BTK A;  4A6F A;  2E2X A;  3DXE A;  5JHG A;  4KHO A;  1U5E A;  4IOY X;  1FHO A;  5HE3 A;  1GC7 A;  3A8P A;  1ZM0 A;  1AWE A;  4DXA B;  1KZ7 A;  1FB8 A;  3ZVR A;  5DIF B;  4TYZ A;  1J0W A;  3LJU X;  1ZSQ A;  4P7I A;  2GJY A;  2GS0 A;  1MIX A;  5C16 A;  2YRY A;  3PEG A;  2LOZ A;  3HW2 B;  1MKE A;  4WJ7 A;  1UPR A;  2CRF A;  2DYN A;  2CAY A;  2VKI A;  2UZS A;  3O96 A;  5KCV A;  2I1J A;  2XQN M;  3WA0 A;  4NSW A;  2EMT A;  3GF9 A;  1FGY A;  1X1G A;  4EJN A;  1XOD A;  1BTN A;  1I7A A;  1P3R A;  5C5B B;  2YS5 A;  4HAY B;  2EJ8 A;  1DYN A;  1SGH A;  2X18 A;  2OQB A;  4KAX B;  1V61 A;  2D9Z A;  4DX8 A;  1SHC A;  1EGX A;  3D8F A;  1EAZ A;  1ZVR A;  4HDO A;  1OY2 A;  4GN1 A;  4HB0 B;  3ODX A;  5FI1 A;  3RCP A;  2VSZ A;  2Z0Q A;  1V88 A;  4MY6 A;  3U7D A;  3ZDT A;  1BWN A;  1EF1 A;  2D9V A;  2MKR A;  1IRS A;  3CIK A;  3F5R A;  1FHW A;  3TO1 A;  2N0Y A;  1ZC4 B;  2LUL A;  3PP2 A;  2KCJ A;  1P6S A;  2LYD A;  2DHK A;  3G9W A;  3A8Q A;  5DHA B;  2P0H A;  2K2J A;  2UZR A;  1QQG A;  4IAP A;  5L81 A;  1X86 A;  1FHX A;  1MIZ B;  1U5D A;  2DKQ A;  2ROV A;  1WI1 A;  4D0N B;  3KRW A;  4DX9 0;  3VIA A;  1DDW A;  4C0A A;  2J0K A;  2H7E A;  1XD4 A;  1K5D B;  1X11 A;  1U2B A;  1TJ6 A;  4B6H A;  1FAO A;  3AU4 A;  1NTV A;  3PG7 A;  4K2O A;  5CLQ B;  4Z2N A;  4BBK A;  2PZ1 A;  2L1C A;  3MDB C;  5GOW B;  2COF A;  1U5F A;  4F7H A;  3SO6 A;  4WVF B;  1GG3 A;  3KY9 A;  4ZRK A;  2RSG A;  1TQZ A;  2J59 M;  1Y5O A;  4K81 A;  4CHJ A;  1WGU A;  1XR0 B;  4A6K A;  1RJ2 A;  5DH9 B;  2EC1 A;  2UVM A;  5J3Q A;  5DI9 B;  3BIN A;  5C5B A;  2YT0 A;  3A98 B;  1PMS A;  1WG7 A;  1GC6 A;  2VRW B;  2BCJ A;  2H7D A;  4HHV A;  5HE2 A;  1V5U A;  4F7U P;  3PZD A;  1NU2 A;  1W1H A;  4A6H A;  3T06 A;  4ZRJ A;  5LOP B;  5KQ4 A;  4Z2M B;  3BJI A;  3SUZ A;  4HAT B;  4D0O A;  5CLL B;  2V76 A;  4H8S A;  2OTX A;  2YVC A;  2FJL A;  1DBH A;  2DTC A;  1X1F A;  3D8E A;  5HE0 A;  3P7Z A;  1J19 A;  5J3Y A;  2W2W A;  2YF0 A;  1PFJ A;  4GZU A;  2AL6 A;  3V5W A;  4HB2 B;  4L6E A;  4YON A;  1UNR A;  2K00 A;  3AU5 A;  2D2Q A;  1XCG A;  2J0M A;  3KRX A;  2Z0P A;  2LOX A;  2P8V A;  2AEH A;  1W1D A;  1FOE A;  4A6F B;  3SV1 A;  5D3Y A;  5D3W A;  1V5M A;  2ELB A;  3OAN A;  4EKU A;  4MT7 A;  4PNK A;  2DX5 A;  2DHI A;  3U8Z A;  2Y8F A;  1KZG A;  1RRP B;  2LG1 A;  4GMV A;  3MPX A;  2YSZ A;  3TVV A;  1MK9 B;  2QKL A;  5J3T A;  2COC A;  1X05 A;  2I5F A;  3ULB A;  1BAK A;  1V5P A;  1DDM A;  3NSU A;  1UPQ A;  1K5G B;  2QKM A;  2M14 A;  3M1I B;  2RVB B;  2ROZ B;  2YS3 A;  4GOU A;  4ZRI A;  2ZPY A;  2COA A;  3PVW A;  1FGZ A;  2YS1 A;  1UEF A;  2W2X D;  3HK0 A;  2KUP A;  1E5W A;  2YT1 A;  3QBV B;  4KHB B;  1WVH A;  1U29 A;  3PVU A;  1OMW A;  2RUK B;  2HTH B;  4F7G A;  2DA0 A;  4GPT B;  2LKO A;  3ODW A;  3WYF B;  1EVH A;  3IVF A;  3SYX A;  2RLO A;  1W1G A;  2D9W A;  4KVG B;  2MWN B;  4KHA A;  1KI1 B;  3X23 A;  3AJ4 A;  2KGX B;  2DFK A;  1TXD A;  1H10 A;  3QWM A;  1WJ1 A;  5HE1 A;  1Q67 A;  2MFQ A;  2K2U A;  1N3H A;  2R0D A;  1LB1 A;  2Q13 A;  1DRO A;  3D8D A;  2D10 A;  3TFM A;  4Y94 A;  3ULC A;  3KZ1 A;  1V89 A;  1ZC3 B;  1UNP A;  2GCJ A;  4NY0 A;  1U5G A;  2ELA A;  5JP4 A;  1B55 A;  2COD A;  2I5C A;  5D3V A;  1P5T A;  3FSS A;  3KSY A;  4DBB A;  4HAW B;  2Y8G A;  2IFS A;  5D3X A;  1Z87 A;  4WSF A;  1NTY A;  3GYO A;  4XWX A;  2DLW A;  3FEH A;  2L2I A;  3TCA A;  5C6R A;  2DX1 A;  3N7C A;  3HQC A;  4GXB A;  3ML4 A;  2HE7 A;  2P0D A;  4A5K A;  1AQC A;  1DDV A;  2IYB A;  5JLJ B;  1U27 A;  4K17 A;  4HAZ B;  2ADZ A;  4PQ0 A;  5EFX A;  3CXB B;  2G35 A;  1OQN A;  1WJM A;  1MK7 B;  1H4R A;  1WGQ A;  3GYP A;  1NI2 A;  2DKP A;  3TW1 A;  3F0W A;  2DN6 A;  3P6A A;  2RNR B;  2RGN B;  2D4Q A;  3DXD A;  5JHH A;  3QIJ A;  2M38 A;  3PVL A;  4TKN A;  3UZT A;  1I2H A;  2DHJ A;  2NMB A;  3FM8 C;  1UNQ A;  3PSC A;  5KQ1 A;  2D9Y A;  1MAI A;  2I1K A;  4HB4 B;  4HAU B;  2EMS A;  1QC6 A;  2DYQ A;  1ISN A;  1XX0 A;  1MPH A;  2R09 A;  1BY1 A;  3SNH A;  5FI0 A;  1PLS A;  3VOQ A;  2MDX A;  4GYV A;  2J0J A;  1F5X A;  4HAV B;  4MK0 A;  2CY4 A;  4YL8 A;  1M7E A;  5LON B;  1XKE A;  2JP2 A;  3EO2 A;  3ODO A;  2CY5 A;  3JV3 A;  4CHM A;  5C79 A;  2Z0O A;  2GCL A;  1LW3 A;  1Y19 B;  4HB3 B;  5D27 A;  2D11 A; 
#chains in the Genus database with same CATH topology
 4EMO A;  4CYE A;  2KR9 A;  2W2X C;  3DXC A;  2P0F A;  5DHF B;  2Y7B A;  2KUQ A;  2D9X A;  2NZ8 B;  2N23 A;  4HAX B;  4K2P A;  4GMX B;  4HDQ A;  1M7R A;  4IFS A;  1BTK A;  4A6F A;  2E2X A;  3DXE A;  5JHG A;  2ZKM X;  4KHO A;  2KR0 A;  1U5E A;  4IOY X;  1FHO A;  5HE3 A;  1GC7 A;  3A8P A;  2RRF A;  1ZM0 A;  1AWE A;  4DXA B;  1KZ7 A;  1FB8 A;  3ZVR A;  2NBV A;  5DIF B;  4TYZ A;  1J0W A;  3LJU X;  1ZSQ A;  4P7I A;  2GJY A;  2GS0 A;  3OHM B;  1MIX A;  5C16 A;  4DIX A;  2YRY A;  3PEG A;  2LOZ A;  3HW2 B;  1MKE A;  4OSN A;  4WJ7 A;  1UPR A;  2CRF A;  2DYN A;  2CAY A;  2VKI A;  2Z13 A;  2UZS A;  3O96 A;  5LG4 B;  2KIE A;  5KCV A;  2I1J A;  2XQN M;  3WA0 A;  4NSW A;  2EMT A;  3GF9 A;  1FGY A;  1X1G A;  2FJU B;  1XOD A;  4EJN A;  1BTN A;  1I7A A;  1P3R A;  5C5B B;  2YS5 A;  4HAY B;  2Z4D A;  2EJ8 A;  1DYN A;  1SGH A;  2X18 A;  2OQB A;  4KAX B;  1V61 A;  2D9Z A;  4DX8 A;  1SHC A;  1EGX A;  3D8F A;  1EAZ A;  1ZVR A;  4HDO A;  1OY2 A;  4GN1 A;  4HB0 B;  3ODX A;  5FI1 A;  3RCP A;  2VSZ A;  2Z0Q A;  1V88 A;  4MY6 A;  3U7D A;  3ZDT A;  4KHB A;  1BWN A;  1EF1 A;  2D9V A;  2MKR A;  1IRS A;  3CIK A;  3F5R A;  1FHW A;  3TO1 A;  2N0Y A;  1ZC4 B;  2LUL A;  3PP2 A;  2KCJ A;  1P6S A;  2LYD A;  2DHK A;  2Z59 A;  3G9W A;  3A8Q A;  3NWF A;  5DHA B;  2P0H A;  2Z14 A;  2K2J A;  3FVC A;  2UZR A;  1QQG A;  3HSA A;  4IAP A;  5L81 A;  1X86 A;  1FHX A;  1MIZ B;  1U5D A;  2DKQ A;  2K8E A;  2ROV A;  2YT2 A;  3A58 A;  1WI1 A;  4D0N B;  3KRW A;  4DX9 0;  3VIA A;  1DDW A;  4C0A A;  2J0K A;  2H7E A;  1XD4 A;  1K5D B;  1X11 A;  1U2B A;  1TJ6 A;  4B6H A;  1FAO A;  3AU4 A;  3HIE A;  1NTV A;  3PG7 A;  4K2O A;  5CLQ B;  4Z2N A;  4BBK A;  2PZ1 A;  2L1C A;  3MDB C;  5GOW B;  2COF A;  1U5F A;  4F7H A;  3SO6 A;  4WVF B;  1GG3 A;  3KY9 A;  4ZRK A;  2RSG A;  1TQZ A;  2J59 M;  1Y5O A;  4K81 A;  4CHJ A;  1WGU A;  1XR0 B;  4A6K A;  3U12 A;  1RJ2 A;  5DH9 B;  2EC1 A;  3DCX A;  2UVM A;  5J3Q A;  5DI9 B;  3BIN A;  5C5B A;  2YT0 A;  3A98 B;  1PMS A;  3NW8 A;  1WG7 A;  1GC6 A;  2VRW B;  2BCJ A;  2H7D A;  4HHV A;  5HE2 A;  1V5U A;  4F7U P;  4L1R A;  3PZD A;  1NU2 A;  1W1H A;  4A6H A;  1ZYI A;  3T06 A;  4ZRJ A;  5LOP B;  5KQ4 A;  4Z2M B;  3BJI A;  3SUZ A;  4HAT B;  4D0O A;  5CLL B;  2V76 A;  4H8S A;  2OTX A;  2YVC A;  2FJL A;  1DBH A;  2DTC A;  1X1F A;  3D8E A;  5HE0 A;  2GUM A;  3P7Z A;  1J19 A;  5J3Y A;  2W2W A;  2YF0 A;  4HSI A;  1PFJ A;  4GZU A;  2AL6 A;  3V5W A;  4HB2 B;  4L6E A;  4YON A;  1UNR A;  2K00 A;  3AU5 A;  2D2Q A;  1XCG A;  2J0M A;  3KRX A;  2Z0P A;  2LOX A;  2KIG A;  2P8V A;  2AEH A;  1W1D A;  1FOE A;  4A6F B;  3SV1 A;  5D3Y A;  5IRS A;  5D3W A;  1V5M A;  2ELB A;  4CSQ A;  3OAN A;  4EKU A;  4MT7 A;  4PNK A;  2DX5 A;  2DHI A;  3U8Z A;  2Y8F A;  1KZG A;  1RRP B;  2LG1 A;  4GMV A;  5I2M A;  3MPX A;  2YSZ A;  3TVV A;  1MK9 B;  2QKL A;  5J3T A;  2COC A;  1X05 A;  2I5F A;  3ULB A;  1BAK A;  1V5P A;  1DDM A;  3NSU A;  1UPQ A;  1K5G B;  2QKM A;  2M14 A;  3M1I B;  2RVB B;  2ROZ B;  2YS3 A;  4GOU A;  4ZRI A;  5M4Y B;  2ZPY A;  2COA A;  3PVW A;  1FGZ A;  2YS1 A;  1UEF A;  2W2X D;  3HK0 A;  2KUP A;  1E5W A;  2YT1 A;  3QBV B;  4KHB B;  1WVH A;  1U29 A;  3PVU A;  1OMW A;  2RUK B;  2HTH B;  4D6W A;  4F7G A;  2DA0 A;  4GPT B;  2LKO A;  3ODW A;  3WYF B;  1EVH A;  3IVF A;  3SYX A;  2RLO A;  1W1G A;  2D9W A;  4KVG B;  4OT1 A;  2MWN B;  4KHA A;  1KI1 B;  3B77 A;  3X23 A;  3AJ4 A;  2KGX B;  2DFK A;  1TXD A;  1H10 A;  3QWM A;  1WJ1 A;  5HE1 A;  1Q67 A;  2MFQ A;  2K2U A;  1N3H A;  2R0D A;  1LB1 A;  2Q13 A;  1DRO A;  3D8D A;  2D10 A;  3TFM A;  4Y94 A;  3ULC A;  3KZ1 A;  1V89 A;  1ZC3 B;  1UNP A;  2GCJ A;  4NY0 A;  1U5G A;  2ELA A;  5JP4 A;  1B55 A;  2COD A;  4GNK B;  1T77 A;  2I5C A;  5D3V A;  1P5T A;  3FSS A;  3KSY A;  4DBB A;  4HAW B;  2Y8G A;  2IFS A;  5D3X A;  1Z87 A;  4WSF A;  1NTY A;  3GYO A;  4XWX A;  2DLW A;  4QJ5 B;  3FEH A;  2L2I A;  3TCA A;  5C6R A;  2DX1 A;  3N7C A;  3HQC A;  4GXB A;  3ML4 A;  2HE7 A;  2P0D A;  4A5K A;  1AQC A;  1DDV A;  2IYB A;  5JLJ B;  1U27 A;  4K17 A;  4HAZ B;  2ADZ A;  4PQ0 A;  4QJ4 B;  5EFX A;  3CXB B;  2G35 A;  1OQN A;  1WJM A;  2R2Y A;  1MK7 B;  1H4R A;  1WGQ A;  3GYP A;  1NI2 A;  2DKP A;  3TW1 A;  3F0W A;  2DN6 A;  3P6A A;  2RNR B;  2RGN B;  2D4Q A;  3DXD A;  5JHH A;  3QIJ A;  1MI1 A;  2M38 A;  3PVL A;  4TKN A;  3UZT A;  1I2H A;  2DHJ A;  3NWA A;  2NMB A;  3FM8 C;  1UNQ A;  3PSC A;  5KQ1 A;  2D9Y A;  1MAI A;  2I1K A;  4HB4 B;  4HAU B;  2EMS A;  1QC6 A;  2DYQ A;  1ISN A;  1XX0 A;  1MPH A;  2R09 A;  1BY1 A;  3SNH A;  5FI0 A;  1PLS A;  2K49 A;  3VOQ A;  2MDX A;  4GYV A;  2J0J A;  1F5X A;  4HAV B;  4MK0 A;  4QXA B;  2CY4 A;  4YL8 A;  5I2S A;  1M7E A;  5LON B;  1XKE A;  2JP2 A;  3EO2 A;  3ODO A;  2CY5 A;  4QJ3 B;  3JV3 A;  4CHM A;  5C79 A;  2Z0O A;  3NWD A;  2GCL A;  1LW3 A;  1Y19 B;  4HB3 B;  5D27 A;  2D11 A; 
#chains in the Genus database with same CATH homology
 4EMO A;  4CYE A;  2KR9 A;  2W2X C;  3DXC A;  2P0F A;  5DHF B;  2Y7B A;  2D9X A;  2NZ8 B;  2N23 A;  4HAX B;  4K2P A;  4GMX B;  4HDQ A;  1M7R A;  4IFS A;  1BTK A;  4A6F A;  2E2X A;  3DXE A;  5JHG A;  4KHO A;  1U5E A;  4IOY X;  1FHO A;  5HE3 A;  1GC7 A;  3A8P A;  1ZM0 A;  1AWE A;  4DXA B;  1KZ7 A;  1FB8 A;  3ZVR A;  5DIF B;  4TYZ A;  1J0W A;  3LJU X;  1ZSQ A;  4P7I A;  2GJY A;  2GS0 A;  1MIX A;  5C16 A;  2YRY A;  3PEG A;  2LOZ A;  3HW2 B;  1MKE A;  4WJ7 A;  1UPR A;  2CRF A;  2DYN A;  2CAY A;  2VKI A;  2UZS A;  3O96 A;  5KCV A;  2I1J A;  2XQN M;  3WA0 A;  4NSW A;  2EMT A;  3GF9 A;  1FGY A;  1X1G A;  4EJN A;  1XOD A;  1BTN A;  1I7A A;  1P3R A;  5C5B B;  2YS5 A;  4HAY B;  2EJ8 A;  1DYN A;  1SGH A;  2X18 A;  2OQB A;  4KAX B;  1V61 A;  2D9Z A;  4DX8 A;  1SHC A;  1EGX A;  3D8F A;  1EAZ A;  1ZVR A;  4HDO A;  1OY2 A;  4GN1 A;  4HB0 B;  3ODX A;  5FI1 A;  3RCP A;  2VSZ A;  2Z0Q A;  1V88 A;  4MY6 A;  3U7D A;  3ZDT A;  1BWN A;  1EF1 A;  2D9V A;  2MKR A;  1IRS A;  3CIK A;  3F5R A;  1FHW A;  3TO1 A;  2N0Y A;  1ZC4 B;  2LUL A;  3PP2 A;  2KCJ A;  1P6S A;  2LYD A;  2DHK A;  3G9W A;  3A8Q A;  5DHA B;  2P0H A;  2K2J A;  2UZR A;  1QQG A;  4IAP A;  5L81 A;  1X86 A;  1FHX A;  1MIZ B;  1U5D A;  2DKQ A;  2ROV A;  1WI1 A;  4D0N B;  3KRW A;  4DX9 0;  3VIA A;  1DDW A;  4C0A A;  2J0K A;  2H7E A;  1XD4 A;  1K5D B;  1X11 A;  1U2B A;  1TJ6 A;  4B6H A;  1FAO A;  3AU4 A;  1NTV A;  3PG7 A;  4K2O A;  5CLQ B;  4Z2N A;  4BBK A;  2PZ1 A;  2L1C A;  3MDB C;  5GOW B;  2COF A;  1U5F A;  4F7H A;  3SO6 A;  4WVF B;  1GG3 A;  3KY9 A;  4ZRK A;  2RSG A;  1TQZ A;  2J59 M;  1Y5O A;  4K81 A;  4CHJ A;  1WGU A;  1XR0 B;  4A6K A;  1RJ2 A;  5DH9 B;  2EC1 A;  2UVM A;  5J3Q A;  5DI9 B;  3BIN A;  5C5B A;  2YT0 A;  3A98 B;  1PMS A;  1WG7 A;  1GC6 A;  2VRW B;  2BCJ A;  2H7D A;  4HHV A;  5HE2 A;  1V5U A;  4F7U P;  3PZD A;  1NU2 A;  1W1H A;  4A6H A;  3T06 A;  4ZRJ A;  5LOP B;  5KQ4 A;  4Z2M B;  3BJI A;  3SUZ A;  4HAT B;  4D0O A;  5CLL B;  2V76 A;  4H8S A;  2OTX A;  2YVC A;  2FJL A;  1DBH A;  2DTC A;  1X1F A;  3D8E A;  5HE0 A;  3P7Z A;  1J19 A;  5J3Y A;  2W2W A;  2YF0 A;  1PFJ A;  4GZU A;  2AL6 A;  3V5W A;  4HB2 B;  4L6E A;  4YON A;  1UNR A;  2K00 A;  3AU5 A;  2D2Q A;  1XCG A;  2J0M A;  3KRX A;  2Z0P A;  2LOX A;  2P8V A;  2AEH A;  1W1D A;  1FOE A;  4A6F B;  3SV1 A;  5D3Y A;  5D3W A;  1V5M A;  2ELB A;  3OAN A;  4EKU A;  4MT7 A;  4PNK A;  2DX5 A;  2DHI A;  3U8Z A;  2Y8F A;  1KZG A;  1RRP B;  2LG1 A;  4GMV A;  3MPX A;  2YSZ A;  3TVV A;  1MK9 B;  2QKL A;  5J3T A;  2COC A;  1X05 A;  2I5F A;  3ULB A;  1BAK A;  1V5P A;  1DDM A;  3NSU A;  1UPQ A;  1K5G B;  2QKM A;  2M14 A;  3M1I B;  2RVB B;  2ROZ B;  2YS3 A;  4GOU A;  4ZRI A;  2ZPY A;  2COA A;  3PVW A;  1FGZ A;  2YS1 A;  1UEF A;  2W2X D;  3HK0 A;  2KUP A;  1E5W A;  2YT1 A;  3QBV B;  4KHB B;  1WVH A;  1U29 A;  3PVU A;  1OMW A;  2RUK B;  2HTH B;  4F7G A;  2DA0 A;  4GPT B;  2LKO A;  3ODW A;  3WYF B;  1EVH A;  3IVF A;  3SYX A;  2RLO A;  1W1G A;  2D9W A;  4KVG B;  2MWN B;  4KHA A;  1KI1 B;  3X23 A;  3AJ4 A;  2KGX B;  2DFK A;  1TXD A;  1H10 A;  3QWM A;  1WJ1 A;  5HE1 A;  1Q67 A;  2MFQ A;  2K2U A;  1N3H A;  2R0D A;  1LB1 A;  2Q13 A;  1DRO A;  3D8D A;  2D10 A;  3TFM A;  4Y94 A;  3ULC A;  3KZ1 A;  1V89 A;  1ZC3 B;  1UNP A;  2GCJ A;  4NY0 A;  1U5G A;  2ELA A;  5JP4 A;  1B55 A;  2COD A;  2I5C A;  5D3V A;  1P5T A;  3FSS A;  3KSY A;  4DBB A;  4HAW B;  2Y8G A;  2IFS A;  5D3X A;  1Z87 A;  4WSF A;  1NTY A;  3GYO A;  4XWX A;  2DLW A;  3FEH A;  2L2I A;  3TCA A;  5C6R A;  2DX1 A;  3N7C A;  3HQC A;  4GXB A;  3ML4 A;  2HE7 A;  2P0D A;  4A5K A;  1AQC A;  1DDV A;  2IYB A;  5JLJ B;  1U27 A;  4K17 A;  4HAZ B;  2ADZ A;  4PQ0 A;  5EFX A;  3CXB B;  2G35 A;  1OQN A;  1WJM A;  1MK7 B;  1H4R A;  1WGQ A;  3GYP A;  1NI2 A;  2DKP A;  3TW1 A;  3F0W A;  2DN6 A;  3P6A A;  2RNR B;  2RGN B;  2D4Q A;  3DXD A;  5JHH A;  3QIJ A;  2M38 A;  3PVL A;  4TKN A;  3UZT A;  1I2H A;  2DHJ A;  2NMB A;  3FM8 C;  1UNQ A;  3PSC A;  5KQ1 A;  2D9Y A;  1MAI A;  2I1K A;  4HB4 B;  4HAU B;  2EMS A;  1QC6 A;  2DYQ A;  1ISN A;  1XX0 A;  1MPH A;  2R09 A;  1BY1 A;  3SNH A;  5FI0 A;  1PLS A;  3VOQ A;  2MDX A;  4GYV A;  2J0J A;  1F5X A;  4HAV B;  4MK0 A;  2CY4 A;  4YL8 A;  1M7E A;  5LON B;  1XKE A;  2JP2 A;  3EO2 A;  3ODO A;  2CY5 A;  3JV3 A;  4CHM A;  5C79 A;  2Z0O A;  2GCL A;  1LW3 A;  1Y19 B;  4HB3 B;  5D27 A;  2D11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...