3P72A

Structure of platelet glycoprotein 1b alpha with a bound peptide inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
269
structure length
269
Chain Sequence
HPICEVSKVASHLEVNCDKRQLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNQLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib alpha chain
publication title Glycoprotein Ibalpha inhibitor complex structure reveals a combined steric and allosteric mechanism of von Willebrand factor antagonism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/inhibitor
total genus 74
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3p72A00
3W3MA 3UN9A 3C6NB 1M0ZA 4KNGA 2IFGA 3C6PB 4FDWA 2Q4GW 1G9UA 3G06A 5AZ5A 1OZNA 1XWDC 3BZ5A 3WPHA 4XGOA 1JL5A 3WPFA 2UZYA 4C2BB 4R09A 5D3IA 1FQVA 3ULUA 4CP6A 4R6FA 4R07A 4ECNA 3O6NA 5IJCA 4Q3GA 5GMHA 4P8SA 1O6VA 5GS0A 3W3NA 1KOHA 1PGVA 4LI1A 4LI2A 5CMNA 2BEXA 4Y61B 5HDHA 3C6OB 4RCAB 2Z7XB 1A9NA 3E4GA 1K5GC 3GOZA 4M7EA 3VQ2A 1WWLA 1SQ0B 1OGQA 4LSCA 3SB4A 3O53A 4CNCA 4QBZA 1M9SA 5AWCA 4BSUA 5LFNA 1P9AG 2Z82A 3REZA 2V9TB 3RW7A 1IO0A 2XOTA 5AWBA 4LSXC 4IM6A 4M7EC 4NKGA 1DFJI 4CC4A 4PSJA 3W3LA 2RR6A 4BSSA 2ID5A 4GLPA 4WYKA 2Z62A 2Y5QA 3RW6A 3M19A 1D0BA 3CIGA 1XCDA 4LSAA 1LTXA 4PERA 3RJ0A 4R6AA 4YEBB 4XOSA 2Z63A 4QC0A 1M9LA 4XSQA 2OMTA 3OJAA 5GS2B 4LXSA 1ZIWA 2P1NB 3RFSA 2JE0A 2UZXA 1K5DC 1QYYA 3JB9j 3WPDA 3W3KA 4OQTA 4R6GA 4R08A 2OMUA 3UL9A 4UFRA 4AW4A 4C2AB 4V2CA 1M10B 1P8VA 3E2JA 2Z64A 5B0NA 3UL7A 3KJ4A 4NKHA 1FO1A 4V2EA 4Z79A 4R6JA 2ASTB 2A0ZA 4CILA 2OMXA 3G3BA 1FS2A 3CVRA 4BSRA 4LSXA 2WQXA 2O6RA 4I6JB 1DCEA 4FCGA 1P8TA 1U0ND 2Z81A 2FT3A 2JQDA 2P1QB 4EZGA 3RFJA 1Z7XW 3RIZA 1OTMA 3FXIA 5GQRK 4G8AA 3ULVA 3WPGA 1GWBA 2Z65A 4BV4R 3PMHG 1O6TA 3ULAA 5AWAA 3W3GA 3G39A 4FS7A 5IYXC 2WQUA 4ARNA 1OTNA 5CMPA 2V9SA 3G3AA 4ECOA 4Z64C 4R5DA 2OMWA 3A79B 2P1MB 3DZEA 3ZYOA 4FD0A 3OGKB 4TZHA 4R5CA 1W8AA 3OGMB 4ARRA 2O6SA 4Q3IA 3UL8A 1FT8A 4AY9X 4KT1A 3OJAB 4HQ1A 4U08A 5IJDA 5B0TA 4B8CD 3E3ZA 4U06A 5A5CA 4J4LA 4KXFB 4R0AA 3W3JA 4RWTC 3WPCA 1YRGA 4CNMA 4FHOA 2OMYA 4H09A 4PKIG 5IJBA 3RGXA 3WPEA 2P1OB 4WP6A 4GT6A 3OGLB 5GMFA 1OTOA 3M18A 2P1PB 2O6QA 5B4PA 2ASSB 4U7LA 2JE1A 4Z61C 4LXRA 3ZYJA 4Z8GA 4PEQB 4FMZA 4PQ8A 3G04C 3WN4A 5FTTB 2BNHA 2R9UA 2WQVA 3WPBA 2Z7XA 1KOOA 2CA6A 4MN8B 4RCWA 4V2DA 4R58A 4L3AA 5AWDA 2XWTC 2WQWA 3E6JA 1XKUA 2OMVA 3P72A 1DS9A 3ZYIA 2Z66A 1H6UA 4U09A 4J0MA 1A4YA 4P91A 4K17A 5GMGA 1OOKG 2V70A 2WFHA 4Q62A 3RFEA 4Z94G 1H6TA 1XECA 4QXEA 3VQ1A 2ELLA 3RGZA 3CIYA 2RA8A 1O6SA 4MQWX 3WPIA 4L3FA 3TSRE 4CC4C 1XEUA 2OMZA 5HZLB 3ZYNA
chains in the Genus database with same CATH superfamily
3W3MA 3UN9A 3C6NB 1M0ZA 4KNGA 2IFGA 3C6PB 4FDWA 2Q4GW 1G9UA 3G06A 5AZ5A 1OZNA 1XWDC 3BZ5A 3WPHA 4XGOA 1JL5A 3WPFA 2UZYA 4C2BB 4R09A 5D3IA 1FQVA 3ULUA 4CP6A 4R6FA 4R07A 4ECNA 3O6NA 5IJCA 4Q3GA 5GMHA 4P8SA 1O6VA 5GS0A 3W3NA 1KOHA 1PGVA 4LI1A 4LI2A 5CMNA 2BEXA 4Y61B 5HDHA 3C6OB 4RCAB 2Z7XB 1A9NA 3E4GA 1K5GC 3GOZA 4M7EA 3VQ2A 1WWLA 1SQ0B 1OGQA 4LSCA 3SB4A 3O53A 4CNCA 4QBZA 1M9SA 5AWCA 4BSUA 5LFNA 1P9AG 2Z82A 3REZA 2V9TB 3RW7A 1IO0A 2XOTA 5AWBA 4LSXC 4IM6A 4M7EC 4NKGA 1DFJI 4CC4A 4PSJA 3W3LA 2RR6A 4BSSA 2ID5A 4GLPA 4WYKA 2Z62A 2Y5QA 3RW6A 3M19A 1D0BA 3CIGA 1XCDA 4LSAA 1LTXA 4PERA 3RJ0A 4R6AA 4YEBB 4NZRM 4XOSA 2Z63A 4QC0A 1M9LA 4XSQA 2OMTA 3OJAA 5GS2B 4LXSA 1ZIWA 2P1NB 3RFSA 2JE0A 2UZXA 1K5DC 1QYYA 3JB9j 3WPDA 3W3KA 4OQTA 4R6GA 4R08A 2OMUA 3UL9A 4UFRA 4AW4A 4C2AB 4V2CA 1M10B 1P8VA 3E2JA 2Z64A 5B0NA 3UL7A 3KJ4A 4NKHA 1FO1A 4V2EA 4Z79A 4R6JA 2ASTB 2A0ZA 4CILA 2OMXA 3G3BA 1FS2A 3CVRA 4BSRA 4NZTM 4LSXA 2WQXA 2O6RA 4I6JB 1DCEA 4FCGA 1P8TA 1U0ND 2Z81A 2FT3A 2JQDA 2P1QB 4EZGA 3RFJA 1Z7XW 3RIZA 1OTMA 3FXIA 5GQRK 4G8AA 3ULVA 3WPGA 1GWBA 2Z65A 4BV4R 3PMHG 1O6TA 3ULAA 5AWAA 3W3GA 3G39A 4FS7A 5IYXC 2WQUA 4ARNA 1OTNA 5CMPA 2V9SA 3G3AA 4ECOA 4Z64C 4R5DA 2OMWA 3A79B 2P1MB 3DZEA 3ZYOA 4FD0A 3OGKB 4TZHA 4R5CA 1W8AA 3OGMB 4ARRA 2O6SA 4Q3IA 3UL8A 1FT8A 4AY9X 4KT1A 3OJAB 4HQ1A 4U08A 5IJDA 5B0TA 4B8CD 3E3ZA 4U06A 5A5CA 4J4LA 4KXFB 4R0AA 3W3JA 4RWTC 3WPCA 1YRGA 4CNMA 4FHOA 2OMYA 4H09A 4PKIG 5IJBA 3RGXA 3WPEA 2P1OB 4WP6A 4GT6A 3OGLB 5GMFA 1OTOA 3M18A 2P1PB 2O6QA 5B4PA 2ASSB 4U7LA 2JE1A 4Z61C 4LXRA 3ZYJA 4Z8GA 4PEQB 4FMZA 4PQ8A 3G04C 3WN4A 5FTTB 2BNHA 2R9UA 2WQVA 3WPBA 2Z7XA 1KOOA 2CA6A 4MN8B 4RCWA 4V2DA 4R58A 4L3AA 5AWDA 2XWTC 2WQWA 3E6JA 1XKUA 2OMVA 3P72A 1DS9A 3ZYIA 2Z66A 1H6UA 4U09A 4J0MA 1A4YA 4P91A 4K17A 5GMGA 1OOKG 2V70A 2WFHA 4Q62A 3RFEA 4Z94G 1H6TA 1XECA 4QXEA 3VQ1A 2ELLA 3RGZA 3CIYA 2RA8A 1O6SA 4MQWX 3WPIA 4L3FA 3TSRE 4CC4C 1XEUA 2OMZA 5HZLB 3ZYNA
chains in the Genus database with same CATH topology
3W3MA 3UN9A 3C6NB 1M0ZA 4KNGA 2IFGA 3C6PB 4FDWA 2Q4GW 1G9UA 3G06A 5AZ5A 1OZNA 1XWDC 3BZ5A 3WPHA 4XGOA 1JL5A 3WPFA 2UZYA 4C2BB 4R09A 5D3IA 1FQVA 3ULUA 4CP6A 4R6FA 4R07A 4ECNA 3O6NA 5IJCA 4Q3GA 5GMHA 4P8SA 1O6VA 5GS0A 3W3NA 1KOHA 1PGVA 4LI1A 4LI2A 5CMNA 2BEXA 4Y61B 5HDHA 3C6OB 4RCAB 2Z7XB 1A9NA 3E4GA 1K5GC 3GOZA 4M7EA 3VQ2A 1WWLA 1SQ0B 1OGQA 4LSCA 3SB4A 3O53A 4CNCA 4QBZA 1M9SA 5AWCA 4BSUA 5LFNA 1P9AG 2Z82A 3REZA 2V9TB 3RW7A 1IO0A 2XOTA 5AWBA 4LSXC 4IM6A 4M7EC 4NKGA 1DFJI 4CC4A 4PSJA 3W3LA 2RR6A 4BSSA 2ID5A 4GLPA 4WYKA 2Z62A 2Y5QA 3RW6A 3M19A 1D0BA 3CIGA 1XCDA 4LSAA 1LTXA 4PERA 3RJ0A 4R6AA 4YEBB 4XOSA 2Z63A 4QC0A 1M9LA 4XSQA 2OMTA 3OJAA 5GS2B 4LXSA 1ZIWA 2P1NB 3RFSA 2JE0A 2UZXA 1K5DC 1QYYA 3JB9j 3WPDA 3W3KA 4OQTA 4R6GA 4R08A 2OMUA 3UL9A 4UFRA 4AW4A 4C2AB 4V2CA 1M10B 1P8VA 3E2JA 2Z64A 5B0NA 3UL7A 3KJ4A 4NKHA 1FO1A 4V2EA 4Z79A 4R6JA 2ASTB 2A0ZA 4CILA 2OMXA 3G3BA 1FS2A 3CVRA 4BSRA 4LSXA 2WQXA 2O6RA 4I6JB 1DCEA 4FCGA 1P8TA 1U0ND 2Z81A 2FT3A 2JQDA 2P1QB 4EZGA 3RFJA 1Z7XW 3RIZA 1OTMA 3FXIA 5GQRK 4G8AA 3ULVA 3WPGA 1GWBA 2Z65A 4BV4R 3PMHG 1O6TA 3ULAA 5AWAA 3W3GA 3G39A 4FS7A 5IYXC 2WQUA 4ARNA 1OTNA 5CMPA 2V9SA 3G3AA 4ECOA 4Z64C 4R5DA 2OMWA 3A79B 2P1MB 3DZEA 3ZYOA 4FD0A 3OGKB 4TZHA 4R5CA 1W8AA 3OGMB 4ARRA 2O6SA 4Q3IA 3UL8A 1FT8A 4AY9X 4KT1A 3OJAB 4HQ1A 4U08A 5IJDA 5B0TA 4B8CD 3E3ZA 4U06A 5A5CA 4J4LA 4KXFB 4R0AA 3W3JA 4RWTC 3WPCA 1YRGA 4CNMA 4FHOA 2OMYA 4H09A 4PKIG 5IJBA 3RGXA 3WPEA 2P1OB 4WP6A 4GT6A 3OGLB 5GMFA 1OTOA 3M18A 2P1PB 2O6QA 5B4PA 2ASSB 4U7LA 2JE1A 4Z61C 4LXRA 3ZYJA 4Z8GA 4PEQB 4FMZA 4PQ8A 3G04C 3WN4A 5FTTB 2BNHA 2R9UA 2WQVA 3WPBA 2Z7XA 1KOOA 2CA6A 4MN8B 4RCWA 4V2DA 4R58A 4L3AA 5AWDA 2XWTC 2WQWA 3E6JA 1XKUA 2OMVA 3P72A 1DS9A 3ZYIA 2Z66A 1H6UA 4U09A 4J0MA 1A4YA 4P91A 4K17A 5GMGA 1OOKG 2V70A 2WFHA 4Q62A 3RFEA 4Z94G 1H6TA 1XECA 4QXEA 3VQ1A 2ELLA 3RGZA 3CIYA 2RA8A 1O6SA 4MQWX 3WPIA 4L3FA 3TSRE 4CC4C 1XEUA 2OMZA 5HZLB 3ZYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W3M A;  3UN9 A;  3C6N B;  1M0Z A;  4KNG A;  2IFG A;  3C6P B;  4FDW A;  2Q4G W;  1G9U A;  3G06 A;  5AZ5 A;  1OZN A;  1XWD C;  3BZ5 A;  3WPH A;  4XGO A;  1JL5 A;  3WPF A;  2UZY A;  4C2B B;  4R09 A;  5D3I A;  1FQV A;  3ULU A;  4CP6 A;  4R6F A;  4R07 A;  4ECN A;  3O6N A;  5IJC A;  4Q3G A;  5GMH A;  4P8S A;  1O6V A;  5GS0 A;  3W3N A;  1KOH A;  1PGV A;  4LI1 A;  4LI2 A;  5CMN A;  2BEX A;  4Y61 B;  5HDH A;  3C6O B;  4RCA B;  2Z7X B;  1A9N A;  3E4G A;  1K5G C;  3GOZ A;  4M7E A;  3VQ2 A;  1WWL A;  1SQ0 B;  1OGQ A;  4LSC A;  3SB4 A;  3O53 A;  4CNC A;  4QBZ A;  1M9S A;  5AWC A;  4BSU A;  5LFN A;  1P9A G;  2Z82 A;  3REZ A;  2V9T B;  3RW7 A;  1IO0 A;  2XOT A;  5AWB A;  4LSX C;  4IM6 A;  4M7E C;  4NKG A;  1DFJ I;  4CC4 A;  4PSJ A;  3W3L A;  2RR6 A;  4BSS A;  2ID5 A;  4GLP A;  4WYK A;  2Z62 A;  2Y5Q A;  3RW6 A;  3M19 A;  1D0B A;  3CIG A;  1XCD A;  4LSA A;  1LTX A;  4PER A;  3RJ0 A;  4R6A A;  4YEB B;  4XOS A;  2Z63 A;  4QC0 A;  1M9L A;  4XSQ A;  2OMT A;  3OJA A;  5GS2 B;  4LXS A;  1ZIW A;  2P1N B;  3RFS A;  2JE0 A;  2UZX A;  1K5D C;  1QYY A;  3JB9 j;  3WPD A;  3W3K A;  4OQT A;  4R6G A;  4R08 A;  2OMU A;  3UL9 A;  4UFR A;  4AW4 A;  4C2A B;  4V2C A;  1M10 B;  1P8V A;  3E2J A;  2Z64 A;  5B0N A;  3UL7 A;  3KJ4 A;  4NKH A;  1FO1 A;  4V2E A;  4Z79 A;  4R6J A;  2AST B;  2A0Z A;  4CIL A;  2OMX A;  3G3B A;  1FS2 A;  3CVR A;  4BSR A;  4LSX A;  2WQX A;  2O6R A;  4I6J B;  1DCE A;  4FCG A;  1P8T A;  1U0N D;  2Z81 A;  2FT3 A;  2JQD A;  2P1Q B;  4EZG A;  3RFJ A;  1Z7X W;  3RIZ A;  1OTM A;  3FXI A;  5GQR K;  4G8A A;  3ULV A;  3WPG A;  1GWB A;  2Z65 A;  4BV4 R;  3PMH G;  1O6T A;  3ULA A;  5AWA A;  3W3G A;  3G39 A;  4FS7 A;  5IYX C;  2WQU A;  4ARN A;  1OTN A;  5CMP A;  2V9S A;  3G3A A;  4ECO A;  4Z64 C;  4R5D A;  2OMW A;  3A79 B;  2P1M B;  3DZE A;  3ZYO A;  4FD0 A;  3OGK B;  4TZH A;  4R5C A;  1W8A A;  3OGM B;  4ARR A;  2O6S A;  4Q3I A;  3UL8 A;  1FT8 A;  4AY9 X;  4KT1 A;  3OJA B;  4HQ1 A;  4U08 A;  5IJD A;  5B0T A;  4B8C D;  3E3Z A;  4U06 A;  5A5C A;  4J4L A;  4KXF B;  4R0A A;  3W3J A;  4RWT C;  3WPC A;  1YRG A;  4CNM A;  4FHO A;  2OMY A;  4H09 A;  4PKI G;  5IJB A;  3RGX A;  3WPE A;  2P1O B;  4WP6 A;  4GT6 A;  3OGL B;  5GMF A;  1OTO A;  3M18 A;  2P1P B;  2O6Q A;  5B4P A;  2ASS B;  4U7L A;  2JE1 A;  4Z61 C;  4LXR A;  3ZYJ A;  4Z8G A;  4PEQ B;  4FMZ A;  4PQ8 A;  3G04 C;  3WN4 A;  5FTT B;  2BNH A;  2R9U A;  2WQV A;  3WPB A;  2Z7X A;  1KOO A;  2CA6 A;  4MN8 B;  4RCW A;  4V2D A;  4R58 A;  4L3A A;  5AWD A;  2XWT C;  2WQW A;  3E6J A;  1XKU A;  2OMV A;  3P72 A;  1DS9 A;  3ZYI A;  2Z66 A;  1H6U A;  4U09 A;  4J0M A;  1A4Y A;  4P91 A;  4K17 A;  5GMG A;  1OOK G;  2V70 A;  2WFH A;  4Q62 A;  3RFE A;  4Z94 G;  1H6T A;  1XEC A;  4QXE A;  3VQ1 A;  2ELL A;  3RGZ A;  3CIY A;  2RA8 A;  1O6S A;  4MQW X;  3WPI A;  4L3F A;  3TSR E;  4CC4 C;  1XEU A;  2OMZ A;  5HZL B;  3ZYN A; 
#chains in the Genus database with same CATH topology
 3W3M A;  3UN9 A;  3C6N B;  1M0Z A;  4KNG A;  2IFG A;  3C6P B;  4FDW A;  2Q4G W;  1G9U A;  3G06 A;  5AZ5 A;  1OZN A;  1XWD C;  3BZ5 A;  3WPH A;  4XGO A;  1JL5 A;  3WPF A;  2UZY A;  4C2B B;  4R09 A;  5D3I A;  1FQV A;  3ULU A;  4CP6 A;  4R6F A;  4R07 A;  4ECN A;  3O6N A;  5IJC A;  4Q3G A;  5GMH A;  4P8S A;  1O6V A;  5GS0 A;  3W3N A;  1KOH A;  1PGV A;  4LI1 A;  4LI2 A;  5CMN A;  2BEX A;  4Y61 B;  5HDH A;  3C6O B;  4RCA B;  2Z7X B;  1A9N A;  3E4G A;  1K5G C;  3GOZ A;  4M7E A;  3VQ2 A;  1WWL A;  1SQ0 B;  1OGQ A;  4LSC A;  3SB4 A;  3O53 A;  4CNC A;  4QBZ A;  1M9S A;  5AWC A;  4BSU A;  5LFN A;  1P9A G;  2Z82 A;  3REZ A;  2V9T B;  3RW7 A;  1IO0 A;  2XOT A;  5AWB A;  4LSX C;  4IM6 A;  4M7E C;  4NKG A;  1DFJ I;  4CC4 A;  4PSJ A;  3W3L A;  2RR6 A;  4BSS A;  2ID5 A;  4GLP A;  4WYK A;  2Z62 A;  2Y5Q A;  3RW6 A;  3M19 A;  1D0B A;  3CIG A;  1XCD A;  4LSA A;  1LTX A;  4PER A;  3RJ0 A;  4R6A A;  4YEB B;  4NZR M;  4XOS A;  2Z63 A;  4QC0 A;  1M9L A;  4XSQ A;  2OMT A;  3OJA A;  5GS2 B;  4LXS A;  1ZIW A;  2P1N B;  3RFS A;  2JE0 A;  2UZX A;  1K5D C;  1QYY A;  3JB9 j;  3WPD A;  3W3K A;  4OQT A;  4R6G A;  4R08 A;  2OMU A;  3UL9 A;  4UFR A;  4AW4 A;  4C2A B;  4V2C A;  1M10 B;  1P8V A;  3E2J A;  2Z64 A;  5B0N A;  3UL7 A;  3KJ4 A;  4NKH A;  1FO1 A;  4V2E A;  4Z79 A;  4R6J A;  2AST B;  2A0Z A;  4CIL A;  2OMX A;  3G3B A;  1FS2 A;  3CVR A;  4BSR A;  4NZT M;  4LSX A;  2WQX A;  2O6R A;  4I6J B;  1DCE A;  4FCG A;  1P8T A;  1U0N D;  2Z81 A;  2FT3 A;  2JQD A;  2P1Q B;  4EZG A;  3RFJ A;  1Z7X W;  3RIZ A;  1OTM A;  3FXI A;  5GQR K;  4G8A A;  3ULV A;  3WPG A;  1GWB A;  2Z65 A;  4BV4 R;  3PMH G;  1O6T A;  3ULA A;  5AWA A;  3W3G A;  3G39 A;  4FS7 A;  5IYX C;  2WQU A;  4ARN A;  1OTN A;  5CMP A;  2V9S A;  3G3A A;  4ECO A;  4Z64 C;  4R5D A;  2OMW A;  3A79 B;  2P1M B;  3DZE A;  3ZYO A;  4FD0 A;  3OGK B;  4TZH A;  4R5C A;  1W8A A;  3OGM B;  4ARR A;  2O6S A;  4Q3I A;  3UL8 A;  1FT8 A;  4AY9 X;  4KT1 A;  3OJA B;  4HQ1 A;  4U08 A;  5IJD A;  5B0T A;  4B8C D;  3E3Z A;  4U06 A;  5A5C A;  4J4L A;  4KXF B;  4R0A A;  3W3J A;  4RWT C;  3WPC A;  1YRG A;  4CNM A;  4FHO A;  2OMY A;  4H09 A;  4PKI G;  5IJB A;  3RGX A;  3WPE A;  2P1O B;  4WP6 A;  4GT6 A;  3OGL B;  5GMF A;  1OTO A;  3M18 A;  2P1P B;  2O6Q A;  5B4P A;  2ASS B;  4U7L A;  2JE1 A;  4Z61 C;  4LXR A;  3ZYJ A;  4Z8G A;  4PEQ B;  4FMZ A;  4PQ8 A;  3G04 C;  3WN4 A;  5FTT B;  2BNH A;  2R9U A;  2WQV A;  3WPB A;  2Z7X A;  1KOO A;  2CA6 A;  4MN8 B;  4RCW A;  4V2D A;  4R58 A;  4L3A A;  5AWD A;  2XWT C;  2WQW A;  3E6J A;  1XKU A;  2OMV A;  3P72 A;  1DS9 A;  3ZYI A;  2Z66 A;  1H6U A;  4U09 A;  4J0M A;  1A4Y A;  4P91 A;  4K17 A;  5GMG A;  1OOK G;  2V70 A;  2WFH A;  4Q62 A;  3RFE A;  4Z94 G;  1H6T A;  1XEC A;  4QXE A;  3VQ1 A;  2ELL A;  3RGZ A;  3CIY A;  2RA8 A;  1O6S A;  4MQW X;  3WPI A;  4L3F A;  3TSR E;  4CC4 C;  1XEU A;  2OMZ A;  5HZL B;  3ZYN A; 
#chains in the Genus database with same CATH homology
 3W3M A;  3UN9 A;  3C6N B;  1M0Z A;  4KNG A;  2IFG A;  3C6P B;  4FDW A;  2Q4G W;  1G9U A;  3G06 A;  5AZ5 A;  1OZN A;  1XWD C;  3BZ5 A;  3WPH A;  4XGO A;  1JL5 A;  3WPF A;  2UZY A;  4C2B B;  4R09 A;  5D3I A;  1FQV A;  3ULU A;  4CP6 A;  4R6F A;  4R07 A;  4ECN A;  3O6N A;  5IJC A;  4Q3G A;  5GMH A;  4P8S A;  1O6V A;  5GS0 A;  3W3N A;  1KOH A;  1PGV A;  4LI1 A;  4LI2 A;  5CMN A;  2BEX A;  4Y61 B;  5HDH A;  3C6O B;  4RCA B;  2Z7X B;  1A9N A;  3E4G A;  1K5G C;  3GOZ A;  4M7E A;  3VQ2 A;  1WWL A;  1SQ0 B;  1OGQ A;  4LSC A;  3SB4 A;  3O53 A;  4CNC A;  4QBZ A;  1M9S A;  5AWC A;  4BSU A;  5LFN A;  1P9A G;  2Z82 A;  3REZ A;  2V9T B;  3RW7 A;  1IO0 A;  2XOT A;  5AWB A;  4LSX C;  4IM6 A;  4M7E C;  4NKG A;  1DFJ I;  4CC4 A;  4PSJ A;  3W3L A;  2RR6 A;  4BSS A;  2ID5 A;  4GLP A;  4WYK A;  2Z62 A;  2Y5Q A;  3RW6 A;  3M19 A;  1D0B A;  3CIG A;  1XCD A;  4LSA A;  1LTX A;  4PER A;  3RJ0 A;  4R6A A;  4YEB B;  4XOS A;  2Z63 A;  4QC0 A;  1M9L A;  4XSQ A;  2OMT A;  3OJA A;  5GS2 B;  4LXS A;  1ZIW A;  2P1N B;  3RFS A;  2JE0 A;  2UZX A;  1K5D C;  1QYY A;  3JB9 j;  3WPD A;  3W3K A;  4OQT A;  4R6G A;  4R08 A;  2OMU A;  3UL9 A;  4UFR A;  4AW4 A;  4C2A B;  4V2C A;  1M10 B;  1P8V A;  3E2J A;  2Z64 A;  5B0N A;  3UL7 A;  3KJ4 A;  4NKH A;  1FO1 A;  4V2E A;  4Z79 A;  4R6J A;  2AST B;  2A0Z A;  4CIL A;  2OMX A;  3G3B A;  1FS2 A;  3CVR A;  4BSR A;  4LSX A;  2WQX A;  2O6R A;  4I6J B;  1DCE A;  4FCG A;  1P8T A;  1U0N D;  2Z81 A;  2FT3 A;  2JQD A;  2P1Q B;  4EZG A;  3RFJ A;  1Z7X W;  3RIZ A;  1OTM A;  3FXI A;  5GQR K;  4G8A A;  3ULV A;  3WPG A;  1GWB A;  2Z65 A;  4BV4 R;  3PMH G;  1O6T A;  3ULA A;  5AWA A;  3W3G A;  3G39 A;  4FS7 A;  5IYX C;  2WQU A;  4ARN A;  1OTN A;  5CMP A;  2V9S A;  3G3A A;  4ECO A;  4Z64 C;  4R5D A;  2OMW A;  3A79 B;  2P1M B;  3DZE A;  3ZYO A;  4FD0 A;  3OGK B;  4TZH A;  4R5C A;  1W8A A;  3OGM B;  4ARR A;  2O6S A;  4Q3I A;  3UL8 A;  1FT8 A;  4AY9 X;  4KT1 A;  3OJA B;  4HQ1 A;  4U08 A;  5IJD A;  5B0T A;  4B8C D;  3E3Z A;  4U06 A;  5A5C A;  4J4L A;  4KXF B;  4R0A A;  3W3J A;  4RWT C;  3WPC A;  1YRG A;  4CNM A;  4FHO A;  2OMY A;  4H09 A;  4PKI G;  5IJB A;  3RGX A;  3WPE A;  2P1O B;  4WP6 A;  4GT6 A;  3OGL B;  5GMF A;  1OTO A;  3M18 A;  2P1P B;  2O6Q A;  5B4P A;  2ASS B;  4U7L A;  2JE1 A;  4Z61 C;  4LXR A;  3ZYJ A;  4Z8G A;  4PEQ B;  4FMZ A;  4PQ8 A;  3G04 C;  3WN4 A;  5FTT B;  2BNH A;  2R9U A;  2WQV A;  3WPB A;  2Z7X A;  1KOO A;  2CA6 A;  4MN8 B;  4RCW A;  4V2D A;  4R58 A;  4L3A A;  5AWD A;  2XWT C;  2WQW A;  3E6J A;  1XKU A;  2OMV A;  3P72 A;  1DS9 A;  3ZYI A;  2Z66 A;  1H6U A;  4U09 A;  4J0M A;  1A4Y A;  4P91 A;  4K17 A;  5GMG A;  1OOK G;  2V70 A;  2WFH A;  4Q62 A;  3RFE A;  4Z94 G;  1H6T A;  1XEC A;  4QXE A;  3VQ1 A;  2ELL A;  3RGZ A;  3CIY A;  2RA8 A;  1O6S A;  4MQW X;  3WPI A;  4L3F A;  3TSR E;  4CC4 C;  1XEU A;  2OMZ A;  5HZL B;  3ZYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...