3P72A

Structure of platelet glycoprotein 1b alpha with a bound peptide inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
269
structure length
269
Chain Sequence
b'HPICEVSKVASHLEVNCDKRQLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNQLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib alpha chain
publication title Glycoprotein Ibalpha inhibitor complex structure reveals a combined steric and allosteric mechanism of von Willebrand factor antagonism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/inhibitor
total genus 74
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3p72A00
3ULVA 2ASSB 3ZYIA 1P9AG 5CMNA 4R6JA 2FT3A 1OTMA 2XOTA 3E4GA 5B4PA 4CNMA 4FS7A 4R5CA 3UL9A 4R5DA 2Z7XB 5AWAA 3SB4A 1XCDA 4CNCA 4P8SA 3JB9j 4LXSA 3W3LA 3RJ0A 3KJ4A 4KT1A 4Z64C 2Q4GW 3A79B 4PKIG 4XSQA 1PGVA 3W3MA 1GWBA 5GMHA 2ID5A 4B8CD 2P1PB 2P1QB 4FDWA 5AWBA 4GT6A 4ECOA 4ARRA 2IFGA 4LSXC 3W3JA 2UZYA 2P1OB 3OGMB 5GS2B 3P72A 2OMVA 1OOKG 1OTOA 4NKHA 4LI1A 4XGOA 4ARNA 4LSAA 2Z82A 2JE0A 1M10B 5IJBA 3UL8A 4WYKA 3RFEA 3OJAB 1A9NA 2OMZA 5GQRK 1H6UA 1OGQA 3M18A 3G06A 1IO0A 4P91A 2OMUA 4CC4C 3VQ2A 4BV4R 1SQ0B 4ECNA 3C6OB 5HDHA 4V2DA 4C2AB 4EZGA 1XECA 3RFSA 5D3IA 3CIGA 4V2CA 4OQTA 2WFHA 1QYYA 4C2BB 3ZYOA 5FTTB 3WPIA 4TZHA 4Z61C 2BEXA 2Z66A 1ZIWA 4RWTC 4RCWA 2CA6A 1D0BA 4R0AA 2OMWA 3ULAA 1XWDC 1U0ND 2P1MB 4BSSA 3FXIA 4Q62A 2O6RA 3TSRE 2Z65A 2Z7XA 4LSXA 3WPGA 1H6TA 1KOHA 2RA8A 2Y5QA 2OMYA 2BNHA 4G8AA 2O6QA 4YEBB 4L3FA 4J4LA 4R08A 1P8VA 3OGLB 3C6PB 1JL5A 2UZXA 3RW6A 1YRGA 2Z64A 1M9LA 2O6SA 4Q3GA 4Z8GA 5IJCA 4R6GA 3OGKB 2Z81A 3ZYNA 4LI2A 4CC4A 1XKUA 1O6SA 2WQVA 4M7EA 3REZA 3W3KA 1OZNA 4Z79A 4U08A 2JE1A 1FS2A 3UN9A 1M0ZA 4PQ8A 3WN4A 3OJAA 3RIZA 4FD0A 3M19A 5AWDA 4KNGA 4IM6A 1FT8A 3E3ZA 1DS9A 4UFRA 3WPCA 4R09A 3O53A 3WPDA 1LTXA 3BZ5A 4RCAB 3RGXA 5B0TA 1P8TA 5HZLB 4QBZA 4FMZA 3G3AA 3O6NA 4CILA 1OTNA 4Y61B 5AWCA 4HQ1A 3W3GA 4PEQB 1W8AA 4KXFB 3E2JA 1KOOA 2ELLA 5AZ5A 4WP6A 2WQUA 4R07A 5GMFA 4NKGA 3C6NB 2ASTB 1O6TA 1XEUA 3VQ1A 2OMTA 2R9UA 3WPEA 5GS0A 3G3BA 4H09A 4PERA 2XWTC 5A5CA 4MN8B 3RFJA 3WPHA 1WWLA 4J0MA 1FO1A 5GMGA 3WPFA 1A4YA 1K5DC 5CMPA 3PMHG 3ULUA 4U7LA 4FCGA 2OMXA 1DCEA 4U06A 2Z62A 5B0NA 2RR6A 2A0ZA 1FQVA 3CVRA 1O6VA 3DZEA 4AY9X 3GOZA 4QXEA 4R6AA 5IYXC 3ZYJA 1DFJI 3W3NA 4PSJA 4CP6A 3CIYA 3G39A 4R58A 4LXRA 4Q3IA 4BSUA 4U09A 4L3AA 4Z94G 4V2EA 4K17A 4GLPA 4BSRA 4AW4A 4FHOA 2V70A 1G9UA 2P1NB 4LSCA 4MQWX 1M9SA 2V9TB 5LFNA 2V9SA 4R6FA 5IJDA 1K5GC 2Z63A 3RGZA 2WQXA 3UL7A 2JQDA 3RW7A 1Z7XW 4M7EC 4XOSA 2WQWA 4I6JB 4QC0A 3E6JA 3G04C 3WPBA
chains in the Genus database with same CATH superfamily
3ULVA 2ASSB 3ZYIA 4NZTM 1P9AG 5CMNA 4R6JA 2FT3A 1OTMA 2XOTA 3E4GA 5B4PA 4CNMA 4FS7A 4R5CA 3UL9A 4R5DA 2Z7XB 5AWAA 3SB4A 1XCDA 4CNCA 4P8SA 3JB9j 4LXSA 3W3LA 3RJ0A 3KJ4A 4KT1A 4Z64C 2Q4GW 3A79B 4PKIG 4XSQA 1PGVA 3W3MA 1GWBA 5GMHA 2ID5A 4B8CD 2P1PB 2P1QB 4FDWA 5AWBA 4GT6A 4ECOA 4ARRA 2IFGA 4LSXC 3W3JA 2UZYA 2P1OB 3OGMB 5GS2B 3P72A 2OMVA 1OOKG 1OTOA 4NKHA 4LI1A 4XGOA 4ARNA 4LSAA 2Z82A 2JE0A 1M10B 5IJBA 3UL8A 4WYKA 3RFEA 3OJAB 1A9NA 2OMZA 5GQRK 1H6UA 1OGQA 3M18A 3G06A 1IO0A 4P91A 2OMUA 4CC4C 3VQ2A 4BV4R 1SQ0B 4ECNA 3C6OB 5HDHA 4V2DA 4C2AB 4EZGA 1XECA 3RFSA 5D3IA 3CIGA 4V2CA 4OQTA 2WFHA 1QYYA 4C2BB 3ZYOA 5FTTB 3WPIA 4NZRM 4TZHA 4Z61C 2BEXA 2Z66A 1ZIWA 4RWTC 4RCWA 2CA6A 1D0BA 4R0AA 2OMWA 3ULAA 1XWDC 1U0ND 2P1MB 4BSSA 3FXIA 4Q62A 2O6RA 3TSRE 2Z65A 2Z7XA 4LSXA 3WPGA 1H6TA 1KOHA 2RA8A 2Y5QA 2OMYA 2BNHA 4G8AA 2O6QA 4YEBB 4L3FA 4J4LA 4R08A 1P8VA 3OGLB 3C6PB 1JL5A 2UZXA 3RW6A 1YRGA 2Z64A 1M9LA 2O6SA 4Q3GA 4Z8GA 5IJCA 4R6GA 3OGKB 2Z81A 3ZYNA 4LI2A 4CC4A 1XKUA 1O6SA 2WQVA 4M7EA 3REZA 3W3KA 1OZNA 4Z79A 4U08A 2JE1A 1FS2A 3UN9A 1M0ZA 4PQ8A 3WN4A 3OJAA 3RIZA 4FD0A 3M19A 5AWDA 4KNGA 4IM6A 1FT8A 3E3ZA 1DS9A 4UFRA 3WPCA 4R09A 3O53A 3WPDA 1LTXA 3BZ5A 4RCAB 3RGXA 5B0TA 1P8TA 5HZLB 4QBZA 4FMZA 3G3AA 3O6NA 4CILA 1OTNA 4Y61B 5AWCA 4HQ1A 3W3GA 4PEQB 1W8AA 4KXFB 3E2JA 1KOOA 2ELLA 5AZ5A 4WP6A 2WQUA 4R07A 5GMFA 4NKGA 3C6NB 2ASTB 1O6TA 1XEUA 3VQ1A 2OMTA 2R9UA 3WPEA 5GS0A 3G3BA 4H09A 4PERA 2XWTC 5A5CA 4MN8B 3RFJA 3WPHA 1WWLA 4J0MA 1FO1A 5GMGA 3WPFA 1A4YA 1K5DC 5CMPA 3PMHG 3ULUA 4U7LA 4FCGA 2OMXA 1DCEA 4U06A 2Z62A 5B0NA 2RR6A 2A0ZA 1FQVA 3CVRA 1O6VA 3DZEA 4AY9X 3GOZA 4QXEA 4R6AA 5IYXC 3ZYJA 1DFJI 3W3NA 4PSJA 4CP6A 3CIYA 3G39A 4R58A 4LXRA 4Q3IA 4BSUA 4U09A 4L3AA 4Z94G 4V2EA 4K17A 4GLPA 4BSRA 4AW4A 4FHOA 2V70A 1G9UA 2P1NB 4LSCA 4MQWX 1M9SA 2V9TB 5LFNA 2V9SA 4R6FA 5IJDA 1K5GC 2Z63A 3RGZA 2WQXA 3UL7A 2JQDA 3RW7A 1Z7XW 4M7EC 4XOSA 2WQWA 4I6JB 4QC0A 3E6JA 3G04C 3WPBA
chains in the Genus database with same CATH topology
3ULVA 2ASSB 3ZYIA 1P9AG 5CMNA 4R6JA 2FT3A 1OTMA 2XOTA 3E4GA 5B4PA 4CNMA 4FS7A 4R5CA 3UL9A 4R5DA 2Z7XB 5AWAA 3SB4A 1XCDA 4CNCA 4P8SA 3JB9j 4LXSA 3W3LA 3RJ0A 3KJ4A 4KT1A 4Z64C 2Q4GW 3A79B 4PKIG 4XSQA 1PGVA 3W3MA 1GWBA 5GMHA 2ID5A 4B8CD 2P1PB 2P1QB 4FDWA 5AWBA 4GT6A 4ECOA 4ARRA 2IFGA 4LSXC 3W3JA 2UZYA 2P1OB 3OGMB 5GS2B 3P72A 2OMVA 1OOKG 1OTOA 4NKHA 4LI1A 4XGOA 4ARNA 4LSAA 2Z82A 2JE0A 1M10B 5IJBA 3UL8A 4WYKA 3RFEA 3OJAB 1A9NA 2OMZA 5GQRK 1H6UA 1OGQA 3M18A 3G06A 1IO0A 4P91A 2OMUA 4CC4C 3VQ2A 4BV4R 1SQ0B 4ECNA 3C6OB 5HDHA 4V2DA 4C2AB 4EZGA 1XECA 3RFSA 5D3IA 3CIGA 4V2CA 4OQTA 2WFHA 1QYYA 4C2BB 3ZYOA 5FTTB 3WPIA 4TZHA 4Z61C 2BEXA 2Z66A 1ZIWA 4RWTC 4RCWA 2CA6A 1D0BA 4R0AA 2OMWA 3ULAA 1XWDC 1U0ND 2P1MB 4BSSA 3FXIA 4Q62A 2O6RA 3TSRE 2Z65A 2Z7XA 4LSXA 3WPGA 1H6TA 1KOHA 2RA8A 2Y5QA 2OMYA 2BNHA 4G8AA 2O6QA 4YEBB 4L3FA 4J4LA 4R08A 1P8VA 3OGLB 3C6PB 1JL5A 2UZXA 3RW6A 1YRGA 2Z64A 1M9LA 2O6SA 4Q3GA 4Z8GA 5IJCA 4R6GA 3OGKB 2Z81A 3ZYNA 4LI2A 4CC4A 1XKUA 1O6SA 2WQVA 4M7EA 3REZA 3W3KA 1OZNA 4Z79A 4U08A 2JE1A 1FS2A 3UN9A 1M0ZA 4PQ8A 3WN4A 3OJAA 3RIZA 4FD0A 3M19A 5AWDA 4KNGA 4IM6A 1FT8A 3E3ZA 1DS9A 4UFRA 3WPCA 4R09A 3O53A 3WPDA 1LTXA 3BZ5A 4RCAB 3RGXA 5B0TA 1P8TA 5HZLB 4QBZA 4FMZA 3G3AA 3O6NA 4CILA 1OTNA 4Y61B 5AWCA 4HQ1A 3W3GA 4PEQB 1W8AA 4KXFB 3E2JA 1KOOA 2ELLA 5AZ5A 4WP6A 2WQUA 4R07A 5GMFA 4NKGA 3C6NB 2ASTB 1O6TA 1XEUA 3VQ1A 2OMTA 2R9UA 3WPEA 5GS0A 3G3BA 4H09A 4PERA 2XWTC 5A5CA 4MN8B 3RFJA 3WPHA 1WWLA 4J0MA 1FO1A 5GMGA 3WPFA 1A4YA 1K5DC 5CMPA 3PMHG 3ULUA 4U7LA 4FCGA 2OMXA 1DCEA 4U06A 2Z62A 5B0NA 2RR6A 2A0ZA 1FQVA 3CVRA 1O6VA 3DZEA 4AY9X 3GOZA 4QXEA 4R6AA 5IYXC 3ZYJA 1DFJI 3W3NA 4PSJA 4CP6A 3CIYA 3G39A 4R58A 4LXRA 4Q3IA 4BSUA 4U09A 4L3AA 4Z94G 4V2EA 4K17A 4GLPA 4BSRA 4AW4A 4FHOA 2V70A 1G9UA 2P1NB 4LSCA 4MQWX 1M9SA 2V9TB 5LFNA 2V9SA 4R6FA 5IJDA 1K5GC 2Z63A 3RGZA 2WQXA 3UL7A 2JQDA 3RW7A 1Z7XW 4M7EC 4XOSA 2WQWA 4I6JB 4QC0A 3E6JA 3G04C 3WPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULV A;  2ASS B;  3ZYI A;  1P9A G;  5CMN A;  4R6J A;  2FT3 A;  1OTM A;  2XOT A;  3E4G A;  5B4P A;  4CNM A;  4FS7 A;  4R5C A;  3UL9 A;  4R5D A;  2Z7X B;  5AWA A;  3SB4 A;  1XCD A;  4CNC A;  4P8S A;  3JB9 j;  4LXS A;  3W3L A;  3RJ0 A;  3KJ4 A;  4KT1 A;  4Z64 C;  2Q4G W;  3A79 B;  4PKI G;  4XSQ A;  1PGV A;  3W3M A;  1GWB A;  5GMH A;  2ID5 A;  4B8C D;  2P1P B;  2P1Q B;  4FDW A;  5AWB A;  4GT6 A;  4ECO A;  4ARR A;  2IFG A;  4LSX C;  3W3J A;  2UZY A;  2P1O B;  3OGM B;  5GS2 B;  3P72 A;  2OMV A;  1OOK G;  1OTO A;  4NKH A;  4LI1 A;  4XGO A;  4ARN A;  4LSA A;  2Z82 A;  2JE0 A;  1M10 B;  5IJB A;  3UL8 A;  4WYK A;  3RFE A;  3OJA B;  1A9N A;  2OMZ A;  5GQR K;  1H6U A;  1OGQ A;  3M18 A;  3G06 A;  1IO0 A;  4P91 A;  2OMU A;  4CC4 C;  3VQ2 A;  4BV4 R;  1SQ0 B;  4ECN A;  3C6O B;  5HDH A;  4V2D A;  4C2A B;  4EZG A;  1XEC A;  3RFS A;  5D3I A;  3CIG A;  4V2C A;  4OQT A;  2WFH A;  1QYY A;  4C2B B;  3ZYO A;  5FTT B;  3WPI A;  4TZH A;  4Z61 C;  2BEX A;  2Z66 A;  1ZIW A;  4RWT C;  4RCW A;  2CA6 A;  1D0B A;  4R0A A;  2OMW A;  3ULA A;  1XWD C;  1U0N D;  2P1M B;  4BSS A;  3FXI A;  4Q62 A;  2O6R A;  3TSR E;  2Z65 A;  2Z7X A;  4LSX A;  3WPG A;  1H6T A;  1KOH A;  2RA8 A;  2Y5Q A;  2OMY A;  2BNH A;  4G8A A;  2O6Q A;  4YEB B;  4L3F A;  4J4L A;  4R08 A;  1P8V A;  3OGL B;  3C6P B;  1JL5 A;  2UZX A;  3RW6 A;  1YRG A;  2Z64 A;  1M9L A;  2O6S A;  4Q3G A;  4Z8G A;  5IJC A;  4R6G A;  3OGK B;  2Z81 A;  3ZYN A;  4LI2 A;  4CC4 A;  1XKU A;  1O6S A;  2WQV A;  4M7E A;  3REZ A;  3W3K A;  1OZN A;  4Z79 A;  4U08 A;  2JE1 A;  1FS2 A;  3UN9 A;  1M0Z A;  4PQ8 A;  3WN4 A;  3OJA A;  3RIZ A;  4FD0 A;  3M19 A;  5AWD A;  4KNG A;  4IM6 A;  1FT8 A;  3E3Z A;  1DS9 A;  4UFR A;  3WPC A;  4R09 A;  3O53 A;  3WPD A;  1LTX A;  3BZ5 A;  4RCA B;  3RGX A;  5B0T A;  1P8T A;  5HZL B;  4QBZ A;  4FMZ A;  3G3A A;  3O6N A;  4CIL A;  1OTN A;  4Y61 B;  5AWC A;  4HQ1 A;  3W3G A;  4PEQ B;  1W8A A;  4KXF B;  3E2J A;  1KOO A;  2ELL A;  5AZ5 A;  4WP6 A;  2WQU A;  4R07 A;  5GMF A;  4NKG A;  3C6N B;  2AST B;  1O6T A;  1XEU A;  3VQ1 A;  2OMT A;  2R9U A;  3WPE A;  5GS0 A;  3G3B A;  4H09 A;  4PER A;  2XWT C;  5A5C A;  4MN8 B;  3RFJ A;  3WPH A;  1WWL A;  4J0M A;  1FO1 A;  5GMG A;  3WPF A;  1A4Y A;  1K5D C;  5CMP A;  3PMH G;  3ULU A;  4U7L A;  4FCG A;  2OMX A;  1DCE A;  4U06 A;  2Z62 A;  5B0N A;  2RR6 A;  2A0Z A;  1FQV A;  3CVR A;  1O6V A;  3DZE A;  4AY9 X;  3GOZ A;  4QXE A;  4R6A A;  5IYX C;  3ZYJ A;  1DFJ I;  3W3N A;  4PSJ A;  4CP6 A;  3CIY A;  3G39 A;  4R58 A;  4LXR A;  4Q3I A;  4BSU A;  4U09 A;  4L3A A;  4Z94 G;  4V2E A;  4K17 A;  4GLP A;  4BSR A;  4AW4 A;  4FHO A;  2V70 A;  1G9U A;  2P1N B;  4LSC A;  4MQW X;  1M9S A;  2V9T B;  5LFN A;  2V9S A;  4R6F A;  5IJD A;  1K5G C;  2Z63 A;  3RGZ A;  2WQX A;  3UL7 A;  2JQD A;  3RW7 A;  1Z7X W;  4M7E C;  4XOS A;  2WQW A;  4I6J B;  4QC0 A;  3E6J A;  3G04 C;  3WPB A; 
#chains in the Genus database with same CATH topology
 3ULV A;  2ASS B;  3ZYI A;  4NZT M;  1P9A G;  5CMN A;  4R6J A;  2FT3 A;  1OTM A;  2XOT A;  3E4G A;  5B4P A;  4CNM A;  4FS7 A;  4R5C A;  3UL9 A;  4R5D A;  2Z7X B;  5AWA A;  3SB4 A;  1XCD A;  4CNC A;  4P8S A;  3JB9 j;  4LXS A;  3W3L A;  3RJ0 A;  3KJ4 A;  4KT1 A;  4Z64 C;  2Q4G W;  3A79 B;  4PKI G;  4XSQ A;  1PGV A;  3W3M A;  1GWB A;  5GMH A;  2ID5 A;  4B8C D;  2P1P B;  2P1Q B;  4FDW A;  5AWB A;  4GT6 A;  4ECO A;  4ARR A;  2IFG A;  4LSX C;  3W3J A;  2UZY A;  2P1O B;  3OGM B;  5GS2 B;  3P72 A;  2OMV A;  1OOK G;  1OTO A;  4NKH A;  4LI1 A;  4XGO A;  4ARN A;  4LSA A;  2Z82 A;  2JE0 A;  1M10 B;  5IJB A;  3UL8 A;  4WYK A;  3RFE A;  3OJA B;  1A9N A;  2OMZ A;  5GQR K;  1H6U A;  1OGQ A;  3M18 A;  3G06 A;  1IO0 A;  4P91 A;  2OMU A;  4CC4 C;  3VQ2 A;  4BV4 R;  1SQ0 B;  4ECN A;  3C6O B;  5HDH A;  4V2D A;  4C2A B;  4EZG A;  1XEC A;  3RFS A;  5D3I A;  3CIG A;  4V2C A;  4OQT A;  2WFH A;  1QYY A;  4C2B B;  3ZYO A;  5FTT B;  3WPI A;  4NZR M;  4TZH A;  4Z61 C;  2BEX A;  2Z66 A;  1ZIW A;  4RWT C;  4RCW A;  2CA6 A;  1D0B A;  4R0A A;  2OMW A;  3ULA A;  1XWD C;  1U0N D;  2P1M B;  4BSS A;  3FXI A;  4Q62 A;  2O6R A;  3TSR E;  2Z65 A;  2Z7X A;  4LSX A;  3WPG A;  1H6T A;  1KOH A;  2RA8 A;  2Y5Q A;  2OMY A;  2BNH A;  4G8A A;  2O6Q A;  4YEB B;  4L3F A;  4J4L A;  4R08 A;  1P8V A;  3OGL B;  3C6P B;  1JL5 A;  2UZX A;  3RW6 A;  1YRG A;  2Z64 A;  1M9L A;  2O6S A;  4Q3G A;  4Z8G A;  5IJC A;  4R6G A;  3OGK B;  2Z81 A;  3ZYN A;  4LI2 A;  4CC4 A;  1XKU A;  1O6S A;  2WQV A;  4M7E A;  3REZ A;  3W3K A;  1OZN A;  4Z79 A;  4U08 A;  2JE1 A;  1FS2 A;  3UN9 A;  1M0Z A;  4PQ8 A;  3WN4 A;  3OJA A;  3RIZ A;  4FD0 A;  3M19 A;  5AWD A;  4KNG A;  4IM6 A;  1FT8 A;  3E3Z A;  1DS9 A;  4UFR A;  3WPC A;  4R09 A;  3O53 A;  3WPD A;  1LTX A;  3BZ5 A;  4RCA B;  3RGX A;  5B0T A;  1P8T A;  5HZL B;  4QBZ A;  4FMZ A;  3G3A A;  3O6N A;  4CIL A;  1OTN A;  4Y61 B;  5AWC A;  4HQ1 A;  3W3G A;  4PEQ B;  1W8A A;  4KXF B;  3E2J A;  1KOO A;  2ELL A;  5AZ5 A;  4WP6 A;  2WQU A;  4R07 A;  5GMF A;  4NKG A;  3C6N B;  2AST B;  1O6T A;  1XEU A;  3VQ1 A;  2OMT A;  2R9U A;  3WPE A;  5GS0 A;  3G3B A;  4H09 A;  4PER A;  2XWT C;  5A5C A;  4MN8 B;  3RFJ A;  3WPH A;  1WWL A;  4J0M A;  1FO1 A;  5GMG A;  3WPF A;  1A4Y A;  1K5D C;  5CMP A;  3PMH G;  3ULU A;  4U7L A;  4FCG A;  2OMX A;  1DCE A;  4U06 A;  2Z62 A;  5B0N A;  2RR6 A;  2A0Z A;  1FQV A;  3CVR A;  1O6V A;  3DZE A;  4AY9 X;  3GOZ A;  4QXE A;  4R6A A;  5IYX C;  3ZYJ A;  1DFJ I;  3W3N A;  4PSJ A;  4CP6 A;  3CIY A;  3G39 A;  4R58 A;  4LXR A;  4Q3I A;  4BSU A;  4U09 A;  4L3A A;  4Z94 G;  4V2E A;  4K17 A;  4GLP A;  4BSR A;  4AW4 A;  4FHO A;  2V70 A;  1G9U A;  2P1N B;  4LSC A;  4MQW X;  1M9S A;  2V9T B;  5LFN A;  2V9S A;  4R6F A;  5IJD A;  1K5G C;  2Z63 A;  3RGZ A;  2WQX A;  3UL7 A;  2JQD A;  3RW7 A;  1Z7X W;  4M7E C;  4XOS A;  2WQW A;  4I6J B;  4QC0 A;  3E6J A;  3G04 C;  3WPB A; 
#chains in the Genus database with same CATH homology
 3ULV A;  2ASS B;  3ZYI A;  1P9A G;  5CMN A;  4R6J A;  2FT3 A;  1OTM A;  2XOT A;  3E4G A;  5B4P A;  4CNM A;  4FS7 A;  4R5C A;  3UL9 A;  4R5D A;  2Z7X B;  5AWA A;  3SB4 A;  1XCD A;  4CNC A;  4P8S A;  3JB9 j;  4LXS A;  3W3L A;  3RJ0 A;  3KJ4 A;  4KT1 A;  4Z64 C;  2Q4G W;  3A79 B;  4PKI G;  4XSQ A;  1PGV A;  3W3M A;  1GWB A;  5GMH A;  2ID5 A;  4B8C D;  2P1P B;  2P1Q B;  4FDW A;  5AWB A;  4GT6 A;  4ECO A;  4ARR A;  2IFG A;  4LSX C;  3W3J A;  2UZY A;  2P1O B;  3OGM B;  5GS2 B;  3P72 A;  2OMV A;  1OOK G;  1OTO A;  4NKH A;  4LI1 A;  4XGO A;  4ARN A;  4LSA A;  2Z82 A;  2JE0 A;  1M10 B;  5IJB A;  3UL8 A;  4WYK A;  3RFE A;  3OJA B;  1A9N A;  2OMZ A;  5GQR K;  1H6U A;  1OGQ A;  3M18 A;  3G06 A;  1IO0 A;  4P91 A;  2OMU A;  4CC4 C;  3VQ2 A;  4BV4 R;  1SQ0 B;  4ECN A;  3C6O B;  5HDH A;  4V2D A;  4C2A B;  4EZG A;  1XEC A;  3RFS A;  5D3I A;  3CIG A;  4V2C A;  4OQT A;  2WFH A;  1QYY A;  4C2B B;  3ZYO A;  5FTT B;  3WPI A;  4TZH A;  4Z61 C;  2BEX A;  2Z66 A;  1ZIW A;  4RWT C;  4RCW A;  2CA6 A;  1D0B A;  4R0A A;  2OMW A;  3ULA A;  1XWD C;  1U0N D;  2P1M B;  4BSS A;  3FXI A;  4Q62 A;  2O6R A;  3TSR E;  2Z65 A;  2Z7X A;  4LSX A;  3WPG A;  1H6T A;  1KOH A;  2RA8 A;  2Y5Q A;  2OMY A;  2BNH A;  4G8A A;  2O6Q A;  4YEB B;  4L3F A;  4J4L A;  4R08 A;  1P8V A;  3OGL B;  3C6P B;  1JL5 A;  2UZX A;  3RW6 A;  1YRG A;  2Z64 A;  1M9L A;  2O6S A;  4Q3G A;  4Z8G A;  5IJC A;  4R6G A;  3OGK B;  2Z81 A;  3ZYN A;  4LI2 A;  4CC4 A;  1XKU A;  1O6S A;  2WQV A;  4M7E A;  3REZ A;  3W3K A;  1OZN A;  4Z79 A;  4U08 A;  2JE1 A;  1FS2 A;  3UN9 A;  1M0Z A;  4PQ8 A;  3WN4 A;  3OJA A;  3RIZ A;  4FD0 A;  3M19 A;  5AWD A;  4KNG A;  4IM6 A;  1FT8 A;  3E3Z A;  1DS9 A;  4UFR A;  3WPC A;  4R09 A;  3O53 A;  3WPD A;  1LTX A;  3BZ5 A;  4RCA B;  3RGX A;  5B0T A;  1P8T A;  5HZL B;  4QBZ A;  4FMZ A;  3G3A A;  3O6N A;  4CIL A;  1OTN A;  4Y61 B;  5AWC A;  4HQ1 A;  3W3G A;  4PEQ B;  1W8A A;  4KXF B;  3E2J A;  1KOO A;  2ELL A;  5AZ5 A;  4WP6 A;  2WQU A;  4R07 A;  5GMF A;  4NKG A;  3C6N B;  2AST B;  1O6T A;  1XEU A;  3VQ1 A;  2OMT A;  2R9U A;  3WPE A;  5GS0 A;  3G3B A;  4H09 A;  4PER A;  2XWT C;  5A5C A;  4MN8 B;  3RFJ A;  3WPH A;  1WWL A;  4J0M A;  1FO1 A;  5GMG A;  3WPF A;  1A4Y A;  1K5D C;  5CMP A;  3PMH G;  3ULU A;  4U7L A;  4FCG A;  2OMX A;  1DCE A;  4U06 A;  2Z62 A;  5B0N A;  2RR6 A;  2A0Z A;  1FQV A;  3CVR A;  1O6V A;  3DZE A;  4AY9 X;  3GOZ A;  4QXE A;  4R6A A;  5IYX C;  3ZYJ A;  1DFJ I;  3W3N A;  4PSJ A;  4CP6 A;  3CIY A;  3G39 A;  4R58 A;  4LXR A;  4Q3I A;  4BSU A;  4U09 A;  4L3A A;  4Z94 G;  4V2E A;  4K17 A;  4GLP A;  4BSR A;  4AW4 A;  4FHO A;  2V70 A;  1G9U A;  2P1N B;  4LSC A;  4MQW X;  1M9S A;  2V9T B;  5LFN A;  2V9S A;  4R6F A;  5IJD A;  1K5G C;  2Z63 A;  3RGZ A;  2WQX A;  3UL7 A;  2JQD A;  3RW7 A;  1Z7X W;  4M7E C;  4XOS A;  2WQW A;  4I6J B;  4QC0 A;  3E6J A;  3G04 C;  3WPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...