3P79A

P38 inhibitor-bound
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
348
structure length
332
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of a novel class of non-ATP site DFG-out state p38 inhibitors utilizing computationally assisted virtual fragment-based drug design (vFBDD).
pubmed doi rcsb
source organism Mus musculus
total genus 107
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p79A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p79A01
5I9WA 2RF9A 3EFJA 3LFAA 2ZJWA 1AQ1A 3OC1A 4QQTA 4V05A 1HCKA 2RFDA 4DLIA 4IB5A 1SNUA 4BRXA 5E1EA 1PXKA 3A7FA 4FEQA 4Y46A 5AUYA 3WI6A 5IDPA 2HWPA 5E8XA 3R30A 2Y6OA 3FMKA 2X8EA 2XYNA 5T6KA 2PYWA 2JKOA 3BYUA 4U79A 4O0WA 4RVTA 3AMAA 4IZYA 2WHBA 3UO5A 3KXHA 4IZ5A 2CN5A 4KRCA 5AP2A 3JY0A 1Y8GA 4EZ3A 1FBNA 3BHYA 4NM3A 3LLAA 5CT7A 1CDKA 5E90A 5AIKA 3VS0A 4F1TA 3D5UA 2ZM3A 3OWPA 5EYCA 4OR5A 4F4PA 1H25A 5F9EA 3ORTA 5DYJA 1K2PA 3PRFA 5GJFA 5IA5A 3I60A 5FWKK 4EOIA 2YM7A 3UZTA 4AX8A 3OWLA 2BR1A 3H0YA 4HOKA 3FSKA 4F09A 3CR0A 5KMIA 4Y85A 1M7QA 4ENXA 4BIEA 4EH8A 2A27A 4QNYA 3SD0A 4ZZOA 3RALA 1JKSA 1KOBA 3OW3A 4FIGA 3DNEA 4Y73A 2ETMA 3KXXA 2XNBA 3PXRA 3KRLA 2J0JA 5H8EA 3W18A 4MVFA 3O71A 1OGUA 5BVWA 3C4FA 5FXRA 1KV1A 3VBTA 2Z2WA 3MESA 2JDRA 3BQRA 3R01A 4CTBA 2W1EA 4J53A 4KABA 3LJ1A 3QQHA 3CTQA 4GIIA 5BYZA 3V8SA 4BZOA 3GUBA 4D9UA 2GHGA 1W82A 2WQOA 3EJ1A 2I0VA 2R3OA 3I1AA 4UZDA 2YIYA 4BCHA 2BPMA 3I7CA 4QMWA 4YJPA 2PMIA 5CXZA 4QMUA 4IIRA 1OL6A 2XBJA 2BAJA 1H24A 4OW8A 3C4ZA 4C4EA 3A99A 4ERKA 3RI1A 2ZB1A 1WVXA 3B2WA 4ZLYA 2CLQA 4C37A 3TNHA 4XBUA 2QONA 4EH3A 5ETAA 1OIUA 3FY2A 4DC2A 2OZOA 3KF4A 5FXSA 5CF5A 4NIFA 5JH6A 2GSFA 3Q5ZA 2BAQA 3EN6A 4FIEA 3IECA 4LFIA 2O8YA 4YJVA 4PL4A 5E8VA 1Q4LA 3H4JA 3EN5A 3RHKA 4MWIA 5EM7A 4RIWA 3R7GA 4RLKA 2YFXA 5TKDA 3D7TB 5JK3A 3QHRA 4C0TA 5JZJA 5BMSA 4QP3A 2QKRA 4ANNA 2J9MA 5AA8A 4AGCA 2G1TA 5HCXA 3EN9A 3CY2A 1UU3A 5AX3A 5FGKA 4AZFA 3LXPA 4WBBB 4XV1A 3ZLWA 3GC0A 5IZFA 3MB7A 2I7QA 1DAWA 5HLWA 4ASDA 4F6WA 2VO0A 3COIA 4DCAA 3GT8A 3HMIA 4J99A 1Q8YA 4LOQA 4ASEA 4QMPA 4MD7E 4BTMA 4C4JA 3TWJA 2PVRA 4FZAB 4BF2A 2JBOA 4E6CA 4BBMA 3GU8A 2QO2A 2W1FA 4RJ8A 2CNVA 3QTQA 5FBOA 3QD0A 1KE9A 4QMMA 2VTTA 4EZ7A 3E63A 1W0XC 3C4CA 5B2KA 3R83A 4BWXA 5E9EA 4IC8A 5CNOA 3W2RA 3RCDA 4O0VA 4CZYB 3V5LA 5GZ8A 2GDOA 3O7LB 1WBVA 4WG3A 5HX8A 2QR8A 2VWXA 4LGGA 3EN4A 3ETAA 4L46A 1OPJA 2G2HA 3I79A 2QR7A 4JR3A 3WARA 3LM5A 4LI5A 3ORZA 2R7BA 2R0UA 4BFMA 4D0XA 5BVFA 4CGAA 1CM8A 1GY3A 5CVFA 2BROA 3CLYA 3CQWA 3U51A 4D4YA 2JKKA 1U46A 3FL5A 4PRJA 2C6DA 4I21A 4I94A 3FI8A 3JPVA 1H1PA 2VN9A 3ITZA 3P7AA 4UMRA 4FTRA 4R7IA 3JY9A 4W4XA 3Q9ZA 4FKQA 5DE2A 3GU4A 5M57A 4O7WA 3ZM4A 4B8MA 3O23A 4DFXE 4YZMA 3F66A 5EI6A 1WBOA 2BRHA 4NEUA 4FNYA 3PVUA 3NCZA 1FPUA 1WFCA 1JBPE 3R1NA 2XF0A 3FZSA 5IMXA 4M12A 5EW8A 4FIIA 4IVAA 3OY3A 3C50A 4FEVA 2XIZA 2RG5A 2UVZA 5GJDA 2W9ZB 5AUWA 2UZOA 4IWDA 5HCZA 4CKJA 1U4DA 3RJCA 4NUSA 3ZONA 4FV4A 3DV3A 2R0IA 5E8UA 2PPQA 4GRBA 4D5HA 4IADA 1UU9A 5IQHA 2UZUE 3DZQA 1U5QA 2WMQA 3ZXZA 4R77A 1PXOA 4KD1A 2ZAZA 4UWBA 4ZTNA 5ANIA 5CEQA 4UMUA 5EKNA 2XK7A 2W5AA 3RAWA 4ANQA 3U6IA 5EHOA 2WTIA 3CIKA 3DAJA 5AV0A 1ZZ2A 2OH4A 3FKLA 3UDBA 1X8BA 4EH6A 1M17A 4J71A 4TYHB 2I0YA 3HMPA 4XBRA 2PULA 4YJOA 5K0XA 4MF1A 4GV1A 2CHLA 5HG8A 4IX6A 3C4WA 5AR8A 4A7CA 2BILB 2XS0A 4O82A 3G90X 4IEBA 3WE8A 1OVEA 3DCVA 4RJ7A 3ZCLA 4CSVA 4TKSA 5FRIA 4AZWA 1JKLA 1Z9XA 2CNQA 3NCGA 3QRJA 5I0BA 1XWSA 5J8IA 4S33A 2PK9A 4J52A 2X7GA 4F70A 3ALOA 5CAVA 2WEVA 2IVUA 4JI9A 2VD5A 5LCJA 2F9GA 4IH8A 2V5QA 3K3IA 3MY1A 2UW9A 4I1ZA 1YDSE 1SYKA 1V1KA 3Q96A 3UODA 3EFKA 1DM2A 2C5XA 4XP0A 5F4NA 4FTNA 4ACDA 3RAKA 4PTEA 3FY0A 3IO7A 4L67A 3CBLA 1YXTA 2ZYBA 3AD6A 1S9IA 4KSQA 4NH1A 4U41A 5CSWA 4YBKA 2GNGA 3ZO4A 3TT0A 5LVOA 2WMVA 4FIJA 4I0RA 3Q6WA 3L9LA 4FV8A 3HX4A 3D7TA 4NM7A 3R7IA 4YJNA 4GK4A 3FHIA 3RBWA 4EBWA 4HZRA 4DBXA 4O2ZA 4MQ2A 4AW1A 2W17A 4FKSA 3LFEA 1ZLTA 1T45A 3QTRA 5DPVA 5KZIA 3DTWA 3QUDA 5DEYA 3L8XA 4DFYA 3O8UA 5BPYA 3A7HA 2GS7A 2XJ0A 3GXLA 4AE6A 4YU2A 5AR2A 3HUCA 2PHKA 3KXMA 3EOCA 4FK3A 4NW5A 3HA8A 4WKQA 3CKXA 2O65A 4FKUA 4D5KA 4J95A 2B1PA 4KWPA 4RJ5A 2JDSA 3L8VA 3RM6A 4EZ5A 4NFNA 2BZJA 4IQ6A 4PV0A 1BI8A 3OCBA 2WO6A 2XCHA 3CEKA 1E1XA 3H9OA 5DLSA 4HYSA 4ONAA 5H2UA 4IM2A 3SV0A 3JYAA 3EYHA 5M4FA 2HWOA 2R3JA 5C1QB 5J5SA 1IAJA 4DH3A 3QQLA 1FMKA 2UW8A 2HIWA 3QKKA 3QXPA 4LMUA 3UOLA 3NUPA 5KMNA 4BI2A 3LQ5A 3CQEA 2FSMX 3KL8A 5M51A 3R7VA 1BYGA 4Q9ZA 5FP6A 1UU8A 2V0DA 2C3LA 5AR7A 3RWQA 4EK6A 3IW5A 3R9NA 4IXPA 5DGZA 4IACA 1XJDA 5DG5A 2Y0AA 1TKIA 1MRYA 2YABA 2YJRA 1YI6A 2R3PA 3QAME 3QWJA 4CZTA 4AT5A 1M2QA 3F5GA 4O0UA 4QYFA 3ZBXA 4WA9A 5IQEA 4MF0A 4OBQA 4RA5A 4EJNA 4QRCA 2G15A 3DOGA 3NW5A 4CFFA 4OT5A 4ZTHA 3MVMA 3MY5A 3CJGA 3BELA 4CQGA 3VS4A 1PXLA 3F2AA 4FIFA 5AP4A 3IW6A 3WF6A 1QPDA 1WBSA 2YIWA 2OWBA 3R8UA 3VS1A 4FF8A 4C4FA 4X6RA 1V0BA 4BZNA 5HORA 5JZNA 2YIQA 3BLRA 3DLSA 5IH6A 3D4QA 3F7WA 2VWBA 4MXOA 4YP8A 5GNKA 5IISA 4TYIA 5LVPA 1M2RA 5KZ0A 4Y83A 4I20A 4USEA 2VNYA 3DFAA 2HW7A 1H01A 3UYTA 4PDSA 3OXTA 3EQDA 3R0TA 1RDQE 1J91A 2EXMA 3O2MA 1NXKA 1XH6A 3QL8A 4KB8A 4RQVA 3ZBFA 4EK3A 5CEKA 2FSOX 4FKPA 3FHRA 5HGIA 4FMQA 5JN2A 4CRSA 2DQ7X 4I3ZA 3HKOA 3TM0A 4Q2AA 1Q8ZA 5HIEA 4HCTA 2OJIA 3AMBA 4PPCA 3F3VA 4PL3A 2YM3A 4GG7A 1YXXA 1GZ8A 4NTSA 3HAVA 3I6WA 4PY1A 5CEOA 2YCSA 3BU5A 2UW3A 5EYDA 3ZZWA 4TYHA 5FQDC 1BUHA 4H39A 1TQIA 3C5UA 4D9TA 2BMCA 2VTHA 3D2IA 2YM6A 2X2MA 4LUDA 1IA8A 3PG1A 4QYGA 5AM6A 3HRBA 3LXNA 1M7NA 5EDQA 2PVKA 2XCKA 2GU8A 3QD4A 3TV7A 3RGFA 4DEAA 3R8ZA 3PLSA 3GP0A 3QX2A 2W7XA 3E8CA 3Q4ZA 1OUKA 4QMYA 2W1HA 3HV5A 2WQMA 2X2KA 4AAAA 4KINA 3ZOSA 4GUEA 5JFVA 3IG7A 5LVLA 4AZVA 3UP7A 3VUHA 2GQGA 4PL5A 4EK4A 3A7IA 4E7WA 2VTOA 1GJOA 1YXSA 2IZTA 4BKYA 4JRNA 4EH9A 1LPUA 4DGLC 3RMFA 1VYZA 2CPKE 3H0ZA 3COMA 5EKOA 2H96A 3R8LA 5CQWA 3VS6A 4FT3A 2F49A 1CKIA 4G5PA 4LRJA 4ZZMA 4WBOA 4C4HA 3PG3A 4W9WA 3QKMA 4H3BA 4GVJA 5D7AA 3V8WA 5CASA 1BLXA 1H1SA 5E1SA 3ZLXA 3IKAA 3TCPA 2O3PA 4MD8E 4XG7A 4ANBA 4O38A 3IDCA 3VW6A 1DI9A 2UW7A 4F7LA 3QTZA 3CKWA 5IKWA 3OD6X 4G9CA 5M09A 2C0OA 3PXZA 4A4LA 3EQPA 3NLBA 3VBYA 5M55A 1B39A 3LFCA 2R4BA 2OGVA 4AE9A 4I4EA 3DQWA 5DRDA 1GIHA 3KFAA 3VO3A 3ATSA 2VO3A 4IBMA 3QUPA 2H8HA 4C4GA 5AIRA 5C03A 3TKHA 2VUWA 3TJCA 4R3RA 3ZSIA 3KULB 2WQEA 4LGHA 2ITYA 3SLSA 3REPA 5FDPA 3ORNA 3E7OA 1NA7A 2ZV9A 2VTSA 3Q53A 4W9XA 2C6MA 1PYXA 3MTFA 1H1QA 2R3RA 4F7JA 3UQCA 4BCFA 3PXQA 4JJRA 2X6EA 4MXCA 1J7IA 1W83A 4L8MA 3QU0A 3DAKA 4GG5A 4F99A 4YJSA 2BALA 2P55A 3EQGA 2PVYA 3MVLA 5KMOA 4GEOA 5AV4A 3VUDA 4M66A 4ZEGA 4OAVB 3HZTA 3R1YA 4QP9A 2X39A 5D11A 4CFXA 1UKIA 2JEDA 2H34A 2QI8A 4BN1A 1KE5A 1EH4A 2A4LA 3OBJA 1OPLA 4I6FA 1W7HA 2CGXA 3DKFA 3KKVA 4JG6A 4C58A 2Y4IB 3RPRA 4ZTMA 4RVMA 5EI8A 1BL7A 3O51A 3S4QA 3UE4A 4OAUC 4HPTE 5GZ9A 4D4SA 2B9HA 4I5MA 5KMKA 4I6HA 2OH0E 4XUFA 3A60A 1GZOA 3RPOA 2P3GX 4E93A 2WOUA 4DHFA 5HLNA 2C1BA 3C13A 2OJFE 4ALVA 1K3AA 4JQ7A 2IW9A 3RPSA 5DMZA 4YLLA 5E4HA 3Q9XA 4E73A 5DT3A 4JBPA 2C5YA 2ZDTA 4FV5A 2QOLA 4RQKA 4CEGA 3D83A 5FM3A 3QALE 5BVDA 4G1WA 5IEXA 1Y57A 4W4VA 3W8QA 2XBAA 3O96A 4MEDA 4FTAA 5IH4A 1XH8A 3FMLA 1R39A 2ACXA 3V8TA 3D0EA 2C0IA 3LQ8A 4FSQA 4K2RA 3U54A 4X2JA 3ID6C 4FKIA 3N4VA 4OTQA 3ERKA 1YQJA 4FE2A 4M14A 5ANJA 4KUJA 4EKKA 2VWIA 5DBXA 1Q97A 4X2KA 3OEZA 3ZDIA 4OTPA 1NW1A 4PMMA 4NKSA 5AP0A 3OY1A 3UC3A 1XBBA 4FSTA 2X6DA 4H3QA 2C1AA 4QYHA 4QP4A 3A62A 2E9NA 3HEGA 1YXUA 3M1SA 3DAEA 4ACMA 2B0QA 3CPCA 4RX8A 4FZFB 3D14A 1JPAA 1P14A 3NYNA 4H1JA 4YJTA 2B9IA 4AOJA 5BX0A 5L8LA 3SA0A 1Q61A 5ICPA 1J7LA 1ZYCA 2BRGA 5HG7A 2VTAA 3WILA 3F5UA 4M8TA 3QWKA 4AOIA 3BHHA 3PJ1A 1W8CA 5BUEA 5D12A 5K5XA 5CSXA 3U6HA 3PIYA 2E2BA 4M3QA 4IX5A 5CX9A 3IPHA 4XYFA 5JGDA 3ZM9A 3GGFA 1WBNA 3LMIA 1MUOA 3M2WA 2ITUA 2ZB0A 3E8EA 4K6ZA 4DGGA 4G9RA 5ANDA 1PW2A 3QC9A 4LMNA 4X6QC 5CU0A 4PMTA 4O7TA 3QGYA 1H26A 3EIDA 1OL2A 2JIVA 3UG2A 2VAGA 2QHMA 4ZTQA 3V6RA 5L4QA 5CEPA 5A4QA 5CS6A 1XH4A 5CY3A 3C51A 3E3PA 1ZOEA 3L8PA 2PZRA 5CEMA 2YDKA 4IVBA 4ZTSA 3D15A 2Y4IC 1VEBA 4G3DA 5CZIA 3GCSA 3WZJA 1YW2A 4NSTA 2W0JA 2YA9A 4Z7GA 5AP3A 3Q9YA 3LCKA 3NMUF 4R5SA 4BWPA 2XKDA 4Q9SA 1OKWA 3QA0A 2UZBA 3M11A 4ZY4A 5HNIX 3FI2A 3LFQA 3ROYA 2OICA 4R1YA 5A4EA 5IA1A 2JBPA 2YM5A 2BRMA 4XH6A 5DEWA 2CN8A 1YOLA 3VS5A 4FKJA 4JDKA 5GHVA 5HE1A 2PZ5A 3P4KA 4FTQA 5HO8A 5DNRA 4NCTA 5C4KA 3P79A 3MH0A 4Y5QA 4ALUA 5AP7A 4II5A 4O96A 2VV9A 4EUUA 2UZVA 4IJPA 5M08A 3OTVA 4GVAA 5CI6A 4O86A 4DFUA 5IQCA 4LOPA 1MQBA 2VTIA 3CD8A 4RPVA 2OK1A 3R7EA 4RVLA 1DI8A 3E8NA 4Z16A 3RK9A 3FLQA 3P23A 3FQEA 3R9RA 4O0XA 1GIJA 5CSPA 3NX8A 2NP8A 1LP4A 2YLEA 2O5KA 5E91A 2CKPA 3TIYA 3KXZA 2UZTA 3AT3A 5AM7A 1OBGA 3R1SA 2BFYA 4GL9A 4DTBA 3QRTA 4XOYA 3OCGA 3VN9A 5HI2A 4F64A 5A9UA 4DFZE 3NNUA 4I92A 5BVNA 4IWQA 3ZC5A 4NW6A 5AFVA 2J0LA 4BZDA 1OL1A 1PKGA 2W5HA 4G3FA 3UO6A 2GQSA 1OL5A 4FTLA 4FV7A 3DXPA 4BI1A 4UEUA 2OIQA 3TDWA 1FOTA 2PUUA 4UBAA 4PWNA 2DYLA 4WUNA 3VS3A 5JGAA 3OTUA 3TNPC 5TOZA 2BFXA 1TQMA 4BDFA 3N4UA 1ZMUA 4RJ4A 4JDIA 3TI1A 3R04A 1PXPA 3I81A 4D0WA 4GJ2A 5I9VA 3B2TA 4O7YA 4QQJA 4J8NA 2RG6A 2HXQA 3UOHA 4DH8A 4FZ7A 1UNHA 3AC4A 2R3KA 4NU1A 5HE3A 2O63A 3MFSA 1BKXA 4JDHA 3ZZEA 3NNXA 1IAHA 3CY3A 2GFCA 1FMOE 2EXCX 3LFNA 3ORKA 5HVYA 3BKBA 3LCDA 5ACBC 1WBPA 1BX6A 2VZ6A 3PY3A 4GT3A 4WNMA 3EQRA 4M13A 2P2IA 2P33A 4EKLA 4PMPA 4IB0A 3T8OA 2H6DA 4EOQA 4M0YA 2REIA 5CVHA 1ATPE 4YSJA 2YACA 3PJ8A 4MKCA 5A14A 4OTIA 2WOTA 2Y4PA 4QTAA 4Y8DA 2OXXA 2PSQA 3TTIA 3VF9A 1PHKA 4GKHA 2YITA 1VR2A 1S9JA 4O22A 2OXDA 3FPQA 4BDBA 4DA5A 4NM0A 4GFGA 4V01A 3TUBA 1UA2A 1H0WA 3LLTA 3NYOA 1KUTA 4BI0A 2PVNA 4F08A 4XV3A 2PE2A 2WMSA 3GU6A 3QHWA 3EHAA 2XNEA 3OT3A 4GFMA 4RBLA 2XNNA 5A4LA 3DBCA 3GCUA 3L9MA 3OEFX 1PKDA 3EKNA 5KX8A 3FZ1A 5M4IA 3T9IA 4IANA 3AXWA 3VVHA 2UZNA 3AC1A 4ZAUA 1IG1A 4NM5A 3PJ3A 2XM9A 4AGDA 2NRYA 4C57A 4CFNA 2YHVA 4JX3A 4Z3VA 3GI3A 4C7TA 2YDIA 2ZM4A 1BMKA 2ZMCA 1OZ1A 4EORA 2BZIB 3W32A 3QZIA 3II5A 3HV7A 4BL1A 4L44A 2VO7A 3AC8A 1Q8WA 5EOBA 4BDIA 2NPQA 4IZ7A 2W06A 3R7YA 1XKKA 3I6UA 1JAMA 3O8TA 2Y8OA 4IAFA 4ZSGA 3IK3A 4AOTA 3BWJA 1Q5KA 4FC0A 4PDOA 3QTUA 4JIAA 3EWHA 2X4FA 3DDQA 4UXLA 3HYHA 4DG0E 2XRUA 2VRXA 2WTJA 3Q3BA 1OITA 5IA4A 2X0GA 4O7RA 5D7VA 3IOKA 4U8ZA 4KKGA 4FSWA 4ITJA 5LVMA 3UO4A 5J5TA 4BCOA 4FYNA 2QOIA 4CFUA 4F9BA 3U9NA 1KOAA 4XHKB 1F5QA 3JVRA 2WEIA 4FA2A 1Z57A 4O7LA 3NAYA 3LCSA 3P0MA 4MBLA 4FKWA 4OBOA 1RW8A 3FXWA 4ZIMA 2FUMA 1WVYA 4CCUA 3DXNA 3FZTA 4TWOA 4ZJIA 2BDWA 4F65A 3TZMA 4O1OA 4GYIA 3GOKA 3DPKA 3VNTA 2Z7LA 3BQCA 4Y5HA 3DA6A 2XK4A 3E93A 5EYKA 4BDHA 2FO0A 2XIRA 3PXKA 4O91A 3LMHA 2XUUA 4UMTA 2XK8A 3PWYA 1UV5A 2PZIA 4K33A 5DR2A 1SVGA 3V3VA 3RZFA 3W2CA 4EOPA 3DGKA 2DUVA 3MPAA 3DK6A 4GYGA 4R6VA 4O2PA 3F82A 3E64A 4XEYA 2HK5A 2YLFA 1Q99A 3BGZA 4HVDA 1O6LA 4BY9E 2ESMA 2JFLA 5I3OA 3WZUA 5CANA 2Z02A 2VWYA 1IEPA 5HE2A 3QRKA 3HA6A 1FQ1B 2W4OA 4M0ZA 3NAXA 2OIBA 2QKWB 2CKQA 4RWLA 2BHHA 4MAOA 4EEVA 3RHXA 1OM1A 1FVTA 3IS5A 4J7BA 3CCNA 5EQYA 3EH9A 3HDNA 3HNGA 2JKMA 3BWFA 4BBFA 5FUTA 3P78A 3KA0A 2E9VA 4G3EA 3UIBA 5LOHA 1L3RE 2CGUA 3ZXTA 3PVBA 4ZY6A 1RE8A 5EM6A 3VUKA 3TV4A 3ALNA 4D4RA 3KEXA 2WMBA 2V7AA 3OP5A 4IHPA 4YSMA 5HNGA 4A06A 1WMKA 3SQQA 3TZ9A 4TYEA 4UZHA 3ULIA 3POOA 4ARKA 4FOBA 2R3NA 2F7EE 5CAOA 4MX9A 4I5CA 4IB1A 4KS7A 3KB7A 4EHEA 3V5WA 4EK8A 4FV3A 3MJ1A 4JBVA 1VJYA 4XP3A 5B7VA 4F0IA 5H3QA 4X2NA 5E7RA 3PVGA 3DB8A 4L3PA 3NYVA 2BZKB 4J97A 5DRBA 2X2LA 4BTFA 4DGNA 2UW5A 5HBEA 2J0MB 4JNWA 3BEGA 5AADA 2I1MA 4E5BA 3E5AA 1YI4A 4CV8A 1ERKA 5LXMA 5IUGA 5ANKA 4XMOA 1M52A 4B7TA 2UW0A 4PMSA 1J7UA 4WD5A 3HDMA 3TL8A 4AUAA 4G17A 5DH3A 3D2KA 3KN5A 3QD2B 4JQ8A 1QPCA 1WBTA 3VF8A 4Y95A 5CZHA 5M4CA 4CG9A 5KMLA 2PUPA 1OL7A 4HPUE 1G8SA 3FKNA 4NJDA 3GC8A 4YTFA 5HU3A 4FTUA 4NJ3A 3QUEA 4BKZA 4EJ7A 4WG4A 4GKIA 3MA6A 2ONLC 3VUGA 3ZFYA 5HD7A 4MYGA 5KCVA 4L42A 4Q5EA 3AC3A 5HEZA 3QCXA 4FIHA 4KIQA 4PF4A 4FNWA 4CTCA 3NIZA 3FMMA 2C5VA 4BGGA 4D4VA 1QPEA 3CGFA 3QLGA 3UJGA 1SVHA 2JD5A 1OKZA 1LUFA 3NRMA 4L52A 1SM2A 3HUBA 2XP2A 4FSMA 4G6NA 5HTCA 4FKTA 4DT8A 4ZMFA 4TWNA 5IG1A 3AMYA 4RSSA 3ZEPA 3QF9A 2WIHA 1B38A 4HVIA 3UIMA 3G51A 3W2PA 3UVQA 3QTWA 4OTHA 1F0QA 3FUPA 4G34A 5K5NA 4KIPA 4ZP5A 4IDVA 3OBGA 3TKUA 2R64A 3AT4A 4RZVA 4RWKA 4D55A 4GU6A 5HLPA 3F3UA 4QQCA 5DR9A 4QD6A 5TO8A 4EQCA 1VZOA 4PQNA 3VUIA 4Z7HA 4CKRA 4FV1A 2PE1A 3PRIA 3AOXA 3BIZA 3FLNC 4YGAA 2ZV8A 4IAAA 4BWKA 4QMQA 3RPVA 2ONLA 2W96B 3LXKA 3CXWA 3PTGA 4ERWA 4BDEA 5EM8A 4RIXB 1QL6A 3WZDA 4CFMA 4QTCA 2XJ2A 2B53A 3DU8A 2IZSA 2WQBA 1JVPP 3O0GA 3C0GA 2ITXA 4PTGA 5HESA 4B0GA 4C62A 4AP7A 3G0FA 4BDGA 4U45A 2VX1A 2WU7A 1ZYLA 3G9LX 4FTMA 2W4KA 4FGBA 2CKEA 3LJ2A 3UC4A 4GT5A 4JL9A 3C4XA 4EONA 3L9NA 4AA0A 2W1IA 3PWDA 1H1RA 2WKMA 5FEEA 4G2FA 4MXZA 3NSZA 4RFMA 4HVGA 3EMGA 3BLQA 3E87A 4FBXA 5DT0A 3ACJA 5HIDA 3MFRA 5A4CA 2OLCA 2X8IA 3RCJA 5A4TA 4O21A 5IQIA 3IQ7A 4XNEA 3VRYA 4YUQA 3V5PA 4WRSA 3FAAA 2YJSA 3LFFA 2QHNA 2KTYA 1CKJA 5ETFA 3W1FA 5AA9A 4ID7A 4AN9A 4FV2A 3ZTXA 1Y6BA 4PX6A 2GMXA 3ENMA 2C5NA 3OF0A 4IFGA 3MIAA 2B9JA 4D2PA 2YEXA 1ZY4A 1PMNA 2YERA 4BTJA 2PVJA 3QQGA 3JXWA 4FSNA 3PP0A 5KHXA 2YWVA 5CAPA 3LFDA 5AV2A 5KBRA 4CKIA 2VTRA 2YDJA 4S2ZA 5DR6A 3VBWA 4CLJA 3EQCA 3PA4A 2JAMA 4FODA 1TVOA 4ZZNA 1OBDA 2W5BA 2B55A 1Z5MA 4R5YA 3V5TA 4CYJA 1UVRA 5JGBA 4DTAA 4FI1A 3GVUA 5JT2A 2BHEA 3ODYX 5TF9A 5AUZA 3TTJA 3R2BA 4YHTA 2W9FB 2XKCA 4YJUA 4O83A 3A7JA 5AEPA 5L6WL 3MFTA 4O7SA 4X3JA 4OTGA 5CF4A 4C2WA 3E3BX 4ZOGA 3VUMA 4ITIA 2C6EA 3QCQA 3VBVA 4QTEA 4UYAA 4ZTRA 5IF1A 2HZ4A 2WNTA 5IA0A 3DTCA 5J7BA 5KKRB 4ZMEA 3WYYA 2C5OA 2NRUA 1ZOGA 3S3IA 2J7TA 5BYLA 2RGPA 3HAMA 3BU3A 4FTTA 5CVGA 4ZXTA 4CXAA 2GS6A 1CTPE 2VWVA 2O64A 2WU6A 3MTLA 3MVHA 3HLLA 3F5XA 4Z9LA 2SRCA 3Q32A 1FVRA 3ZO1A 5BUIA 4TL0A 3W2OA 1ZWSA 4GFOA 3CTHA 4M15A 4RZWA 3EL8A 3HRCA 3PPKA 4I5HA 4QMZA 3S00A 2WB8A 3QYWA 4FSYA 4FL3A 4QTBA 3BZ3A 2UV2A 2QCSA 3R1QA 4YHJA 3DKOA 5HCYA 5M4UA 2XK9A 1H1WA 2BRNA 5EW9A 2PMNX 4LV8A 4NZWB 1BL6A 3K5UA 1U5RA 3IW8A 3OMVA 4TNBA 3R9OA 4WUAA 3ZC6A 4E20A 3DB6A 3KGAA 5FTQA 4A9UA 2HCKA 2QOKA 5LMAA 4ZJVA 1YWVA 2JLDA 4RX5A 5C01A 3KMWA 4U43A 5AUTA 4WSYA 3H10A 2IW8A 2HY0A 4GT4A 3FPMA 4PPAA 4F9AA 3UZPA 1YOJA 1ZXEA 1ZYDA 4UWYA 3ZU7A 3E92A 3FMNA 4QOXA 4FKGA 4N6YA 4E6AA 4HVHA 3MH3A 4H58A 2R3IA 2IO6A 4I22A 2C6OA 3K5VA 3FXZA 3VQHA 5L8JA 4CNHA 3NVMB 2RFSA 2QOOA 2W1CA 2XNMA 1G3NA 2JDTA 2WTWA 4UY9A 2CMWA 4FV9A 4EOKA 2WQNA 4RIXA 5I9ZA 4XG2A 4CMTA 3F2NA 2PVHA 3AC2A 2PU8A 3RPYA 2WTDA 4M69A 1WVWA 5EH0A 2YAKA 1PY5A 4L43A 3NUNA 4L00A 2IZRA 4C3FA 4UB7A 3PJCA 4B6LA 4GK3A 2VTPA 5J9LA 5HOAA 4EWQA 3MJ2A 4QMTA 4DN5A 3KU2A 2VO6A 4IWOA 2X8DA 4HYHA 2HOGA 4KKEA 3TUCA 1MRUA 2RFNA 2J0KA 4EK5A 3MV5A 1XQZA 2UVXA 4O6EA 1R78A 3GC9A 4RVKA 3RAHA 4DEBA 4ENYA 1V0PA 3CE3A 2HAKA 3CQUA 5J9ZA 3DQXA 3PPJA 4QP2A 5HTBA 2IVTA 2BVAA 3MDYA 4U5JA 3G6HA 2A2AA 3E88A 4Y72A 1ZY5A 2J5FA 2CCHA 4JDJA 5BQ0A 3G2FA 4QNAA 3DKGA 3AGMA 1LEZA 4KA3A 4BC6A 2Z7QA 2VWWA 1Q24A 4F0FA 3R6XA 4JG8A 2ITOA 4E5WA 4MXAA 2QQ7A 2PY3A 4LRMA 4YC8A 4S34A 3AT2A 3IONA 4FOCA 5J7HA 3UPZA 3KF7A 4YNEA 1DAYA 4ZK5A 5L2IA 3TACA 2UZDA 2AYPA 2B4SB 3FYJX 1OUYA 4L7SA 4RA4A 5AV1A 5FBNC 2B9FA 2FSLX 3MH2A 4QP8A 2C6LA 2GCDA 2ZDUA 3DK7A 3EN7A 2GHMA 4IFCA 3I5ZA 5C27A 3TN8A 3L1SA 2BZHB 1XBCA 3HP5A 4NT4A 4XJ0A 2Z60A 4X2GA 2XVDA 3FMHA 1KWPA 4BKJA 4E4NA 5B2MA 3F3WA 4IW0A 4YO4A 4RC4A 4EOLA 2OFUA 3CD3A 2ITZA 5C9CA 3UZRA 4XG8A 4LL0A 1KE8A 3DS6A 3QCYA 3ET7A 4KNBA 2OFVA 4P5QA 4PP9A 2QU6A 3FI3A 2QOFA 4QYEA 4YO6A 4BTKA 2QLUA 3LHJA 3PPZA 4USFA 5FDXA 4OGRA 5EK7A 1GZKA 2JIUA 4BCGA 4E5AX 1YKRA 4NWMA 2QO7A 4PNIA 5HVKA 4QPMA 3MI9A 2OF2A 2UZEA 5LMBA 1ZOHA 4APPA 4ZY5A 2R7IA 5CSHA 3QCSA 2QO9A 3DFCB 3N9XA 3PSBA 2XB7A 3LJ0A 5CU6A 5IH5A 4HJOA 3TNWA 2RIOA 4QMNA 4FK6A 1UKHA 1ZMVA 4DEIA 4DYMA 1CSNA 1LR4A 2WAJA 4EH7A 3Q04A 1PMVA 4JVGA 5LWNA 2R3FA 2FGIA 2BIYA 2G2IA 3R02A 5AAGA 3ZEWA 4AU8A 1YHVA 2F2UA 4BCPA 3UMXA 3G0EA 4X3FB 3MSSA 5TE0A 2B54A 3DKCA 2I6LA 3R28A 5CU4A 5A6OA 1JOWB 4PUZA 4AWIA 1ZYJA 4OTDA 5F20A 1JKTA 3DZOA 3OW4A 4WSQA 3TKIA 1I09A 3ANQA 3DBDA 3FLWA 5CWZA 3AGLA 2XRWA 3MWUA 1YI3A 2G2FA 4A4XA 3GENA 5HBJA 1URWA 2XNOA 4AG8A 3LFSA 4MXYA 2BDJA 5CU3A 3EQFA 3ZSHA 2P0CA 5AUXA 5LMKA 3LMGA 4YPDA 4TPTA 4JXFA 1YXVA 3UOKA 3QXOA 2B7AA 2GTNA 5KO1A 5FTGA 2YCFA 2CLXA 4QP1A 3FLSA 3LIJA 3PSDA 4XG9A 1ZARA 3R2YA 2R3HA 3U4UA 1PF8A 3VJNA 4NCTC 5G6VA 1OB3A 4LM5A 4YHFA 4YTCA 2YCQA 4D1XA 2UZWE 3H30A 3A8XA 4IM0A 5K3YA 3WIKA 2Q83A 1ZYSA 3LE6A 5L2SA 3IOPA 3OFMA 3UP2A 4K9YA 4A4OA 3GEQA 5AP1A 3NUXA 4FNZA 2OJGA 3ZO3A 2PE0A 3VRZA 2C30A 2XJ1A 4ZTLA 2G9XA 4DFBA 4U40A 4I6QA 4KS8A 2GQRA 4FNXA 3VHEA 5DN3A 5HG9A 2OKRA 3BE9A 2GPHA 3PIZA 1IRKA 3ZUUA 5KMJA 3PDTA 4RWJA 2J4ZA 3FLZA 3OXIA 3SX9A 2FH9A 3Q4UA 2BUJA 5LWMA 3QZFA 2P2HA 5KMMA 4KIKA 4ACHA 1IA9A 3C5IA 4MD9E 3UIUA 4EHGA 1GAGA 3RNIA 2WZJA 3A2CA 3MW1A 2HENA 3AC5A 4YPSA 5TR6A 4D2TA 4FKLA 5E8TA 4FL2A 2XA4A 5EFQA 5IEYA 2W1DA 5FP5A 4E6DA 3ZSGA 4ANMA 5M07A 2OI4X 2ZOQA 3L8SA 4XOZA 3G15A 2O2UA 1FGKA 4G16A 4AZSA 4YBJA 5D41A 4O0YA 3HV4A 3NUUA 3NGAA 4RC2A 3HMOA 3P08A 3ZMMA 2H9VA 5CXHA 5FD2A 5BUJA 3ROCA 3GU7A 3PLAE 1JNKA 1E1VA 3QX4A 4XLVA 3ZO2A 4GS6A 4DCEA 5JKGA 5IA3A 3UIXA 3S1HA 4U9AA 2WMUA 3LFBA 3U8WA 5EQEA 3FJQE 4P5ZA 1QPJA 3PP1A 5K9IA 4AF3A 3SGCA 3HV3A 5DA3A 4AZTA 3HRFA 3MA3A 3ZLSA 4EUTA 4RWIA 3UVPA 2XK6A 1YRPA 4I0SA 4DEHA 3FEGA 4KBAA 5KNJA 2QNJA 4ZSLA 3NEWA 3HP2A 4XCUA 4APCA 4AW2A 4EH4A 2BTRA 3ATTA 4TTHB 3OZ6A 4H3PA 2W05A 4MCVA 3BHTA 4DEGA 2ITWA 4QMXA 5AAFA 3EQHA 4MWHA 5E92A 2ZMDA 4F1MA 5M56A 5LQFA 4ACGA 5EDRA 2OO8X 3TIZA 4M84A 4F6UA 4C33A 4W4WA 2Y7JA 3SXSA 4S31A 3UNKA 1OKVA 3R73A 3C1XA 4D2WA 4BDCA 1TQPA 2C4GA 4E8AA 4ORKA 4DLJA 4YZDA 4J8MA 4I0TA 4JIKA 4EQMA 2PUIA 2JC6A 3ZUVA 4EOOA 3W10A 4HYUA 4W4YA 3LKMA 3PUPA 4IZAA 4TWPA 5KE0A 4P2KA 1YWNA 5CENA 3SRVB 2YWPA 3VS7A 2JITA 5L3AA 4EC8A 2HZNA 5FM2A 2EUFB 1H0VA 5HIBA 2PWLA 1A9UA 2EU9A 3DBQA 4WG5A 3R8VA 4B8LA 2VX0A 3NZ0A 1W84A 4W8DA 3QGWA 4HGTA 1JWHA 4LYNA 1SVEA 3SVVA 4JOAA 4X3FA 3EFLA 5K0KA 4NFMA 1YDRE 3COKA 4PNKA 4PTCA 4USDA 1OIRA 2WMXA 4EC9A 1PXJA 5AUUA 4LV5A 4YJQA 2V22A 4OTFA 4BVUA 4CCBA 4L3LA 3A7GA 4MNFA 3FC2A 4FTCA 2XM8A 3EB0A 4XX9A 3RNYA 2E9UA 3MVJA 3MBLA 2VTNA 2QU5A 2YCRA 4YZNA 4Z55A 4LG4A 3KK9A 4I93A 1Y91A 4U3ZA 3SAYA 3GB2A 2OJJA 3DK3A 3RM7A 4D2SA 2ITPA 2EXEA 5HHWA 4F6SA 2R5TA 2W1ZA 3V01A 3CGOA 5EOLA 1R0EA 2X81A 4BDAA 2X9EA 3RVGA 3GCVA 3PYYA 3VIDA 3I0QA 5FEQA 4GSBA 3MN3A 4FT0A 5IQBA 2ERKA 3FMDA 5ITAA 2PMOX 4BB4A 4FV0A 3BX5A 3F69A 2QODA 3SXRA 3CTJA 4TZRA 4DTKA 3TZ7A 4DG3E 4YURA 2XMYA 3LQ3A 4RGJA 4YZBA 3BLHA 4J1RA 3UNZA 4GCJA 3RKBA 2XEYA 3OHTA 3OS3A 4XG4A 3O8PA 4GIHA 5HQ0A 4IAKA 2PMLX 2QOCA 2WTKB 5HTIA 2A19B 3VS2A 5CALA 4AGWA 1T46A 3FZPA 2XKEA 2WMWA 3K54A 1APME 3DNDA 3QBNA 2YZAA 4G3CA 4S30A 3WF9A 4RT7A 2QOBA 4C3PA 4DH7A 5ANOA 4EH2A 1R3CA 2UVYA 4I24A 4UXQA 5FXQA 2CGVA 5K4IA 3GCPA 3FYKX 3H9FA 3PY0A 3SKCA 1Q8TA 3POZA 1OECA 3QYZA 2DS1A 4EYMA 2VGPA 3K3JA 3CSVA 4UV0A 4ZSEA 3Q9WA 5GJGA 4CT1A 2CSNA 5IEVA 3ZUTA 2Z8CA 3CS9A 5ANEA 4FTKA 3KCFA 2Q0NA 3VBQA 2V62A 3QLFA 3PFQA 5E8ZA 3U55A 4UYNA 5HNBA 1H28A 3OCSA 2J2IB 4N0SA 4A9YA 3QQJA 1KSWA 4K11A 4QP6A 2IPXA 4FKOA 4WNKA 2DWBA 1H8FA 2ZVAA 3VWAA 3T3UA 5J1WA 3HVCA 3QTXA 4RC3A 5CAUA 3OUNB 4RMZA 5AP5A 3QRIA 3VUTA 5EYMA 2ERZE 3W2QA 4CLIA 4N70A 3DXQA 3LZBA 2PL0A 3UMWA 3EKKA 5CTPA 3KRXA 3QQFA 1Y6AA 4J96A 3FMJA 5LCKA 2ZV2A 4FT7A 3BE2A 4CFWA 3DDPA 1PYEA 2X1NA 3FL4A 3FI4A 4JRVA 4U42A 3FE3A 4ZJJA 3GBZA 3S95A 4DGOA 5C26A 4MNEB 5H9BA 3EQBA 4H1MA 3PA3A 1PJKA 4HNFA 4JR7A 3BBTB 4V04A 3PE2A 4B99A 4TYJA 4AACA 3QC4A 5CSVA 2VU3A 4N4SA 5GZAA 4O81A 3SRVA 3W33A 4L6QA 4BCIA 4D58A 3BYVA 4QP7A 4OTRA 4IX4A 5IQDA 1MP8A 4U81A 3BHUA 2HY81 4C02A 5HO7A 2C3IB 5CLPA 2ITNA 2C68A 2Z7SA 1SZMA 2W4JA 4IB3A 2WTKC 4R7HA 1CMKE 5J9YA 5A46A 3EQIA 2BRBA 2OZAB 3F7ZA 3IGGA 4HW7A 4TYGA 2WIPA 4EOSA 5AR5A 4G6OA 2WELA 4BDDA 4BCKA 3S0OA 5JQ5A 3FV8A 1SMHA 3KN6A 5IQAA 4FT5A 4P7EA 1HCLA 4L45A 3R21A 5HBHA 2J0IA 4FVPA 4E4MA 1PRYA 4X2FA 5AP6A 3ZLYA 3Q60A 1I44A 1GZNA 4P90A 1IASA 2I0EA 3GOPA 4WT6A 5BMMA 4R3CA 5JRSA 4U6RA 4E3CA 3F3TA 1OIYA 1NVSA 5H8GA 3Q2JA 3VAPA 1RJBA 4D1ZA 3PXYA 5CQUA 4C2VA 1XO2B 5EM5A 3NR9A 3RWPA 2E9PA 4BDJA 3DJ7A 4YR8A 5CF6A 1AGWA 3KQ7A 2Q0BA 3GQLA 3MPMA 3Q52A 2XKFA 2VNWA 5L2WA 4IE9A 4LUEA 4FVQA 4EL9A 3DLZA 3UTOA 2PUNA 2RSVA 3MPTA 3PY1A 2BIKB 2ETKA 3A61A 4KAOA 3OWKA 3EFWA 4KKHA 1OI9A 2R3LA 2YIRA 4TN6A 4ASXA 4E4LA 5IA2A 2IG7A 4DE4A 3OVVA 4OTWA 4F7SA 4I5PA 4FTIA 5J87A 1O9UA 1H27A 3T9TA 3FC1X 1JSUA 3FQSA 4FX3A 5AX9A 2FA2A 4OLIA 4GW8A 3D5XA 2PVFA 3BRBA 1WAKA 4EWHA 3GQIA 1Q41A 2R3MA 3BBWA 2ITVA 5HE0A 2A1AB 2XIKA 4N6ZA 4WRGA 4ALWA 4OT6A 3NS9A 5ANGA 5HVJA 2JIIA 2YM4A 2F57A 3TEIA 4AZEA 5M53A 2BTSA 4O1PA 1XHAA 2F2CB 2WMRA 5I3RA 4FTJA 3F2RA 2R3GA 2X4ZA 3MB6A 2QVSE 3KXGA 3OUKA 3UQFA 4F63A 4AFEA 5L6OA 4FEUA 4FTOA 3IDPA 3ZRMA 1OIQA 3GNIB 3GFWA 4BGHA 2ZM1A 2IVVA 2CGWA 2XYUA 2YISA 4R3PA 1GOLA 4C8BA 1QMZA 5CT0A 3OT8A 4U80A 2V7OA 2R2PA 2R9SA 2IW6A 2VGOA 4F7NA 2BAKA 2Z7RA 2VTQA 4QPSA 4A9TA 3S2PA 5JRQA 2NNWB 4D2VA 4K18A 4M69B 3EYGA 3F5PA 4L9IA 3V6SA 1ND4A 4XV2A 4RX9A 3NDMA 3GCQA 5I4NA 1JQHA 1Q3WA 4E6QA 5DFPA 2C69A 4UN0C 4ANSA 4JX7A 5JSMA 3ZRKA 2GHLA 2C6KA 5DIAA 4FEXA 1XH7A 1P5EA 4QMOA 2PVLA 3NNVA 2KULA 1H00A 3PVWA 5CNNA 2JDOA 5EHLA 4DF3A 2OF4A 5E8SA 4UALA 1BI7A 4K8AA 3W16A 4GU9A 2PZYA 4MNEA 3WF8A 4BCQA 1AD5A 3WYXA 4AGUA 4JG7A 3THBA 4IDTA 4JAIA 4WOVA 1KE6A 4RFZA 3SOCA 3QRUA 3LOKA 1PXMA 4RLLA 4TRLA 4YC3A 3WOWA 4DEEA 2QD9A 4TWCA 4KSPA 3FSFA 5LARA 4V0GB 5HX6A 3LXLA 5T3QA 4GH2A 3SW7A 3O17A 3OROA 4FSUA 3N51A 1XBAA 1YVJA 1UWHA 3FLYA 3MFUA 2OXYA 2GFSA 4FV6A 3NWWA 3IDBA 3FZRA 5D10A 3LPBA 4QPAA 4EOMA 2OZAA 2FSTX 4G31A 4F0GA 3AQVA 4I41A 2J51A 4H36A 4HGEA 3SHEA 4A9SA 3B8QA 3BGPA 3D94A 1V0OA 2C3JA 3FQHA 2WFYA 1YHSA 5I9XA 1OPKA 3NIEA 3FXXA 3PSCA 3R22A 4Q5HA 4YTIA 2QG7A 2HW6A 4ZS0A 1U54B 4H05A 5K4JA 1Q8UA 2G01A 3Q4CA 2VWZA 3O50A 5EW3A 3TZ8A 1FVVA 4CZUA 2OW3A 3ZH8A 4G5JA 1B6CB 4MTAA 2F7ZE 2IN6A 4NKAA 4DINA 5KHWA 5TT7A 5DT4A 4ZS4A 5IQGA 3KRRA 4O0SA 1NT2A 3ORIA 4DEDA 1A48A 3OOMA 3V04A 3V51A 3LVPA 3MGYA 4FG7A 3BHVA 4YLJA 3NUSA 1E9HA 3D7ZA 5FEDA 4AA4A 4CV9A 5C4LA 5D9HA 1NVQA 4KIOA 4BCMA 3A4PA 5D1JA 1PXNA 2EWAA 4FSZA 3ZRLA 3AD4A 1DS5A 4BGQA 1XR1A 3HL7A 3UGCA 3I5NA 3NW7A 3ACKA 3I4BA 4MH7A 4DG2E 5DOSA 4AT3A 5EQPA 2AC3A 5CI7A 4DH1A 5AJQA 4C38A 4C34A 1XH9A 3BYOA 3F61A 4TW9A 3TG1A 4ZLZA 3ZFXA 3RAIA 4UX9A 4RIYB 2HELA 3KXNA 1O6KA 3PA5A 3PXFA 4O27B 1PXIA 4C35A 2OIDA 3I0OA 2ZV7A 3KRJA 5I5ZA 4I23A 2F7XE 4OUCA 5IDNA 5HG5A 2UZLA 3TUDA 2X7FA 3ELJA 4O0RA 1PMUA 3BV3A 3M42A 3R9HA 3KMMA 5IU2A 2YAAA 4ZSJA 3FDNA 4BYIA 2OJ9A 3I7BA 3LW0A 3ZS5A 1GIIA 3IGOA 1W98A 4FZ6A 5GINE 3QZHA 3SOAA 3WF5A 2WXVA 5J95A 4DGMA 4WHZA 3SG8A 3A4OX 3OWJA 2BKZA 4FICA 4L3JA 4YZ9A 5AR3A 5ETIA 5CF8A 1OMWA 4HZSA 1JSTA 4MK0A 4YTHA 4DH5A 3Q5IA 2O0UA 3ZHPC 4GUBA 3RK5A 4BHNA 3R00A 3VULA 4B9DA 3R63A 4YC6A 3DJ5A 1P4OA 3P1AA 3UPXA 3VJOA 3OG7A 3TJDA 3E62A 2XNPA 3DY7A 3QQUA 4P4CA 4IM3A 3C0IA 5E8YA 3EZVA 2GNFA 3BYMA 1A06A 5CYIA 4C4IA 1G8AA 2QOQA 3KREA 3AD5A 3BEAA 3KVWA 1YDTE 5AMNA 5HZNA 3HV6A 2XEZA 4BBEA 2HZ0A 4KBCA 3CC6A 1J1BA 5ETCA 4ZSAA 3UOJA 3P7CA 5AV3A 3FKOA 5C8NA 3C7QA 1Q62A 4BCJA 4QTDA 4ASZA 4FEWA 4O0TA 1CKPA 5JMSA 4NYEA 4AXAA 4JBQA 5T68A 2GNHA 3PIXA 2V55A 2XIXA 3KVXA 3K2LA 2ETRA 3BI6A 2R3QA 3QQKA 5C8KA 4IC7A 4CQEA 2C6TA 2PTKA 3KCKA 4KIKB 5JFXA 3UQGA 4HCVA 2E9OA 4M67A 5M44A 4LOOA 2X7OA 3PZEA 4O7ZA 3F6XA 3E8DA 3WIGA 3ZDUA 1IR3A 4BIBA 4A9RA 4DAWA 5AUVA 4YMJA 2GNIA 4RIOA 4V0GA 1REKA 5IPJA 5KKRC 5AWMA 4R78A 1FINA 2WMAA 3GFEA 2PVMA 2EVAA 3G33A 3D5VA 5HKMA 3P9JA 3HECA 4QQ5A 4AW0A 5HD4A 1HOWA 3Q4TA 1J1CA 2C3KA 4RFYA 2RL5A 3HGKA 4XV9A 5GIPE 4R7BA 2F4JA 1ZMWA 5IUIA 1K9AA 3MY0A 2A0CX 2CCIA 1H4LA 4UMQA 5G1XA 2JAVA 4C59A 4O84A 1WZYA 3OOGA 3QTIA 4TY1A 5ACKA 4ANLA 2YM8A 3JR1A 5EG3A 5I9UA 4MBIA 5A3XA 1FGIA 4HGLA 2C47A 4KRDA 3N4TA 3QZGA 4HNIA 1U54A 4M7IA 4HVSA 4MBJA 4M97A 4WIHA 3ORXA 4QMSA 3U6JA 4HCUA 3PZHA 3HMNA 4U0IA 3SDJA 4D2RA 4G3GA 3RINA 3SG9A 2OSCA 5KUPA 5F1ZA 4FT9A 3BV2A 3CJFA 5HICA 2OG8A 2UW4A 1P2AA 4TNDA 3GU5A 2VWUA 5CEIA 1KE7A 4O7NA 5LMKC 1UNGA 4U3YA 4N57A 4XRLA 4XLIA 4QT1A 5A54A 2BKKA 1ZAOA 3MH1A 5KBQA 3ZYAA 2AUHA 5J1VA 3NW6A 3ODZX 3VW8A 4CVAA 3KMUA 4IAYA 4D28A 5F95A 1PMEA 3F9NA 3ORMA 4RIYA 5EDPA 4K77A 2B52A 4U7ZA 1OKYA 3RTPA 2YZLA 5B2LA 4OBPA 3QA8A 3NPCA 4PDYA 4IAZA 4E1ZA 2WTVA 3FWQA 3TNQB 1YWRA 1F3MC 2LGCA 5F94A 3NVKI 4FKVA 2VX3A 3BPRA 3ORPA 2HXLA 5BYYA 4PP7A 3AG9A 2GNLA 4RJ3A 4IJ9A 4EHVA 1Q3DA 4RG0A 4CFVA 2CKOA 4O7VA 2FYSA 4LQMA 5FLFA 2XH5A 3VQUA 4UWCA 4FVRA 3V5JA 4IVDA 4TXCA 2EB2A 3DT1A 3C9WA 3KC3A 2J6MA 2YIXA 2GTMA 4F9YA 3L9PA 3KK8A 4NTTA 3C0HA 2J90A 4PDPA 4NL0A 4AN2A 2AC5A 4XP2A 4MXXA 3WBLA 4AA5A 5AAEA 3SXFA 2CJMA 4FG9A 4I4FA 4YLKA 4EHZA 3GC7A 4FKRA 3W2SA 2I40A 2WMTA 4K1BA 5CAQA 4IX3A 1URCA 5I9YA 4LGDA 2NO3A 4RJ6A 5IQFA 5BVOA 5HU9A 2J5EA 2OBJA 3RZBA 2QURA 4GK2A 2JFMA 3ORLA 4FR4A 1JKKA 3F88A 2C0TA 4BICA 3Q6UA 4RX7A 4XG3A 2CDZA 3B8RA 4JQEA 1UU7A 1LEWA 1NVRA 5GIOE 3WZEA 4C3RA 4LRKA 3WE4A 3T3VA 3TNIA 3V5QA 3ZFMA 1G5SA 3KRWA 2RKUA 3R7OA 2XIYA 1ZZLA 1P4FA 3COHA 3LAUA 4J98A 4WO5A 5FTOA 3UYSA 4AFJA 4CYIA 4PPBA 4DFNA 2XK3A 4AQCA 5L2TA 4DITA 4YZCA 3WF7A 4X0MA 3H3CA 4A07A 4FL1A 5BNJA 5H8BA 1QCFA 1WBWA 2VTMA 2I0HA 2YN8A 3G5DA 5JQ8A 5L2QA 4CMOA 5JEBA 2FVDA 2W1GA 3E7VA 3QTSA 4YJRA 5DHJA 3RK7A 4CD0A 3ANRA 3W55A 4BYJA 3ENHA 3R8MA 5LJJA 5IUHA 1WCCA 3VHKA 3OXZA 4M68A 3TV6A 2QLQA 4F9WA 3DBEA 3HMMA 2QOHA 4MQ1A 3PJ2A 4FG8A 3BGQA 3NUYA 3D5WA 4AW5A 3NUAA 5AR4A 4O6LA 4L01A 3UNJA 3P7BA 1U59A 5C8MA 4C36A 4QYYA 3R7UA 1GNGA 3UG1A 3VBXA 4HYIA 2GNJA 1SNXA 3P5KA 1VYWA 4FSRA 2WTCA 1O6YA 2P4IA 3Q2MA 1JLUE 1MQ4A 3U4WA 4EOJA 2IZUA 3NYXA 5CU2A 4YNOA 4EI4A 4DT9A 2IJMA 4HGSA 3O7LD 4IWPA 4X3FC 4IMYA 2J50A 5B0XA 3WZKA 4ACCA 4R8QA 3C4EA 4L7FA 3LCTA 2QC6A 1Y8YA 4L68A 4D1SA 3R71A 4U44A 2CNUA 2Y6MA 1MRVA 4CG8A 4XG6A 5L6PA 1M2PA 4DFLA 4GMYA 3FZOA 5M06A 4AT4A 1J3HA 4JT3A 2FB8A 4ITHA 4KBKA 3KULA 4ZLOA 5LVNA 3IW4A 4S32A 4WNPA 5FG8A 1STCE 3FMEA 2IVSA 4FYOA 3RP9A 3D9VA 4K0YA 4WNOA 2ITQA 4CT2A 2JKQA 1XH5A 4MHAA 5J79A 2LAVA 4GJ3A 4EH5A 4B4LA 2Y9QA 3W8LA 3JUHA 3SC1A 2GS2A 2ITTA 3EL7A 2HZIA 3R8PA 2X9FA 5DI1A 3PE1A 4U97A 4BCNA 3LCOA 5JFSA 3H9RA 3OCTA 1RQQA 3F3ZA 4BR3A 4NIFB 5E8WA 2XZSA 4XS2A 1L8TA 3TDVA 4IAIA 4W8EA 5JFWA 4FUXA 4BDKA 2UUEA 1YHWA 4FGRA 2JGZA 2WGJA 4F9CA 1ZRZA 4X7QA 5EHYA 4CMUA 3QFVA 5HO6A 5BVEA 3UBDA 5DVRA 1REJA 3BCEA 3R9DA 4DBNA 4G6LA 4RIWB 1R1WA 4QMVA 1H08A 1JSVA 2IWIA 4E26A 2OU7A 3G9NA 2VTLA 2C6IA 5EI2A 4RRVA 3JS2A 2RFEA 3CP9A 4IVCA 2WPAA 4NK9A 4TT7A 5BVKA 4E4XA 4R1VA 3EZRA 5L8KA 3NNWA 3MIYA 2VTJA 1H07A 3A8WA 3G6GA 3TXOA 3JVSA 2XNGA 1M14A 3MYGA 4XRJA 2HYYA 3VC4A 3SW4A 2JDVA 3BYSA 4QO9A 3U87A 4JS8A 2PZPA 2WD1A 1R0PA 2BDFA 3FBVA 4FZDB 3ULZA 4EQUA 3KY2A 4L53A 4QMLA 4JLCA 4LL5A 4F1OA 1KV2A 3P86A 4X21A 3QKLA 3LM0A 3U9CA 4FUYA 5DWRA 1UWJA 3IW7A 4UMPA 4EBVA 3DBFA 4AN3A 4JAJA 2BCJA 3DJ6A 4AS0A 4CRLA 2UW6A 4ANOA 4BIDA 1NY3A 4JBOA 5IMEA 4EYJA 3BU6A 2QG5A 1YOMA 4I6BA 4C61A 3CPBA 3QD3A 1UNLA 3UVRA 5A6NA 3MS9A 2EB3A 2W99B 4BHZA
chains in the Genus database with same CATH superfamily
5I9WA 2RF9A 3EFJA 3LFAA 2ZJWA 4AXDA 1AQ1A 3OC1A 4QQTA 4V05A 1HCKA 2RFDA 4DLIA 4IB5A 1SNUA 4BRXA 5E1EA 1PXKA 3A7FA 4FEQA 4Y46A 5AUYA 3WI6A 5IDPA 2HWPA 5E8XA 3R30A 2Y6OA 1W2DA 2X8EA 2XYNA 3FMKA 5T6KA 2PYWA 2JKOA 3BYUA 4U79A 4O0WA 4RVTA 3AMAA 4IZYA 2WHBA 3UO5A 3KXHA 4IZ5A 2CN5A 4KRCA 5AP2A 3JY0A 1Y8GA 4EZ3A 1FBNA 3BHYA 4NM3A 3LLAA 5CT7A 1CDKA 5E90A 5AIKA 3VS0A 4F1TA 3D5UA 2ZM3A 3OWPA 5EYCA 4OR5A 4F4PA 1H25A 5F9EA 3ORTA 5DYJA 1K2PA 3PRFA 5GJFA 5IA5A 3I60A 5FWKK 4EOIA 2YM7A 3UZTA 4AX8A 3OWLA 1G8KA 2BR1A 3H0YA 4HOKA 3FSKA 4F09A 3CR0A 5KMIA 4Y85A 1M7QA 4ENXA 4BIEA 4EH8A 2A27A 4QNYA 3SD0A 4ZZOA 3RALA 1JKSA 1KOBA 3OW3A 4FIGA 3DNEA 4Y73A 2ETMA 3KXXA 2XNBA 3PXRA 3KRLA 2J0JA 5H8EA 3W18A 4MVFA 3O71A 1OGUA 5BVWA 3C4FA 5FXRA 1KV1A 3VBTA 2Z2WA 3MESA 3P5JC 2JDRA 3BQRA 3R01A 4CTBA 2W1EA 4J53A 4KABA 3LJ1A 3QQHA 3CTQA 4GIIA 5BYZA 3V8SA 4BZOA 3GUBA 4D9UA 2GHGA 1W82A 2WQOA 3EJ1A 2I0VA 2R3OA 3I1AA 4UZDA 2YIYA 4BCHA 2BPMA 3I7CA 4QMWA 4YJPA 2PMIA 5CXZA 4QMUA 4IIRA 4O4BB 1OL6A 5BV3A 2XBJA 2BAJA 1H24A 4OW8A 3C4ZA 4C4EA 3A99A 4ERKA 3RI1A 2ZB1A 1WVXA 3B2WA 4ZLYA 2CLQA 4C37A 3TNHA 4XBUA 2QONA 4EH3A 5ETAA 1OIUA 3FY2A 4DC2A 2OZOA 3KF4A 5FXSA 5CF5A 4NIFA 5JH6A 2GSFA 3Q5ZA 2BAQA 3EN6A 4FIEA 3IECA 4LFIA 2O8YA 4YJVA 4PL4A 5E8VA 1Q4LA 3H4JA 3EN5A 3RHKA 4MWIA 5EM7A 4RIWA 3R7GA 4RLKA 2YFXA 5TKDA 3D7TB 5JK3A 3QHRA 4C0TA 5JZJA 5BMSA 4QP3A 2QKRA 4ANNA 2XAOA 2J9MA 5AA8A 4AGCA 2G1TA 5HCXA 3EN9A 3CY2A 1UU3A 5AX3A 5FGKA 4AZFA 3LXPA 4WBBB 4XV1A 3ZLWA 3GC0A 5IZFA 3MB7A 2I7QA 1DAWA 5HLWA 4ASDA 4F6WA 2VO0A 3COIA 4DCAA 3GT8A 3HMIA 4J99A 1Q8YA 4LOQA 4ASEA 4QMPA 4MD7E 4BTMA 4C4JA 3TWJA 2PVRA 4FZAB 4BF2A 2JBOA 4E6CA 4BBMA 3GU8A 2QO2A 2W1FA 4RJ8A 2CNVA 3QTQA 5FBOA 3QD0A 1KE9A 4QMMA 2VTTA 4EZ7A 3E63A 1W0XC 3C4CA 5B2KA 3R83A 4BWXA 1ST0A 5E9EA 4IC8A 5CNOA 3W2RA 3RCDA 4O0VA 4CZYB 3V5LA 5GZ8A 3W0MA 2GDOA 3O7LB 1WBVA 4WG3A 5HX8A 2QR8A 2VWXA 4LGGA 3EN4A 3ETAA 4L46A 1OPJA 2G2HA 3I79A 2QR7A 4JR3A 3WARA 3LM5A 4LI5A 3ORZA 2R7BA 2R0UA 4BFMA 4D0XA 5BVFA 4CGAA 1CM8A 1GY3A 5CVFA 2BROA 3CLYA 3CQWA 3U51A 4D4YA 2JKKA 1U46A 3FL5A 4DHIB 4PRJA 2C6DA 4I21A 4I94A 3FI8A 3JPVA 1H1PA 2VN9A 3ITZA 3P7AA 4UMRA 4FTRA 4R7IA 3JY9A 4W4XA 3Q9ZA 4FKQA 5DE2A 3GU4A 5M57A 4O7WA 3ZM4A 4B8MA 3O23A 4DFXE 4DHZA 4YZMA 3F66A 5EI6A 1WBOA 2BRHA 4NEUA 4FNYA 3PVUA 3NCZA 1FPUA 1WFCA 1JBPE 3R1NA 2XF0A 3FZSA 5IMXA 4M12A 5EW8A 4FIIA 4IVAA 3OY3A 3C50A 4FEVA 2XIZA 2RG5A 2UVZA 5GJDA 2W9ZB 5AUWA 2UZOA 4IWDA 5HCZA 4CKJA 1U4DA 3RJCA 4NUSA 3ZONA 4FV4A 3DV3A 2R0IA 5E8UA 2PPQA 4GRBA 4D5HA 4IADA 1UU9A 5IQHA 2UZUE 3DZQA 1U5QA 2WMQA 3ZXZA 4R77A 1PXOA 4KD1A 2ZAZA 4UWBA 4ZTNA 5ANIA 5CEQA 4UMUA 5EKNA 2XK7A 2W5AA 3RAWA 4ANQA 3U6IA 5EHOA 2WTIA 3CIKA 3DAJA 5AV0A 1ZZ2A 2OH4A 3FKLA 3UDBA 1X8BA 4EH6A 3BLAA 1M17A 4J71A 4TYHB 2I0YA 3HMPA 4XBRA 2PULA 4YJOA 5K0XA 4MF1A 4GV1A 2CHLA 5HG8A 4IX6A 3C4WA 5AR8A 4A7CA 2BILB 2XS0A 4O82A 3G90X 4IEBA 3WE8A 1OVEA 3DCVA 4RJ7A 3ZCLA 4CSVA 3W0RA 4TKSA 5FRIA 4AZWA 1JKLA 1Z9XA 2CNQA 3NCGA 3QRJA 5I0BA 1XWSA 5J8IA 4S33A 2PK9A 4J52A 2X7GA 4F70A 3ALOA 5CAVA 2WEVA 2IVUA 4JI9A 2VD5A 5LCJA 2F9GA 4IH8A 2V5QA 3K3IA 3MY1A 2UW9A 4I1ZA 1YDSE 1SYKA 1V1KA 3Q96A 3UODA 3EFKA 1DM2A 2C5XA 4XP0A 5F4NA 4FTNA 4ACDA 3RAKA 4PTEA 3FY0A 3IO7A 4L67A 3CBLA 1YXTA 2ZYBA 3AD6A 1S9IA 4KSQA 4NH1A 4U41A 5CSWA 4O4FA 4YBKA 2GNGA 3ZO4A 3TT0A 5LVOA 2WMVA 4FIJA 4I0RA 3Q6WA 3L9LA 4FV8A 3HX4A 3D7TA 4NM7A 3R7IA 4YJNA 4GK4A 3FHIA 3RBWA 4EBWA 4HZRA 4DBXA 4O2ZA 4MQ2A 4AW1A 2W17A 4FKSA 3LFEA 1ZLTA 1T45A 3QTRA 5DPVA 5KZIA 3DTWA 3QUDA 5DEYA 3L8XA 4DFYA 3O8UA 5BPYA 3A7HA 2GS7A 2XJ0A 3GXLA 4AE6A 4YU2A 5AR2A 3HUCA 2PHKA 3KXMA 3EOCA 4FK3A 4NW5A 3HA8A 4WKQA 3CKXA 2O65A 4FKUA 4D5KA 1G8JA 4J95A 2B1PA 4KWPA 4RJ5A 2JDSA 3L8VA 3RM6A 4EZ5A 4NFNA 2BZJA 4IQ6A 4PV0A 1BI8A 3OCBA 2WO6A 2XCHA 3CEKA 1E1XA 3H9OA 5DLSA 4HYSA 4ONAA 5H2UA 4IM2A 3SV0A 3JYAA 3EYHA 5M4FA 2HWOA 2R3JA 5C1QB 5J5SA 1IAJA 4DH3A 3QQLA 1FMKA 2UW8A 2HIWA 3QKKA 3QXPA 4LMUA 3UOLA 3NUPA 5KMNA 4BI2A 3LQ5A 3CQEA 2FSMX 3KL8A 5M51A 3R7VA 1BYGA 4Q9ZA 5FP6A 1UU8A 2V0DA 2C3LA 5AR7A 3RWQA 4EK6A 3IW5A 3R9NA 4IXPA 5DGZA 4IACA 1XJDA 5DG5A 2Y0AA 1TKIA 1MRYA 2YABA 2YJRA 1YI6A 2R3PA 3QAME 3QWJA 4CZTA 4AT5A 1M2QA 3F5GA 4O0UA 4QYFA 3ZBXA 4WA9A 5IQEA 4MF0A 4OBQA 4RA5A 4EJNA 4QRCA 2G15A 3DOGA 3NW5A 4CFFA 2A98A 4OT5A 4ZTHA 3MVMA 3MY5A 3CJGA 3BELA 4CQGA 3VS4A 1PXLA 3F2AA 4FIFA 5AP4A 3IW6A 3WF6A 1QPDA 1WBSA 2YIWA 2OWBA 3R8UA 3VS1A 4FF8A 4C4FA 4X6RA 1V0BA 4BZNA 5HORA 5JZNA 2YIQA 3BLRA 3DLSA 5IH6A 3D4QA 3F7WA 2VWBA 4MXOA 4YP8A 5GNKA 5IISA 4TYIA 5LVPA 1M2RA 5KZ0A 4Y83A 4I20A 4USEA 2VNYA 3DFAA 2HW7A 1H01A 3UYTA 4PDSA 3OXTA 3EQDA 3R0TA 1RDQE 1J91A 2EXMA 3O2MA 1NXKA 1XH6A 3QL8A 4KB8A 4RQVA 3ZBFA 4EK3A 5CEKA 2FSOX 2XARA 4FKPA 3FHRA 5HGIA 4FMQA 5JN2A 4O4DA 4CRSA 2DQ7X 4I3ZA 3HKOA 3TM0A 4Q2AA 1Q8ZA 5HIEA 4HCTA 2OJIA 3AMBA 4PPCA 3F3VA 4PL3A 2YM3A 4GG7A 1YXXA 1GZ8A 4NTSA 3HAVA 3I6WA 4PY1A 5CEOA 2YCSA 3BU5A 2UW3A 5EYDA 3ZZWA 4TYHA 5FQDC 1BUHA 4H39A 1TQIA 3C5UA 4D9TA 2BMCA 2VTHA 3D2IA 2YM6A 2X2MA 4LUDA 1IA8A 3PG1A 4QYGA 5AM6A 3HRBA 3LXNA 1M7NA 5EDQA 2PVKA 2XCKA 2GU8A 3QD4A 3TV7A 3RGFA 4DEAA 3W0NA 3R8ZA 3PLSA 3GP0A 3QX2A 2W7XA 3E8CA 3Q4ZA 1OUKA 4QMYA 2W1HA 3HV5A 2X0OA 2WQMA 2X2KA 4AAAA 4KINA 3ZOSA 4GUEA 5JFVA 3IG7A 5LVLA 4AZVA 3UP7A 3VUHA 2GQGA 4PL5A 4EK4A 3A7IA 4E7WA 2VTOA 1GJOA 1YXSA 2IZTA 4BKYA 4JRNA 4EH9A 1LPUA 4DGLC 3RMFA 1VYZA 2CPKE 3H0ZA 3COMA 5EKOA 2H96A 3R8LA 5CQWA 3VS6A 4FT3A 2F49A 1CKIA 4G5PA 4LRJA 4ZZMA 4WBOA 4C4HA 3PG3A 4W9WA 3QKMA 4H3BA 4GVJA 5D7AA 3V8WA 5CASA 1BLXA 1H1SA 5E1SA 3ZLXA 4I6LA 3IKAA 3TCPA 2O3PA 4MD8E 4XG7A 4ANBA 4QDEA 4O38A 3IDCA 3VW6A 1DI9A 1W2FA 2UW7A 4F7LA 3QTZA 4LV7A 3CKWA 5IKWA 3OD6X 4G9CA 5M09A 2C0OA 3PXZA 4A4LA 3EQPA 3NLBA 3VBYA 5M55A 1B39A 3LFCA 2R4BA 2OGVA 4AE9A 4AXFA 4I4EA 3DQWA 5DRDA 1GIHA 3KFAA 3VO3A 3ATSA 2VO3A 4IBMA 3QUPA 2H8HA 4C4GA 5AIRA 5C03A 3TKHA 2VUWA 3TJCA 4R3RA 3ZSIA 3KULB 2WQEA 4LGHA 2ITYA 3SLSA 3REPA 5FDPA 3ORNA 3E7OA 1NA7A 2ZV9A 2VTSA 3Q53A 4W9XA 2C6MA 1PYXA 3MTFA 1H1QA 2R3RA 4F7JA 3UQCA 4BCFA 3PXQA 4JJRA 2X6EA 4MXCA 1J7IA 1W83A 4L8MA 3QU0A 3DAKA 4GG5A 4F99A 4YJSA 2BALA 2P55A 3EQGA 2PVYA 3MVLA 5KMOA 4GEOA 5AV4A 3VUDA 4M66A 4ZEGA 4OAVB 3HZTA 3R1YA 4QP9A 2X39A 5D11A 4CFXA 1UKIA 2JEDA 2H34A 2QI8A 4BN1A 1KE5A 1EH4A 2A4LA 3OBJA 1OPLA 4I6FA 1W7HA 2CGXA 3DKFA 3KKVA 4JG6A 4C58A 2Y4IB 3RPRA 4ZTMA 4RVMA 5EI8A 1BL7A 3O51A 3S4QA 3UE4A 4OAUC 4HPTE 5GZ9A 4D4SA 2B9HA 4I5MA 5KMKA 4I6HA 2OH0E 4XUFA 3A60A 1GZOA 3RPOA 2P3GX 4E93A 2WOUA 4DHFA 5HLNA 2C1BA 3C13A 2OJFE 4ALVA 1K3AA 4JQ7A 2IW9A 3RPSA 5DMZA 4YLLA 5E4HA 3Q9XA 4E73A 5DT3A 4JBPA 2C5YA 2ZDTA 4FV5A 2QOLA 4RQKA 4CEGA 3D83A 5FM3A 3QALE 5BVDA 4G1WA 5IEXA 1Y57A 4W4VA 3W8QA 2XBAA 3O96A 4MEDA 4FTAA 5IH4A 1XH8A 3FMLA 1R39A 2ACXA 3V8TA 3D0EA 2C0IA 3LQ8A 4FSQA 4K2RA 3U54A 4X2JA 3ID6C 4FKIA 3N4VA 4OTQA 3ERKA 1YQJA 4FE2A 4M14A 5ANJA 4KUJA 4EKKA 2VWIA 3W0SA 5DBXA 1Q97A 4X2KA 3OEZA 3ZDIA 4OTPA 1NW1A 4PMMA 4NKSA 5AP0A 3OY1A 3UC3A 1XBBA 4FSTA 2X6DA 4H3QA 2C1AA 4QYHA 4QP4A 3A62A 2E9NA 3HEGA 1YXUA 3M1SA 3DAEA 4ACMA 2B0QA 3CPCA 4RX8A 4FZFB 3D14A 1JPAA 1P14A 3NYNA 4H1JA 4YJTA 2B9IA 4AOJA 5BX0A 5L8LA 3SA0A 1Q61A 5ICPA 1J7LA 1ZYCA 2BRGA 5HG7A 2VTAA 3WILA 3F5UA 4M8TA 3QWKA 4AOIA 3BHHA 3PJ1A 1W8CA 5BUEA 5D12A 5K5XA 5CSXA 3U6HA 3PIYA 2E2BA 4M3QA 4IX5A 5CX9A 3IPHA 4XYFA 5JGDA 3ZM9A 3GGFA 1XMLA 1WBNA 3LMIA 1MUOA 3M2WA 2ITUA 2ZB0A 3E8EA 4K6ZA 4DGGA 4G9RA 5ANDA 1PW2A 3QC9A 4LMNA 4X6QC 5CU0A 4PMTA 4O7TA 3QGYA 1H26A 3EIDA 1OL2A 2JIVA 3UG2A 2VAGA 2QHMA 4ZTQA 3V6RA 5L4QA 5CEPA 5A4QA 5CS6A 1XH4A 5CY3A 3C51A 3E3PA 1ZOEA 3L8PA 2PZRA 5CEMA 2YDKA 4IVBA 4ZTSA 3D15A 2Y4IC 1VEBA 4G3DA 5CZIA 3GCSA 3WZJA 1YW2A 4NSTA 2W0JA 2YA9A 4Z7GA 5AP3A 3Q9YA 3LCKA 3NMUF 4R5SA 4BWPA 2XKDA 4Q9SA 1OKWA 3QA0A 2UZBA 3M11A 4ZY4A 5HNIX 3FI2A 3LFQA 3ROYA 2OICA 4R1YA 5A4EA 5IA1A 2JBPA 2YM5A 4QDVA 2BRMA 4XH6A 5DEWA 2CN8A 1YOLA 3VS5A 4FKJA 4JDKA 5GHVA 5HE1A 2PZ5A 3P4KA 4FTQA 5HO8A 5DNRA 4NCTA 5C4KA 3P79A 3MH0A 4Y5QA 4ALUA 5AP7A 4II5A 4O96A 2VV9A 4EUUA 2UZVA 4IJPA 4O4CA 5M08A 3OTVA 4GVAA 5CI6A 4O86A 4DFUA 5IQCA 4LOPA 1MQBA 2VTIA 3CD8A 4RPVA 2OK1A 3R7EA 4RVLA 1DI8A 3E8NA 4Z16A 3RK9A 3FLQA 3P23A 3FQEA 3R9RA 4O0XA 1GIJA 5CSPA 3NX8A 2NP8A 1LP4A 2YLEA 2O5KA 5E91A 2CKPA 3TIYA 3KXZA 2UZTA 3AT3A 5AM7A 1OBGA 3AKJA 3R1SA 2BFYA 4GL9A 4DTBA 3QRTA 4XOYA 3OCGA 3VN9A 5HI2A 3PUFC 4F64A 5A9UA 4DFZE 3NNUA 4I92A 5BVNA 4IWQA 3ZC5A 4NW6A 5AFVA 2J0LA 4BZDA 1OL1A 1PKGA 2W5HA 4G3FA 3UO6A 2GQSA 1OL5A 4FTLA 4FV7A 3DXPA 4BI1A 4UEUA 2OIQA 3TDWA 1FOTA 2PUUA 4UBAA 4PWNA 2DYLA 4WUNA 3VS3A 5JGAA 3OTUA 3TNPC 5TOZA 2BFXA 1TQMA 4BDFA 3N4UA 3BL9A 1ZMUA 4RJ4A 4JDIA 3TI1A 3R04A 1PXPA 3I81A 4D0WA 4GJ2A 5I9VA 3B2TA 4O7YA 4QQJA 4J8NA 2RG6A 2HXQA 3UOHA 4DH8A 4FZ7A 1UNHA 3AC4A 2R3KA 4NU1A 5HE3A 2O63A 3MFSA 1BKXA 4JDHA 3ZZEA 3NNXA 1IAHA 3CY3A 2GFCA 1FMOE 2EXCX 3LFNA 3ORKA 5HVYA 3BKBA 3LCDA 5ACBC 1WBPA 1BX6A 2IF8A 2VZ6A 3PY3A 4GT3A 3EQRA 4M13A 2P2IA 2P33A 4EKLA 4PMPA 4IB0A 3T8OA 2H6DA 4EOQA 1VLRA 4M0YA 2REIA 5CVHA 1ATPE 4YSJA 2YACA 3PJ8A 4MKCA 5A14A 4OTIA 4QEBA 2WOTA 2Y4PA 4QTAA 4Y8DA 2OXXA 2PSQA 3TTIA 3VF9A 1PHKA 4GKHA 2YITA 1VR2A 1S9JA 4O22A 2OXDA 3FPQA 4BDBA 4DA5A 4NM0A 4GFGA 4V01A 3TUBA 4DDGA 1UA2A 1H0WA 3LLTA 3NYOA 1KUTA 4BI0A 2PVNA 4F08A 4XV3A 2PE2A 2WMSA 3GU6A 3QHWA 3EHAA 2XNEA 3OT3A 4GFMA 3W0QA 4RBLA 2XNNA 5A4LA 3DBCA 3GCUA 3L9MA 3OEFX 1PKDA 3EKNA 5KX8A 3FZ1A 5M4IA 3T9IA 4IANA 3AXWA 3VVHA 2UZNA 3AC1A 4ZAUA 1IG1A 4NM5A 3PJ3A 2XM9A 4AGDA 2NRYA 4C57A 4CFNA 2YHVA 4JX3A 4Z3VA 3W0PA 3GI3A 4C7TA 2YDIA 2ZM4A 1BMKA 2ZMCA 1OZ1A 4EORA 2BZIB 3W32A 3QZIA 3II5A 3HV7A 4BL1A 4L44A 2VO7A 3AC8A 1Q8WA 5EOBA 4BDIA 2NPQA 4IZ7A 2W06A 3R7YA 1XKKA 3I6UA 1JAMA 3O8TA 2Y8OA 4IAFA 4ZSGA 3IK3A 4AOTA 3BWJA 1Q5KA 4FC0A 4PDOA 3QTUA 4JIAA 3EWHA 2X4FA 3DDQA 4UXLA 3HYHA 4DG0E 2XRUA 2VRXA 2WTJA 3Q3BA 1OITA 5IA4A 2X0GA 4O7RA 5D7VA 3IOKA 4U8ZA 4KKGA 4FSWA 4ITJA 5LVMA 3UO4A 5J5TA 4BCOA 4FYNA 2QOIA 4CFUA 4F9BA 3U9NA 1KOAA 4XHKB 1F5QA 3JVRA 2WEIA 4FA2A 1Z57A 4O7LA 3NAYA 3LCSA 3P0MA 4MBLA 4FKWA 4OBOA 1RW8A 3FXWA 4ZIMA 2FUMA 1WVYA 4CCUA 3DXNA 3FZTA 4TWOA 4ZJIA 2BDWA 4F65A 3TZMA 4O1OA 4GYIA 3GOKA 3DPKA 3VNTA 2Z7LA 3BQCA 4Y5HA 3DA6A 2XK4A 3E93A 5EYKA 4BDHA 2FO0A 2XIRA 3PXKA 4O91A 3LMHA 2XUUA 4UMTA 2XK8A 2NYAA 3PWYA 1UV5A 2PZIA 4K33A 5DR2A 1SVGA 3V3VA 3RZFA 3W2CA 4EOPA 3DGKA 2DUVA 3MPAA 3DK6A 4GYGA 4R6VA 4O2PA 3F82A 3E64A 4XEYA 2HK5A 2YLFA 1Q99A 3BGZA 4HVDA 1O6LA 4BY9E 2ESMA 2JFLA 5I3OA 3WZUA 5CANA 2Z02A 4AXEA 2VWYA 1IEPA 5HE2A 3QRKA 3HA6A 1FQ1B 2W4OA 4M0ZA 3NAXA 2OIBA 2QKWB 2CKQA 4RWLA 2BHHA 4MAOA 4EEVA 3RHXA 1OM1A 1FVTA 3IS5A 4J7BA 3CCNA 5EQYA 3EH9A 3HDNA 3HNGA 2JKMA 4WNMA 3BWFA 4BBFA 5FUTA 3P78A 3KA0A 2E9VA 4G3EA 3UIBA 5LOHA 1L3RE 2CGUA 3ZXTA 3PVBA 4ZY6A 1RE8A 5EM6A 3VUKA 3TV4A 3ALNA 4D4RA 3KEXA 2WMBA 2IEWA 2V7AA 3OP5A 4IHPA 4YSMA 5HNGA 4A06A 1WMKA 3SQQA 3TZ9A 4TYEA 4UZHA 3ULIA 3POOA 4ARKA 4FOBA 2R3NA 2F7EE 5CAOA 4MX9A 4I5CA 4IB1A 4KS7A 3KB7A 4EHEA 3V5WA 4EK8A 4FV3A 3MJ1A 4JBVA 1VJYA 4XP3A 5B7VA 4F0IA 5H3QA 4X2NA 5E7RA 3PVGA 3DB8A 2XALA 4L3PA 3NYVA 2BZKB 4J97A 5DRBA 2X2LA 4BJJB 4BTFA 4DGNA 2UW5A 5HBEA 2J0MB 4JNWA 3BEGA 5AADA 2I1MA 4E5BA 3E5AA 1YI4A 4CV8A 1ERKA 5LXMA 5IUGA 5ANKA 4XMOA 1M52A 4B7TA 2UW0A 4PMSA 1J7UA 4WD5A 3HDMA 3TL8A 4AUAA 4G17A 5DH3A 3D2KA 3KN5A 3QD2B 4JQ8A 1QPCA 1WBTA 3VF8A 4Y95A 5CZHA 5M4CA 4CG9A 5KMLA 2PUPA 1OL7A 4HPUE 1G8SA 3FKNA 4NJDA 3GC8A 4YTFA 5HU3A 4FTUA 4NJ3A 3QUEA 4BKZA 4EJ7A 4WG4A 4GKIA 3MA6A 2ONLC 3VUGA 3ZFYA 5HD7A 4MYGA 5KCVA 4L42A 4Q5EA 3AC3A 5HEZA 3QCXA 4FIHA 4KIQA 4PF4A 4FNWA 4CTCA 3NIZA 2AEGA 3FMMA 2C5VA 4BGGA 4D4VA 1QPEA 3CGFA 3QLGA 3UJGA 1SVHA 2JD5A 1OKZA 1LUFA 3NRMA 4L52A 1SM2A 3HUBA 2XP2A 4FSMA 4G6NA 5HTCA 4FKTA 4DT8A 4ZMFA 4TWNA 5IG1A 3AMYA 4RSSA 3ZEPA 3QF9A 2WIHA 1B38A 4HVIA 3UIMA 3G51A 3W2PA 3UVQA 3QTWA 4OTHA 1F0QA 3FUPA 4G34A 5K5NA 4KIPA 4ZP5A 4IDVA 3OBGA 3TKUA 2R64A 3AT4A 4RZVA 4RWKA 4D55A 4GU6A 5HLPA 3F3UA 4QQCA 5DR9A 4QD6A 5TO8A 4EQCA 1VZOA 4PQNA 3VUIA 4Z7HA 4CKRA 4FV1A 2PE1A 3PRIA 3AOXA 3BIZA 3FLNC 4YGAA 2ZV8A 4IAAA 4BWKA 4QMQA 3RPVA 2ONLA 2W96B 3LXKA 3CXWA 3PTGA 4ERWA 4BDEA 5EM8A 4RIXB 1QL6A 3WZDA 4CFMA 4QTCA 2XJ2A 2B53A 3DU8A 2IZSA 2WQBA 1JVPP 3O0GA 4FJVA 3C0GA 2ITXA 4PTGA 5HESA 4B0GA 4C62A 1XMMA 4AP7A 3G0FA 4BDGA 4U45A 2WU7A 2VX1A 1ZYLA 3G9LX 4FTMA 2W4KA 4FGBA 2CKEA 3LJ2A 3UC4A 4GT5A 4JL9A 3C4XA 4EONA 3L9NA 4AA0A 2W1IA 3PWDA 1H1RA 2WKMA 5FEEA 4G2FA 4MXZA 3NSZA 4RFMA 4HVGA 3EMGA 3BLQA 3E87A 4FBXA 5DT0A 3ACJA 5HIDA 3MFRA 5A4CA 2OLCA 2X8IA 3RCJA 5A4TA 3O5AA 4O21A 5IQIA 3IQ7A 4XNEA 3VRYA 4YUQA 3V5PA 4WRSA 3FAAA 2YJSA 3LFFA 2QHNA 2KTYA 1CKJA 5ETFA 4O4EA 3W1FA 5AA9A 4ID7A 4AN9A 4FV2A 3ZTXA 1Y6BA 4PX6A 2GMXA 3ENMA 2C5NA 3OF0A 4IFGA 3MIAA 2B9JA 4D2PA 2YEXA 1ZY4A 1PMNA 2YERA 4BTJA 2PVJA 3QQGA 3JXWA 4FSNA 3PP0A 5KHXA 2YWVA 5CAPA 3LFDA 5AV2A 5KBRA 4CKIA 2VTRA 2YDJA 4S2ZA 5DR6A 3VBWA 4CLJA 3EQCA 3PA4A 2JAMA 4FODA 1TVOA 4ZZNA 1OBDA 2W5BA 2B55A 4BJJA 1Z5MA 4R5YA 3V5TA 4CYJA 1UVRA 5JGBA 4DTAA 4FI1A 3GVUA 5JT2A 2BHEA 3ODYX 5TF9A 5AUZA 3TTJA 3R2BA 4YHTA 2W9FB 2XKCA 4YJUA 4O83A 4JMQA 3A7JA 5AEPA 5L6WL 3MFTA 4O7SA 4X3JA 4OTGA 5CF4A 4C2WA 3E3BX 4ZOGA 3VUMA 4ITIA 2C6EA 3QCQA 3VBVA 4QTEA 4UYAA 4ZTRA 5IF1A 2HZ4A 2WNTA 5IA0A 3DTCA 5J7BA 5KKRB 4ZMEA 3WYYA 2C5OA 2NRUA 1ZOGA 3S3IA 2J7TA 5BYLA 2RGPA 3HAMA 3BU3A 4FTTA 5CVGA 4ZXTA 4CXAA 2GS6A 1CTPE 2VWVA 2O64A 2WU6A 3MTLA 3MVHA 3HLLA 3F5XA 4Z9LA 2SRCA 3Q32A 1FVRA 3ZO1A 2XANA 5BUIA 4TL0A 3W2OA 1ZWSA 4GFOA 3CTHA 4M15A 4RZWA 3EL8A 3HRCA 3PPKA 4I5HA 4QMZA 3S00A 2WB8A 3QYWA 4FSYA 4FL3A 4QTBA 3BZ3A 2UV2A 2QCSA 3R1QA 4YHJA 3DKOA 5HCYA 5M4UA 2XK9A 1H1WA 2BRNA 5EW9A 2PMNX 4LV8A 4NZWB 1BL6A 3K5UA 1U5RA 3IW8A 3OMVA 4TNBA 3R9OA 4WUAA