3P6AA

Crystal structure of the dh/ph domains of p115-rhogef (r399e mutant)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
355
structure length
344
Chain Sequence
PKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 1
total genus 128
structure length 344
sequence length 355
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3p6aA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3p6aA02
1WG7A 4K2OA 4Z2MB 1XR0B 4CHJA 1V5UA 1SHCA 5J3QA 1FGZA 4B6HA 2D9ZA 3PG7A 2K2UA 2DYNA 2EMTA 1P5TA 3AJ4A 2ZPYA 1BAKA 2RUKB 4WJ7A 3V5WA 1GC6A 3N7CA 2ROVA 3WA0A 2LYDA 2H7EA 2MFQA 2EJ8A 1U5FA 3A98B 2XQNM 5KQ1A 4HB2B 2K00A 5DH9B 5JHHA 5EFXA 1PMSA 3X23A 2OQBA 3HK0A 3ML4A 2RSGA 1MAIA 5DIFB 2D11A 2GCLA 2D9YA 2OTXA 2DKPA 2NMBA 1EVHA 1N3HA 4YONA 3A8PA 3KRXA 5GOWB 1X11A 4CHMA 3AU5A 2CY4A 2I5FA 5FI1A 1OY2A 2DTCA 3TVVA 1PFJA 1FHXA 2DN6A 1K5GB 3FEHA 5D3WA 1WJ1A 4H8SA 1UPQA 5HE2A 3ULCA 3ODXA 1FOEA 1MPHA 1ZC3B 2DHJA 3ULBA 4P7IA 5KCVA 2FJLA 5DHAB 1J19A 5D3VA 5LOPB 4HAVB 4F7GA 5JHGA 1WGUA 1ISNA 4WVFB 3SNHA 3PZDA 1U2BA 2Z0OA 3HW2B 1XKEA 4HATB 1K5DB 1X1FA 5C79A 2GS0A 2Y7BA 2RNRB 1KI1B 2LG1A 2YT0A 2I1KA 4DBBA 3RCPA 3OANA 3PVUA 3P6AA 2CRFA 2LKOA 1UNPA 4WSFA 2LULA 4ZRKA 4HDOA 2W2WA 2IFSA 1P3RA 4PQ0A 4PNKA 4HAUB 1NTYA 3SUZA 5KQ4A 3EO2A 4GMVA 2N23A 2YS3A 1EGXA 1NU2A 1Z87A 3TFMA 2DHIA 4A6FB 2DX1A 3A8QA 4KHBB 2MDXA 1NI2A 3D8FA 1PLSA 4IFSA 2VKIA 2UZSA 2EMSA 2J0KA 1U27A 4YL8A 4TKNA 1MIXA 2J59M 2UZRA 4HB4B 3QBVB 1LB1A 1OMWA 3ODWA 2L1CA 2P8VA 4K17A 1FB8A 2P0HA 4NY0A 5JLJB 1UNRA 1UPRA 4HAZB 2Q13A 1Y5OA 3U8ZA 4XWXA 2YT1A 1ZSQA 4KHOA 2P0FA 1W1HA 3G9WA 3KZ1A 2AL6A 5C6RA 4A6KA 4GZUA 3GYPA 4D0NB 4Z2NA 1TXDA 5HE3A 1IRSA 4Y94A 2DKQA 1AWEA 1XCGA 4L6EA 2QKMA 1MK7B 2DHKA 2UVMA 2P0DA 4A6FA 1AQCA 4GPTB 3DXDA 3SYXA 3CIKA 4NSWA 3MPXA 5C16A 4EKUA 1V89A 1ZC4B 4K2PA 5L81A 2CY5A 1KZ7A 1I7AA 3ODOA 4HB0B 2RVBB 2G35A 4D0OA 3TO1A 2QKLA 1GC7A 1DYNA 5D3XA 3PEGA 1EF1A 2Y8GA 1I2HA 2N0YA 1DROA 1F5XA 3P7ZA 2HE7A 4HHVA 2VSZA 3HQCA 4GYVA 3M1IB 3PP2A 5D3YA 1P6SA 2COAA 2BCJA 1V61A 5J3YA 3ZDTA 4HAYB 1DDWA 4GXBA 1U5GA 3SO6A 2I1JA 2L2IA 3JV3A 1RRPB 1QC6A 3PVWA 2Z0QA 5DI9B 2VRWB 2ELBA 2COCA 2AEHA 4TYZA 2RGNB 1BY1A 1MIZB 2KGXB 4ZRIA 2DFKA 4C0AA 4F7HA 4DXAB 4MT7A 2D9VA 1SGHA 1B55A 2ROZB 1KZGA 1FHWA 4IOYX 2YVCA 2R09A 4ZRJA 2D4QA 2D9XA 4A6HA 2W2XC 3KSYA 1EAZA 2CAYA 3LJUX 4KVGB 1E5WA 1XX0A 2RLOA 4BBKA 4K81A 2KR9A 1XD4A 3VOQA 2X18A 4DX8A 1WVHA 3GF9A 3FM8C 1OQNA 2YS5A 3VIAA 2GCJA 1W1GA 2MKRA 3BINA 2DA0A 1DDVA 3D8DA 1Y19B 1V5PA 3QWMA 5LONB 5FI0A 1DDMA 4DX90 4A5KA 3GYOA 1BTNA 2J0JA 2Y8FA 5HE1A 1W1DA 2COFA 2V76A 5CLQB 3SV1A 5HE0A 1LW3A 3TCAA 2MWNB 1WI1A 1V88A 1MK9B 2J0MA 3AU4A 3O96A 2PZ1A 1MKEA 1WGQA 2R0DA 1TQZA 2D2QA 2JP2A 2Z0PA 3WYFB 3QIJA 3DXEA 2D10A 5J3TA 1QQGA 2YS1A 4EJNA 1FHOA 2LOXA 1X86A 3BJIA 5C5BB 1ZM0A 1GG3A 2YRYA 3PSCA 5CLLB 1H4RA 1U5EA 2D9WA 1ZVRA 4KAXB 4HDQA 2DYQA 1UNQA 2K2JA 3T06A 1M7EA 5C5BA 5DHFB 4HB3B 2I5CA 4HAWB 2IYBA 3ZVRA 2NZ8B 3KRWA 3NSUA 3PVLA 4CYEA 2W2XD 1Q67A 1TJ6A 1M7RA 3IVFA 1RJ2A 2LOZA 3F0WA 3CXBB 3UZTA 1BWNA 3DXCA 1H10A 1BTKA 1NTVA 4GMXB 1WJMA 2DLWA 4GOUA 2YF0A 2HTHB 4MK0A 2CODA 4HAXB 2DX5A 1FGYA 3D8EA 4F7UP 4KHAA 3FSSA 2E2XA 2KUPA 4EMOA 1J0WA 3TW1A 1UEFA 3U7DA 1U29A 4GN1A 3F5RA 2M38A 1DBHA 1V5MA 2YSZA 5D27A 1U5DA 2ELAA 1FAOA 1XODA 2H7DA 3MDBC 4IAPA 4MY6A 1X05A 2ADZA 2M14A 2GJYA 3KY9A 2KCJA 5JP4A 2EC1A 1X1GA
chains in the Genus database with same CATH superfamily
1WG7A 4K2OA 4Z2MB 1XR0B 4CHJA 1V5UA 1SHCA 5J3QA 1FGZA 4B6HA 2D9ZA 3PG7A 2K2UA 2DYNA 2EMTA 3AJ4A 1P5TA 2ZPYA 1BAKA 2RUKB 4WJ7A 1MI1A 3V5WA 1GC6A 3N7CA 2ROVA 3WA0A 2LYDA 2H7EA 2MFQA 2EJ8A 1U5FA 3A98B 4QJ3B 2XQNM 2YT2A 5KQ1A 4HB2B 2K00A 5DH9B 5JHHA 4D6WA 5EFXA 4QJ5B 1PMSA 3X23A 4QJ4B 2OQBA 3HK0A 3ML4A 2RSGA 1MAIA 5DIFB 5I2MA 2D11A 2GCLA 2D9YA 2OTXA 2DKPA 2GUMA 2NMBA 5M4YB 1EVHA 1N3HA 2K49A 4YONA 3A8PA 3KRXA 5GOWB 1X11A 4CHMA 3AU5A 2CY4A 2I5FA 5FI1A 1OY2A 2DTCA 4KHBA 3TVVA 1PFJA 1FHXA 2DN6A 1K5GB 2NBVA 3FEHA 5D3WA 1WJ1A 4H8SA 1UPQA 5HE2A 5LG4B 3ULCA 3ODXA 3B77A 1FOEA 1MPHA 1ZC3B 2DHJA 3ULBA 4P7IA 5KCVA 2FJLA 5DHAB 1J19A 5D3VA 2KIGA 5LOPB 4HAVB 4F7GA 5JHGA 1WGUA 1ISNA 4WVFB 3SNHA 3PZDA 1U2BA 2Z0OA 3HW2B 4GNKB 1XKEA 2Z59A 4HATB 1K5DB 1X1FA 5C79A 2GS0A 2Y7BA 2RNRB 1KI1B 2LG1A 2YT0A 2I1KA 2KUQA 3RCPA 4DBBA 3OANA 3PVUA 3P6AA 2CRFA 2LKOA 1UNPA 4WSFA 2LULA 2RRFA 4ZRKA 4HDOA 2W2WA 2IFSA 1P3RA 4PQ0A 4PNKA 4HAUB 1NTYA 3SUZA 5KQ4A 3EO2A 4GMVA 2N23A 2YS3A 1EGXA 2KR0A 1NU2A 1Z87A 3TFMA 2DHIA 4A6FB 2DX1A 3A8QA 4KHBB 2MDXA 1NI2A 3D8FA 1PLSA 4IFSA 2VKIA 2UZSA 2EMSA 2J0KA 1U27A 4YL8A 4TKNA 1MIXA 2J59M 2UZRA 4HB4B 3QBVB 1LB1A 1OMWA 3ODWA 2L1CA 2P8VA 4K17A 1FB8A 2P0HA 4NY0A 5JLJB 1UNRA 1UPRA 4HAZB 2Q13A 1Y5OA 3U8ZA 4XWXA 2YT1A 1ZSQA 4KHOA 2Z13A 2P0FA 1W1HA 3G9WA 3KZ1A 2AL6A 5C6RA 4A6KA 4GZUA 3GYPA 4D0NB 4Z2NA 1TXDA 5HE3A 1IRSA 4Y94A 2DKQA 1AWEA 1XCGA 4L6EA 2QKMA 1MK7B 2DHKA 2UVMA 2P0DA 4A6FA 1AQCA 4GPTB 3DXDA 3SYXA 3CIKA 4NSWA 3MPXA 5C16A 4EKUA 1V89A 1ZC4B 2Z4DA 3U12A 4K2PA 5L81A 2CY5A 1KZ7A 1I7AA 4HSIA 3ODOA 4HB0B 2RVBB 2G35A 4D0OA 3TO1A 2QKLA 1GC7A 1DYNA 5D3XA 3PEGA 1EF1A 2Y8GA 1I2HA 2N0YA 2K8EA 3NWFA 1DROA 1F5XA 3P7ZA 2HE7A 4HHVA 2VSZA 3HQCA 4GYVA 3M1IB 3PP2A 5D3YA 1P6SA 2COAA 2BCJA 1V61A 3NW8A 5J3YA 3ZDTA 4OT1A 4HAYB 1DDWA 4GXBA 4CSQA 1U5GA 3SO6A 2I1JA 2L2IA 3JV3A 1RRPB 1QC6A 3PVWA 2Z0QA 3OHMB 5DI9B 2VRWB 2ELBA 2COCA 2AEHA 4TYZA 2RGNB 1BY1A 1MIZB 1T77A 2KGXB 4ZRIA 2DFKA 4C0AA 4F7HA 4DXAB 4MT7A 2D9VA 1SGHA 1B55A 2ROZB 1KZGA 2Z14A 1FHWA 3DCXA 4IOYX 2YVCA 2R09A 4ZRJA 2D4QA 2D9XA 4A6HA 2W2XC 3KSYA 1EAZA 2CAYA 3LJUX 4KVGB 1E5WA 1XX0A 2RLOA 4BBKA 4K81A 2KR9A 1XD4A 3HSAA 3VOQA 2X18A 3HIEA 4DX8A 1WVHA 3GF9A 3FM8C 1OQNA 2YS5A 3VIAA 2GCJA 4DIXA 1W1GA 2MKRA 3BINA 2DA0A 1DDVA 3D8DA 1Y19B 1V5PA 3QWMA 5LONB 5FI0A 1DDMA 4DX90 4A5KA 3GYOA 1BTNA 2J0JA 2Y8FA 5HE1A 1W1DA 2COFA 2V76A 5CLQB 3SV1A 5HE0A 1ZYIA 1LW3A 3TCAA 2MWNB 1WI1A 1V88A 3NWAA 1MK9B 2J0MA 3AU4A 3O96A 4L1RA 2PZ1A 1MKEA 1WGQA 4QXAB 2R0DA 1TQZA 2D2QA 2JP2A 2Z0PA 3WYFB 3QIJA 3DXEA 2D10A 5J3TA 1QQGA 2YS1A 4EJNA 1FHOA 2LOXA 1X86A 3BJIA 5C5BB 1ZM0A 1GG3A 2FJUB 2YRYA 3PSCA 5CLLB 1H4RA 1U5EA 2D9WA 1ZVRA 4KAXB 4HDQA 2DYQA 1UNQA 2ZKMX 5IRSA 2K2JA 3T06A 1M7EA 5C5BA 5DHFB 4HB3B 2I5CA 4HAWB 2IYBA 3ZVRA 2NZ8B 3KRWA 3NSUA 3PVLA 4CYEA 2W2XD 1Q67A 1TJ6A 1M7RA 3IVFA 1RJ2A 2LOZA 3F0WA 3CXBB 3UZTA 1BWNA 3DXCA 1H10A 1BTKA 1NTVA 4GMXB 1WJMA 2DLWA 4GOUA 2YF0A 2HTHB 3NWDA 4MK0A 2CODA 4HAXB 2DX5A 1FGYA 3D8EA 4F7UP 4KHAA 3FSSA 2E2XA 2KUPA 2R2YA 3FVCA 4EMOA 1J0WA 3TW1A 1UEFA 3U7DA 1U29A 4GN1A 3F5RA 2M38A 1DBHA 1V5MA 2YSZA 5D27A 1U5DA 2ELAA 1FAOA 1XODA 2H7DA 3MDBC 4IAPA 3A58A 4MY6A 2KIEA 1X05A 4OSNA 2ADZA 2M14A 2GJYA 3KY9A 2KCJA 5JP4A 2EC1A 1X1GA 5I2SA
chains in the Genus database with same CATH topology
1WG7A 4K2OA 4Z2MB 1XR0B 4CHJA 1V5UA 1SHCA 5J3QA 1FGZA 4B6HA 2D9ZA 3PG7A 2K2UA 2DYNA 2EMTA 1P5TA 3AJ4A 2ZPYA 1BAKA 2RUKB 4WJ7A 3V5WA 1GC6A 3N7CA 2ROVA 3WA0A 2LYDA 2H7EA 2MFQA 2EJ8A 1U5FA 3A98B 2XQNM 5KQ1A 4HB2B 2K00A 5DH9B 5JHHA 5EFXA 1PMSA 3X23A 2OQBA 3HK0A 3ML4A 2RSGA 1MAIA 5DIFB 2D11A 2GCLA 2D9YA 2OTXA 2DKPA 2NMBA 1EVHA 1N3HA 4YONA 3A8PA 3KRXA 5GOWB 1X11A 4CHMA 3AU5A 2CY4A 2I5FA 5FI1A 1OY2A 2DTCA 3TVVA 1PFJA 1FHXA 2DN6A 1K5GB 3FEHA 5D3WA 1WJ1A 4H8SA 1UPQA 5HE2A 3ULCA 3ODXA 1FOEA 1MPHA 1ZC3B 2DHJA 3ULBA 4P7IA 5KCVA 2FJLA 5DHAB 1J19A 5D3VA 5LOPB 4HAVB 4F7GA 5JHGA 1WGUA 1ISNA 4WVFB 3SNHA 3PZDA 1U2BA 2Z0OA 3HW2B 1XKEA 4HATB 1K5DB 1X1FA 5C79A 2GS0A 2Y7BA 2RNRB 1KI1B 2LG1A 2YT0A 2I1KA 4DBBA 3RCPA 3OANA 3PVUA 3P6AA 2CRFA 2LKOA 1UNPA 4WSFA 2LULA 4ZRKA 4HDOA 2W2WA 2IFSA 1P3RA 4PQ0A 4PNKA 4HAUB 1NTYA 3SUZA 5KQ4A 3EO2A 4GMVA 2N23A 2YS3A 1EGXA 1NU2A 1Z87A 3TFMA 2DHIA 4A6FB 2DX1A 3A8QA 4KHBB 2MDXA 1NI2A 3D8FA 1PLSA 4IFSA 2VKIA 2UZSA 2EMSA 2J0KA 1U27A 4YL8A 4TKNA 1MIXA 2J59M 2UZRA 4HB4B 3QBVB 1LB1A 1OMWA 3ODWA 2L1CA 2P8VA 4K17A 1FB8A 2P0HA 4NY0A 5JLJB 1UNRA 1UPRA 4HAZB 2Q13A 1Y5OA 3U8ZA 4XWXA 2YT1A 1ZSQA 4KHOA 2P0FA 1W1HA 3G9WA 3KZ1A 2AL6A 5C6RA 4A6KA 4GZUA 3GYPA 4D0NB 4Z2NA 1TXDA 5HE3A 1IRSA 4Y94A 2DKQA 1AWEA 1XCGA 4L6EA 2QKMA 1MK7B 2DHKA 2UVMA 2P0DA 4A6FA 1AQCA 4GPTB 3DXDA 3SYXA 3CIKA 4NSWA 3MPXA 5C16A 4EKUA 1V89A 1ZC4B 4K2PA 5L81A 2CY5A 1KZ7A 1I7AA 3ODOA 4HB0B 2RVBB 2G35A 4D0OA 3TO1A 2QKLA 1GC7A 1DYNA 5D3XA 3PEGA 1EF1A 2Y8GA 1I2HA 2N0YA 1DROA 1F5XA 3P7ZA 2HE7A 4HHVA 2VSZA 3HQCA 4GYVA 3M1IB 3PP2A 5D3YA 1P6SA 2COAA 2BCJA 1V61A 5J3YA 3ZDTA 4HAYB 1DDWA 4GXBA 1U5GA 3SO6A 2I1JA 2L2IA 3JV3A 1RRPB 1QC6A 3PVWA 2Z0QA 5DI9B 2VRWB 2ELBA 2COCA 2AEHA 4TYZA 2RGNB 1BY1A 1MIZB 2KGXB 4ZRIA 2DFKA 4C0AA 4F7HA 4DXAB 4MT7A 2D9VA 1SGHA 1B55A 2ROZB 1KZGA 1FHWA 4IOYX 2YVCA 2R09A 4ZRJA 2D4QA 2D9XA 4A6HA 2W2XC 3KSYA 1EAZA 2CAYA 3LJUX 4KVGB 1E5WA 1XX0A 2RLOA 4BBKA 4K81A 2KR9A 1XD4A 3VOQA 2X18A 4DX8A 1WVHA 3GF9A 3FM8C 1OQNA 2YS5A 3VIAA 2GCJA 1W1GA 2MKRA 3BINA 2DA0A 1DDVA 3D8DA 1Y19B 1V5PA 3QWMA 5LONB 5FI0A 1DDMA 4DX90 4A5KA 3GYOA 1BTNA 2J0JA 2Y8FA 5HE1A 1W1DA 2COFA 2V76A 5CLQB 3SV1A 5HE0A 1LW3A 3TCAA 2MWNB 1WI1A 1V88A 1MK9B 2J0MA 3AU4A 3O96A 2PZ1A 1MKEA 1WGQA 2R0DA 1TQZA 2D2QA 2JP2A 2Z0PA 3WYFB 3QIJA 3DXEA 2D10A 5J3TA 1QQGA 2YS1A 4EJNA 1FHOA 2LOXA 1X86A 3BJIA 5C5BB 1ZM0A 1GG3A 2YRYA 3PSCA 5CLLB 1H4RA 1U5EA 2D9WA 1ZVRA 4KAXB 4HDQA 2DYQA 1UNQA 2K2JA 3T06A 1M7EA 5C5BA 5DHFB 4HB3B 2I5CA 4HAWB 2IYBA 3ZVRA 2NZ8B 3KRWA 3NSUA 3PVLA 4CYEA 2W2XD 1Q67A 1TJ6A 1M7RA 3IVFA 1RJ2A 2LOZA 3F0WA 3CXBB 3UZTA 1BWNA 3DXCA 1H10A 1BTKA 1NTVA 4GMXB 1WJMA 2DLWA 4GOUA 2YF0A 2HTHB 4MK0A 2CODA 4HAXB 2DX5A 1FGYA 3D8EA 4F7UP 4KHAA 3FSSA 2E2XA 2KUPA 4EMOA 1J0WA 3TW1A 1UEFA 3U7DA 1U29A 4GN1A 3F5RA 2M38A 1DBHA 1V5MA 2YSZA 5D27A 1U5DA 2ELAA 1FAOA 1XODA 2H7DA 3MDBC 4IAPA 4MY6A 1X05A 2ADZA 2M14A 2GJYA 3KY9A 2KCJA 5JP4A 2EC1A 1X1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WG7 A;  4K2O A;  4Z2M B;  1XR0 B;  4CHJ A;  1V5U A;  1SHC A;  5J3Q A;  1FGZ A;  4B6H A;  2D9Z A;  3PG7 A;  2K2U A;  2DYN A;  2EMT A;  1P5T A;  3AJ4 A;  2ZPY A;  1BAK A;  2RUK B;  4WJ7 A;  3V5W A;  1GC6 A;  3N7C A;  2ROV A;  3WA0 A;  2LYD A;  2H7E A;  2MFQ A;  2EJ8 A;  1U5F A;  3A98 B;  2XQN M;  5KQ1 A;  4HB2 B;  2K00 A;  5DH9 B;  5JHH A;  5EFX A;  1PMS A;  3X23 A;  2OQB A;  3HK0 A;  3ML4 A;  2RSG A;  1MAI A;  5DIF B;  2D11 A;  2GCL A;  2D9Y A;  2OTX A;  2DKP A;  2NMB A;  1EVH A;  1N3H A;  4YON A;  3A8P A;  3KRX A;  5GOW B;  1X11 A;  4CHM A;  3AU5 A;  2CY4 A;  2I5F A;  5FI1 A;  1OY2 A;  2DTC A;  3TVV A;  1PFJ A;  1FHX A;  2DN6 A;  1K5G B;  3FEH A;  5D3W A;  1WJ1 A;  4H8S A;  1UPQ A;  5HE2 A;  3ULC A;  3ODX A;  1FOE A;  1MPH A;  1ZC3 B;  2DHJ A;  3ULB A;  4P7I A;  5KCV A;  2FJL A;  5DHA B;  1J19 A;  5D3V A;  5LOP B;  4HAV B;  4F7G A;  5JHG A;  1WGU A;  1ISN A;  4WVF B;  3SNH A;  3PZD A;  1U2B A;  2Z0O A;  3HW2 B;  1XKE A;  4HAT B;  1K5D B;  1X1F A;  5C79 A;  2GS0 A;  2Y7B A;  2RNR B;  1KI1 B;  2LG1 A;  2YT0 A;  2I1K A;  4DBB A;  3RCP A;  3OAN A;  3PVU A;  3P6A A;  2CRF A;  2LKO A;  1UNP A;  4WSF A;  2LUL A;  4ZRK A;  4HDO A;  2W2W A;  2IFS A;  1P3R A;  4PQ0 A;  4PNK A;  4HAU B;  1NTY A;  3SUZ A;  5KQ4 A;  3EO2 A;  4GMV A;  2N23 A;  2YS3 A;  1EGX A;  1NU2 A;  1Z87 A;  3TFM A;  2DHI A;  4A6F B;  2DX1 A;  3A8Q A;  4KHB B;  2MDX A;  1NI2 A;  3D8F A;  1PLS A;  4IFS A;  2VKI A;  2UZS A;  2EMS A;  2J0K A;  1U27 A;  4YL8 A;  4TKN A;  1MIX A;  2J59 M;  2UZR A;  4HB4 B;  3QBV B;  1LB1 A;  1OMW A;  3ODW A;  2L1C A;  2P8V A;  4K17 A;  1FB8 A;  2P0H A;  4NY0 A;  5JLJ B;  1UNR A;  1UPR A;  4HAZ B;  2Q13 A;  1Y5O A;  3U8Z A;  4XWX A;  2YT1 A;  1ZSQ A;  4KHO A;  2P0F A;  1W1H A;  3G9W A;  3KZ1 A;  2AL6 A;  5C6R A;  4A6K A;  4GZU A;  3GYP A;  4D0N B;  4Z2N A;  1TXD A;  5HE3 A;  1IRS A;  4Y94 A;  2DKQ A;  1AWE A;  1XCG A;  4L6E A;  2QKM A;  1MK7 B;  2DHK A;  2UVM A;  2P0D A;  4A6F A;  1AQC A;  4GPT B;  3DXD A;  3SYX A;  3CIK A;  4NSW A;  3MPX A;  5C16 A;  4EKU A;  1V89 A;  1ZC4 B;  4K2P A;  5L81 A;  2CY5 A;  1KZ7 A;  1I7A A;  3ODO A;  4HB0 B;  2RVB B;  2G35 A;  4D0O A;  3TO1 A;  2QKL A;  1GC7 A;  1DYN A;  5D3X A;  3PEG A;  1EF1 A;  2Y8G A;  1I2H A;  2N0Y A;  1DRO A;  1F5X A;  3P7Z A;  2HE7 A;  4HHV A;  2VSZ A;  3HQC A;  4GYV A;  3M1I B;  3PP2 A;  5D3Y A;  1P6S A;  2COA A;  2BCJ A;  1V61 A;  5J3Y A;  3ZDT A;  4HAY B;  1DDW A;  4GXB A;  1U5G A;  3SO6 A;  2I1J A;  2L2I A;  3JV3 A;  1RRP B;  1QC6 A;  3PVW A;  2Z0Q A;  5DI9 B;  2VRW B;  2ELB A;  2COC A;  2AEH A;  4TYZ A;  2RGN B;  1BY1 A;  1MIZ B;  2KGX B;  4ZRI A;  2DFK A;  4C0A A;  4F7H A;  4DXA B;  4MT7 A;  2D9V A;  1SGH A;  1B55 A;  2ROZ B;  1KZG A;  1FHW A;  4IOY X;  2YVC A;  2R09 A;  4ZRJ A;  2D4Q A;  2D9X A;  4A6H A;  2W2X C;  3KSY A;  1EAZ A;  2CAY A;  3LJU X;  4KVG B;  1E5W A;  1XX0 A;  2RLO A;  4BBK A;  4K81 A;  2KR9 A;  1XD4 A;  3VOQ A;  2X18 A;  4DX8 A;  1WVH A;  3GF9 A;  3FM8 C;  1OQN A;  2YS5 A;  3VIA A;  2GCJ A;  1W1G A;  2MKR A;  3BIN A;  2DA0 A;  1DDV A;  3D8D A;  1Y19 B;  1V5P A;  3QWM A;  5LON B;  5FI0 A;  1DDM A;  4DX9 0;  4A5K A;  3GYO A;  1BTN A;  2J0J A;  2Y8F A;  5HE1 A;  1W1D A;  2COF A;  2V76 A;  5CLQ B;  3SV1 A;  5HE0 A;  1LW3 A;  3TCA A;  2MWN B;  1WI1 A;  1V88 A;  1MK9 B;  2J0M A;  3AU4 A;  3O96 A;  2PZ1 A;  1MKE A;  1WGQ A;  2R0D A;  1TQZ A;  2D2Q A;  2JP2 A;  2Z0P A;  3WYF B;  3QIJ A;  3DXE A;  2D10 A;  5J3T A;  1QQG A;  2YS1 A;  4EJN A;  1FHO A;  2LOX A;  1X86 A;  3BJI A;  5C5B B;  1ZM0 A;  1GG3 A;  2YRY A;  3PSC A;  5CLL B;  1H4R A;  1U5E A;  2D9W A;  1ZVR A;  4KAX B;  4HDQ A;  2DYQ A;  1UNQ A;  2K2J A;  3T06 A;  1M7E A;  5C5B A;  5DHF B;  4HB3 B;  2I5C A;  4HAW B;  2IYB A;  3ZVR A;  2NZ8 B;  3KRW A;  3NSU A;  3PVL A;  4CYE A;  2W2X D;  1Q67 A;  1TJ6 A;  1M7R A;  3IVF A;  1RJ2 A;  2LOZ A;  3F0W A;  3CXB B;  3UZT A;  1BWN A;  3DXC A;  1H10 A;  1BTK A;  1NTV A;  4GMX B;  1WJM A;  2DLW A;  4GOU A;  2YF0 A;  2HTH B;  4MK0 A;  2COD A;  4HAX B;  2DX5 A;  1FGY A;  3D8E A;  4F7U P;  4KHA A;  3FSS A;  2E2X A;  2KUP A;  4EMO A;  1J0W A;  3TW1 A;  1UEF A;  3U7D A;  1U29 A;  4GN1 A;  3F5R A;  2M38 A;  1DBH A;  1V5M A;  2YSZ A;  5D27 A;  1U5D A;  2ELA A;  1FAO A;  1XOD A;  2H7D A;  3MDB C;  4IAP A;  4MY6 A;  1X05 A;  2ADZ A;  2M14 A;  2GJY A;  3KY9 A;  2KCJ A;  5JP4 A;  2EC1 A;  1X1G A; 
#chains in the Genus database with same CATH topology
 1WG7 A;  4K2O A;  4Z2M B;  1XR0 B;  4CHJ A;  1V5U A;  1SHC A;  5J3Q A;  1FGZ A;  4B6H A;  2D9Z A;  3PG7 A;  2K2U A;  2DYN A;  2EMT A;  3AJ4 A;  1P5T A;  2ZPY A;  1BAK A;  2RUK B;  4WJ7 A;  1MI1 A;  3V5W A;  1GC6 A;  3N7C A;  2ROV A;  3WA0 A;  2LYD A;  2H7E A;  2MFQ A;  2EJ8 A;  1U5F A;  3A98 B;  4QJ3 B;  2XQN M;  2YT2 A;  5KQ1 A;  4HB2 B;  2K00 A;  5DH9 B;  5JHH A;  4D6W A;  5EFX A;  4QJ5 B;  1PMS A;  3X23 A;  4QJ4 B;  2OQB A;  3HK0 A;  3ML4 A;  2RSG A;  1MAI A;  5DIF B;  5I2M A;  2D11 A;  2GCL A;  2D9Y A;  2OTX A;  2DKP A;  2GUM A;  2NMB A;  5M4Y B;  1EVH A;  1N3H A;  2K49 A;  4YON A;  3A8P A;  3KRX A;  5GOW B;  1X11 A;  4CHM A;  3AU5 A;  2CY4 A;  2I5F A;  5FI1 A;  1OY2 A;  2DTC A;  4KHB A;  3TVV A;  1PFJ A;  1FHX A;  2DN6 A;  1K5G B;  2NBV A;  3FEH A;  5D3W A;  1WJ1 A;  4H8S A;  1UPQ A;  5HE2 A;  5LG4 B;  3ULC A;  3ODX A;  3B77 A;  1FOE A;  1MPH A;  1ZC3 B;  2DHJ A;  3ULB A;  4P7I A;  5KCV A;  2FJL A;  5DHA B;  1J19 A;  5D3V A;  2KIG A;  5LOP B;  4HAV B;  4F7G A;  5JHG A;  1WGU A;  1ISN A;  4WVF B;  3SNH A;  3PZD A;  1U2B A;  2Z0O A;  3HW2 B;  4GNK B;  1XKE A;  2Z59 A;  4HAT B;  1K5D B;  1X1F A;  5C79 A;  2GS0 A;  2Y7B A;  2RNR B;  1KI1 B;  2LG1 A;  2YT0 A;  2I1K A;  2KUQ A;  3RCP A;  4DBB A;  3OAN A;  3PVU A;  3P6A A;  2CRF A;  2LKO A;  1UNP A;  4WSF A;  2LUL A;  2RRF A;  4ZRK A;  4HDO A;  2W2W A;  2IFS A;  1P3R A;  4PQ0 A;  4PNK A;  4HAU B;  1NTY A;  3SUZ A;  5KQ4 A;  3EO2 A;  4GMV A;  2N23 A;  2YS3 A;  1EGX A;  2KR0 A;  1NU2 A;  1Z87 A;  3TFM A;  2DHI A;  4A6F B;  2DX1 A;  3A8Q A;  4KHB B;  2MDX A;  1NI2 A;  3D8F A;  1PLS A;  4IFS A;  2VKI A;  2UZS A;  2EMS A;  2J0K A;  1U27 A;  4YL8 A;  4TKN A;  1MIX A;  2J59 M;  2UZR A;  4HB4 B;  3QBV B;  1LB1 A;  1OMW A;  3ODW A;  2L1C A;  2P8V A;  4K17 A;  1FB8 A;  2P0H A;  4NY0 A;  5JLJ B;  1UNR A;  1UPR A;  4HAZ B;  2Q13 A;  1Y5O A;  3U8Z A;  4XWX A;  2YT1 A;  1ZSQ A;  4KHO A;  2Z13 A;  2P0F A;  1W1H A;  3G9W A;  3KZ1 A;  2AL6 A;  5C6R A;  4A6K A;  4GZU A;  3GYP A;  4D0N B;  4Z2N A;  1TXD A;  5HE3 A;  1IRS A;  4Y94 A;  2DKQ A;  1AWE A;  1XCG A;  4L6E A;  2QKM A;  1MK7 B;  2DHK A;  2UVM A;  2P0D A;  4A6F A;  1AQC A;  4GPT B;  3DXD A;  3SYX A;  3CIK A;  4NSW A;  3MPX A;  5C16 A;  4EKU A;  1V89 A;  1ZC4 B;  2Z4D A;  3U12 A;  4K2P A;  5L81 A;  2CY5 A;  1KZ7 A;  1I7A A;  4HSI A;  3ODO A;  4HB0 B;  2RVB B;  2G35 A;  4D0O A;  3TO1 A;  2QKL A;  1GC7 A;  1DYN A;  5D3X A;  3PEG A;  1EF1 A;  2Y8G A;  1I2H A;  2N0Y A;  2K8E A;  3NWF A;  1DRO A;  1F5X A;  3P7Z A;  2HE7 A;  4HHV A;  2VSZ A;  3HQC A;  4GYV A;  3M1I B;  3PP2 A;  5D3Y A;  1P6S A;  2COA A;  2BCJ A;  1V61 A;  3NW8 A;  5J3Y A;  3ZDT A;  4OT1 A;  4HAY B;  1DDW A;  4GXB A;  4CSQ A;  1U5G A;  3SO6 A;  2I1J A;  2L2I A;  3JV3 A;  1RRP B;  1QC6 A;  3PVW A;  2Z0Q A;  3OHM B;  5DI9 B;  2VRW B;  2ELB A;  2COC A;  2AEH A;  4TYZ A;  2RGN B;  1BY1 A;  1MIZ B;  1T77 A;  2KGX B;  4ZRI A;  2DFK A;  4C0A A;  4F7H A;  4DXA B;  4MT7 A;  2D9V A;  1SGH A;  1B55 A;  2ROZ B;  1KZG A;  2Z14 A;  1FHW A;  3DCX A;  4IOY X;  2YVC A;  2R09 A;  4ZRJ A;  2D4Q A;  2D9X A;  4A6H A;  2W2X C;  3KSY A;  1EAZ A;  2CAY A;  3LJU X;  4KVG B;  1E5W A;  1XX0 A;  2RLO A;  4BBK A;  4K81 A;  2KR9 A;  1XD4 A;  3HSA A;  3VOQ A;  2X18 A;  3HIE A;  4DX8 A;  1WVH A;  3GF9 A;  3FM8 C;  1OQN A;  2YS5 A;  3VIA A;  2GCJ A;  4DIX A;  1W1G A;  2MKR A;  3BIN A;  2DA0 A;  1DDV A;  3D8D A;  1Y19 B;  1V5P A;  3QWM A;  5LON B;  5FI0 A;  1DDM A;  4DX9 0;  4A5K A;  3GYO A;  1BTN A;  2J0J A;  2Y8F A;  5HE1 A;  1W1D A;  2COF A;  2V76 A;  5CLQ B;  3SV1 A;  5HE0 A;  1ZYI A;  1LW3 A;  3TCA A;  2MWN B;  1WI1 A;  1V88 A;  3NWA A;  1MK9 B;  2J0M A;  3AU4 A;  3O96 A;  4L1R A;  2PZ1 A;  1MKE A;  1WGQ A;  4QXA B;  2R0D A;  1TQZ A;  2D2Q A;  2JP2 A;  2Z0P A;  3WYF B;  3QIJ A;  3DXE A;  2D10 A;  5J3T A;  1QQG A;  2YS1 A;  4EJN A;  1FHO A;  2LOX A;  1X86 A;  3BJI A;  5C5B B;  1ZM0 A;  1GG3 A;  2FJU B;  2YRY A;  3PSC A;  5CLL B;  1H4R A;  1U5E A;  2D9W A;  1ZVR A;  4KAX B;  4HDQ A;  2DYQ A;  1UNQ A;  2ZKM X;  5IRS A;  2K2J A;  3T06 A;  1M7E A;  5C5B A;  5DHF B;  4HB3 B;  2I5C A;  4HAW B;  2IYB A;  3ZVR A;  2NZ8 B;  3KRW A;  3NSU A;  3PVL A;  4CYE A;  2W2X D;  1Q67 A;  1TJ6 A;  1M7R A;  3IVF A;  1RJ2 A;  2LOZ A;  3F0W A;  3CXB B;  3UZT A;  1BWN A;  3DXC A;  1H10 A;  1BTK A;  1NTV A;  4GMX B;  1WJM A;  2DLW A;  4GOU A;  2YF0 A;  2HTH B;  3NWD A;  4MK0 A;  2COD A;  4HAX B;  2DX5 A;  1FGY A;  3D8E A;  4F7U P;  4KHA A;  3FSS A;  2E2X A;  2KUP A;  2R2Y A;  3FVC A;  4EMO A;  1J0W A;  3TW1 A;  1UEF A;  3U7D A;  1U29 A;  4GN1 A;  3F5R A;  2M38 A;  1DBH A;  1V5M A;  2YSZ A;  5D27 A;  1U5D A;  2ELA A;  1FAO A;  1XOD A;  2H7D A;  3MDB C;  4IAP A;  3A58 A;  4MY6 A;  2KIE A;  1X05 A;  4OSN A;  2ADZ A;  2M14 A;  2GJY A;  3KY9 A;  2KCJ A;  5JP4 A;  2EC1 A;  1X1G A;  5I2S A; 
#chains in the Genus database with same CATH homology
 1WG7 A;  4K2O A;  4Z2M B;  1XR0 B;  4CHJ A;  1V5U A;  1SHC A;  5J3Q A;  1FGZ A;  4B6H A;  2D9Z A;  3PG7 A;  2K2U A;  2DYN A;  2EMT A;  1P5T A;  3AJ4 A;  2ZPY A;  1BAK A;  2RUK B;  4WJ7 A;  3V5W A;  1GC6 A;  3N7C A;  2ROV A;  3WA0 A;  2LYD A;  2H7E A;  2MFQ A;  2EJ8 A;  1U5F A;  3A98 B;  2XQN M;  5KQ1 A;  4HB2 B;  2K00 A;  5DH9 B;  5JHH A;  5EFX A;  1PMS A;  3X23 A;  2OQB A;  3HK0 A;  3ML4 A;  2RSG A;  1MAI A;  5DIF B;  2D11 A;  2GCL A;  2D9Y A;  2OTX A;  2DKP A;  2NMB A;  1EVH A;  1N3H A;  4YON A;  3A8P A;  3KRX A;  5GOW B;  1X11 A;  4CHM A;  3AU5 A;  2CY4 A;  2I5F A;  5FI1 A;  1OY2 A;  2DTC A;  3TVV A;  1PFJ A;  1FHX A;  2DN6 A;  1K5G B;  3FEH A;  5D3W A;  1WJ1 A;  4H8S A;  1UPQ A;  5HE2 A;  3ULC A;  3ODX A;  1FOE A;  1MPH A;  1ZC3 B;  2DHJ A;  3ULB A;  4P7I A;  5KCV A;  2FJL A;  5DHA B;  1J19 A;  5D3V A;  5LOP B;  4HAV B;  4F7G A;  5JHG A;  1WGU A;  1ISN A;  4WVF B;  3SNH A;  3PZD A;  1U2B A;  2Z0O A;  3HW2 B;  1XKE A;  4HAT B;  1K5D B;  1X1F A;  5C79 A;  2GS0 A;  2Y7B A;  2RNR B;  1KI1 B;  2LG1 A;  2YT0 A;  2I1K A;  4DBB A;  3RCP A;  3OAN A;  3PVU A;  3P6A A;  2CRF A;  2LKO A;  1UNP A;  4WSF A;  2LUL A;  4ZRK A;  4HDO A;  2W2W A;  2IFS A;  1P3R A;  4PQ0 A;  4PNK A;  4HAU B;  1NTY A;  3SUZ A;  5KQ4 A;  3EO2 A;  4GMV A;  2N23 A;  2YS3 A;  1EGX A;  1NU2 A;  1Z87 A;  3TFM A;  2DHI A;  4A6F B;  2DX1 A;  3A8Q A;  4KHB B;  2MDX A;  1NI2 A;  3D8F A;  1PLS A;  4IFS A;  2VKI A;  2UZS A;  2EMS A;  2J0K A;  1U27 A;  4YL8 A;  4TKN A;  1MIX A;  2J59 M;  2UZR A;  4HB4 B;  3QBV B;  1LB1 A;  1OMW A;  3ODW A;  2L1C A;  2P8V A;  4K17 A;  1FB8 A;  2P0H A;  4NY0 A;  5JLJ B;  1UNR A;  1UPR A;  4HAZ B;  2Q13 A;  1Y5O A;  3U8Z A;  4XWX A;  2YT1 A;  1ZSQ A;  4KHO A;  2P0F A;  1W1H A;  3G9W A;  3KZ1 A;  2AL6 A;  5C6R A;  4A6K A;  4GZU A;  3GYP A;  4D0N B;  4Z2N A;  1TXD A;  5HE3 A;  1IRS A;  4Y94 A;  2DKQ A;  1AWE A;  1XCG A;  4L6E A;  2QKM A;  1MK7 B;  2DHK A;  2UVM A;  2P0D A;  4A6F A;  1AQC A;  4GPT B;  3DXD A;  3SYX A;  3CIK A;  4NSW A;  3MPX A;  5C16 A;  4EKU A;  1V89 A;  1ZC4 B;  4K2P A;  5L81 A;  2CY5 A;  1KZ7 A;  1I7A A;  3ODO A;  4HB0 B;  2RVB B;  2G35 A;  4D0O A;  3TO1 A;  2QKL A;  1GC7 A;  1DYN A;  5D3X A;  3PEG A;  1EF1 A;  2Y8G A;  1I2H A;  2N0Y A;  1DRO A;  1F5X A;  3P7Z A;  2HE7 A;  4HHV A;  2VSZ A;  3HQC A;  4GYV A;  3M1I B;  3PP2 A;  5D3Y A;  1P6S A;  2COA A;  2BCJ A;  1V61 A;  5J3Y A;  3ZDT A;  4HAY B;  1DDW A;  4GXB A;  1U5G A;  3SO6 A;  2I1J A;  2L2I A;  3JV3 A;  1RRP B;  1QC6 A;  3PVW A;  2Z0Q A;  5DI9 B;  2VRW B;  2ELB A;  2COC A;  2AEH A;  4TYZ A;  2RGN B;  1BY1 A;  1MIZ B;  2KGX B;  4ZRI A;  2DFK A;  4C0A A;  4F7H A;  4DXA B;  4MT7 A;  2D9V A;  1SGH A;  1B55 A;  2ROZ B;  1KZG A;  1FHW A;  4IOY X;  2YVC A;  2R09 A;  4ZRJ A;  2D4Q A;  2D9X A;  4A6H A;  2W2X C;  3KSY A;  1EAZ A;  2CAY A;  3LJU X;  4KVG B;  1E5W A;  1XX0 A;  2RLO A;  4BBK A;  4K81 A;  2KR9 A;  1XD4 A;  3VOQ A;  2X18 A;  4DX8 A;  1WVH A;  3GF9 A;  3FM8 C;  1OQN A;  2YS5 A;  3VIA A;  2GCJ A;  1W1G A;  2MKR A;  3BIN A;  2DA0 A;  1DDV A;  3D8D A;  1Y19 B;  1V5P A;  3QWM A;  5LON B;  5FI0 A;  1DDM A;  4DX9 0;  4A5K A;  3GYO A;  1BTN A;  2J0J A;  2Y8F A;  5HE1 A;  1W1D A;  2COF A;  2V76 A;  5CLQ B;  3SV1 A;  5HE0 A;  1LW3 A;  3TCA A;  2MWN B;  1WI1 A;  1V88 A;  1MK9 B;  2J0M A;  3AU4 A;  3O96 A;  2PZ1 A;  1MKE A;  1WGQ A;  2R0D A;  1TQZ A;  2D2Q A;  2JP2 A;  2Z0P A;  3WYF B;  3QIJ A;  3DXE A;  2D10 A;  5J3T A;  1QQG A;  2YS1 A;  4EJN A;  1FHO A;  2LOX A;  1X86 A;  3BJI A;  5C5B B;  1ZM0 A;  1GG3 A;  2YRY A;  3PSC A;  5CLL B;  1H4R A;  1U5E A;  2D9W A;  1ZVR A;  4KAX B;  4HDQ A;  2DYQ A;  1UNQ A;  2K2J A;  3T06 A;  1M7E A;  5C5B A;  5DHF B;  4HB3 B;  2I5C A;  4HAW B;  2IYB A;  3ZVR A;  2NZ8 B;  3KRW A;  3NSU A;  3PVL A;  4CYE A;  2W2X D;  1Q67 A;  1TJ6 A;  1M7R A;  3IVF A;  1RJ2 A;  2LOZ A;  3F0W A;  3CXB B;  3UZT A;  1BWN A;  3DXC A;  1H10 A;  1BTK A;  1NTV A;  4GMX B;  1WJM A;  2DLW A;  4GOU A;  2YF0 A;  2HTH B;  4MK0 A;  2COD A;  4HAX B;  2DX5 A;  1FGY A;  3D8E A;  4F7U P;  4KHA A;  3FSS A;  2E2X A;  2KUP A;  4EMO A;  1J0W A;  3TW1 A;  1UEF A;  3U7D A;  1U29 A;  4GN1 A;  3F5R A;  2M38 A;  1DBH A;  1V5M A;  2YSZ A;  5D27 A;  1U5D A;  2ELA A;  1FAO A;  1XOD A;  2H7D A;  3MDB C;  4IAP A;  4MY6 A;  1X05 A;  2ADZ A;  2M14 A;  2GJY A;  3KY9 A;  2KCJ A;  5JP4 A;  2EC1 A;  1X1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...