3P86A

Crystal structure of ctr1 kinase domain mutant d676n in complex with staurosporine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
267
structure length
250
Chain Sequence
MDIPWCDLNIKEKIGAGSFGTVHRAEWHGSDVAVKILMEQDFHAERVNEFLREVAIMKRLRHPNIVLFMGAVTQPPNLSIVTEYLSRGSLYRLLHKSGAREQLDERRRLSMAYDVAKGMNYLHNRNPPIVHRNLKSPNLLVDKKYTVKVCDFGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKCKRLEIPRNLNPQVAAIIEGCWTNEPWKRPSFATIMDLLRPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase CTR1
publication title Protein kinase domain of CTR1 from Arabidopsis thaliana promotes ethylene receptor cross talk.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 73
structure length 250
sequence length 267
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p86A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p86A01
3OTUA 4RC4A 1QPJA 2QI8A 2Y8OA 3PRIA 3QTXA 4LRMA 4EK8A 3ORNA 4CZUA 1DM2A 4YJTA 1WCCA 2J4ZA 4XJ0A 4ANQA 4G6LA 3WZKA 2XK8A 2O65A 4MQ1A 3U8WA 4F63A 5HE2A 5KMIA 2XNPA 4PY1A 2OIBA 1W82A 5HG9A 3Q4TA 4QOXA 5DEWA 3MB7A 4WSQA 1SNUA 5TR6A 3UZRA 1KV2A 4BDBA 5HESA 3ZSGA 5JFVA 1QPEA 4EYMA 4RVLA 3LFCA 4C62A 3NVMB 3DAEA 3ENMA 4PDOA 4QTCA 3PVBA 1MRYA 4EOSA 3EOCA 4DBXA 2GTNA 3D5VA 4FKIA 2QOKA 2BIYA 2IZRA 3KRXA 4YC3A 2WO6A 5KX8A 2YM6A 2WU7A 3QRUA 2I6LA 3SGCA 3GC7A 4PTCA 4UWCA 1H0WA 5I5ZA 5HVYA 3TV4A 3EFWA 3ZMMA 2X9EA 2KTYA 4IVBA 1XH7A 3GU7A 4MVFA 5HG8A 3TCPA 2CMWA 3HNGA 4XS2A 3UYSA 3VS0A 4JQEA 3OWLA 2W9ZB 4J52A 3NS9A 4WD5A 4YZNA 4MD7E 2PE1A 3W2PA 4EHVA 4FVPA 4HNFA 4PNIA 4F99A 1O6LA 2Y4IB 3JY0A 4NZWB 4YTHA 3Q4CA 4U0IA 2GNGA 4RA5A 4AN3A 2O64A 4PMPA 3PTGA 4L53A 4AN9A 4AGUA 5AEPA 5IPJA 3POOA 3DS6A 3IGGA 2WEIA 3D15A 2X0GA 3IG7A 3KN6A 4QMZA 5E8SA 5HE0A 4BCOA 2X8EA 3G0EA 4IH8A 3UIUA 4CV9A 5KZIA 2VN9A 4DT9A 1Q8UA 2YIXA 4WNKA 2HW7A 3RHXA 5ANEA 5ETFA 3IK3A 1OPKA 3RM7A 3C0HA 5CXHA 2W4JA 4XHKB 1SNXA 5AP1A 4V05A 4FIGA 4WUAA 3EH9A 3JY9A 3GU6A 3NEWA 4BR3A 5HZNA 2ITQA 5CNNA 4DCAA 3C51A 4NJ3A 2IO6A 4FSNA 2W5AA 5DOSA 5JQ5A 2I0EA 3GU4A 4I6BA 4L3LA 2BDWA 3UC3A 2R7BA 4BCKA 1K9AA 3AC5A 2R3QA 3KKVA 4YSMA 3TJDA 5HHWA 2YZLA 3MTLA 2BAJA 2W17A 4GT3A 3N4UA 2R0UA 3PUPA 4OBPA 3UOHA 1UKHA 4XP0A 2YLEA 4E20A 2HZIA 2J50A 3D2IA 3DQXA 3FYKX 5K9IA 3GQLA 5DR6A 2C0TA 2PSQA 4LGDA 3ULIA 2EUFB 1R0PA 4U81A 4JQ7A 3VW6A 4NU1A 1F5QA 4FT0A 4O2ZA 4RT7A 4TKSA 4EOKA 2QU5A 4DEHA 4J95A 3I6WA 2Y6MA 4KABA 3OW4A 4FKOA 4ITIA 2HIWA 4YTFA 2BPMA 4GMYA 3S95A 5J7BA 4U3ZA 4XLIA 4H58A 4JBPA 5A4LA 3O8TA 4ZY6A 3KCKA 4GU6A 4IE9A 3VUIA 3CE3A 4LUEA 1PXIA 2RG5A 4UWYA 2I40A 3PVUA 4E4LA 1XWSA 3FLZA 2E9VA 2W96B 2HYYA 4O27B 3NRMA 3LW0A 3QQUA 3SXRA 4DITA 2GQSA 5KHXA 5BVFA 1R39A 2WTKC 3VULA 4AOTA 4FTNA 2Z7QA 4QMSA 4YJRA 1PMNA 2H6DA 2W99B 2ITVA 3ZU7A 4MH7A 2IW8A 4JAIA 5B0XA 5J9LA 3E3BX 4PMMA 5KMKA 2QD9A 3HZTA 5EHOA 5DRBA 4LI5A 4J96A 4R1VA 4BWXA 5AV3A 3RCDA 4C37A 1GZNA 2YN8A 4AGWA 3MY1A 5AUUA 4QMWA 3PSCA 3DXQA 2QLQA 1NVQA 1GZ8A 1GIJA 1XKKA 2CN8A 2IW9A 2JDOA 4ANOA 5EKNA 3CEKA 5CSXA 3LFEA 3A8XA 3BQCA 2WQNA 3KULA 3IPHA 3L9LA 2X2LA 4A7CA 2GS7A 1BL7A 3OXTA 1WBVA 2G15A 4KKEA 4DTKA 4FT9A 3I5NA 4FX3A 2Z7RA 4NKSA 5ANDA 3Q5IA 2XK4A 3W8LA 5D10A 2XP2A 3QQJA 4BCIA 4HVIA 4R3RA 1H1RA 4YLLA 4AOJA 5AIKA 1OIYA 2PZ5A 1M2QA 2R5TA 4C4EA 4KBAA 2UVZA 1OL2A 4FSRA 2OJFE 2WTIA 3CSVA 2YCQA 2RL5A 3UMXA 3GEQA 1ZOHA 5FG8A 3MWUA 1A48A 5TO8A 3O8PA 4U6RA 3CXWA 3R8LA 1YXUA 5GIOE 5HLPA 3JVRA 5IQIA 3W2QA 3MPTA 2WTDA 3EFLA 4D9UA 1IAJA 3U4WA 4UWBA 4D2VA 3FMHA 4QTBA 5L6WL 2IZTA 2QOOA 3A2CA 3WOWA 4KUJA 1STCE 4QPMA 4RX5A 2YM4A 5EHLA 2VO3A 1QMZA 1U54A 3Q9YA 3TACA 3KN5A 5IQAA 5KO1A 5CVHA 1BYGA 4L42A 4PPCA 3F3ZA 3MY5A 4R7HA 3TZ7A 2Y0AA 2B9HA 1H00A 1H1PA 3OEFX 4FV2A 4TRLA 5EW8A 4BI2A 4EZ3A 3UO5A 1NW1A 4A4XA 2VWZA 4LOQA 4YJNA 4NL0A 5KUPA 4M3QA 1SZMA 2IZUA 3UQCA 4F7NA 2JDTA 2VAGA 4AE6A 5CEIA 1WVWA 4FTTA 3I79A 4BGHA 4O7ZA 4L00A 5C4KA 3LCTA 4FKLA 2VX3A 4UXLA 3EFJA 3NUXA 2VTPA 1UV5A 4YURA 5DVRA 5EDPA 1IR3A 4C61A 5I9YA 4F1OA 3UQFA 4L9IA 4FTCA 2WEVA 2XYNA 1PMVA 3MJ1A 3UDBA 5CQWA 2OH4A 5FRIA 1OKVA 2FSMX 4M67A 1A9UA 1GZOA 2YWPA 4RVKA 5FXQA 5CF6A 4EQMA 2BAQA 3RHKA 3LMGA 1RW8A 4G2FA 5CYIA 4O86A 3MPMA 2F9GA 4ZIMA 2PWLA 4B4LA 5EW3A 3HUBA 2HY81 2ITPA 3QX4A 3KGAA 3DT1A 1FMOE 4HYUA 3LLAA 1JAMA 4DFXE 5FUTA 1NXKA 2F2CB 4UMTA 3F61A 2WMRA 4NSTA 1V0BA 4O0XA 4EKKA 2BHHA 1FVVA 3QKLA 4TWOA 4XYFA 5DLSA 5DRDA 1H28A 3FLSA 5BVEA 3I7CA 4YP8A 5KMJA 3HV4A 5IUGA 4AWIA 4BKYA 3G2FA 5CVFA 4KKHA 3CD3A 3NGAA 4AN2A 4AU8A 4H05A 4DH5A 4G9CA 4O6LA 4II5A 1OIRA 4JX3A 2GU8A 1YVJA 5EK7A 4KRDA 3L9MA 3W55A 2C5VA 2VTOA 1REJA 1J1CA 3PG1A 2ERKA 3P9JA 3DFAA 2B9IA 4MD9E 4H39A 3VUKA 3PJCA 4A06A 5IA3A 3SG9A 3DNDA 4BVUA 2HW6A 1J1BA 2BCJA 2NRUA 4FNXA 2EB2A 3DAJA 4OTRA 2XIXA 5A4TA 1WBNA 5IH4A 4O7RA 3ORKA 5J1WA 3II5A 4NW5A 3FLYA 4J99A 5IH5A 3PXFA 1OI9A 4DG0E 5AA8A 3RNIA 3OCTA 3LCOA 3OROA 5L6PA 1O6KA 3R30A 4ERKA 5J1VA 2EB3A 4S31A 3BU6A 2WZJA 4TT7A 4D2PA 4JDJA 4LG4A 4ZLZA 3AC1A 2UZUE 1XH8A 2F7ZE 5EH0A 3T8OA 1VR2A 5FEDA 4KBCA 2WTCA 5CI6A 2YM3A 3EQBA 3VS6A 3ZM9A 2BRNA 2HXQA 4WBOA 1SYKA 4BL1A 4RA4A 2X8DA 2Q0NA 2XM9A 4B99A 3SW7A 4CG9A 2VTTA 2FH9A 1BUHA 4AX8A 4MBJA 2O5KA 2CCIA 4W4VA 2XKFA 3LMIA 1YI3A 4RQVA 3LFDA 3UOKA 3UVRA 4E6AA 1W83A 2J6MA 3EN9A 3IOKA 4IX3A 3KEXA 4YZBA 1Q8TA 3P7CA 5HBHA 2WFYA 3PJ8A 5KZ0A 3GP0A 1OL6A 5AR3A 3DKCA 3MI9A 4FTJA 4MQ2A 2Z8CA 3MGYA 4RPVA 1X8BA 3OY3A 2C6KA 4X0MA 5EM6A 2I0VA 1YHSA 3F5XA 1W84A 4GH2A 3C4XA 2WQBA 5LVMA 4W4YA 2BALA 3H10A 3MW1A 3R9RA 3VIDA 4NTTA 5LWNA 4O7YA 3RPYA 2UUEA 4XG8A 4GIHA 2JIUA 3FZRA 3QBNA 2IW6A 3IDPA 3NUSA 4P5QA 5JRSA 3ZH8A 5KMLA 5IQCA 3MBLA 4DEEA 4J97A 3G0FA 4IQ6A 4JXFA 4TY1A 4M12A 4OTWA 2R2PA 2IVTA 3AT2A 4U97A 4YSJA 2IVVA 1Z5MA 2AYPA 2ONLA 2YITA 3ZCLA 2X2KA 4EOMA 5HBJA 3TDWA 4F0GA 3LM0A 2BFYA 1YI6A 3ZBFA 4EHZA 1HOWA 4I5PA 5JH6A 4BCFA 3EQHA 1BLXA 1OB3A 2PHKA 3Q60A 5EQEA 1IA9A 3CD8A 3MA3A 3ROYA 5JFXA 3OUKA 4I0RA 3Q2JA 3WZDA 5ETAA 4YHJA 3E64A 2BRHA 3CKXA 3GXLA 3QQHA 4OTIA 2ITXA 3R2YA 4Q5EA 4L45A 4IWPA 1WVXA 2QR7A 5HD7A 4IVDA 2XZSA 1GOLA 4FEWA 4D4YA 2C5YA 4O96A 4DGLC 4U45A 4FNWA 1XJDA 3NMUF 4D1SA 4DGNA 3DLZA 3VUMA 1SVHA 3GCVA 5CT0A 2VWUA 5J79A 3DA6A 1OKZA 5M07A 2GQGA 4ZY4A 5BVKA 4DGOA 4ONAA 4P2KA 3EQIA 2WB8A 4MXZA 5J5SA 5DR2A 4XRLA 2C6MA 4FV8A 3Q4UA 5M44A 4ALWA 5AAGA 3F7ZA 4Q9SA 1Q62A 4S30A 3HAMA 1LP4A 2VO0A 5H3QA 4IM2A 3UNZA 4IB1A 1Q61A 3FC2A 2WOUA 4JAJA 2UVXA 4TYGA 1Q5KA 4LUDA 4F1TA 2XEZA 1BKXA 4NJDA 3TZ9A 2GS2A 4GUBA 4MNEB 5DBXA 3DFCB 5E8VA 2VWIA 3ZLXA 3SD0A 4RC3A 3FMDA 1Y6AA 3LFQA 5BUEA 4ZTSA 1GY3A 1VEBA 4JR7A 3NYXA 2XJ1A 2PL0A 4KSPA 3GU5A 4P4CA 3V6RA 4IX4A 1U46A 4KB8A 4MEDA 2B4SB 3W2SA 2VGPA 2PVRA 3TKUA 2WELA 4FV5A 3THBA 3HKOA 5L2QA 4B7TA 1KE9A 1Q99A 5CLPA 3A60A 2XS0A 3A7IA 3OZ6A 1WBPA 3I60A 4ZTLA 2VWYA 2XK6A 2OICA 3KVXA 5GNKA 1ZYDA 3TN8A 4YTCA 2PVKA 4FT7A 3LJ2A 3FZPA 2A4LA 2BZJA 2W06A 3HGKA 4BWKA 3DJ6A 3FC1X 1YWNA 4QMPA 3PDTA 4IC8A 4N4SA 4QTDA 4V04A 3TM0A 4USDA 2G2HA 5EYKA 4D5KA 5BUJA 2CLQA 4G34A 2B9JA 2O8YA 4RFMA 4A9SA 4F7JA 2H34A 4E93A 4QMMA 5CENA 4V0GB 3FMNA 1H4LA 1PF8A 4PDPA 5JFSA 1FINA 3PP1A 3DPKA 3QA8A 2BMCA 3QTZA 2ITTA 4YGAA 2PVNA 1TQPA 2BZHB 4FTOA 4DLIA 5HLWA 2ZDTA 3LXLA 2XKCA 5L8KA 3LFNA 4HCTA 5H2UA 2VWXA 3PWYA 3BHHA 2FSTX 3FPMA 4CT2A 2HOGA 5DR9A 4AZEA 4FZ6A 4NM7A 3U9CA 3R2BA 5JFWA 4BDCA 3E8EA 3KF7A 3KRLA 2O2UA 4M68A 3V5QA 4RWJA 5L2WA 3FWQA 2OLCA 4ANSA 1OUKA 1BI7A 1UNGA 1Y6BA 5T3QA 2EU9A 3D14A 4F4PA 4RMZA 5A4QA 2C6DA 2ITWA 5FEEA 4D55A 3E92A 5AUZA 2QOBA 5EKOA 1G8AA 4BDJA 2GNJA 3TNQB 2C1AA 4O6EA 3U6HA 3L8XA 3LFSA 4QMYA 4FL1A 2BZIB 2WKMA 4IM3A 4FIEA 2Z60A 3BWJA 3AMBA 4FTKA 3IO7A 3NAXA 4JI9A 5HO6A 4FBXA 4DFZE 3MH1A 4MNEA 4KNBA 2WMTA 4L8MA 4CMOA 4MCVA 4FTUA 2YIQA 4G6NA 1KUTA 2I7QA 2JBPA 5DT3A 3UJGA 4X2GA 5BX0A 2JD5A 4S33A 4BHNA 1P2AA 4NW6A 4Y46A 4IZAA 4F64A 1H07A 5CNOA 4HPUE 2JIIA 3BGQA 4QPAA 1PHKA 5JT2A 3L9NA 5DT4A 4F6UA 5KNJA 5JN2A 3NW5A 2R3KA 4G6OA 4O0WA 3I81A 3UZPA 5F95A 4E3CA 4F7SA 2QVSE 2QG7A 4DFBA 2RIOA 3OT8A 4C34A 3PA3A 4I24A 4L6QA 4RLKA 1LPUA 3O51A 4B0GA 5HVKA 2PYWA 4WRSA 3F6XA 3PVWA 3RMFA 2WMVA 1DI8A 2PTKA 1OVEA 4LGHA 4CZTA 3W32A 4I3ZA 4JBOA 3K3IA 5B7VA 4BBEA 4ZJJA 3OWPA 2VNYA 4QT1A 3U54A 1ZY5A 4LV5A 3MH2A 2W1EA 3RKBA 4IANA 2EXEA 3B2TA 4FL2A 4GJ3A 4O0UA 4OTDA 4KS8A 2XCHA 5F20A 2HWPA 3VJNA 4F0FA 5IQFA 2BFXA 3DV3A 3ZDUA 4RWIA 4ASDA 5J9YA 3GB2A 4D4RA 4DTBA 2QC6A 4MHAA 3RBWA 5FBOA 1OIUA 3HMPA 4XV3A 2FO0A 1OECA 3G6HA 5BMSA 5IG1A 4G3CA 3LAUA 4X7QA 3QHRA 5L2TA 3EHAA 4NIFA 5HCZA 4GK3A 2JBOA 3FQSA 3AC8A 3HV7A 4RJ4A 4DTAA 2P33A 3QQFA 4J8NA 3HV3A 1H08A 3ENHA 4U9AA 5D41A 2GDOA 2ZM3A 1OKWA 1Q24A 4QYFA 2WNTA 4OBQA 3UTOA 5KBRA 4MNFA 4OTQA 2E9PA 3R7VA 4JIKA 4I92A 3ZUUA 4FNZA 5C4LA 2HENA 5BUIA 3CPCA 3UOLA 4DEBA 5IA1A 2HAKA 1ZYSA 5A9UA 5CEMA 4BDHA 3W10A 3BU3A 4LL5A 4YPDA 4YMJA 5I9ZA 5LMKA 5ANKA 4UZHA 4DF3A 2F7EE 2FYSA 3K54A 5CSHA 3QRIA 4NFMA 3VF8A 3FXZA 4RJ6A 3MVMA 3QAME 4X3FB 3QCYA 2V5QA 3VQUA 3QC9A 3MESA 4BDFA 2R3JA 4PL4A 5CF4A 2EXCX 3D94A 5FP6A 1UNHA 4HCVA 4CSVA 4Z7HA 5HTBA 4RG0A 3R8VA 3QQLA 3ATTA 4EK3A 2JDSA 3NYVA 3NDMA 4GFMA 4TW9A 2UZTA 3KY2A 4C8BA 4UY9A 3L8PA 5TOZA 2B53A 1APME 1XBCA 2XMYA 3KRWA 2PUUA 3F88A 3OF0A 5HQ0A 3OCSA 4C4FA 3TNPC 4ZJVA 4AA4A 5DGZA 2R3HA 1OIQA 1A06A 3N9XA 4BKJA 3F3UA 4IHPA 3SOAA 4C3FA 4I5HA 4N0SA 2XVDA 4H3PA 1KOBA 2A19B 2RKUA 3WF9A 1M7NA 4L7FA 5I4NA 3C9WA 3MFRA 1PXKA 3AQVA 5EHYA 4XP2A 5IDNA 2YHVA 4GS6A 4FYNA 2WPAA 5E8XA 4M0ZA 4EOJA 4OTFA 3UPXA 3PA4A 3VVHA 5ANIA 4BTFA 4ZZNA 3UYTA 4O7VA 4KIKB 3EZVA 4AS0A 3COHA 2X7FA 2PPQA 2R7IA 4Z16A 4I22A 1Q3DA 3AMYA 1G3NA 1T45A 1Q97A 2J0JA 2QO9A 2VTJA 4NKAA 5D7AA 5HIDA 3VWAA 4BCQA 3R9NA 3UZTA 4MKCA 4GT4A 3L9PA 3NPCA 4XH6A 3EL7A 3HP2A 4BDKA 2OK1A 4ZTQA 3LJ0A 2QO2A 5CSPA 4USEA 1KE7A 4RIWB 1B39A 2YA9A 3PG3A 3BELA 4Q2AA 4WOVA 5FD2A 4B6LA 5M4IA 4WSYA 3WI6A 4ACDA 2YLFA 2WGJA 1Y91A 3R9DA 3CQUA 3QF9A 3ZFYA 1CKPA 4F6WA 2QURA 3VS7A 3PXRA 3QWKA 4TYEA 4GFGA 2OJIA 3DBEA 4N70A 4GJ2A 5BVWA 4X3FA 3M11A 4ALVA 2W1IA 5J7HA 2PE2A 4WNPA 2CGWA 3K2LA 4TNBA 4LRJA 2ZM1A 5CS6A 4MD8E 1YI4A 4TWCA 4YJOA 4GU9A 2PVMA 3NLBA 1NVSA 2YM8A 5TF9A 3EN7A 4IAYA 3JPVA 3BV2A 3MH0A 3A8WA 1EH4A 2CGVA 3QYZA 4D4VA 4YNOA 3UG1A 5EYMA 1NA7A 2C6TA 2ZAZA 3QD3A 3HRFA 3PIZA 4J71A 4R7BA 5JGDA 3R6XA 3I6UA 4U80A 5C8KA 3G9LX 3R9HA 4EBWA 1WZYA 4IC7A 2A1AB 3CQWA 4PL5A 3V8SA 5FTOA 4ZSLA 3HECA 2QODA 3MFUA 1CKIA 2QKWB 3R22A 2BR1A 3E8CA 4BTKA 1JKLA 5L3AA 1Z9XA 2GCDA 4HNIA 1CKJA 2YAKA 2ZV8A 1SMHA 3PJ1A 3RK7A 2C0IA 3B2WA 3RK5A 1UWHA 2GQRA 4DC2A 3DDQA 4DEDA 4QYGA 1BL6A 3OXZA 2G1TA 3R28A 3LQ5A 3IQ7A 3DBDA 3VBQA 3NAYA 2A0CX 3BYVA 5EI6A 3VS2A 4BCMA 4KSQA 1REKA 3LM5A 4ENYA 4E5BA 3OBJA 2ZOQA 3KXZA 3AC4A 4FUYA 3KF4A 5AIRA 3VRYA 4YBJA 3WZJA 5BVDA 4DH1A 2XNOA 4YJUA 3TXOA 4C57A 2YDJA 5JQ8A 2OFVA 4FV1A 1UU3A 3AGMA 3UNJA 4EOLA 3RPSA 4RIWA 4B9DA 2R3OA 3EYHA 4BDEA 2V55A 4FR4A 2V22A 3WF5A 4APPA 2YCRA 3KREA 3PP0A 4IW0A 3A7JA 1YOMA 4YLJA 3R71A 1QPCA 3HMOA 4JBVA 3TTIA 3WZEA 2PZPA 4M14A 3HA6A 2UW4A 3ITZA 3MSSA 4M69B 4R3PA 5AWMA 1U5QA 1FOTA 4I20A 5AV0A 3U4UA 1H1QA 3UODA 4AA5A 3ZDIA 4ZZOA 4AP7A 4QMNA 2DQ7X 4CKRA 2Z02A 2X6DA 5TKDA 3QCSA 5L8JA 3RWPA 2WMBA 5ANOA 5BMMA 4AW5A 2J7TA 4D4SA 3DK7A 3ALNA 4RZVA 4EC8A 3RPOA 5JKGA 4QMVA 5ICPA 4Y73A 3HV5A 4FUXA 5HNGA 3ACKA 4MF0A 2CKQA 5GJFA 3O17A 5IQDA 4F9BA 2GS6A 2JGZA 4JIAA 4O7WA 5H9BA 4BIEA 2W1GA 5AA9A 2C5NA 3HMNA 4K18A 5AR2A 2QO7A 4AGDA 3H9FA 4CKIA 2C4GA 2VTHA 3QKKA 3RALA 2RSVA 2VTRA 4BYJA 1OM1A 4DH3A 3VC4A 3GC8A 2CKEA 4AZSA 3NUPA 3B8RA 2W5HA 5ANJA 3ODYX 4RC2A 5G6VA 3I4BA 3EMGA 4H3QA 3QHWA 3PIXA 1H0VA 3ZEPA 4BZDA 3FYJX 3EWHA 3GNIB 2BTRA 5HICA 4I6FA 4XBUA 4S32A 5BYLA 3M2WA 2QHNA 3IS5A 4MWHA 3HDMA 3C4CA 1W98A 3LQ8A 2C3JA 2VTLA 3R9OA 3NYOA 4F09A 2GTMA 3JUHA 4P7EA 5D1JA 4CMUA 4NTSA 4PP7A 5LMBA 4USFA 1H26A 3NCZA 4QP2A 4DAWA 5AX9A 1LEWA 3D5UA 2RFEA 1YXSA 4CMTA 4EOQA 3TT0A 3G15A 4G17A 5HNBA 2Z2WA 5BPYA 3ALOA 3PXKA 2A2AA 2VNWA 3UIBA 4EI4A 3PPKA 1YXTA 2GFSA 1JNKA 4QQ5A 2R3LA 4EK6A 3PY0A 4M69A 1JKTA 4L3PA 3NWWA 3TNWA 3WYYA 1FVRA 5LVOA 3KXXA 5AR7A 2QCSA 3HV6A 3Q9XA 4D9TA 1W7HA 3MY0A 2GHMA 2CNUA 3DU8A 4EH4A 4MWIA 2FVDA 2UW3A 2ZDUA 5CAPA 4QP7A 3EQRA 3GC0A 4PDSA 4ZEGA 3H9OA 2ITZA 3QXPA 4IB0A 4XG9A 4Z9LA 4CG8A 5M56A 4W9XA 5I9XA 1J91A 5CSWA 4TYIA 3R0TA 4QQJA 3WIKA 3R8MA 4N6ZA 3SW4A 3ZYAA 5I3OA 5IA5A 2F7XE 2CNVA 1O6YA 3BYSA 3R7UA 2G9XA 4FKRA 4YZMA 3NUNA 3O23A 4AQCA 2QG5A 1CTPE 3C5IA 4DT8A 3LE6A 3LOKA 4FTLA 5DEYA 4FIFA 2JAMA 1YQJA 2PMNX 3JS2A 3SHEA 4A4OA 2XJ2A 2VTQA 4QYYA 3PVGA 3UBDA 2P55A 2R3RA 3FQHA 4NH1A 1NY3A 4I94A 5DWRA 5EW9A 4ANMA 2ZB1A 2BZKB 3H30A 3KK9A 5AR4A 5KMMA 1OBDA 5K3YA 2XKDA 1E9HA 4WG4A 3KQ7A 5GINE 1YHWA 2QOIA 4FT5A 4FVRA 3ZONA 2C6IA 2XM8A 3ORMA 2PY3A 4CT1A 2VRXA 1F3MC 3FKOA 4IAFA 4O1OA 3V5TA 4ANLA 5IEVA 1DI9A 2OWBA 3BIZA 5CZIA 3NW7A 4ANNA 3W1FA 2PUIA 3ORPA 1PMUA 2VU3A 4CTCA 4K1BA 4IMYA 4O22A 3T3UA 3V3VA 5EDQA 2JKOA 4IACA 3R8ZA 4HYIA 4G16A 1PXLA 4JDKA 2V7AA 3GUBA 5LWMA 3QL8A 4J8MA 2VO7A 2YCFA 4UMPA 4FKUA 2I1MA 4C4IA 3EJ1A 3MH3A 5HI2A 4U7ZA 1PXOA 3DNEA 4C7TA 4EH2A 2XB7A 4M84A 3LFFA 3DBCA 4ZSEA 5J95A 3N4TA 3MTFA 4R5SA 1RE8A 3H0ZA 1PXJA 3B8QA 2PVHA 2WTJA 3D4QA 4IZ7A 5LCKA 3VHKA 4O0TA 5AUXA 4EH9A 5M4CA 5EFQA 4P5ZA 1PXNA 2UZDA 3CY3A 4AA0A 4AZVA 4DH7A 4C38A 2Y6OA 3LHJA 4ZSJA 2P3GX 5DIAA 3UIMA 3TUCA 5DMZA 1IG1A 3EL8A 3CKWA 3A62A 2UW0A 4BZOA 2ZMCA 1YDRE 3AD4A 2R4BA 2VTIA 3DB6A 3Q6UA 4TN6A 4K0YA 4A9TA 4DLJA 3DCVA 4MYGA 1XH4A 4FTMA 2W9FB 3ERKA 4FT3A 4W4XA 2Q0BA 4DG3E 4QO9A 3TIYA 2PULA 5FLFA 4ZTHA 1V1KA 5IA2A 1LEZA 2NRYA 1U59A 4GG5A 2ZYBA 2VTAA 4FKVA 5DA3A 4FZAB 4HW7A 2B0QA 4O83A 3ZRMA 5AADA 2F57A 1Q41A 4NFNA 3FMJA 3HX4A 4HGLA 4TYJA 4XUFA 3QUEA 1ZY4A 4I1ZA 5EM5A 4Q9ZA 3R01A 3P78A 1BX6A 3MV5A 3RZBA 3FSFA 5AP5A 3TNHA 4AZTA 4BZNA 3WF6A 1RJBA 1YXVA 4QQTA 5CF5A 4PPAA 4C36A 3BEGA 4E1ZA 4FVQA 3FSKA 3Q4ZA 3QCXA 3DZOA 4EZ5A 4CFUA 3ZS5A 1WVYA 2IJMA 5IISA 4BBFA 3PA5A 3HMMA 2XUUA 4RWKA 4FSWA 2Y4IC 4JDHA 1ZLTA 4OW8A 4LOOA 4U42A 5FEQA 3M1SA 2BTSA 4YZDA 3GENA 1H01A 4MXCA 2XH5A 1W0XC 5A4CA 3ZLYA 3BV3A 3CLYA 4IDVA 3VHEA 4CXAA 5M08A 2ZJWA 1SVEA 4FEQA 2OF2A 3RGFA 3ZRKA 3LLTA 3MYGA 3TKHA 4MXXA 4EHGA 5EI2A 4G1WA 4YLKA 4TPTA 2UW5A 3D5XA 5HE3A 1XH5A 4D0WA 3RPVA 1KV1A 3QXOA 5H8GA 4RZWA 2C3LA 3ZC6A 3ZLSA 2WMAA 4G31A 3EFKA 5BNJA 3G9NA 4O38A 4BC6A 4F9YA 4UMRA 2P0CA 3VUHA 4EC9A 2PMOX 4JRNA 4LFIA 4GK4A 5E8WA 2J90A 5TT7A 5IQHA 5JZJA 3QTRA 4BIBA 5K4JA 2JKKA 3PSDA 3GFWA 3QD4A 4K11A 3QUDA 4RJ5A 5CY3A 4Y72A 5M51A 4A07A 3KL8A 4BCJA 2UW6A 3O50A 4OUCA 4DEGA 4GRBA 3TTJA 2YABA 4WG3A 2XK9A 4TTHB 2W1DA 4BGGA 2PUPA 4FC0A 4GSBA 4APCA 4YTIA 4WRGA 3SV0A 4I5MA 1V0OA 4IZYA 3VJOA 2ZVAA 1AD5A 4XG6A 4IVCA 4DBNA 3F2RA 4MTAA 2YACA 3SXFA 3ANRA 3LCDA 3Q9WA 2XIYA 2XNGA 4NWMA 4BCPA 4GEOA 1UU9A 4RIOA 3MPAA 3PY1A 3UP7A 4BCHA 5C03A 3R7GA 2VUWA 3E93A 3F2NA 5ACKA 4KINA 3PJ3A 3VS3A 4UB7A 5AFVA 3QTSA 2QNJA 3S00A 4ZJIA 2WAJA 5CU4A 5D9HA 2JEDA 4UZDA 4ERWA 3RNYA 3MFTA 4RIYB 3UC4A 3ZLWA 4ZMEA 3OEZA 2OU7A 3ORXA 2GHGA 1FGKA 1XBAA 2GSFA 5AUYA 1LUFA 5AAEA 5FTQA 3L8VA 1OL1A 4G3DA 2HZNA 5AV4A 4JG6A 3NIEA 3TKIA 4FICA 4WO5A 4E73A 5ETCA 3AT4A 3UO4A 2VTNA 4BIDA 4GIIA 2HK5A 4QP1A 5IMXA 3V6SA 2FA2A 4MBIA 3GOKA 4X6RA 2XK7A 3IONA 4FI1A 3C7QA 3LMHA 1WBSA 3NR9A 3ANQA 1TKIA 2HZ4A 3AT3A 5ANGA 4AXAA 4EQCA 4YJVA 3QUPA 4RJ7A 2PZRA 4JLCA 4ENXA 3UPZA 5JZNA 2CGUA 3REPA 2XF0A 2B9FA 4IJ9A 3CTQA 5IA0A 4J98A 4QMLA 2QOLA 5FQDC 4HGEA 2O3PA 3R83A 3LKMA 2NO3A 4WUNA 5CEPA 1MP8A 2XBJA 5E91A 2OFUA 3QD2B 3T9TA 3GBZA 5FM3A 4AZFA 1YKRA 3FLWA 4I6QA 4UEUA 4FV0A 4RIXB 5B2MA 2BROA 1PW2A 4TYHB 3D83A 2ERZE 4C3PA 2XRUA 3QWJA 1ZMWA 1XHAA 4R77A 3QGWA 4FNYA 3QA0A 3CQEA 4EQUA 5DYJA 2X7OA 2YCSA 3C13A 3UG2A 3FZOA 2NP8A 1IASA 4JDIA 4FODA 2AC5A 2CKPA 4FGRA 4I93A 1PYXA 3QZIA 3ZRLA 3AC3A 4FGBA 3ZUTA 4CQEA 3E87A 1URCA 3DLSA 4IWQA 1J7IA 3TWJA 4DHFA 4O7TA 2BDFA 3TUDA 3GCQA 4AT4A 2C3IB 2E2BA 4L52A 4NM5A 2QOCA 2R9SA 3ZO3A 3FJQE 2JC6A 3OOMA 3IKAA 1PRYA 4I4EA 4ZOGA 4XV2A 3OMVA 1Q8WA 4I0TA 2Y4PA 2CN5A 4KBKA 2OO8X 2QLUA 3D9VA 2C6LA 2RFDA 3KXHA 4IDTA 3PIYA 2WD1A 5CQUA 4ACMA 3FL4A 3ETAA 5IMEA 3KC3A 3C0IA 3VUDA 4D58A 3Q52A 4BDIA 4FSQA 4JT3A 2YM7A 2X81A 4BTJA 2R3FA 3HP5A 4HGSA 4BICA 4D2TA 2ZV2A 3KFAA 3PJ2A 4PF4A 2C47A 2GNHA 4GK2A 3DAKA 3S4QA 5LCJA 3IW7A 1UWJA 3F3TA 3IECA 5A3XA 3RM6A 2AC3A 3RPRA 4DH8A 3Q5ZA 4D0XA 2GNLA 5HG5A 3SXSA 4EONA 3QTQA 3DK3A 4LV8A 5IH6A 3DXPA 1KE8A 4BN1A 4ZTRA 2QOFA 2WQMA 4C33A 1MQBA 3DJ7A 4L3JA 3GC9A 3G51A 5LQFA 1PKDA 1M52A 2JDRA 3ZO1A 4QMUA 5G1XA 2R3NA 4RIXA 3GCUA 2R3GA 4FTRA 4L7SA 2WTKB 2BVAA 3QZFA 2H96A 4IADA 3P0MA 4RSSA 1ZMVA 4X3JA 2OJGA 4Z3VA 3VUTA 3QQKA 5A6NA 3N4VA 5FTGA 4FTIA 3KXNA 5IEXA 4V0GA 2CSNA 2YZAA 4TWNA 4X6QC 4RBLA 3ZOSA 4OAVB 4OGRA 4D2SA 3VRZA 3VBWA 4XV9A 4UX9A 3MFSA 2XK3A 3FZ1A 4P90A 4TNDA 4ANBA 3RJCA 5CXZA 2RF9A 3OT3A 4FG9A 4UMUA 4L43A 2FB8A 4E6DA 3V8TA 3U51A 2VO6A 5J8IA 5DN3A 2ONLC 4AGCA 4L44A 3PFQA 1DS5A 2XIRA 2LGCA 3WARA 5E8TA 3UOJA 4YNEA 3EYGA 5AUVA 2H8HA 3EIDA 4FKTA 4E4XA 4CNHA 3DXNA 3EZRA 3L8SA 4W4WA 5CU6A 4F9AA 3R1YA 5C26A 5HKMA 3QRTA 2UW9A 5EQPA 4RX8A 3BEAA 5C27A 1NVRA 2OIQA 4CFXA 4O0VA 4NUSA 4RVMA 4OR5A 4QRCA 5CWZA 4KS7A 2C0OA 2W4OA 2FGIA 4AT5A 3ULZA 2OKRA 4K9YA 1R1WA 4B8MA 4DEAA 4AZWA 4ZP5A 4YO4A 1JSTA 5JRQA 5D11A 2FUMA 2OXDA 4I5CA 3TV7A 5KHWA 3LQ3A 5A46A 3KRRA 2CNQA 1G5SA 3A7HA 4FF8A 4KWPA 2X4ZA 3QZGA 4A9YA 3R7OA 5HX6A 5EYCA 3RTPA 3E8NA 3UVQA 2JKQA 4O0SA 1R3CA 3RINA 4IEBA 4CVAA 4WBBB 1Q3WA 3GVUA 4CTBA 5E8YA 2YJSA 4GL9A 4ACGA 2JDVA 3C4ZA 3E63A 2X6EA 4HOKA 4GVJA 4IWOA 5A4EA 4JQ8A 1QL6A 4OTPA 4L01A 2YIWA 3DK6A 5HO7A 4OT5A 3BGZA 5M4UA 4YJQA 3AMAA 4BF2A 4HPTE 1JVPP 3F9NA 5IDPA 3EN6A 3F5UA 4HVHA 5J87A 2BILB 3C4FA 1CSNA 4ZS0A 3IW6A 3U9NA 4X2FA 3V8WA 3FI3A 4BCNA 3DY7A 4BTMA 1E1VA 3SOCA 5FBNC 4ZS4A 5HO8A 3P79A 2J5FA 3A4OX 5CTPA 2ETKA 4PP9A 5K0KA 4EOPA 3FL5A 3LZBA 3QTUA 4JOAA 4KD1A 5CEQA 3DKOA 4O2PA 3FAAA 3BZ3A 1J3HA 4IFCA 4MF1A 2IVUA 4W8DA 3V5LA 2Y7JA 4M0YA 1GIHA 4G3FA 4F08A 4JG7A 3V5WA 1PMEA 3GCSA 5HVJA 2QQ7A 3WZUA 4BDGA 3SA0A 3OUNB 3A99A 1UU8A 2UZVA 3MN3A 3NUUA 3Q2MA 4BDAA 4XG4A 4C2WA 4UYNA 3ZEWA 4XCUA 2W05A 4M7IA 2QKRA 2QHMA 2UZEA 1Q8ZA 2QU6A 2BKKA 4I21A 4I23A 4LMUA 5LOHA 4WT6A 4DCEA 2SRCA 1URWA 4QP6A 5ITAA 2WIPA 1ATPE 3Q6WA 3DB8A 5FXSA 3PLAE 1H1WA 1P14A 4JRVA 2WHBA 4H1JA 5CSVA 4FV7A 3CY2A 3PXQA 4S34A 5HCYA 5AJQA 3UVPA 5DPVA 3VAPA 3VS4A 5HGIA 4QNAA 1MRVA 3U6IA 4QMOA 2HWOA 4EUUA 1PKGA 2X39A 2IG7A 4AAAA 1O9UA 2ITUA 4EK5A 4O7NA 3F82A 4KAOA 1AQ1A 2WMUA 4QD6A 2X7GA 5AR5A 4R78A 4NEUA 4NM3A 5E8UA 4FIJA 2PVJA 2UVYA 1VYZA 2E9UA 3FI8A 3EKKA 3OOGA 3R1SA 4EWHA 5IU2A 3V04A 5JEBA 3F5GA 2CLXA 2HY0A 3PE1A 3W18A 1PXPA 2GPHA 4FKSA 5GZ8A 2WQEA 1Y57A 1IEPA 4XNEA 2ACXA 1XR1A 2PZYA 4FL3A 5AUWA 3CBLA 2VZ6A 5HTCA 5LVNA 3PSBA 4V01A 3JVSA 3AGLA 1RDQE 2Z7LA 4C58A 4F70A 3LXNA 3NCGA 3P7BA 3BLRA 1BMKA 3OHTA 5HBEA 1M7QA 1B38A 1QCFA 2KULA 4GCJA 4XX9A 4CRLA 2WMWA 5KCVA 3OG7A 1YHVA 3FY0A 4R1YA 5LXMA 2PK9A 1HCKA 3R21A 4FTAA 1P4OA 4FSYA 3VN9A 4E6CA 3OD6X 2HCKA 1YOJA 3P23A 4DG2E 1IA8A 3ZBXA 3GI3A 1LR4A 2VV9A 1UKIA 2YM5A 3NNXA 4ASXA 2E9OA 5CU3A 4NK9A 4C59A 4AACA 5CEKA 3BKBA 5IUHA 2J0MB 5M4FA 4F9CA 3F3WA 3OXIA 4FSMA 4CCBA 3CGOA 2E9NA 2DWBA 3KK8A 4I41A 3UGCA 4EEVA 3CR0A 3Q04A 3M42A 3UP2A 3SRVB 4QTAA 4OTHA 4KIKA 4RX9A 2VGOA 3DKFA 3EQPA 4XG2A 3HRBA 1CMKE 4Y95A 5IQGA 3E88A 2O63A 1TQIA 2PVFA 4MXOA 5BYYA 4DE4A 5FM2A 2W1FA 3RK9A 4W9WA 2CHLA 2R3MA 4BDDA 2RGPA 3FZTA 5CX9A 5FGKA 3CS9A 2IZSA 4CRSA 3Q3BA 3EKNA 2J0IA 1U5RA 4C4GA 2XJ0A 4CFMA 3EN5A 4PL3A 3ZZEA 2Y9QA 3BLHA 4KIQA 5FDXA 3ZFMA 1TQMA 4ZY5A 5KKRC 3ODZX 3WE8A 1WBTA 1FQ1B 4CFNA 2OSCA 1OMWA 3FMLA 2P2IA 4LMNA 4RFZA 4IX5A 3TJCA 4XG3A 3VQHA 3ZC5A 5GZ9A 3LCKA 3U6JA 3BE9A 4GW8A 1IAHA 2YDKA 4NM0A 3PZEA 5AM6A 4FMQA 3ET7A 4AW1A 3FHRA 2OJJA 5F4NA 2BRGA 4EWQA 4MXAA 5CU2A 4FTQA 2B7AA 3R00A 3ZM4A 5CEOA 3KULB 4EORA 5HORA 2WOTA 3MDYA 2XNBA 5IF1A 2C68A 3FDNA 4BYIA 1FMKA 3ZSIA 4YHFA 4R3CA 4XP3A 3UQGA 4IX6A 1ZYJA 3E8DA 2B1PA 2PVYA 4J7BA 2HELA 2OZAB 4FKQA 3QYWA 4FEUA 2EVAA 2NNWB 5AR8A 3PZHA 3F69A 3UIXA 4M13A 5CAQA 4CGAA 1M14A 2FSOX 4R8QA 5DH3A 3Q96A 1H8FA 4U5JA 5LMKC 2UZBA 3IDBA 4XOYA 3WYXA 4DGGA 4DINA 4ID7A 2VTMA 4L67A 1YXXA 3DJ5A 4X21A 3JYAA 2WXVA 5DFPA 2IVSA 3DBQA 3KVWA 2WTVA 4CYIA 4YU2A 3KMUA 3SX9A 5M53A 4DGMA 3COMA 3O71A 4MX9A 5C1QB 2UZWE 4AW2A 4YR8A 2QOHA 4JL9A 5HE1A 5EDRA 3ZSHA 3O0GA 2XKEA 3E3PA 5E1EA 4C4HA 3FBVA 4RJ3A 4FG7A 3ORIA 4JVGA 1Y8GA 4XG7A 3SDJA 2XIZA 3FMEA 3PYYA 2WMSA 5AM7A 5T68A 2XEYA 3D7ZA 5C9CA 3BCEA 4HGTA 5IEYA 3SRVA 3V5PA 4KA3A 1HCLA 1JSUA 1U54B 3RI1A 5JK3A 2OIDA 2IPXA 3NUAA 2Q83A 1KSWA 1XQZA 4FG8A 1Z57A 3QC4A 3E7OA 1DAYA 3D0EA 1M2RA 4R7IA 4GUEA 3IW5A 3LCSA 5F9EA 5AP4A 5HIBA 3I0QA 4EYJA 4W8EA 2VTSA 5EYDA 3KA0A 3NUYA 3KCFA 5HNIX 3CJFA 5LVPA 4QQCA 3O96A 2PZIA 2R0IA 4PV0A 4O84A 3EB0A 4YC8A 3EN4A 3SKCA 3FMKA 3UE4A 4CFWA 3SVVA 3P7AA 4QP9A 2C69A 4YBKA 2PU8A 4O82A 3BQRA 1R0EA 4IIRA 4FSUA 2JLDA 2C30A 3H9RA 2YFXA 4KKGA 5IKWA 4QTEA 4IBMA 3HA8A 4D28A 2R3PA 5BYZA 3VBTA 2BKZA 2JFLA 3SC1A 4IAKA 5IZFA 3RVGA 5DI1A 5BQ0A 4RFYA 3RZFA 1YW2A 3QZHA 5FWKK 2G01A 4HCUA 3V01A 3NW6A 1RQQA 3ROCA 4ACCA 3RWQA 4ASZA 3K5VA 1OL5A 2OZAA 4JNWA 4K2RA 1VZOA 3BU5A 3KMWA 4JBQA 4ZSGA 1FBNA 1S9JA 4FZDB 4PUZA 3LXKA 4A9RA 4DFNA 1ZARA 2XA4A 3UNKA 3VBVA 5AP2A 3DTWA 1FPUA 3Q53A 3ATSA 1BI8A 2XIKA 4J1RA 2F2UA 3MVHA 5CVGA 4O91A 3RAIA 3G33A 3MIYA 1GAGA 4QPSA 5E1SA 4KIOA 3S3IA 4AT3A 2OBJA 4NYEA 2DUVA 3TUBA 5CT7A 4FOCA 5GIPE 4ACHA 4X3FC 3U87A 5J5TA 3HL7A 4NCTA 1MRUA 4ZMFA 3KXMA 4IM0A 3QTIA 4ALUA 3LVPA 1YRPA 3ORZA 1E1XA 3R8PA 3ZZWA 3DDPA 5C8MA 3RCJA 3ORTA 3BHYA 4EOOA 4GFOA 3AD6A 5L8LA 4E8AA 3MIAA 4K33A 5AX3A 3T3VA 2IN6A 1FGIA 3GFEA 3F7WA 2V0DA 3PY3A 1YDTE 3MS9A 1OGUA 3W16A 4LRKA 4WG5A 2QR8A 4FKGA 5FP5A 4C35A 4FEXA 2OH0E 2XNMA 2YEXA 4GV1A 5A54A 3S0OA 4BY9E 3IW8A 3GOPA 3H3CA 4JJRA 5DT0A 5EOLA 4EKLA 3C5UA 4CZYB 4KIPA 4RGJA 3POZA 4DEIA 1QPDA 2BRBA 3AOXA 3I5ZA 1MUOA 4D5HA 2BAKA 3FI2A 5M55A 3R7EA 4O0YA 4Y83A 1H25A 1ZXEA 3G5DA 4UBAA 4AE9A 4AOIA 4EH7A 4FKWA 5K4IA 4XMOA 3FPQA 2WMQA 3FE3A 4ZLOA 4OAUC 2JFMA 4Y5QA 2P2HA 3HLLA 5HEZA 3MA6A 1OPJA 1ZWSA 3O7LD 3CP9A 4OBOA 4PRJA 4YPSA 5HIEA 5HG7A 4H36A 1J7UA 2EWAA 4RQKA 2V7OA 1OKYA 4FYOA 5E90A 5H8BA 3VBYA 3VO3A 3ZXZA 4EH8A 4EL9A 5M57A 4XLVA 4Y5HA 2R64A 3C0GA 3HRCA 3KB7A 3DGKA 3P1AA 3ELJA 1VJYA 3P4KA 5M09A 3HAVA 5AV2A 5HU3A 2YISA 2XYUA 2ZM4A 4PPBA 3FQEA 4PX6A 3DQWA 5L2IA 3COIA 2X9FA 5BVOA 4WNMA 3VS1A 2W1ZA 3TV6A 2DYLA 4HJOA 3QCQA 3FV8A 3K3JA 4H3BA 3TL8A 1KE6A 2LAVA 5L6OA 4E4NA 4A9UA 2NPQA 2VX1A 1AGWA 2YDIA 4K8AA 4QP4A 4C0TA 4TWPA 4XRJA 3WE4A 3E5AA 4G5JA 4EZ7A 5J9ZA 1GIIA 2CKOA 3ZXTA 3T9IA 4FOBA 2J51A 1H24A 3EQDA 2XNNA 4M15A 4M66A 1P4FA 4YO6A 5LJJA 1PY5A 5KMOA 1WFCA 3AD5A 2QONA 4Z55A 3CTHA 3K5UA 3PPJA 2GNIA 4HZRA 3TIZA 2UZOA 5EQYA 3AG9A 4O0RA 2WMXA 2J2IB 1GZKA 3C4EA 5L4QA 5GJDA 3I0OA 3UMWA 4QMXA 1JKKA 3VNTA 3OCBA 2EXMA 3PXYA 4LQMA 2VX0A 4LGGA 2PE0A 3TZ8A 4GT5A 5DG5A 5HU9A 4FZFB 2BDJA 4MAOA 3W2OA 3F66A 4C02A 4FK3A 3GCPA 2OXYA 4K6ZA 4AFEA 4D2WA 4DA5A 3JXWA 3F3VA 3R04A 3FZSA 3BPRA 1W8CA 3G6GA 2CGXA 3LFAA 5AUTA 4AFJA 4CQGA 2C5OA 4XOZA 5TE0A 3O2MA 3BBTB 3FKNA 2C3KA 4QYEA 5AP3A 4IWDA 2WQOA 5FXRA 4IB3A 1J7LA 2BRMA 3PXZA 4EOIA 1WAKA 3MVLA 4AF3A 2J5EA 3BE2A 3H4JA 1OBGA 2FSLX 5EI8A 4FK6A 4UMQA 4BCGA 4I4FA 3HUCA 2JAVA 3LFBA 4U3YA 2F4JA 3OVVA 1WBWA 4XEYA 3BHUA 4GVAA 2VWVA 1L8TA 4ASEA 3BGPA 3MB6A 5AMNA 5B2KA 1KE5A 2GMXA 5CF8A 2WU6A 3COKA 4FV9A 5LARA 3ZO2A 3QU0A 2JITA 3OS3A 3QX2A 3NNWA 4LM5A 4Z7GA 2B55A 4YZCA 1JOWB 3TG1A 5E7RA 4BHZA 5IUIA 4RX7A 3HMIA 2PMLX 3PWDA 4JX7A 1T46A 2YWVA 3EQGA 5L2SA 3CGFA 2J0KA 3A4PA 1KOAA 3RAHA 3U55A 4DFLA 1R78A 4WKQA 3FXXA 3LJ1A 4CYJA 2GFCA 4Y85A 2PVLA 3FLQA 4FEVA 4FSZA 2J9MA 4UALA 4FIIA 2H9VA 5IA4A 2DS1A 2JKMA 4BB4A 4AUAA 4ZTNA 4YUQA 3QFVA 5A6OA 4HVSA 1DAWA 5JGAA 2G2IA 2UV2A 1UVRA 3WBLA 4L68A 3DBFA 3FHIA 1M17A 3QRJA 4G5PA 3KU2A 4NCTC 3OWKA 4IAIA 3FKLA 3D5WA 4UV0A 5IQBA 4GYGA 1K3AA 3G90X 4F7LA 5DNRA 1ZRZA 3GU8A 1SVGA 4QYHA 3WF8A 2I0YA 4D1ZA 3GT8A 4BGQA 4CEGA 4R5YA 2BUJA 4D1XA 3AC2A 4ORKA 5IQEA 3C1XA 2OF4A 3R8UA 1SM2A 2RG6A 3MVJA 4PMTA 5F1ZA 4N6YA 5I9UA 1OL7A 4DFYA 1PJKA 5CASA 3CTJA 4WNOA 1JPAA 1JBPE 1I44A 1M2PA 2YIRA 4HYHA 3GGFA 4QNYA 4MK0A 5EOBA 3OCGA 4XBRA 4F6SA 1OITA 2W0JA 3FMMA 2G2FA 3BHVA 4J53A 2C1BA 4FSTA 3NVKI 5CI7A 5HOAA 1XBBA 1UNLA 3AXWA 5EM8A 3QALE 3S2PA 5CAVA 2ZMDA 4IAZA 3W8QA 4O1PA 1V0PA 4PTGA 3VF9A 1KWPA 3WF7A 1YWRA 2X8IA 3RP9A 4X2KA 4FE2A 5ETIA 4CLJA 4TZRA 4PWNA 4FKJA 5GHVA 3KXGA 4CFFA 4EH6A 2B54A 1ZYLA 4RJ8A 3E62A 4ZAUA 5HLNA 4BKZA 4U44A 2IWIA 5K0XA 3NX8A 3VBXA 1H1SA 4A4LA 3N51A 4Y8DA 3WILA 4CV8A 2RFSA 4ZSAA 3CJGA 1MQ4A 3ZTXA 4IJPA 3FUPA 3VUGA 2C6EA 3HEGA 3IW4A 1ZYCA 3ZO4A 4BFMA 5FDPA 1Q8YA 3LXPA 3BHTA 1TVOA 2HZ0A 1ZAOA 3QGYA 4ZXTA 4BRXA 5B2LA 3OW3A 3IOPA 1OZ1A 4C4JA 4E26A 2WIHA 5E8ZA 5LMAA 4EJNA 4M97A 4M8TA 3NSZA 5CANA 2BIKB 1GJOA 2VD5A 4I6HA 4RIYA 4AG8A 3E7VA 3PE2A 4TL0A 2W4KA 4HYSA 4JR3A 1K2PA 2OGVA 3R7YA 3NNUA 3R73A 4F65A 1ZZLA 5KKRB 3Q9ZA 4IXPA 4DN5A 4WHZA 3SLSA 1Y8YA 1L3RE 4UXQA 3TI1A 3PRFA 4BWPA 1CDKA 4C2VA 5F94A 1YWVA 4YJSA 4FV4A 5CAUA 2C5XA 2W5BA 3MJ2A 4G3EA 4G3GA 4K77A 3S1HA 5D12A 5H8EA 1WBOA 4UYAA 3VW8A 1ZZ2A 4EHEA 4NIFB 3R1QA 3TNIA 2O0UA 4D2RA 1XH6A 4E5WA 5JSMA 2QOQA 2OZOA 1XH9A 4PQNA 5DE2A 2REIA 2XRWA 3HDNA 4X2JA 1JWHA 4FA2A 4GG7A 4PTEA 3A7FA 5HCXA 4RLLA 4I0SA 5E4HA 3C50A 4OLIA 1XO2B 3I1AA 3V51A 2A27A 3PPZA 3W33A 1NT2A 4PNKA 4U40A 2OG8A 4FIHA 4RWLA 5GJGA 5ACBC 4CLIA 3H0YA 5CU0A 1CM8A 5AV1A 2XNEA 2W1HA 4AW0A 5I0BA 3SG8A 3FEGA 3OFMA 4X2NA 1YDSE 3BWFA 5LVLA 3ORLA 4R6VA 5HX8A 4ITHA 3A7GA 1JSVA 3R02A 4F1MA 4QMQA 2YJRA 3IDCA 2J0LA 3EQCA 3LPBA 2OJ9A 1ZOEA 4TYHA 3O7LB 4BBMA 5CAOA 2RFNA 3CPBA 3F2AA 3UO6A 2ITNA 1Q4LA 2XBAA 3BBWA 3DZQA 5E9EA 1S9IA 3BYMA 4IZ5A 3SAYA 1P5EA 2B52A 1OUYA 4S2ZA 4FV6A 1ZMUA 1ERKA 4TXCA 3ZUVA 2UZLA 3F5PA 4LOPA 3Q32A 3FY2A 3GQIA 4ZLYA 2UW7A 3I7BA 4L46A 2VWBA 3KRJA 3O8UA 4FV3A 5DHJA 4YZ9A 4JG8A 4ITJA 3R63A 3W2RA 2PUNA 2F49A 2OW3A 3LIJA 2CPKE 3BI6A 3P86A 4HZSA 5EM7A 5M06A 4ARKA 3C4WA 4WIHA 4Q5HA 5I9VA 4IVAA 4JS8A 4O21A 2W7XA 3W2CA 4CFVA 2YAAA 4GKHA 2WTWA 1PXMA 5AP0A 3TZMA 5BVNA 4E6QA 5AP6A 4IAAA 5E92A 5HTIA 4GKIA 4DYMA 3BYUA 4YC6A 4CKJA 4YJPA 2CCHA 5CZHA 1FVTA 1GNGA 2ZV7A 1UU7A 1YOLA 3D7TB 4GYIA 4BI1A 4PMSA 1G8SA 1IRKA 5CALA 3QTWA 4XV1A 2UW8A 3NYNA 4E7WA 5C8NA 3DKGA 4UN0C 2X4FA 3ZFXA 3CC6A 2UZNA 2OXXA 3R7IA 3NNVA 4CD0A 2HXLA 4LL0A 3VS5A 4FZ7A 5GZAA 1H27A 4G9RA 3ZHPC 2OI4X 3OC1A 3OWJA 3QD0A 2ITYA 2XCKA 4ZK5A 4HVDA 4EH5A 5K5NA 4E4MA 4H1MA 3ACJA 3QRKA 4IB5A 5KE0A 5KMNA 3TDVA 4O7SA 4PDYA 3DOGA 3HYHA 3V5JA 4B8LA 3A61A 3BX5A 4IFGA 1UA2A 5KBQA 4O81A 4U43A 5I3RA 4EUTA 3L1SA 2V62A 4YHTA 1ND4A 4QP8A 4EBVA 4ZZMA 3SQQA 4DFUA 4U8ZA 5JMSA 1JQHA 2BHEA 5JGBA 1I09A 4OT6A 5C01A 1VYWA 3BRBA 3KMMA 2YERA 3QLGA 4FKPA 3OBGA 3OTVA 4LYNA 3CIKA 4QP3A 2X2MA 4CCUA 3JR1A 3WIGA 3FI4A 1PYEA 1JLUE 3IGOA 3FXWA 4U79A 1U4DA 2I0HA 3NZ0A 4NT4A 4MXYA 2ETMA 2ESMA 4QMTA 5EG3A 4RVTA 2AUHA 1WMKA 3PLSA 5AP7A 4EJ7A 1B6CB 4F0IA 2Z7SA 4BI0A 4KRCA 4U41A 2R3IA 5I9WA 3R1NA 2P4IA 4E5AX 3HVCA 3RAKA 4OTGA 4F9WA 5A14A 3P08A 3FLNC 4MBLA 2ITOA 5K5XA 2ZB0A 2JIVA 2X1NA 3RAWA 4C3RA 2GHLA 4ZTMA 2W1CA 3QKMA 2CDZA 4EH3A 1F0QA 5T6KA 3OP5A 3EQFA 5D7VA 3DTCA 2GNFA 3BLQA 1ZOGA 4N57A 3QQGA 2PMIA 3D2KA 2YIYA 3BYOA 2ZV9A 3NIZA 3CCNA 4WA9A 2ETRA 3P5KA 4EK4A 3D7TA 2C6OA 4RRVA 1OPLA 3OY1A 5AAFA 1JKSA 5HD4A 2CJMA 2VWWA 4HVGA 3TEIA 3ID6C 4O7LA 3QLFA
chains in the Genus database with same CATH superfamily
3OTUA 4RC4A 1QPJA 2QI8A 2Y8OA 3PRIA 3QTXA 4LRMA 4EK8A 3ORNA 4CZUA 1DM2A 4YJTA 1WCCA 2J4ZA 4XJ0A 4ANQA 4G6LA 3WZKA 2XK8A 2O65A 3W0PA 4MQ1A 3U8WA 4F63A 5HE2A 5KMIA 2XNPA 4PY1A 2OIBA 1W82A 5HG9A 3Q4TA 4QOXA 4O4FA 5DEWA 3MB7A 4WSQA 1SNUA 5TR6A 3UZRA 1KV2A 4BDBA 5HESA 3ZSGA 5JFVA 1QPEA 4EYMA 4RVLA 3LFCA 4C62A 3NVMB 3DAEA 3ENMA 4PDOA 4QTCA 3PVBA 1MRYA 4EOSA 3EOCA 4DBXA 2GTNA 3D5VA 4FKIA 2QOKA 2BIYA 2IZRA 3KRXA 4YC3A 2WO6A 2XAOA 5KX8A 2YM6A 2WU7A 3QRUA 2I6LA 3SGCA 3GC7A 4PTCA 4UWCA 1H0WA 5I5ZA 5HVYA 3TV4A 3EFWA 3ZMMA 2X9EA 2KTYA 4IVBA 1XH7A 3GU7A 4MVFA 5HG8A 3TCPA 2CMWA 3HNGA 4XS2A 3UYSA 3VS0A 4JQEA 3OWLA 2W9ZB 4J52A 3NS9A 4WD5A 4YZNA 4MD7E 2PE1A 3W2PA 4EHVA 4FVPA 4HNFA 4PNIA 4F99A 1O6LA 2Y4IB 4DDIA 3JY0A 4NZWB 4YTHA 3Q4CA 4U0IA 2GNGA 4RA5A 4AN3A 2O64A 4PMPA 3PTGA 4L53A 4AN9A 4AGUA 5AEPA 5IPJA 3POOA 3DS6A 3IGGA 2WEIA 3D15A 2X0GA 3IG7A 3KN6A 4QMZA 5E8SA 5HE0A 4BCOA 2X8EA 3G0EA 4IH8A 3UIUA 4CV9A 5KZIA 2VN9A 4DT9A 1Q8UA 2YIXA 4WNKA 2HW7A 3RHXA 5ANEA 5ETFA 3IK3A 1OPKA 3RM7A 3C0HA 5CXHA 2W4JA 4XHKB 1SNXA 5AP1A 4V05A 4FIGA 4WUAA 3EH9A 3JY9A 3GU6A 3NEWA 4BR3A 5HZNA 2ITQA 5CNNA 4DCAA 3C51A 4NJ3A 2IO6A 4FSNA 2W5AA 5DOSA 5JQ5A 2I0EA 3GU4A 4I6BA 4L3LA 2BDWA 3UC3A 2R7BA 4BCKA 1K9AA 3AC5A 2R3QA 3KKVA 4YSMA 3TJDA 5HHWA 2YZLA 3MTLA 2BAJA 2W17A 4GT3A 3N4UA 2R0UA 3PUPA 4OBPA 3UOHA 1UKHA 4XP0A 2YLEA 4E20A 2HZIA 2J50A 3D2IA 3DQXA 3FYKX 5K9IA 3GQLA 5DR6A 2C0TA 2PSQA 4LGDA 3ULIA 2EUFB 1R0PA 4U81A 4JQ7A 3VW6A 4NU1A 1F5QA 4FT0A 4O2ZA 4RT7A 4TKSA 4EOKA 2QU5A 4DEHA 4J95A 3I6WA 2Y6MA 4KABA 3OW4A 4FKOA 4ITIA 2HIWA 4YTFA 2BPMA 4GMYA 3S95A 5J7BA 4U3ZA 4XLIA 4H58A 4JBPA 5A4LA 3O8TA 4ZY6A 3KCKA 4GU6A 4IE9A 3VUIA 3CE3A 4LUEA 1PXIA 2RG5A 4UWYA 2I40A 3PVUA 4E4LA 1XWSA 3FLZA 2E9VA 2W96B 2HYYA 4O27B 3NRMA 3LW0A 3QQUA 3SXRA 4DITA 2GQSA 4AXFA 5KHXA 5BVFA 1R39A 2WTKC 3VULA 4AOTA 4FTNA 2Z7QA 4QMSA 4YJRA 1PMNA 2H6DA 2W99B 2ITVA 3ZU7A 4MH7A 2IW8A 4JAIA 5B0XA 5J9LA 3E3BX 4PMMA 5KMKA 2QD9A 3HZTA 5EHOA 5DRBA 4LI5A 4J96A 4R1VA 4BWXA 5AV3A 3RCDA 4C37A 1GZNA 2YN8A 4AGWA 3MY1A 5AUUA 4QMWA 3PSCA 3DXQA 2QLQA 1NVQA 1GZ8A 1GIJA 1XKKA 2CN8A 2IW9A 4QDEA 2JDOA 4ANOA 5EKNA 3CEKA 5CSXA 3LFEA 3A8XA 3BQCA 2WQNA 3KULA 3IPHA 3L9LA 2X2LA 4A7CA 2GS7A 1BL7A 3OXTA 1WBVA 2G15A 4KKEA 4DTKA 4FT9A 3I5NA 4FX3A 2Z7RA 4NKSA 5ANDA 3Q5IA 2XK4A 3W8LA 5D10A 2XP2A 3QQJA 4BCIA 4HVIA 4QEBA 4R3RA 1H1RA 4YLLA 4AOJA 5AIKA 1OIYA 2PZ5A 1M2QA 2R5TA 4C4EA 4KBAA 2UVZA 1OL2A 4FSRA 2OJFE 2WTIA 3CSVA 2YCQA 2RL5A 3UMXA 3GEQA 1ZOHA 5FG8A 3MWUA 1A48A 5TO8A 3O8PA 4U6RA 3CXWA 3R8LA 1YXUA 5GIOE 5HLPA 3JVRA 5IQIA 3W2QA 3MPTA 2WTDA 3EFLA 4D9UA 1IAJA 3U4WA 4UWBA 4D2VA 3FMHA 4QTBA 5L6WL 2IZTA 2QOOA 3A2CA 3WOWA 4KUJA 1STCE 4QPMA 4RX5A 2YM4A 5EHLA 2VO3A 1QMZA 1U54A 3Q9YA 3TACA 3KN5A 5IQAA 5KO1A 5CVHA 1BYGA 4L42A 4PPCA 3F3ZA 3MY5A 4R7HA 3TZ7A 2Y0AA 2B9HA 1H00A 1H1PA 3OEFX 4FV2A 4TRLA 5EW8A 4BI2A 4EZ3A 3UO5A 1NW1A 4A4XA 2VWZA 4LOQA 4YJNA 4NL0A 5KUPA 4M3QA 1SZMA 2IZUA 3UQCA 4F7NA 2JDTA 2VAGA 4AE6A 5CEIA 1WVWA 4FTTA 3I79A 4BGHA 4O7ZA 4L00A 5C4KA 3LCTA 4FKLA 2VX3A 4UXLA 3EFJA 3NUXA 2VTPA 1UV5A 4YURA 5DVRA 5EDPA 1IR3A 4C61A 5I9YA 3UDTA 4F1OA 3UQFA 4L9IA 4FTCA 2WEVA 2XYNA 1PMVA 3MJ1A 3UDBA 5CQWA 2OH4A 5FRIA 1OKVA 2FSMX 4M67A 1A9UA 1GZOA 2YWPA 4RVKA 5FXQA 5CF6A 4EQMA 2BAQA 3RHKA 3LMGA 1RW8A 4G2FA 5CYIA 4O86A 3MPMA 2F9GA 4ZIMA 2PWLA 4B4LA 5EW3A 3HUBA 2HY81 2ITPA 3QX4A 3KGAA 3DT1A 1FMOE 4HYUA 3LLAA 1JAMA 4DFXE 5FUTA 1NXKA 2F2CB 4AXEA 4UMTA 3F61A 2WMRA 4NSTA 1V0BA 4O0XA 4EKKA 2BHHA 1FVVA 3QKLA 4TWOA 4XYFA 5DLSA 5DRDA 1H28A 3FLSA 5BVEA 3I7CA 4YP8A 5KMJA 3HV4A 5IUGA 4AWIA 4BKYA 3G2FA 5CVFA 4KKHA 3CD3A 3NGAA 4AN2A 4AU8A 4H05A 4DH5A 4G9CA 4O6LA 4II5A 1OIRA 4JX3A 2GU8A 1YVJA 5EK7A 4KRDA 3L9MA 3W55A 4FJVA 2C5VA 2VTOA 1REJA 3NFFB 1J1CA 3PG1A 2ERKA 3P9JA 3DFAA 2B9IA 4MD9E 4H39A 3VUKA 3PJCA 4A06A 5IA3A 3SG9A 3DNDA 4BVUA 2HW6A 1J1BA 2BCJA 2NRUA 4FNXA 2EB2A 3DAJA 4OTRA 2XIXA 5A4TA 1WBNA 5IH4A 4O7RA 3ORKA 5J1WA 3II5A 4NW5A 3FLYA 4J99A 5IH5A 3PXFA 1OI9A 4DG0E 5AA8A 3RNIA 3OCTA 3LCOA 3OROA 5L6PA 1O6KA 3R30A 4ERKA 5J1VA 2EB3A 4S31A 3BU6A 2WZJA 4TT7A 4D2PA 4JDJA 4LG4A 4ZLZA 3AC1A 2UZUE 1XH8A 2F7ZE 5EH0A 3T8OA 1VR2A 5FEDA 4KBCA 2WTCA 5CI6A 2YM3A 3EQBA 3VS6A 3ZM9A 2BRNA 2HXQA 4WBOA 1SYKA 4BL1A 4RA4A 2X8DA 2Q0NA 2XM9A 4B99A 3SW7A 4CG9A 2VTTA 2FH9A 1BUHA 4AX8A 4MBJA 2O5KA 2CCIA 4W4VA 2XKFA 3LMIA 1YI3A 4RQVA 3LFDA 3UOKA 3UVRA 4E6AA 1W83A 2J6MA 3EN9A 3IOKA 4IX3A 3KEXA 4YZBA 1Q8TA 3P7CA 5HBHA 2WFYA 3PJ8A 5KZ0A 3GP0A 1OL6A 5AR3A 3DKCA 3MI9A 4FTJA 4MQ2A 2Z8CA 3MGYA 4RPVA 1X8BA 3OY3A 2C6KA 4X0MA 5EM6A 2I0VA 4JMQA 1YHSA 3F5XA 1W84A 4GH2A 3C4XA 2WQBA 5LVMA 4W4YA 2BALA 3H10A 3MW1A 3R9RA 3VIDA 3BL7A 4NTTA 5LWNA 3BL9A 3W0MA 4O7YA 3RPYA 2UUEA 4XG8A 4GIHA 2JIUA 3FZRA 3QBNA 2IW6A 3IDPA 3NUSA 4P5QA 5JRSA 3ZH8A 5KMLA 5IQCA 3MBLA 4DEEA 4J97A 3G0FA 4IQ6A 4JXFA 4TY1A 4M12A 4OTWA 2R2PA 2IVTA 3AT2A 4U97A 4YSJA 2IVVA 1Z5MA 2AYPA 2ONLA 2YITA 3ZCLA 2X2KA 4EOMA 5HBJA 3TDWA 4F0GA 3LM0A 2BFYA 1YI6A 3ZBFA 4EHZA 1HOWA 4I5PA 5JH6A 4BCFA 3EQHA 1BLXA 1OB3A 2PHKA 3Q60A 5EQEA 1IA9A 3CD8A 3MA3A 3ROYA 5JFXA 3OUKA 4I0RA 3Q2JA 3WZDA 5ETAA 4YHJA 3E64A 2BRHA 3CKXA 3GXLA 3QQHA 4OTIA 2ITXA 3R2YA 4Q5EA 4L45A 4IWPA 1WVXA 2QR7A 5HD7A 4IVDA 2XZSA 1GOLA 4FEWA 4D4YA 4QDVA 2C5YA 4O96A 4DGLC 3W0NA 4U45A 4FNWA 1XJDA 3NMUF 4D1SA 4DGNA 3DLZA 3VUMA 1SVHA 3GCVA 5CT0A 2VWUA 5J79A 3DA6A 1OKZA 5M07A 2GQGA 4ZY4A 5BVKA 4DGOA 4ONAA 4P2KA 3EQIA 2WB8A 4MXZA 5J5SA 5DR2A 4XRLA 2C6MA 4FV8A 3Q4UA 5M44A 4ALWA 5AAGA 3F7ZA 4Q9SA 1Q62A 4S30A 3HAMA 1LP4A 2VO0A 5H3QA 4IM2A 3UNZA 4IB1A 1Q61A 3FC2A 2WOUA 4JAJA 2UVXA 4TYGA 1Q5KA 4LUDA 4F1TA 2XEZA 1BKXA 4NJDA 3TZ9A 2GS2A 4GUBA 4MNEB 5DBXA 3DFCB 5E8VA 2VWIA 3ZLXA 3SD0A 4RC3A 3FMDA 1Y6AA 3LFQA 5BUEA 4ZTSA 1GY3A 1VEBA 4JR7A 3NYXA 2XJ1A 2PL0A 4KSPA 3GU5A 4P4CA 3V6RA 3ML1A 4IX4A 1U46A 4KB8A 4MEDA 2B4SB 3W2SA 2VGPA 2PVRA 3TKUA 2WELA 4FV5A 3THBA 3HKOA 5L2QA 4B7TA 1KE9A 1Q99A 5CLPA 3A60A 2XS0A 3A7IA 3OZ6A 1WBPA 3I60A 4ZTLA 2VWYA 2XK6A 2OICA 3KVXA 5GNKA 1ZYDA 3TN8A 4YTCA 2PVKA 4FT7A 3LJ2A 3FZPA 2A4LA 2BZJA 2W06A 3HGKA 4BWKA 3DJ6A 3FC1X 1YWNA 4QMPA 3AKKA 4IC8A 4N4SA 4QTDA 4V04A 3TM0A 4USDA 2G2HA 5EYKA 4D5KA 5BUJA 2CLQA 4G34A 2B9JA 2O8YA 4RFMA 4A9SA 4F7JA 2H34A 4E93A 4QMMA 5CENA 4V0GB 3FMNA 1H4LA 1PF8A 4PDPA 5JFSA 4LV7A 1FINA 3PP1A 3DPKA 3QA8A 2BMCA 3QTZA 2ITTA 4YGAA 2PVNA 1TQPA 2BZHB 4FTOA 4DLIA 5HLWA 2ZDTA 3LXLA 2XKCA 5L8KA 3LFNA 4HCTA 5H2UA 2VWXA 3PWYA 3BHHA 2FSTX 3FPMA 4CT2A 2HOGA 5DR9A 4AZEA 4FZ6A 4NM7A 3U9CA 3R2BA 5JFWA 4BDCA 3E8EA 3KF7A 3KRLA 2O2UA 4M68A 3V5QA 4RWJA 5L2WA 3FWQA 2OLCA 4ANSA 1OUKA 1BI7A 1UNGA 1Y6BA 5T3QA 2EU9A 3D14A 4F4PA 4RMZA 5A4QA 2C6DA 2ITWA 5FEEA 4D55A 3E92A 5AUZA 2QOBA 5EKOA 3TMOA 1G8AA 4BDJA 2GNJA 3TNQB 2C1AA 4O6EA 3U6HA 3L8XA 3LFSA 4QMYA 4FL1A 2BZIB 2WKMA 4IM3A 4FIEA 2Z60A 3BWJA 3AMBA 4FTKA 3IO7A 3NAXA 4JI9A 5HO6A 4FBXA 4DFZE 3MH1A 4MNEA 4KNBA 2WMTA 4L8MA 4CMOA 4MCVA 4FTUA 2YIQA 4G6NA 1KUTA 2I7QA 2JBPA 5DT3A 3UJGA 4X2GA 5BX0A 2JD5A 4S33A 4BHNA 1P2AA 4NW6A 4Y46A 4IZAA 4F64A 1H07A 5CNOA 4HPUE 2JIIA 3BGQA 4QPAA 1PHKA 5JT2A 3L9NA 5DT4A 4F6UA 5KNJA 5JN2A 3NW5A 2R3KA 4G6OA 4O0WA 3I81A 3UZPA 5F95A 4E3CA 4F7SA 2QVSE 2QG7A 4DFBA 2RIOA 3OT8A 4C34A 3PA3A 4I24A 4L6QA 4RLKA 1LPUA 3O51A 4B0GA 5HVKA 2PYWA 4WRSA 3F6XA 3PVWA 3RMFA 2WMVA 1DI8A 2PTKA 1OVEA 4LGHA 4CZTA 3W32A 4I3ZA 4JBOA 3K3IA 5B7VA 4BBEA 4ZJJA 3OWPA 2VNYA 4QT1A 3U54A 1ZY5A 4LV5A 3MH2A 2W1EA 3RKBA 4IANA 2EXEA 3B2TA 4FL2A 4GJ3A 4O0UA 4OTDA 4KS8A 2XCHA 5F20A 2HWPA 3VJNA 4F0FA 5IQFA 2BFXA 3DV3A 3ZDUA 4RWIA 4ASDA 5J9YA 3GB2A 4D4RA 4DTBA 2QC6A 4MHAA 3RBWA 5FBOA 1OIUA 3HMPA 4XV3A 2FO0A 1OECA 3G6HA 5BMSA 5IG1A 4G3CA 3LAUA 4X7QA 3QHRA 5L2TA 3EHAA 4NIFA 5HCZA 4GK3A 2JBOA 3FQSA 3AC8A 3HV7A 4RJ4A 4DTAA 2P33A 3QQFA 4J8NA 3HV3A 1H08A 3ENHA 4U9AA 5D41A 2GDOA 2ZM3A 1OKWA 1Q24A 4QYFA 2WNTA 4OBQA 3UTOA 5KBRA 4MNFA 4OTQA 2E9PA 3R7VA 4JIKA 4I92A 3ZUUA 4FNZA 5C4LA 2HENA 5BUIA 3CPCA 3UOLA 4DEBA 5IA1A 2HAKA 1ZYSA 2A98A 5A9UA 5CEMA 4BDHA 3W10A 3BU3A 4LL5A 4YPDA 4YMJA 5I9ZA 5LMKA 5ANKA 4UZHA 4DF3A 2F7EE 2FYSA 3K54A 5CSHA 3QRIA 4NFMA 3VF8A 3FXZA 4RJ6A 3MVMA 3QAME 4X3FB 3QCYA 2V5QA 3VQUA 3QC9A 3MESA 4BDFA 2R3JA 4PL4A 5CF4A 2EXCX 3D94A 5FP6A 1UNHA 4HCVA 4CSVA 4Z7HA 5HTBA 4RG0A 3R8VA 3QQLA 3ATTA 4AXDA 4EK3A 2JDSA 3NYVA 3NDMA 4GFMA 4TW9A 2UZTA 3KY2A 4C8BA 4DHIB 4UY9A 3L8PA 5TOZA 2B53A 4AXCA 3AKJA 1APME 1XBCA 2XMYA 3KRWA 2PUUA 3F88A 3OF0A 4AQKA 5HQ0A 3OCSA 4C4FA 3TNPC 4ZJVA 4AA4A 5DGZA 2R3HA 1OIQA 1A06A 3N9XA 4BKJA 3F3UA 4IHPA 3SOAA 4C3FA 4I5HA 4N0SA 2XVDA 4H3PA 1KOBA 2A19B 2RKUA 3WF9A 1M7NA 4L7FA 5I4NA 3C9WA 3MFRA 1PXKA 3AQVA 5EHYA 4XP2A 5IDNA 2YHVA 4GS6A 4FYNA 2WPAA 5E8XA 4M0ZA 4EOJA 4OTFA 3UPXA 3PA4A 3VVHA 5ANIA 4BTFA 4ZZNA 3UYTA 4O7VA 4KIKB 3EZVA 4AS0A 3COHA 2X7FA 2PPQA 2R7IA 4Z16A 4I22A 1Q3DA 3AMYA 1G3NA 1T45A 1Q97A 2J0JA 2QO9A 2VTJA 4NKAA 5D7AA 5HIDA 3VWAA 4BCQA 3R9NA 3UZTA 4MKCA 4GT4A 3L9PA 3NPCA 4XH6A 3EL7A 3HP2A 4BDKA 2OK1A 4ZTQA 3LJ0A 2QO2A 5CSPA 4USEA 1KE7A 4RIWB 1B39A 2YA9A 3PG3A 3BELA 4Q2AA 4WOVA 5FD2A 4B6LA 5M4IA 4WSYA 3WI6A 4ACDA 2YLFA 2WGJA 1Y91A 3R9DA 3CQUA 3QF9A 3ZFYA 1CKPA 4F6WA 2QURA 3VS7A 3PXRA 3QWKA 4TYEA 4GFGA 2OJIA 3DBEA 4N70A 4GJ2A 5BVWA 4X3FA 3M11A 4ALVA 2W1IA 5J7HA 2PE2A 4WNPA 2CGWA 3K2LA 4TNBA 4LRJA 2ZM1A 5CS6A 3AKLA 4MD8E 1YI4A 4TWCA 4YJOA 4GU9A 2PVMA 1TZDA 3NLBA 1NVSA 2YM8A 5TF9A 3EN7A 4IAYA 3JPVA 3BV2A 3MH0A 3A8WA 1EH4A 2CGVA 3QYZA 4D4VA 4YNOA 4DHJA 3UG1A 5EYMA 1NA7A 2C6TA 2ZAZA 3QD3A 3HRFA 3PIZA 4J71A 4R7BA 5JGDA 3R6XA 3I6UA 4U80A 5C8KA 3G9LX 3R9HA 4EBWA 1WZYA 4IC7A 2A1AB 3CQWA 4PL5A 3V8SA 5FTOA 4ZSLA 3HECA 2QODA 3MFUA 1CKIA 2QKWB 3R22A 2BR1A 3E8CA 4BTKA 1JKLA 5L3AA 1Z9XA 2GCDA 4HNIA 1CKJA 2YAKA 2ZV8A 1SMHA 3PJ1A 3RK7A 2C0IA 3B2WA 3RK5A 1UWHA 2GQRA 4DC2A 3DDQA 4DEDA 4QYGA 1BL6A 3OXZA 2G1TA 3R28A 3LQ5A 1TFFA 3IQ7A 3DBDA 3VBQA 3NAYA 2A0CX 3BYVA 5EI6A 3VS2A 4BCMA 4KSQA 1REKA 3LM5A 4ENYA 4E5BA 3OBJA 2ZOQA 3KXZA 3AC4A 4FUYA 3KF4A 5AIRA 3VRYA 4YBJA 3WZJA 5BVDA 4DH1A 2XNOA 4YJUA 3TXOA 4C57A 3O5AA 2YDJA 5JQ8A 2OFVA 4FV1A 1UU3A 3AGMA 3UNJA 4EOLA 3RPSA 4RIWA 4B9DA 2R3OA 3EYHA 4BDEA 2V55A 4FR4A 2V22A 3WF5A 4APPA 2YCRA 3KREA 3PP0A 4IW0A 3A7JA 1YOMA 4YLJA 3R71A 1QPCA 3HMOA 4JBVA 3TTIA 2XARA 3PDTA 3WZEA 2PZPA 4M14A 3HA6A 2UW4A 3ITZA 3MSSA 4M69B 4R3PA 5AWMA 1U5QA 1FOTA 4I20A 5AV0A 3U4UA 1H1QA 3UODA 4AA5A 3ZDIA 1W2CA 4ZZOA 4AP7A 4QMNA 2DQ7X 4CKRA 2Z02A 2X6DA 5TKDA 3QCSA 5L8JA 3RWPA 2WMBA 5ANOA 5BMMA 4AW5A 2J7TA 4D4SA 3DK7A 3ALNA 4RZVA 4EC8A 3RPOA 5JKGA 4QMVA 5ICPA 4Y73A 3HV5A 4FUXA 5HNGA 3ACKA 4MF0A 2CKQA 5GJFA 3O17A 5IQDA 4F9BA 2GS6A 2JGZA 4JIAA 4O7WA 5H9BA 4BIEA 2W1GA 4AAYA 5AA9A 2C5NA 3HMNA 4K18A 5AR2A 2QO7A 4AGDA 3H9FA 4CKIA 2C4GA 2VTHA 4LDTA 3QKKA 3RALA 2RSVA 2VTRA 4BYJA 1OM1A 4DH3A 3VC4A 3GC8A 2CKEA 4AZSA 3NUPA 3B8RA 2W5HA 5ANJA 3ODYX 4RC2A 5G6VA 3I4BA 3EMGA 4H3QA 3QHWA 3PIXA 1H0VA 3ZEPA 4BZDA 3FYJX 3EWHA 3GNIB 2BTRA 5HICA 4I6FA 4XBUA 4S32A 5BYLA 3M2WA 2QHNA 3IS5A 4MWHA 3HDMA 3C4CA 1W98A 3LQ8A 4DHZA 2C3JA 2VTLA 3R9OA 3NYOA 4F09A 2GTMA 3JUHA 4P7EA 5D1JA 4CMUA 4NTSA 4PP7A 5LMBA 4USFA 1H26A 3NCZA 4QP2A 4DAWA 5AX9A 1LEWA 3D5UA 2RFEA 1YXSA 4CMTA 4EOQA 3TT0A 3G15A 4G17A 5HNBA 2Z2WA 5BPYA 3ALOA 3PXKA 2A2AA 2VNWA 3UIBA 4EI4A 3PPKA 2X0QA 1YXTA 2GFSA 1JNKA 4QQ5A 2R3LA 4EK6A 3PY0A 4M69A 1JKTA 4L3PA 3NWWA 3TNWA 3WYYA 1FVRA 5LVOA 2AEGA 3KXXA 5AR7A 2QCSA 3HV6A 3Q9XA 4D9TA 1W7HA 3MY0A 2GHMA 2CNUA 2XANA 3DU8A 4EH4A 4MWIA 2FVDA 2UW3A 2ZDUA 5CAPA 4QP7A 3EQRA 3GC0A 4PDSA 4ZEGA 3H9OA 2ITZA 3QXPA 4IB0A 4XG9A 4Z9LA 4CG8A 5M56A 4W9XA 5I9XA 1J91A 5CSWA 4BJJB 4TYIA 3R0TA 4QQJA 3WIKA 3R8MA 4N6ZA 3SW4A 3ZYAA 5I3OA 5IA5A 2F7XE 2CNVA 1O6YA 3BYSA 3R7UA 2G9XA 4FKRA 4YZMA 3NUNA 3O23A 4AQCA 2QG5A 1CTPE 3C5IA 4DT8A 3LE6A 3LOKA 4FTLA 5DEYA 4FIFA 2JAMA 1YQJA 2PMNX 3JS2A 3SHEA 4A4OA 2XJ2A 2VTQA 4QYYA 3PVGA 3UBDA 2P55A 4O4CA 2R3RA 3FQHA 4NH1A 1NY3A 4I94A 5DWRA 5EW9A 4ANMA 2ZB1A 2BZKB 3H30A 3KK9A 5AR4A 5KMMA 1OBDA 5K3YA 2XKDA 1E9HA 4WG4A 3KQ7A 5GINE 1YHWA 2QOIA 4FT5A 4FVRA 3ZONA 2C6IA 2XM8A 3ORMA 2PY3A 4CT1A 2VRXA 1F3MC 3FKOA 4IAFA 4O1OA 3V5TA 4ANLA 5IEVA 1DI9A 2XAMA 2OWBA 3BIZA 5CZIA 3NW7A 4ANNA 3W1FA 2PUIA 3ORPA 1PMUA 2VU3A 4CTCA 4K1BA 4IMYA 4O22A 3T3UA 3V3VA 5EDQA 2JKOA 4IACA 3R8ZA 4HYIA 4G16A 1PXLA 4JDKA 2V7AA 3GUBA 5LWMA 3QL8A 4J8MA 2VO7A 2YCFA 4UMPA 4FKUA 2I1MA 4C4IA 3EJ1A 3MH3A 5HI2A 4U7ZA 1PXOA 3DNEA 4C7TA 4EH2A 3PFYA 2XB7A 4M84A 3LFFA 3DBCA 4ZSEA 5J95A 3N4TA 3MTFA 4R5SA 1RE8A 3H0ZA 1PXJA 3B8QA 2PVHA 2WTJA 3D4QA 3W0OA 4IZ7A 5LCKA 3VHKA 4O0TA 5AUXA 4EH9A 5M4CA 5EFQA 4P5ZA 1PXNA 2UZDA 3CY3A 4AA0A 4AZVA 4DH7A 4C38A 2Y6OA 3LHJA 4ZSJA 2P3GX 5DIAA 3UIMA 3TUCA 5DMZA 1IG1A 3EL8A 3CKWA 3A62A 2UW0A 4BZOA 2ZMCA 1YDRE 3AD4A 2R4BA 2VTIA 3DB6A 3Q6UA 4TN6A 4K0YA 4A9TA 4DLJA 3DCVA 4MYGA 1XH4A 4FTMA 2W9FB 3ERKA 4FT3A 4W4XA 2Q0BA 4DG3E 4QO9A 3TIYA 2PULA 5FLFA 4ZTHA 1V1KA 5IA2A 1LEZA 2NRYA 1U59A 4GG5A 2ZYBA 2VTAA 4FKVA 5DA3A 4FZAB 4HW7A 2B0QA 4O83A 3ZRMA 5AADA 2F57A 1Q41A 4NFNA 3FMJA 3HX4A 4HGLA 4TYJA 4XUFA 3QUEA 1ZY4A 4I1ZA 5EM5A 4Q9ZA 3R01A 3P78A 1BX6A 3MV5A 3RZBA 3FSFA 5AP5A 3TNHA 4AZTA 4BZNA 3WF6A 1RJBA 1YXVA 4QQTA 5CF5A 4PPAA 4C36A 3BEGA 4E1ZA 4FVQA 3FSKA 3Q4ZA 3QCXA 3DZOA 4EZ5A 4CFUA 3ZS5A 1WVYA 2IJMA 5IISA 4BBFA 3PA5A 3HMMA 2XUUA 4RWKA 4FSWA 2Y4IC 4JDHA 1ZLTA 4OW8A 4LOOA 4U42A 5FEQA 3M1SA 2BTSA 4YZDA 3GENA 1H01A 4MXCA 2XH5A 1W0XC 5A4CA 3ZLYA 3BV3A 3CLYA 4IDVA 3VHEA 4CXAA 5M08A 2ZJWA 1SVEA 4FEQA 2OF2A 3RGFA 3ZRKA 3LLTA 3MYGA 3TKHA 4MXXA 4EHGA 5EI2A 4G1WA 4YLKA 3W0QA 4TPTA 2UW5A 3D5XA 5HE3A 1XH5A 4D0WA 3RPVA 1KV1A 3QXOA 5H8GA 4RZWA 2C3LA 3ZC6A 3ZLSA 2WMAA 4G31A 3EFKA 5BNJA 3G9NA 4O38A 4BC6A 4F9YA 4UMRA 2P0CA 3VUHA 4EC9A 2PMOX 4JRNA 4LFIA 4GK4A 5E8WA 2J90A 5TT7A 5IQHA 5JZJA 3QTRA 4BIBA 5K4JA 2JKKA 3PSDA 3GFWA 3QD4A 4K11A