3P8BB

X-ray crystal structure of pyrococcus furiosus transcription elongation factor spt4/5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
AGKIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNKGVVDEAIRGIRHARGVLPGEVPFKEIEHFLEEKPAVSGLEPGDLVEVIAGPFKGQKAKVVKIDESKDEVVVQFIDAIVPIPVTIKGDYVRLISKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase, subunit e''
publication title RNA polymerase and transcription elongation factor Spt4/5 complex structure.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/transcription
total genus 33
structure length 147
sequence length 147
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00467 KOW KOW motif
B PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3p8bB02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 3p8bB01
1KD1C 3CCQT 3CCLA 3CD6T 3TREA 2MI6A 1VQLT 3A5ZB 1XTDA 3JAME 5J3BA 3PIOA 1NJIU 3I56A 1JJ2S 3CC2A 1Q7YU 1VQNT 1KC8U 3DB3A 2K06A 3J81E 3J7AF 3CC4T 2OTJA 1S72A 1M90U 1JJ2A 3CC7A 2CKKA 2KVQG 1UEBA 1K9MU 1VQMT 1K73U 5IT9E 2LQ8A 1YJ9A 1M1KC 1QVFS 1W2BS 2LVMA 3CXCS 3I55A 2MWOA 1VQOA 3J80E 3QQCD 1YJWT 3CCJA 1VQ6A 1QVFA 3CPWS 1W2BA 2JUFA 1KD1U 3CXCA 3G4ST 2OTLT 1X6OA 1VQ7A 2DO3A 2QA4A 3OYYA 3CCUT 1YJNT 3CMEA 4TVRA 3DLLA 3CCVT 1VQ4A 1VQPT 1K8AC 3G6EA 2QEXA 1VQ8A 2JVVA 4QQDA 3CCRT 3CCQA 1VQ9T 3CD6A 1Q82U 2JOYA 1QVGS 5DLQE 1YI2T 4CRIA 1VQNA 1M1HA 4ZN1A 3CCMT 1M1KU 1QVGA 3P8BB 1NZ8A 5A2QE 1RL2A 2E70A 3PIPA 2E6ZA 1KQSS 1N8RC 1VQKT 1YIJT 3I56T 1YBYA 1YHQT 1YITA 3CCET 5J26A 1YJWA 3CPFA 3G71T 1KQSA 2MWPA 2OTJT 3G4SA 2L3RA 1VQ5T 3CPWA 3H7HB 2OTLA 3CCUA 2JNGA 1M1GA 1NJIC 3HKSA 5LL6S 1Q7YC 1YJ9T 1Q81C 3KBGA 4YTLA 3CCRA 1VQLA 1EIFA 1SSFA 3CMAT 1VQOT 3LPEA 3CCST 3CCJT 3LGLA 3CC4A 1VQ6T 1KHIA 1K9MC 1NPPA 1NPRA 3LGFA 3LH0A 1NZ9A 1VQ7T 3CMET 3CCLT 2KDSA 3DB4A 1VQMA 3G6ET 1Q86C 3OW2S 3CC2T 2IG0A 4X34A 1K8AU 1VQKA 5DM7R 3OW2A 2EXUA 4ZN3A 1YIJA 1YHQA 3CCEA 1S72T 1Q81U 3CC7T 2G3RA 3G71A 5HY6A 1YJNA 3CCVA 1VQPA 1VQ5A 1BKBA 5IAYA 1Q82C 1KC8C 2XHCA 3ER0A 2EIFA 3I55T 3EWGA 1VQ9A 1M90C 1IZ6A 5FLXE 3CMAA 1YI2A 1YITT 1K73C 1Q86U 3CCMA 1XNIA 3CCSA 1N8RU 4RG2A 2QA4T 2OUGA 1VQ4T 2QEXT 2LCLA 1VQ8T
chains in the Genus database with same CATH superfamily
4JYAF 3WQPA 2ZAEA 5KFZA 2PVGB 4QCLA 5GAMd 3CCEQ 2XULA 3J7AF 1I94F 2KT1A 2L3PA 1WOPA 1YKWA 3A4TA 4LF8F 2C0TA 1QVFS 5BJRA 1UCNA 1WC1A 5DJBA 4A8XA 2J6KA 3HSZA 5AT1B 4TVRA 1T94A 1JU5C 3HULA 3BQ1A 3U1MA 4IUQA 2R3VA 4OI0A 3KG4A 3WC2A 5IT4A 4ZLLA 3FUYA 1YWOA 3A8JA 3CJ0A 2QFIA 1K0XA 2ASYA 1FX2A 2YX1A 2XMVA 3H0IA 3C46A 2JMAA 1BC6A 1YJRA 1YWPA 3E9FA 2ILYA 2UUCJ 4BE1A 4M7AB 4N47A 1S49A 2B43A 5EHHA 4LF7F 2WBRA 3TUZC 1T8EA 1AZGB 2VGNA 3TEEA 3OA6A 2CJ9A 1S1VB 3G6ET 4K5SA 4CI0B 4BDPA 4F4WA 4A8WA 2HSEB 4YB1P 2ROPA 1U26A 4BD3A 3QDFA 1IBMJ 4A8OA 1M5Q1 2CJQA 2PT0A 4X62F 3ZTQA 3G7ZA 4UY85 5B0DA 1HQEA 3TX8A 3MTKA 1OYEA 1HQEB 1PSFA 3G6XA 4DV6J 3FMBA 2XYPB 3BGRA 1I6JA 3BGRB 2XO6A 4JZ4A 2IM0A 1FD8A 2JS0A 4DSJA 3QZ5B 1QLNA 3DI6A 3IR5B 2CKKA 2OIHA 3AD8C 1X27A 3CE8A 2RS2A 5A6PA 2UUAF 3MEEA 1S1TB 1LW0A 3MEEB 4NLYA 2R58A 4DSLA 1WNEA 2RHYA 1GTEA 2IBKA 2FJEB 1PCXA 4OI2A 4ETXA 4YP3A 2WW8A 3T1HJ 2R8GA 4F7UE 2ZPBB 3GOXA 1RLPC 1WHXA 2QIFA 4PG5A 1RL2A 2KY9A 2MQQA 4AMCA 2GTOA 1YBYA 2YUNA 4J9HA 1AHJB 1Y57A 1R77A 5LL6S 2Y1RI 1UW4A 2G2YA 2KFNA 3BPDA 2DGOA 3OB9A 7FDRA 4M7DG 1Y5IB 5M9OA 3P8DA 1U49A 4ZGDB 1FVSA 1KD1T 1C4CA 4DV3F 3X3UA 1VJWA 3UCZP 3DU5A 2XHCA 4OZLA 5F8GA 3L2ZA 5D7UA 3FKBA 3D66A 1U02A 2KYXA 3BSAA 3RB6A 4CRJA 2VQEJ 4TLRA 3LP1A 2OP5A 1NEEA 3EVOA 3SI8A 3J81E 4JI0F 2Z56B 4U9RA 2DNPA 4EZ6A 2A3LA 3TX0A 1SKUB 1UTIA 3A8GB 4HYKA 3CMAQ 1EX4A 5GAOp 2VFVA 2KRRA 3CCLQ 3QAEA 3PV8A 3QJJA 1FMWA 2RM4A 3LWHA 2RIJA 2CPIA 4FSSA 2BQUA 3GNGA 1UHCA 3BSOA 3QRQA 1Y7XA 1QVGA 2ACYA 5L46A 4YFUA 2M9UA 3FQLA 4RUAA 4AFZC 3RJMB 2BOAA 2FHKA 1QM9A 2VODA 3EPGA 2MSSA 2ZM6J 2KKHA 3THVA 5D0GA 1UFLA 4ZGJB 4WXWA 4ECXA 4Y34A 3UN2A 3UDCA 2KT3A 4EI2A 4FYYB 4E7HA 2FHOB 1SL2A 4M77E 5LJ5g 1S48A 5GADI 4KPCA 4OMMA 2ZNZA 1FESA 3NTIA 4PYAA 2COLA 1M2OA 1VRQC 2HFOA 5B08A 3HHEA 2YHTA 2HKNA 1WC4A 4KRWA 1NHVA 1IGUA 1RT3A 1FI4A 2KTQA 1RT3B 4DPTA 3O5ZA 1S57A 3QWYA 4DSKA 1K73R 2HBZB 3VS2A 3POTA 4WP8A 3POTB 4OGEA 5D4OA 1W2BS 1U1MA 1WQ7A 3OXFA 1J5EF 6FDRA 5C5JA 4R25A 4CT8A 2EG1A 2B3TB 1R27B 1X9MA 1VQ8Q 3WVDB 3J7ZT 2NQPA 3W2WA 3X25B 2KYMA 3I0RA 1R31A 5SUHA 2CYYA 3W2WB 3P5BP 3I0RB 3A3NB 3E2EA 2LZ6B 1SQGA 2AX1A 4UOHA 1FJCA 2JEFA 1B99A 3P8BB 4AT1B 3GV8B 4FBUA 3HZGA 1HIYA 2EBEA 1WQWA 4CLWA 5D8HB 3K0JA 3M8RA 4N8OA 3GIBA 2AJ2A 1LWEA 4M78C 3NTKA 1LWEB 4HDHA 3HM9A 1S7IA 1VQ9S 1PD1A 1Z4UA 2VBYA 1ZSZC 2W10A 1KQ2A 3BN4A 3CCRQ 3LF0A 5C24A 1QVGP 3C3LA 5C24B 3QT5A 3I9QA 1YJUA 3GIIA 2Y3YA 1SJRA 2FVQA 2PMHA 4LF1A 1WKJA 2XG8A 2JLFA 2FUG9 4PNOA 3OSNA 4KAIA 2F2XA 4JDSA 3KYLA 2DM1A 2FVSA 4YQWA 3D54A 4WCEQ 4O4RA 4RZRA 2MCNA 1NYGA 5CD4A 2GS8A 4PEOA 4NXMJ 2B0GA 3ENQA 3OT9A 2XMFA 3GNFB 5LJ3d 5DDOC 2XU8A 1SEMA 5C6SA 1OQ6A 1YJ9S 3PHTA 2DPPB 1VQOS 2RQ4A 3GMGA 3H9NA 1NKEA 2RHZA 4LF6F 1ZLMA 2JVVA 1DTQA 2K2MA 2B7CB 1DTQB 2DVIA 1YI2T 3K8VA 4C8QA 2D0NA 5GAMj 4C8QB 1T03A 1T03B 2A1BA 2A6OA 3M53A 2IJFA 4F0HA 2ATCB 1MG7A 5IT9Y 4RBUA 4WFNQ 4LF9J 1D0ZA 2GFFA 3KKFA 2P6TA 2LU2A 3OYAA 2V4JA 1NJIC 2DXCA 5KTQA 1RLCL 2QYZA 1KTQA 4NZ7A 1BMQB 5IN1A 2HFUA 3OBIA 1KIKA 2HIYA 2YH0A 3CMET 1GFWB 1N5VA 4PG7A 4AL7A 1BBZA 2MLXA 2IG0A 2PUKB 4NOYA 1CEZA 2ZBCA 3M6XA 1RCXB 3NAIA 2HNIA 4YOEA 3MEGA 1K47A 3MEGB 3NRBA 4OYPA 5KFXA 1EZZB 2E3HA 2FYXA 1LJOA 4WIIA 4QVZA 2BZ8A 4XTWA 2M1HA 2Q6CA 1VJQA 4MMOA 3EG9A 3LW5C 3EG9B 2YPZA 3MD1A 4XPEA 1HHQA 3CC7Q 3OTOF 1SH2A 1AD5A 4P75A 3MAQA 2W7OA 2BQ3A 3PNIA 1VGYA 2HZAA 4FT4A 2J8AA 2CA9A 1YBAA 3HHNB 2MY8A 5T41A 3PIPA 2ABYA 3I9ZA 4C3KA 4C9DA 4B3TJ 1MV0B 4JI7F 1GAOA 3DLKA 3FJPA 1U0HA 3DLKB 1U0HB 2IYGA 1TP7A 1H3HA 1SJ1A 4CZCA 8AT1B 2PI5A 2MIOA 1W26A 4M5LA 4O44A 1WKLA 3LGFA 3GV7B 4EMHA 4O44B 2KROA 4WBFA 3AJDA 4CH7A 5HK4A 1RWUA 1YBUA 5H9EJ 1S6QA 3RAXA 1S6QB 2IHR1 3KTQA 2R5AA 2O66A 1LK5A 4RUGA 3SCIE 1KP6A 3VS6A 4N0AC 3IWLA 4I68A 4BDYA 3GJRB 2K57A 3W62A 3ZZZA 3JSMA 3R5GA 3JSMB 2ZITA 2R2SA 1HI0P 3ME9A 1FE4A 4AL6A 4HH0A 4OB0B 2DBBA 3AA9A 1S6UA 4K0KF 1P27B 4A8KA 3PR5B 2UU9F 4OB3B 1HWIA 3IBCB 4LF5F 4WFZA 5GJVB 3GCXP 4JV1A 1T3NA 4RTXA 4C92D 3CCQA 1LOUA 1FMKA 4LSZB 2N4CA 2DVEA 1SC4B 1SKSA 1V5IB 2E5QA 3TAMA 3TAMB 3MM6A 3MM6B 3GG1A 1MROA 2O01C 1IKXA 4KGZB 2HDAA 3R2CJ 1MROB 1IKXB 4N77A 3JCMP 5KFAA 1TH7A 1VBZA 2ZH5A 1CC8A 2Y0BB 2UV8A 4H4KC 1XMQJ 1ZTTA 3LTOA 3H5SA 4CLSA 2HURA 1T9VA 2CG4A 2IJRA 1MMAA 5GMKi 4NLVA 1VQPS 2M3DA 2A08A 2G0JA 3QSUA 3CCVA 3RB0A 1RBLA 3THTA 3PHEA 5EG2A 1HW8A 4OZNA 1WKKA 2BIVA 4M75G 4GKKF 1U1LA 2J05A 1SUQA 1JO8A 1SUQB 2VUBA 3X28B 3BSNA 3CCQT 1GCQC 2AKWB 3CIZA 4X1VA 4IOBA 2KXDA 1NDKA 2DTJA 1RWPB 3HF5A 4OYBA 3NGTA 2RHQB 2D8JA 3RAMA 1OIAA 1WJRA 1H3ZA 4XIUA 2A36A 3CCTA 2VQFJ 3M54A 1FEEA 3NS5A 4EU0A 5GAGI 4M75C 1QE1A 4WKRA 1HYSB 1QE1B 4ALZA 2B4VA 2BX6A 4DSIA 2UXBF 4NYPA 5HK3A 4OYIA 2HGLA 4O3SA 4M78E 4CNYA 4EK2A 2ZPIB 2Y0SD 2D3ZA 4WYWA 3C15A 3C15B 3O8VA 5CYQA 5CYQB 3EG3A 4JI5F 1D3WA 3ENVA 2EFPA 4J9GA 2XZWA 2RJDA 3PX6A 3QATA 5B0FA 2AJ4A 5G0RA 2DEJA 4DLGA 5G0RB 1FNOA 2M9KA 2ROLA 3GSIA 3ZTSA 4LF8J 4Q44A 1PRLC 4ITSA 4P72A 3SFGA 1YHQA 2E66A 5CCMA 2KNBB 1UUEA 5M2PA 1W4SA 4EEYA 3CIMA 2UVWA 2IMWP 1FDBA 3HDSA 4CLLA 5I3QA 5ETVA 2P9CA 4DOVA 1ZX6A 2OUGA 4K11A 3BEGB 3R5BA 3L09A 1S0VA 1I81A 4F4XA 1DJ7B 3VRZA 2YSQA 3A3OB 4MZMA 3V7SA 1NMEB 3SCKE 2DZ9A 1NK4A 4DDFA 4FVCA 3FCWA 4CQ1A 3NS7B 4B9LA 3A13A 4NLQA 4QIWD 2BOPA 3CCJA 4QW8A 1VQ4S 2JUFA 4RCCA 1S9EA 1K8AC 1S9EB 3UFCX 3G6EQ 1NEGA 3W2VB 1IBLJ 2K2VA 1XQIA 5CXTA 4GBQA 4RJVA 2EI5A 2EBGA 3I5BA 1YLXA 4L6V5 2JT4A 3OL9A 3R6GB 1YHQT 5F41A 2K3IA 2RHUA 1I8FA 5HJYA 4XAXB 4BB7A 4B02A 4LDWA 2X3GA 5GAN3 1ZM9A 4DZDA 4UT4A 2V8VA 2KAFA 3JB9D 1VK8A 1BU1A 2ZZTA 2XY7A 4B9NA 1JXEA 2F5TX 5FDLA 4C97A 2ZH6A 2QQ9A 5FDLB 2DXUA 3IG1A 3IG1B 2AU0A 2DNNA 2LCCA 1T3LA 3LW5E 4RG2A 3PW2A 2FYKA 3V6KA 5DGBA 2XDBA 1XTDA 4FF1A 4RNHA 3KMQA 2AEJA 3A8OB 1EFNA 4NCAA 1TOVA 1Q7LB 2HHPA 3FSIA 4FBTA 2V1RA 4NS5A 4MKVA 2WZ1A 1X43A 3GJSB 1N33F 3HSDA 3LH2S 3H2VE 3CDEA 3DKDA 1RT2A 1RT2B 2VBWA 1B0PA 3OYYA 1UB4A 4KGKA 2W2MP 3EMTA 1W70A 2GO8A 3OTEA 3F41A 2G1DA 2EFIA 3A8MB 1M1HA 5EWFA 4J9SA 2LEBA 4M7DF 5LJ5e 4J9DA 1T9YA 3H0PA 4IRDA 3JCMJ 4NLPA 4C0DC 2R8KA 3CPWA 2OTLA 3M55A 5B0BA 2LYVA 4MMLA 1Q78A 3JQJA 2LT1A 3HPOA 2SRCA 2VF3A 2LXFA 4IFVA 4IFVB 2FQQB 3DB4A 1UEUA 3UT1A 1YZ7A 4M5DA 2OTJS 2JSXA 2O67A 4M5DB 3OS1A 1YIJQ 4HH1A 3OS2A 5LJ5h 3JB9F 4MK9A 1Y0HA 2JMCA 4RTZA 1WNLA 3I4PA 3OTCA 1TL3A 3AD9C 2E29A 1Y3JA 1DURA 1TL3B 1G3YA 4DV7J 5M2UA 2AZ1A 1MGQA 1SH3A 1QVPA 3M7VA 5GAOn 2C0OA 2DR6A 2FC9A 2I0XA 1UEVA 1CJVB 3EG1A 3MAHA 3QT7A 5GMKl 1M3CA 1WX6A 5I2MA 1TUCA 1GMWD 2F4FA 2ZWOA 2RA2A 2HHQA 2CSIA 3GWCA 2B4OA 4I1TA 2Q43A 5J2MA 3OS0A 5J2MB 2OTLT 4OL8A 3R2DJ 1WHVA 2QEXA 1X4EA 4B3RF 2W25A 2XI2A 3EJMA 3GSDA 4DV0J 4ZP6A 3NCRA 1Q5YA 1WSRA 4USTA 1BI3A 4UUXA 5KG1A 2O01E 2IM1A 2VONA 4MIAA 3D6TB 1AOJA 4GY5A 1RHUB 2YY3A 1YJWQ 1R7IA 2CWKA 2CYZB 1YBTA 4GVLA 4L76A 4M4ZA 4ZVFA 1KFSA 3H8YA 4U96A 4DR6J 1FXDA 4A4HA 1KC8T 4VUBA 2HNZA 2HNZB 3SWNA 4ECSA 3SWNB 3N9UC 4NX9A 1OYDA 5CABA 2W4CA 4F4YA 5KFUA 1N34F 3WX8A 4C92A 4C8LA 4PR6A 3CPWP 4C92B 2HNDA 5HK0A 3O8WA 4O0IA 2HNDB 1UFFA 1S4FA 2X3XD 1TFYA 4FYWB 2OPPA 3QWXX 3UATA 2OPPB 4ELYC 3D0IE 2RH2A 2M4MA 3RW7A 3HFOA 2DBMA 4A63B 1R8HA 2K4YA 2QEXT 3KHRA 3ZC4A 5RUBA 4CT9A 2DY1A 4LF4J 1XQHA 1ZBJA 3Q8RB 4DQ2A 5KG0A 4DSFA 2DNZA 4RBVA 4O3NA 1QVGR 1X01A 2XMTA 3IM9A 4M75E 1RAEB 2EFNA 5CIUA 2BBEA 2LRQA 2CQIA 4ZCLA 4Q5VA 2Z8QA 1UDLA 2XLKA 5KFBA 1RABB 1S5ZA 3M9NB 2CPJA 5KE3A 5LJ3Y 5BYSA 4EBEA 1NZAA 4MMKA 3VR1A 2E7XA 1C2PA 3MAAA 1K1SA 1KHWA 3MAAB 1YITA 3J7YU 4CC2A 1OQ3A 2K5LA 5KFKA 5HL7Q 5FW9A 3OFEA 3SIPB 4Z7YA 1YJ9T 1N56A 1HHSA 2F63A 1VQOT 3NHNA 3KLIA 3B4DA 2XI9A 3KLIB 2EQIA 3NNAA 4HCZA 2I9SA 3MPDA 4NA3A 3WVEB 3DLGA 1SBRA 5CZVA 3DLGB 3CCES 4JI8J 2XC9A 4MTPA 4LBPA 1OU9A 1AROP 3T6BA 4EBCA 4DMZA 3MUMP 3CSKA 2JJ4D 4RO0A 3CCSS 2EGEA 3ITHA 1YI2Q 2CWXA 3ITHB 2P4TA 3N28A 4DX5A 1M27C 2B86A 4O0NA 2L9DA 1IQTA 2DGQA 1VRUA 2HQDA 4TU9A 2FDNA 2L9WA 3GFZA 1VRUB 4LR7A 4F50A 1YX2A 2J7UA 3F56A 1ZTWA 2JEJA 1R8PA 2ZVSA 1NJXA 4IUVA 2C2NA 3UN5A 1T9XA 1VQ7S 4AXJA 3EFSA 3QHSA 3OL7A 3CMEQ 2ZH9A 1SVDA 3C2PA 4PL6A 1F6TA 2P8IA 1Z9ZA 1GTHA 1T0HA 2VKNA 3EAEA 2XZTB 3GIKA 5LJ5j 3UR0A 2XICA 3VQSA 1GMVA 1X9SA 1RAAB 4NA2A 3PW0A 2J9EA 2R8IA 2DRAA 1U1NA 4DZ6A 3OFGA 2CVIA 3KXDA 1EKRA 4C0ZA 5DQGA 3K8WA 3BW1A 3MEAA 3JB9H 4ECYA 5CO7A 4Z7CA 4AQYF 4LFBF 1N54B 4JI2J 3HHKA 1Q81R 4M5IA 1LFWA 2GGPA 1UL3A 2GGPB 3Q8YA 2ALZA 2CIMA 4C5HA 2ECZA 2RHSB 3RNJA 1N36F 1JQQA 4GLKA 4LFAJ 4N8NA 1RI9A 3OLAA 4J9KA 3KG0A 2FJDB 4Y2CA 2KEAA 4X4SA 3KNGA 3TZYA 1V6HA 2AK5A 2HQXA 1HI1A 4II1A 4E8UA 3JCMV 3A1YG 4MDXA 3M30A 5KYNA 4HDGA 3BKUA 3M30B 3RESA 2JFDA 1XC9A 5HMZA 2OAUA 2GV1A 2VVKA 2MYFA 4USVA 4P5NA 3RBZA 2HBPA 2OI2A 5FD1A 3KUGA 3QYHB 3JV3A 4ZPWR 1VQNS 1HWJA 3TA1A 5B09A 4CC7A 2GZOA 1Y07A 4ZVTB 2MJNA 3JS9A 3DLHA 4ANDA 5HVHA 1N5QA 1PC4A 5FLXU 2LQJA 1UVLA 1W2IA 1RUWA 2WONA 2WONB 1HYOA 1HWKA 2LLZA 3C4SA 3GIRA 1JLFA 1NK7A 1JLFB 4J37A 1WF0A 2GNCA 2RS8A 2BE9B 1D0XA 1NPPA 1GRIA 4X64J 2B51A 2HYIB 3NL0A 4K0KJ 4KO0A 2L41A 1K44A 4KO0B 5KYUA 1GNKA 3WXMB 5KYUB 3ONQA 1VI7A 4NCGA 1Q82C 3CMAS 2MEWA 4NCGB 2O3DA 2DJZA 1PKUA 3CCLS 4B9UA 4HACA 2YLCA 4HACB 2YKQA 5EN1A 1OX9A 1YSJA 2EGAA 4KT0C 3I35A 1S72Q 3EGUA 1X4BA 1XMBA 2H65B 2OEMA 1VYTA 2DGVA 3MCOA 5AXNA 2K7JA 4U67Q 3C12A 4LRFA 3OXGA 2VKZG 4WPAA 3RGIA 3TVTA 1KR4A 1X6OA 1MSWD 1VQPT 4NCBA 1LW2A 3DLLQ 2DNMA 1K4US 3HO1A 2B56A 5F8NA 1LW2B 1D1UA 3FJ2A 2LQWA 2ASJA 2D69A 3CCMT 1DTTA 3A3PB 5I22A 1DTTB 4ZK7M 3TSWA 3TJ9A 1R3NA 2XD0A 1YCSB 1T95A 2KH9A 3MP8A 4I2PA 1FNMA 4I2PB 4RPFA 2HS3A 2PC6A 3OHAA 1O5JA 3EE3A 3GZ7A 1WC5A 1OU8A 2DHSA 1AW0A 2CNKB 5IWAJ 1VHFA 1GMWA 3OUYA 1H3DA 1ZA2B 5DLOA 2EC2A 3ZNUA 2W01A 2E41A 1D1BA 3OYMA 1VQMA 5KFQA 4DLEA 3VGVA 4LDYA 1VQKQ 4G3IA 2WCXA 4C8MA 3HVAA 2F2VA 2EYZA 2DGXA 1YJNA 4IG0A 1ZS6A 1FF2A 4IG0B 2GA7A 4ERDA 2HHSA 1SPKA 2QTVA 1HL6A 5D78A 4WU2A 5L9XA 5LOQA 2CT3A 2YNIB 1BB9A 2XLIA 4J9EA 4DBRA 1X7VA 3J7Z5 2A3JA 2V94A 3CC2Q 6AT1B 3WHIA 2R42A 3I55S 4AXIA 4PABA 2DMOA 1T9UA 4JI5J 4FKYA 1UA1A 4F2RA 2K79A 4OB1B 3FC3A 4C8OA 1K0SA 1P8GA 4UOGA 4QOTA 1N5ZA 3NGDA 3V2UC 5J2PA 5J2PB 1B7FA 2MTLA 1D8YA 1FDDA 1RWKB 1QUVA 4JRIA 5BYRA 3T9ZA 3PGGA 4OX8A 5L38A 1V29B 2GJ2A 5IHKA 5LJ5Y 3MEVA 1Q8IA 2LT4A 2R2RA 1KSPA 2EVRA 3UDLA 2DKGA 3PE0A 3OY9A 3H8ZA 1IBCB 3CC4A 1MNEA 1YVFA 1K9MC 1RTHA 4UZBA 4LBHA 4M77D 1RTHB 2C3PA 5A2QU 2KYZA 4ZIVA 2E10A 4RTUA 2Z2YB 3KHHA 4DV2J 3IA0A 1A9NB 3KK1A 4I0WA 2ZPFB 3KK1B 4KRTA 1YWXA 2EKNA 5EC7A 3RR8A 1B07A 3LGNA 4RX6A 2HFSA 1Q86R 5SZTA 1FVQA 1RTZA 4CP5A 4DU7A 3FQKA 4ZDNA 4YB5A 1H641 1WHMA 2W9BA 2C1EB 1NZ8A 2IM2A 2W9BB 3I56S 2GMJA 5DGAA 3EHRA 3EXCX 4F67A 3LP0A 3PJ9A 3HRSA 1OS5A 2OJ3A 4M7AG 3LP0B 1YHQQ 2MHEA 4ELVA 3PRDA 1CKBA 4YR0A 4QWBA 2OJ2A 2RI2A 2ZKTA 4ORZA 3L9ZA 1KD1U 5F3ZA 2W2QP 2UXDF 3VRYA 4ZVPB 2VFTA 4MKYA 1NLKL 4EYIB 1LFPA 1WI8A 1RACB 4X9DA 4RBTA 1U24A 1HNXF 2XQCA 3X20B 4M7AC 2RI5A 4EGLA 1TUWA 1S79A 1N8RC 3K17A 3QYGB 3EGVA 3MMBA 1RK8A 3GB0A 2ZC4A 3DOMB 4IRCA 4YTLA 4KHPF 5GAOq 4CWBA 4CI0C 3HFVA 3NLCA 2PVDB 2XIDA 1D8ZA 2NXNA 2C42A 3QPHA 4X4TA 2W9CA 4L74A 2VC1A 2W9CB 1LWXA 5FIIA 2DETA 3UR3C 2CKWA 3EPIA 2EFQA 1RU2A 1RUSA 4C0GA 4P10A 1B64A 3EGXA 1L3KA 4EUVA 2R7OA 1PJ5A 2HVIA 2DPIA 1KD1C 3TANA 2XWXA 4ME7A 2NUPA 3MR7A 3AY0A 2AP6A 2NUPB 4IYQA 4F2SA 4OZ5A 2ZJRQ 2JFKA 1FMVA 1RHRB 2FVUA 2YKPA 3PVXA 2LECA 2MPUA 2V8KA 4W4MA 2E5KA 3F73A 3Q2TC 5L1JA 3S3OA 1YTYA 4DR2F 2JN0A 2MQMA 1PSDA 4JB8B 4U7UD 3TYTA 5KG6A 3NBPA 3KDNA 3NBPB 3JSRA 4X4UA 4LSLA 2ZWPA 4LSLB 5C2CA 4LUDA 3H2UB 3VJPA 2FRWA 3G8QA 3IGNA 3ILOA 4NLWA 3W7BA 1Q53A 2MQPA 3DRRA 3B6BA 3OSVA 1CULA 4DN0A 2XMAA 1CULB 3L4BC 4C0FA 5H9FK 2MK5A 1YP5A 3CJ3A 4A54A 3NNHA 1F5CA 4N5SA 1H2UX 4CLPA 2E5JA 5JMNA 3MFIA 3BDEA 5HROA 2FLOA 5BYQA 1WD6A 4PJOC 5ADZA 1SI9A 3G71A 3UNYA 2XY6A 2OTLQ 3VAHA 3LAKA 2DB1A 1H8KA 5CHCB 3EWGA 2ED1A 2RN8A 3LGMA 4U7CA 2FPHX 2PNIA 5FU6C 3SD4A 4AL5A 2ZJPQ 5IM0A 5IM0B 3BH6B 4KT0E 4BE2A 4OI6A 5KFCA 1ZM4A 1HMVA 1RAOA 2LP4A 1RHQB 5THWA 3GIJA 2N82B 1JXLA 3QBYA 1C1AA 3FBEA 4YS2A 2QT7A 4E7JA 2D9OA 4Q0BA 4QIFA 2GX8A 4NL5A 4Q0BB 1QJHA 4EMKA 2OPRB 3RB4A 5LMNF 2RB6A 3CPWR 2F40A 4HR2A 4CLUA 3T5HA 2R7RA 4IR9A 1Z1ZA 2RF2A 1OZ3A 1VOMA 2DKOB 2EG2A 3P3DA 4IUTA 2RF2B 4FNIA 1F9HA 1PKSA 2H5JB 2L5QA 1EIYB 2AJFE 5KYXA 4FS1A 3G71T 5KYXB 3WIVA 3H5YA 3SFUA 3BDUA 4BHQA 2DR5A 1OYXA 4PYDA 1GBRA 1GFDA 2CZ1B 1V1CA 3FSYA 4BACA 3FRZA 2HVZA 3HHLA 2JJ9A 1HR0J 1HA1A 4MZTA 2IDEA 3T5JA 2UZAA 3NP5A 5IT0A 1MN7A 4QBUA 4F7UA 2K3KA 4F7UB 2D8HA 3BR8A 4HI2A 2ZZMA 2MKSA 1FDAA 1LWFA 3N01A 1LWFB 5FRNA 2ZH7A 4O4GA 2Q1LA 3CDUA 4O4GB 3GCWP 4FN5A 1VMBA 3GF5A 1Q95G 4N76A 4NI2A 1V76A 2YX7A 4EWTA 2POKA 4NI2B 3MMAA 3CQTA 2XWYA 3MMAB 4F14A 3CD0A 3WZ0A 1KDNA 1QAYA 2AX0A 2F4VF 2FVCA 1YJ9Q 3S6WA 1PRMC 4QR2A 1X2QA 1VQOQ 5HATA 2X1BA 4QYRA 1ZQ1A 2I38A 3KLHA 3KLHB 5GAMf 4JPBW 2QA4A 2BZYA 2DNUA 5IQQA 3BDPA 2XS7A 1U8SA 2Z57B 3FC9A 5E3AA 3G8TA 1M2VA 5KH6A 1M2VB 3L42A 2NXUA 4WFAQ 3QRPA 1IR1A 2EQUA 4KHRA 2V26A 2O9SA 2A18A 1WDTA 5K9FA 1EKSA 4A8SA 1G2EA 1GXUA 4RTTA 4ZMMA 1VQLA 4X84A 1S0OA 2E9ZA 1OQKA 1U1QA 4F4ZA 2E5LJ 2VG6A 1JMTA 1AVZC 2UUCF 2V2ZA 2VG6B 1VQ7T 5DZ7A 2M0YA 2X1FA 3DN9A 2H51B 1TXQA 4Y91A 4UQTA 2U2FA 1MWQA 3D67A 5FRMA 2JTEA 1WIEA 4N56A 3HSBA 3LH5A 2VL1A 1M5KC 1FO1A 2FZCB 4RW8A 4ZIWA 4C8QG 4RW8B 3L95X 1LOJA 2QA4T 3G6ES 2P4RA 3LWLA 2V9KA 4E7KA 2V1QA 4PWWA 1LXNA 2QA1A 1PJ7A 4ES3A 4QYZJ 2KHDA 5GAHU 2JLGA 4EZ9A 4B9XA 3GP8A 1JJ2A 4XQ3A 4DV6F 1X5TA 1XOVA 4M77A 1NK8A 3LAMA 4M77B 2ZKUA 2QASA 4CDIA 4IOAQ 1CSJA 4JUVA 1E6GA 2KI2A 4FT2A 1UA0A 4M7AE 2YPYA 5CK9A 4U6PA 3NTHA 4M78D 2CQCA 1FA0A 5A2QE 4I6WA 1RAIB 1SJ3P 3GYNA 3CULA 1VS3A 2EFOA 2QRRA 5J26A 3OFHA 1CVJA 3RU0A 3T1HF 2MQ8A 1S0MA 2YUOA 1FKAF 3X1LB 4FW1A 3HHTB 2RRNA 1WG1A 2MPXC 2VXFA 4M5MA 5F9LA 1UTAA 1VQYA 3M57A 4Y65A 7AT1B 4DJBA 1EQ0A 3CBOA 3N6MA 2HHTA 2WVBA 5D0EA 1TKZB 4NL3A 4ZP7A 2PO4A 1N27A 3BSCA 2KB2A 4DV1J 5ETLA 1PWTA 1JJ4A 2QV6A 1VQ5A 3ZNJ1 2SEMA 3TSZA 4K2XA 1VQ9A 4KHMA 4DX6A 2MYSA 3GU0A 3JCMd 3PRVA 2EPDA 4QQBA 3PG9A 1ZAWA 3TVKA 4YR3A 2JRSA 2DH7A 2VHGA 4O5VA 2HBYB 5KE2A 1GMUA 4C0HA 3CO0P 5ETQA 4IUFA 3WDOA 2F2WA 1OPZA 1HJDA 4ELZC 4PLLA 1NCLA 2E9RX 2ABLA 5DQHA 2VQEF 1A7GE 1AT1B 2YWWA 2HPUA 2V69A 5D4LA 2R9LA 4OJGA 5FLXY 2J0QD 3OR2A 1VC6A 1M5HA 1DQ8A 3OR2B 3RUXA 2EK6A 2MKHA 4LIWA 3CT9A 1IXDA 1S4EA 2CH4W 5E3PA 4WFBQ 2ADCA 1JJ2P 3QAUA 5GAOr 5GAMg 4ZN1A 2PN6A 1HNVA 5IS2A 2V5HG 1HNVB 4YUDA 5I2SA 2XMJA 2DEQA 1UECA 4QWEA 3SDZA 1VA7A 2BRLA 5GMKm 3KJNB 2FJVA 2RT3A 3SXLA 1E6HA 1U3OA 3MMJA 1TSFA 1VQ5T 3SCJE 3H4BA 2LDMA 2B7BB 2QDLA 1QKXA 4ED6A 4C8YA 2ZDPA 5K20B 4G1IA 3I96A 4DF8A 1VIOA 2DFUA 1K73T 1O51A 4PJOE 2ZM6F 4LDXA 3TNVA 4OMOA 1LK7A 3MPWA 2D1XA 3MHXA 4D3HA 1VQPQ 5HVGA 4ED0A 2C28A 2VPYB 4JI1J 3GP9A 5B7WA 3KUFA 3ZO7A 3CCMQ 2H9ZA 5E41A 3ZL7C 4XU3A 3DDKA 1QWFA 2PA8D 5HMWA 3M8SA 1UJ4A 2GCFA 3D6FB 3KWMA 2NZ4A 2HMAA 1SJFA 2LQ8A 3JCMe 5L1KA 1JXOA 5B0EA 4LFCF 3O5TB 2HHWA 3C6TA 1PKTA 1AWOA 3C6TB 5KFMA 4K7QA 5HP1A 5HP1B 3DLBA 1QVGS 4NZ0A 3EZ5A 4YY3J 1KQ1A 3QJLA 3FDRA 3FJ5A 3ZZYA 3OMGA 3V8JA 1NJZA 3M0SA 2DHAA 5KFIA 1BQNA 4Q8EA 3CPFA 4CO4A 5LMUJ 1BQNB 2GVZA 2IVMA 3K5NA 2GVZB 3DOKA 2BW7A 4FYVB 3DOKB 4DQRA 4RWWA 3BPSP 3GG0A 3L2UA 4K59A 3Q8PB 2IBOA 4QT7A 5GMKj 4C98A 3PW4A 1CQMA 1HQUA 3Q8UA 2LJ0A 1HQUB 2CP7A 3AHUA 3TA0A 3NMRA 2EFVA 2HBRB 2EQMA 4PPDA 3BBFA 1SXLA 5A0YA 5FROA 5A0YB 5IAYA 5KOXA 4OHWA 5BXIA 2VBZA 1ZPWX 2K5FA 4IUPA 4XDDA 1SQFA 2DR8A 3BN7A 2EJ9A 3MTJA 1D0YA 4ZGEB 2HAFA 2K7KA 4CTAB 4D8DA 4NXMF 3QFWA 1I3OB 4KR0B 4RW7A 3PKYA 3H4DA 4RW7B 4RG8A 4PFPA 1VQ6A 4TU7A 4P73A 1NE8A 1PAUB 3R1LA 2DNKA 1VQ4Q 1VHIA 1N32J 5IH2A 2YLBA 2YH1A 2AF6A 3TCJA 4ZCIA 1ZA1B 2C2ZB 1JLEA 2UUWA 1ELOA 1JLEB 2GGRA 3HP9A 3ENAA 4ZVGA 5A2QY 3H5UA 3M59A 3I56T 1IHWA 3O44A 5DETA 3MURP 1HD1A 4NOHA 3V5RA 4ECQA 3CO9A 4I56A 2DTIA 2X1GA 2GQ2A 4Z8AA 3TW0A 2FG0A 4LF9F 2R7QA 1TUVA 1X8DA 2KDOA 4OHYA 1YK9A 1FRLA 3D3BJ 3M8YA 4BI4A 3PEHA 1IB8A 2V8PA 1QLYA 1XK8A 1F5BA 4WE1A 4B9TA 2OEKA 4ZJOA 3EM1A 1NK5A 4DR1J 1Y3KA 2K2PA 2M88A 1KFDA 2QZ8A 2ALYB 4ELUA 4N7TA 4ZHRA 4J9NA 1RTJA 1KHCA 3VV0A 4ZHRB 1FKOB 3E2UA 2DXFA 5KCOA 3A5ZB 4NLUA 3GE9A 4DUYJ 1YRXA 3ETOA 1XMOJ 2DTHA 1P1LA 3QQCD 2JZ5A 3B8HA 1BI2A 1L5UA 2YQ3A 3DKMA 1T0TV 1CJUA 5IHNA 1CJUB 2OHDA 1TTHB 1HBUA 2UVVA 1HBUB 3T6JA 2CQHA 3UCGA 5C25A 4IH5A 5C25B 4OZ0A 4OJHA 4JI6J 2DNOA 3L2VA 5ITHA 1WTFA 1Y9OA 4A48A 3R7SB 3G4SA 3VYGA 2ZBIA 3KHGA 2W7AA 3HFKA 3LOUA 5CCAA 2AV5A 2LTOA 4DS5A 4B3TF 1EP4B 5GADU 5B0CA 8ATCB 2ZZNA 1OY8A 3KG1A 2K1RA 2GJFA 5D77A 3FZ2A 1NM2A 4ZCMA 1CQNA 5CQGA 3ICLA 4M78A 4M78B 3CF5Q 1R89A 1BCOA 3HVTA 4URQU 2R2TA 2CQ3A 3HVTB 1ZSZA 4A4KA 4O23A 4PWUA 3UI3A 3CDWA 3WC0A 1M90R 1B3TA 1YG0A 1KC8U 2P9GA 2VD3A 1X6GA 4DX8H 2QLJB 1M5VC 1H74A 5CKDA 1XNRJ 1RT4A 4EBDA 4U7UK 4KJIA 3VAFA 4N4HA 1RT4B 3NY0A 4RUCA 3W3SA 3G4ST 1SV5A 1Q4RA 1SV5B 2XYHB 1GXTA 2D6FA 1M1KR 3PZPA 2N4DA 5LJ3g 4NLTA 2DA9A 3CW2C 5IV3A 3H41A 2YXYA 1NPKA 3ZZ0A 2MZQA 2YQ0A 4WK1A 4JS5A 3OJUA 3CEYA 1HPZB 1XNQJ 4M5GA 1K1QA 4OMFG 1BCMA 3EX7B 1WXUA 2CPDA 3SZ2A 1L3SA 4F0KA 3C8YA 1XMQF 3OW2A 1IM4A 2QGFB 1SPBP 1SRLA 2R7WA 2Q3PA 2QL7B 1TU0B 2YT6A 4KUIA 1KC8C 2E9TA 1RBAA 4BC7A 2X4WA 4LVNP 4KULA 1RADB 1VRTA 2QYCA 5FU7C 2HZCA 4D8KA 1IKWB 5KFSA 1HD3A 2RF0A 2CQDA 2RKIA 5KFOA 2RKIB 4ID8A 1FT8A 3D9BA 3IN5A 3VTIA 2XG8D 4EIKA 4KH0B 1QDUB 3IM8A 3G71Q 3AJ2A 2OFGX 2J76E 2CJBA 1BI0A 4V19J 2LVMA 1RAHB 2HK3A 1DQAA 1OPLA 3CCQS 1TKDA 4LMZA 1I0CA 1Y4ZB 4C92G 3V6DA 2X3DA 2LKZA 5T7LB 3V6DB 1RJJA 2PZ1A 3WBZA 2VQFF 2DT9A 3E3XA 2A0FB 4ZP9A 3DGPA 3H25A 3DGPB 1S77D 3VCDA 2MDAA 2HVHA 4QIGA 4KV8A 1AFIA 3OQ2A 3SMZA 4KV8B 4HEA9 2FO0A 2CPYA 4B08A 1NJIT 4E7LA 1WZOA 4ETZA 1C0UA 1Y5LB 1C0UB 2E1PA 3FRNA 4C92C 1C1CA 1VFJA 2KDSA 2E1MC 5B0GA 1C1CB 1ROFA 4OGCA 1Q7YR 2EFGA 4LQ9A 3QG1A 3O3LA 2VPZB 4ZLPA 4X4OA 1JLGA 2F65A 3NCQA 2IDLA 2AZVA 2EAYA 4XO0A 1M5OC 4EFAC 4AFSC 2F9DA 1JB0C 3J7YI 2O5DA 3BR9A 3JCMW 3CCSQ 2RAQA 3VS0A 2HQFA 4HA8A 4DUTA 3OW2P 1IJEB 2YNHA 4P2XA 2YNHB 1HNIA 4EO6A 1HNIB 2OTJA 4EPCA 4K4VA 4J91A 3H42A 3TZWA 2CDRB 2QTWA 5A8RA 2UXCJ 4C8KA 5A8RB 4N0AA 3BGUA 2BJEA 1VQ7Q 3G82A 5KT7A 3OV7A 3G82B 3V81A 3FSXA 1SJ4P 4B3MJ 1UPMB 3V81B 4DR5J 1KOHA 4X66J 4J9OA 4M8LA 2Y8WA 5LJ5f 3T5LA 4KTQA 2EYXA 4QVCA 4X4NA 2CJXB 1RT7A 2MGZA 2D9PA 1RT7B 3PW5A 2MGZB 1U7LA 2KQWA 2P0PA 5ETRA 4AG1C 2GNKA 1G83A 1IBLF 1NG2A 8RUCA 1FJEB 2EYQA 3X26B 2QA4Q 4OMLA 2J7WA 1M1GA 3NGKA 2Y1IA 5GAN8 3UCUP 3BKTA 1UG1A 2CZVC 3ELHA 3LANA 5EX3A 3EZOA 4C8QF 4USIA 2YWGA 2ZVIA 3UD5A 1YHQS 4GC6A 4P7TA 4O3RA 4KPYA 3OVSA 4W98A 3VAKA 2MQNA 2NYSA 3W5YA 2A37A 1HSQA 3DI6B 2MZ1A 1WHHA 2H5EA 1HKAA 2M0GB 3RRGA 2PA3A 2JS2A 4Z89A 1LNQA 1LW0B 5HLFA 2JC1A 4JV2A 4JRPA 4USHA 1VUBA 4OMNA 1TFWA 3CDAA 5GAMe 1FTRA 4OHZA 2KXCA 1M3AA 1D1CA 5IT9E 3IMQJ 3CCJS 5GAOm 3F70A 3BJYA 4WFYA 2YRDA 1WGSA 3M9MB 1BWEA 2WVEA 4C5IA 3HKWA 3U23A 2D3OR 2B9YA 2W1BA 1RISA 2CUDA 2FPDA 3CD6A 4KY3A 1BD6A 1GX6A 2VJUA 2R7VA 5K8OA 2CQ2A 1GCQA 3S1TA 2H4WB 3VS7A 1VQNQ 1DHMA 2YNGA 3LP2A 3HI9A 2ROEA 3LP2B 5GAMh 4CLZA 4K4WA 3OVAA 3THKA 5EDWA 2HQCA 1WF1A 2Q6BA 2XCPA 3HCXA 3TQ7P 3A8HB 2DCLA 3EICA 1FE0A 2HHXA 3QGHA 2BW2A 2BTTA 1NK9A 2MKIA 3T5KA 4M75A 4GRSA 5F8LA 5T14A 4M75B 4I4BA 4J9PA 2PU9B 1SC6A 3NGUA 4OFZA 3P96A 2CUBA 3CJ4A 3L7PA 4DCPB 3MOJB 3P8HA 1RTIA 4F3OA 1RTIB 4IKAA 2HAIA 1T9WA 3IXQA 2MZRA 1VDHA 3JB9G 4M7DC 5DQIA 2M0OA 3LP1B 1WACA 4BWMA 3F44A 1U1TA 3RRKA 1RI0A 2V2QA 3KK2A 4LREA 2FY1A 3KK2B 2PMWA 1JJ2R 2VV5A 3M8PA 1C0TA 4NEZA 1TV6A 3M8PB 3QXEB 1C0TB 1UPPA 1CLFA 4JUZA 2QGGA 3IR6B 2DGTA 5I3PA 3DDNA 1Q8KA 3PEJA 3CD6T 2DERA 3R5AA 4NXNJ 2BMBA 4DV7F 2HQHA 1N0VC 3BF4A 1VQ5Q 5GAGU 1S1NA 3BBBA 4HI1A 2O2OA 2KG0A 2UUBJ 2CSQA 2JLEA 1DRZA 2KFYA 1F9EB 5DLFA 4DPOA 1D9AA 1F0XA 3GYXB 4RKUC 2Y4YA 4RLEA 2XZDB 3JQKA 4Y0FA 3P49B 4DG1A 1MWYA 4DG1B 4WK3A 3OYCA 4NLXA 2OTLS 4DV0F 2IRXA 2MWPA 1RLDA 2L3RA 2HEKA 4ES2A 3N5FA 3CCUA 4I69A 3LALA 1NSQA 1IBKJ 2MZTA 1QCFA 4DXLA 2KU7A 2FZKB 1B7TA 4PK4A 1RTDA 3M2UA 1RTDB 3M2UB 2KJWA 1CJTA 4EMDA 1GX5A 4M1KA 1CJTB 3AFGA 4QR1A 4Y2IA 4DL7A 5CAIA 2FPFA 3GPLA 2B8AA 1SF9A 4DR6F 3D0GE 1EHWA 3C6UA 2J0XA 1G5VA 2DK3A 3C6UB 4RW4A 1BK2A 4Y2AA 3VAJA 2ACMA 4RW4B 4LFCJ 4X4PA 3IWNC 1UGPB 1UGVA 1QAJA 2IA6A 1U1KA 2BM0A 4JV0A 5C7PA 4B9VA 6FD1A 3UDVA 4Y2KA 3HD1A 5HQMA 1X69A 1A6LA 2O1PA 2H5IB 2XS2A 4DL2A 4JV5J 3M8WA 2KFZA 1BE4A 1TL1A 5CD4H 2HIQA 3SDEA 3I55Q 1TL1B 3SDEB 1NK0A 4OV6A 4LF4F 2QEXS 3PFOA 3AHPA 4DN9A 3EH1A 3CCUT 1RAFB 2Y8YA 4DI6A 2DX1A 2RQRA 1PAEX 2KHCA 1K8AT 1U06A 2DXBA 2PI4A 2APOA 3GIMA 2DNHA 3M4XA 4MIWA 4P7VA 2DCUB 5G4DA 3TJ8A 2DISA 3ZEHA 4J9MA 2GHWA 5K8PA 1T9TA 1WG4A 2BQRA 3EVMA 1IM6A 4BC9A 4BY6C 1I07A 4OV1A 3U27A 3RZAA 1N5YA 2IJNA 4RW6A 1KONA 3MPVA 1N5YB 4J5OA 4RW6B 1NPRA 1V5VA 3R97A 1GL5A 3VZHA 4L75A 2QL5B 4NLOA 5KFTA 4WFXA 1D09B 1I1JA 5L9NA 4ED2A 2NCKL 1PYTA 1JB0E 4LXCA 3IBFB 4O6JA 4C0DB 3AT1B 4JI8F 2IVWA 5HMXA 4FL6A 1RWWB 3BQ2A 3S6EA 1SC3B 1DLOA 2DGWA 3B78A 1DLOB 2V8GA 3PM9A 2J5AA 3N5BA 2WSCC 2AGPA 4UTGA 2X7IA 3N5BB 4ECVA 5J39A 1L3VA 3I56Q 2GIFA 2QA2A 1X75C 1QD1A 4TY9A 2Z4PA 3W9HA 4A4EA 4OF1A 1MLAA 1XBWA 2B9WA 4FXDA 1TR0A 1GK8A 1KN6A 1NO8A 1MMDA 2PMZD 3GPAA 2EKYA 3Q2SC 5GAN5 3KHLA 1PYOB 2FHDA 2LX9A 1MMGA 2V4JB 3TJAA 3HT0A 5KYYA 2FHMA 1QQJA 4DV4J 3LLRA 5KYYB 4CRIA 1Q81T 3HPWA 3V4IA 3TEGA 3IC1A 2KMTA 3V4IB 4CNZA 4ZTFA 1WYXA 1WHJA 3T1YJ 2WHOA 1JK9B 4Y28C 5L39A 4DPUA 2DYBA 2VG5A 3NOCA 2VG5B 3BQ0A 3MOZA 4CLTA 2XY5A 3EFRA 1U1SA 4E7SA 4IQMA 2F1LA 4YB7A 1PNJA 2WK4A 3S8SA 5EGYA 1TMJA 3ISND 1RE1B 1IGQA 4GVBA 5H9EK 2ZPEB 5IFMA 2ZC3A 4GVBB 4DFKA 2QAZA 1H38A 1AA1B 1T02A 2XM3A 3VAGA 3BV8A 3M4GA 1N5SA 4JI2F 4YEAA 4JRKA 5LXRA 1Q8LA 4PXBA 2EYYA 1DFDA 5ETPA 3MUTP 3N6LA 4DUZJ 3AB4B 2HFZA 2V67A 4LFAF 3QGGA 3FZBA 3KOAA 2L08A 5LJ3e 3T9NA 2F7VA 2QLBB 4Q7AA 1D1AA 3OYEA 4WZQA 4LD6A 4C8NA 1EQMA 5HKCA 3MR3A 4G1PA 3QKJA 3QIIA 1TELA 5I21A 1JJCB 4QWCA 2DL3A 5A8KA 1VQ8A 5KFEA 4DWIA 5A8KB 3UW1A 3VAIA 1Y96A 2JOYA 2X9HA 4NLRA 1Y96B 1KFZA 4L72B 5LJ3h 4YHHJ 3QWUA 5IXUA 2MZJA 2KM8C 3KLEA 2DBKA 3KUEA 3KLEB 1URRA 4DPWA 4ZPCA 4XPCA 3SV3A 3W5XA 1NHKL 1FX4A 4FXVA 2QXFA 1H98A 4FP9A 4J9LA 3K89A 2FB0A 3MEKA 3CCRA 3M0PA 2CPZA 2KR3A 3D1OA 3M56A 1ZUKA 4OVAA 2DITA 4W92B 4M7DE 1K76A 1CJKA 4IUUA 3UF4A 1CJKB 1B70B 5LXYA 2XI3A 3GV5B 5FWCA 5F8IA 4MK8A 3VAMA 3TQEA 2WAQD 2QN6B 2ED0A 3KLGA 4F17A 3R6LB 1NB7A 1IVZA 3KLGB 4X64F 4MJKA 1X4AA 3M0TA 1ACMB 1OX8A 2P9EA 1R8BA 4ZLJA 2KE9A 2NSCA 1X4FA 3TEHB 1VQ8T 2M70A 2MSTA 2HQGA 3FMWA 4FZVA 4K4TA 1ARKA 2AJ0A 1P9YA 5DDPC 2OO4A 4ZTJA 1Q7YU 2ROGA 4Z37A 2E4HA 1KEKA 3I82A 2DGUA 3PT9A 1WXTA 1QW1A 3HVRA 4RKUE 3IAS9 4J5YA 3AODA 4PFZA 5DG7A 2C3OA 2UP1A 2EQJA 3CCRT 2VH7A 2COWA 1FK9A 4PPZA 3ZFJA 4KGMA 1FK9B 1ZUUA 2LX7A 1RSCA 1UE9A 3QBCA 3H98A 4B3SF 2X4JA 1SJQA 4NPOA 4RNMA 5CCLA 4HT5A 3HT3A 3IFEA 2DF6A 4E98A 1DBDA 1TUGB 1M30A 4K8RA 4K50A 2HWTA 4AYBD 3CCMS 2J6SA 3X24B 3GLXA 1Z2ZA 1SSHA 2G6FX 4F3QA 2HK2A 3VGSA 5IWAF 3VVUA 5DLGA 2YKOA 3ZTRA 3ZZOA 3EXYA 3TZXA 3MEDA 3M9QA 2VOOA 3BM7A 1VBXA 1PCAA 3DC2A 4O3PA 2N7CA 4JRQA 4E2FB 2DO4A 2GW8A 1UVMA 1FXRA 3TQ1A 3QFHA 2V50A 4ECUA 5DDQC 3R27A 4IH7A 2UVUA 3TAQA 1NDLA 3CC7A 4C92F 3NFCA 2MMPA 4R0JA 2CS7A 3DYAA 2XCAA 2COYA 3DYAB 3SSQA 4PQUA 2CZ4A 4PQUB 2GIQA 3OYDA 1FRIA 1U2RA 1AUDA 4K4UA 1X4DA 3ET6A 1ZOTA 1S59A 3UWTA 3ET6B 3CCVT 2EJGA 2AZ3A 4LBIA 1H7WA 2HLTA 3SB2A 4CO3A 2VFUA 5A0GA 5GANd 4F7UG 4AE5A 1U48A 1S9FA 4LJMA 3V6HA 2NYHA 1ZYQA 5KFWA 3B82A 1Q86T 2J06A 3OSPA 3OW2R 2VA3A 3DGVA 1UMJA 3J81U 4NE9C 5DO2A 3MR6A 2KN4A 4PJOD 3TVYA 4XU1A 3L2WA 3OYJA 1LVKA 2LA6A 1RT6A 1NJIR 5J2NA 2QL9B 5J2NB 1YJNS 2EXUA 1H6KX 2EW3A 3CC7T 2Q79A 2QA4G 4HL9A 1OJ4A 1NXIA 4CC4B 4R5PA 2H4YB 4R5PB 3MO8A 1YN8A 2JM8A 2WSCE 4DV2F 3LWIA 4C8ZA 1S97A 3L7OA 1GXLA 1T3SA 1B0VA 2B8QA 2A28A 3F0NA 4DU8A 3Q1JA 1PO6A 1HI8A 3QUIA 1FWLA 2R2UA 1RDRA 5LJ3j 3JYTA 3VALA 1FJGJ 3QYYA 3JYTB 4J6WA 3VS4A 3MFHA 1SHFA 3R9LA 1WELA 4ELTA 2XNQA 3W9IA 4OZ1A 3V7RA 2QE5A 2YTCA 2Z0GA 1RHKB 2HKEA 2YBVA 2YVSA 4Q8FA 2VASA 3JAMY 4LNPA 1TL5A 4PRFA 5J1EA 5J1EB 1F2HA 3MD3A 4Y28E 3DHWC 4LRCA 2Y9HA 1UZDA 2V63A 3BS9A 4DCOB 2FY8A 4LQ3A 1RWVB 5IXFA 4WTOB 3W66A 1KBRA 3C14A 3C14B 4PJJA 2K6DA 1WPYA 4QW2A 3D6HB 2CPEA 4U8VA 3CC4S 2HWHA 1UP1A 3VWSA 3CCJT 5GANe 1ZAVA 2YWHA 3SCLE 4M77G 1RA6A 1B3QA 4RTVA 1TAQA 1VBKA 3DRXA 3PO4A 2IC3A 3BREA 3JCMX 2B5JA 2FJWA 2B5JB 2VB6A 1U8WA 1SQEA 1D0EA 3E51A 2MQLA 2QO3A 2GCXA 1D9FA 2MMYA 4CM2A 2L0AA 3SSRA 2RD1A 4XDCA 3VZIA 3FLGA 1FRHA 4GKJF 4JS4A 3IWXA 5A6WA 3GLJA 2R5MA 4LUBA 3T1AA 2MLYA 4DBHA 1K73U 1NK6A 3MWBA 2NPIA 4B17A 5CA5A 2NUHA 2JC0A 3CXCA 2IM3A 2GQQA 2FHJD 2CJAA 1UAWA 2MKCA 4P2FA 2VIHA 2F1FA 1KG1A 2MKYA 3BGLA 2JW4A 2EBPA 4ZA1A 5H1SV 2E3IA 1F3FA 2M8DB 5D15A 4MH8A 4LRAA 4JI3J 3MF5A 1A0OB 4OYAA 3TRGA 4DOWA 1G6BA 3H0FA 2I1RA 3LYIA 1QAXA 3Q22A 4ZCKA 1PC0A 2RQCA 3TARA 3CD6Q 1ZZFA 3HJVA 2KJVA 4QW9A 4DR3J 1TWBA 2RJCA 3BYPA 5F9NA 2KBTA 1M8MA 2RJEA 1V3ZA 2MY7A 2RDIA 4ATNA 1QWEA 2X4XA 3UWNA 4IO1A 3V6JA 1P92A 1X9WA 4YDXA 4C3LA 3LO3A 4C0BA 1C6VX 1BI1A 1FDNA 2DHHA 3D2WA 1K73C 2JTFA 2ROTA 2CH4A 2CREA 4JI4J 1F60B 3DRPA 3DRPB 3Q8QB 1ZBTA 2G0CA 1EJ7L 2MKKA 1TL7A 1WDDA 1TL7B 3AA8A 1SKWA 3GILA 3CJTA 2RPNA 3NWGA 2D1CA 2H3JA 2FB7A 4C0OC 4DFPA 4ZPTR 4J9RA 4QWAA 4EDUA 4N4IA 3G6EA 3TUPA 2E6NA 2QK0A 1N88A 1UVJA 4X4RA 1UHFA 2K9GA 3OS5A 2AKKA 3LPYA 1UFKA 3Q83A 3W8GA 2PIIA 1GCPA 4QJVA 2CXEA 3OFFA 4MAKA 3CXCP 3EGDA 5E33A 4F7VA 3EGDB 3QO9A 3QZ9B 1XR7A 5K8MA 3QO9B 4CCHA 5D6XA 3KFWX 3IGVA 5FWBA 3HRTA 3CJSA 3MCNA 4RMOA 2AJ1A 1K9MT 2CP2A 3AOBA 1O8BA 3G6VA 3HK2A 3TR5A 3G71S 3N0VA 3PMIA 3NEKA 4M7AA 1IUJA 3EUNA 4DS4A 1WLPB 2HZYA 2CT4A 3K5PA 3CCUQ 2BABA 2DNGA 4U8YA 5KG4A 2ZFHA 1HR0F 2JVRA 3OXLA 2FL7A 2AZSA 1S1VA 2F9JA 3MCAB 4GO7X 3H59A 2XDDA 4OX6A 2RH3A 5AJ3J 1MHNA 4E6RA 1NH7A 1U6BA 1FD2A 2KRBA 2DR7A 1Y71A 4USWA 2ZEJA 2HHUA 4ED8A 3LWMA 3SEOA 3OYHA 4B9SA 2CAJA 3OD2A 3SQGA 2RDJA 3MP1A 3TUIC 3SQGB 3CJ8A 1NSKL 3FRYA 3TP2A 4H54A 3HP6A 1VIEA 1WFWA 2XKOC 2B9EA 1K8AR 3A12A 1S1TA 2QMWA 4A53A 1PBAA 1N8RT 2MQOA 2Z30B 4IOCQ 4X4QA 2HG4A 2QQAA 3BZQA 2R57A 4F4KA 5GANj 2RJFA 1PILA 1MU2A 4UF4A 1K1ZA 1MU2B 1SHGA 3PTWA 3Q89A 2HQIA 4V1Ak 5E5NA 3EYZA 2ZH4A 2VDIA 1YIJA 2E5LF 4DQSA 4P2SA 2HBQB 5BR8J 4J7CA 2DILA 4XAKA 2EIFA 3GTYX 3G8SA 2GIRA 1IRXA 1YITT 4ED1A 2IVFB 3J7AN 3V8KA 1Q1KA 3IAM9 3QSIA 3PO5A 1AFJA 1WI7A 1PBUA 4F16A 4YN3B 2ZUGA 5ETSA 2HQ3A 1OWXA 3SBMA 1PGZA 4LDUA 3FNNA 2X3WD 3TU4K 1KJWA 2HHVA 2BEFA 1NKBA 4PJOA 2HWIA 5D6YA 2RMOA 1K9AA 2RQTA 4PJOB 1M0SA 4ZP8A 2RJZA 5D0HA 2QA4S 4J83A 2ZH3A 4URGA 1J27A 3NS6A 4Z2XA 5M2RA 5FU6B 1KOOA 4LVOP 1HBMA 1HBMB 2O9VA 3RBBB 1PYSB 3J81j 4PXEA 2F8HA 4DV5J 2HFNA 5KFPA 1RZMA 1H73A 3VHQA 1RT5A 1YIJT 2OAWA 1RT5B 1YJWA 1REVA 2V8JA 1VQLS 1REVB 3AB2B 1NBEB 3QJYA 4UZCA 1UFWA 2J6FA 2RU9A 2G2ZA 3PRBA 5F0WA 5KFLA 2BANA 5HI7A 5I11A 2BANB 3OR1A 2DLPA 3OR1B 2W9AA 4C5EA 5JUMA 2FRYA 4OX9J 2CRLA 1U2FA 3IS9A 3IS9B 2Y1JA 3VVTA 2R7SA 4I6YA 1PHTA 4DV1F 5KFJA 1KLNA 5CKFA 2D3O1 5KG2A 4LN2A 5GAEU 5AE2A 4DEZA 3M6WA 5JVGQ 4J9QA 1SG5A 1JJ2S 4IO9Q 3TA2A 5LSRA 3K2YA 3JCMf 4A8YA 2KT8A 2KVQG 1R0CB 2CG8A 3W60A 2JX2A 2XB2D 5E7OB 4USKA 1SL1A 5CKHA 1RXOB 1YJWT 2HGMA 4C4WA 4AD6A 2PQWA 1RGVA 1VIXA 3Q8SB 5IHIA 4V2SA 3D5MA 3GBQA 3JCMQ 2J7IA 4D6WA 1N4LA 4M78G 1HK9A 3HJFA 3PIPQ 3W1YC 3JQMA 4CH0S 2CDQA 4KC5A 2HRTA 4ZPVR 2RMLA 1NAQA 2HQEA 2FTRA 2Y4XA 3L1AA 3PVQA 3C0CA 1RAGB 1TMMA 2KRNA 2QX0A 3ILLA 3LH0A 1CSKA 1ZETA 1WHLA 2HD0A 2ENMA 2YUQA 2OX7A 2JTMA 2FHJA 4X34A 1AXQA 3C16A 1VQ5S 1HW9A 3C16B 2QQBA 3FBBA 3RG6A 3US5A 1HLWA 2LCSA 4Y2MA 1V3SA 5E0OA 1DJ0A 3ENWA 1FRXA 1YI2A 1XEZA 2E44A 3HHLD 5LT5A 1WWHA 4OI3A 2AW0A 4QPXA 2NS1B 4B3SJ 2XMKA 1NJIU 1MMNA 2CNNB 4JI1F 4NMXA 3JB9k 3CB4A 1UVNA 5IC6B 2XTJP 3OYNA 1U2CA 4F04B 4HT9A 2W8KA 4OMQA 3KJFB 2O4XA 1TZ0A 2HS0A 2O4XB 2ZH1A 2IA0A 5DM7Q 3CMEA 3RAQA 2ZZDA 4C11A 2AHJB 1IKYA 2XGPA 4IQXA 3CCQQ 4C11B 1IKYB 3S3NA 2M02A 2C2MB 2DK2A 4ZVHA 1IWAA 1BY9A 3OUYB 2A2CA 2ZDOA 4F26A 2WSFC 3N4WA 3VKIA 1DAXA 4YY3F 1KQSA 4JBCA 3ZZTA 4G6VB 1YDLA 3NXZA 2GHVC 2FGCA 1BLUA 4O3OA 3M0RA 5JJBA 1WUUA 1SSFA 2PE8A 3HZEA 3NPFA 1PD0A 4AUKA 1FEHA 5LMUF 3BBCA 1OMSA 1HBNA 3QLHA 3TUJC 1LCKA 3ZZPA 1HBNB 3QLHB 4N41A 1APSA 5ETKA 5DM7R 4ZN3A 3C95A 5F8HA 2G3RA 2M51A 3L7UA 4DFMA 3CCVQ 2GJIA 1FTCA 1M1FA 2OPSA 4DQQA 3QMQA 2ZBQA 2OPSB 3RKYA 1S6OA 2D41A 5J2QA 3D7SB 3CJKA 1M4ZA 5J2QB 3CJKB 5C0MA 2IRUA 2OH2A 4DA4A 5KFRA 1M5PC 2VICA 1WEXA 3KNAA 2RRBA 4ZNXA 5HANA 1X60A 1HARA 3ILIA 1WJ9A 1NJYA 1LEOA 3TO8A 4F7UF 1VQMT 1JRIA 1EAYC 1RWOB 2U1AA 4J9IA 4FIBA 3JCMg 4TY8A 1FWZA 1KVKA 2VDHA 4TY8B 4WU3A 1YJVA 3U02A 2K3BA 1YJNT 1U1RA 2ZUAA 4DR4J 2W0ZA 5CYMA 2EYWA 5CYMB 3A98A 1WC3A 4DQPA 5LSOA 2WW4A 1AYEA 3J81Y 4CIOA 1N32F 4MT1A 2OMLA 2EVZA 4PG8A 3FBCA 2GFUA 4Q43A 1FX7A 2XYGB 3RYLA 4WKYA 2O88A 4Y00A 2HFVA 4Q45A 2LEAA 2IFXA 3CD7A 3QPIA 4B9WA 3GJQB 1KVIA 2HGNA 4F8RA 1OY6A 1KQSP 4PJNA 4I6AA 4RCBA 4QQ6A 2E5GA 1SB6A 1DARA 4USUA 4X2BA 1UVKA 2RO0A 3M8ZA 2OFHX 2G0IA 2NPFA 2K3YA 3E1SA 3K59A 2DIUA 1HNZJ 1KLMA 1QAIA 4DR1F 1KLMB 2FD2A 2OSRA 3CC4T 4CH1A 1S1UA 3OYGA 1RWNB 1S72A 4OYZA 3C94A 1S1UB 2XGQA 2E1CA 4DQIA 5A76A 3S7RA 2DGSA 1NH8A 2EK1A 1VQ6S 3RR7A 1FKPA 4TNOA 5K5MA 1FKPB 3M5AA 4HHJA 1T0JA 4DUYF 3DHXA 3CCJQ 3C19A 3MMBB 3NMZC 3DLLA 1GT8A 4IFYA 4IFYB 1XMOF 2AD9A 9ATCB 5L1IA 5D4NA 2L3MA 1NB2A 5DM6Q 2D7SA 1LQ9A 1NM7A 3HVWA 1X4HA 2K5IA 3NGSA 5GVQA 1AZSA 1AZSB 4M77F 5GAOl 4HTJA 4DR7J 5GAN6 3EHQA 3M2VA 2VXEA 4JI6F 3HSGA 3HKSA 3M2VB 4M5HA 2DHGA 3P5TL 2J0WA 4NYZA 4ZKAA 3L3CA 2M5YA 4GKJJ 2XMUA 2GAHC 4FKXA 3EGXB 1M90T 1IHVA 4WIQA 2DTOA 1WOSA 3JB9I 1J3TA 1HQ2A 1VQKA 4OYMA 2VC8A 1S72T 4IH6A 1TQLA 3OLBA 2XDPA 2J9DE 2P84A 4B9MA 1E6VA 4PKCC 1E6VB 4KGXB 3CGIA 1ZH5A 1UWAA 1M1KT 4TU8A 2RQVA 1IJFB 4WXOA 2HHHJ 2HVDA 1Q82R 4W90B 2GTJA 3ZZUA 4JZ3A 3BKFA 2MAMA 3AH6A 4TVAB 3CC2A 2CQ4A 4OI1A 2VPWB 1BHNA 3MUVP 4ER8A 2KYBA 2LJ3A 2MWOA 3R5JB 4Q5WA 1QVFA 4ZPBA 2FEIA 2NXEA 3CEDA 2LXUA 3DRRB 4I64A 4Y92A 3UPFA 4FXWA 1NU4A 2MJUA 1XNRF 2E5IA 1XN9A 2YDLA 3VGUA 2AEMA 4CO0A 1X0FA 4NYOA 4JJCA 3CCZA 2KVQE 2H3EB 3NOGA 3PYGA 1FERA 1OULA 4OP0A 1VQKT 3QIDA 3G4SS 5HROB 2RB7A 2IIHA 1KWMA 2L8DA 3BO2A 1EX8A 4C48A 2RU3A 1HYSA 1AB8A 3M32A 5CKEA 3M32B 2VU5A 2E1RA 5DG9A 2X1AA 2IRYA 4F36A 2XBPA 1T11A 4DOZA 3P6YC 3DXSX 4I7FA 3JTPA 3VF0B 2M7SA 4I7FB 2AYEA 3GYGA 3HX9A 3MM8A 3UQSA 1NSPA 3MM8B 1NUEA 1XNQF 3CC2T 1K8AU 1R43A 2IPOB 3W64A 3INZA 5EWEA 3W65A 2DIGA 3IRXA 1HMVB 5KG5A 3RB3A 1FCAA 2WTFA 3IRXB 4JYAJ 2PTKA 2AWZA 3CMQA 5FLXE 2QLFB 3D3CJ 1S10A 5KFDA 1I94J 3NAHA 5GAN2 2LQKA 2G4BA 1W25A 3E01A 3FEOA 3CXCR 3E01B 2FZGB 2HRUA 4DL3A 4EMKB 4USMA 4J8OA 2K06A 1XTZA 3JTNA 3PW7A 1QUPA 2C3MA 3RMSA 4RUHA 2OKQA 2G9OA 1KSWA 3M0QA 1VK3A 2QEXQ 2BJ9A 4DSEA 3OBYA 3OTBA 2WSFE 2M8HA 2RUSA 1Q7YT 3MPUB 3MGJA 4EO8A 2C2EA 2VZ9A 2NLUA 4LF7J 5LJ5d 2XO7A 3HHLB 1QVFP 4TKTA 2OELA 1RA7A 2DEUA 3LA0A 2QJ3A 3AXKA 5EUHA 3W2VA 4MYTA 1NHUA 4M7DD 3TOQA 1T7PA 3META 4QQGA 5IV4A 5EWGA 1NLPC 2HMIA 4X62J 3OW2S 3UPUA 2HMIB 3OPKA 5CH7B 3K5OA 1I4K1 1PC5A 4J6YA 4D3GA 1Q81U 1K9MR 1S7HA 3AJ1A 4WTYA 3BE3A 4ENOA 5MLCV 3RBXA 4DPXA 2BJDA 3R1HA 1U4BA 3FCVA 2JH3A 1I51B 3MCSA 2PUOB 1XNIA 3EGNA 4MZPA 3UE2A 4QYZK 1R6YA 1YGYA 3G9CA 3V4MA 1R6VA 2UUAJ 2HCKA 3RIRA 1UGSB 2QMUB 2RQWA 3DLMA 1RHMB 1QTMA 1TG0A 2BKPA 3VS1A 4M95A 2QFJA 2PEBA 2DNLA 4ILLA 5C2GA 1GXIE 2GQIA 3MMCA 3MMCB 1VYAA 1NJWA 1K0TA 3CNQP 4PG6A 4P71A 3PCOB 1NDPA 2AGOA 1NSAA 2C22A 2ZPGB 3W63A 2BUNA 3MXHP 4S0MA 5HO4A 4TLQA 2C3UA 1VIFA 4K4SA 5GMKe 2UXCF 4NRTA 4M5NA 2DL5A 5IQ6A 2AHOB 4B3MF 4DR5F 4X66F 2GC8A 3Q24A 2CQBA 3CCWA 4FM4B 1YITQ 5GMKa 4A8QA 5HBMA 3TI0A 5HBMB 3U7JA 4ECRA 1Q81C 2C2DA 1G7CB 1NKCA 1NYFA 1N8RR 1HNWF 3ULHA 2DO0A 3LPEA 4QPTA 4ZS6A 4DV3J 2BUDA 2EWNA 3IR7B 4HVUA 4ZVEA 4C7QA 4URSA 5GMKh 3QT6A 4MKAA 3HTRA 1OPIA 3PY8A 4NLDA 1L3UA 2FLPA 3D6MB 3SHWA 3OVBA 1FFSB 3ER0A 4LR9A 5KT5A 2C2OB 3FEYB 2GVDA 2XSJA 2DYAA 2GVDB 2XSJB 4JI0J 3VS3A 1H72C 4PQAA 4BCAA 1XWLA 4C8QC 2A2DA 2MI6A 1VQLT 4Z88A 1X4CA 1M9SA 1TK5A 2YNFA 1UEBA 2YNFB 3IQLA 4NEYA 1KD1R 2WVDA 2CQ0A 2LQ5A 4CO5A 2DJQA 5CVIA 2NZCA 1YRTA 1W2BA 1XIQA 3UNGC 3H40A 1ZPVA 3KUHA 5FU7B 1CJVA 1ITPA 4L73A 1S6PA 4DHVA 2KI7A 1S6PB 4EMGA 2CQ1A 4RR5A 4OMFB 2V6AA 4ICLA 1N9SA 2VFRA 4ICLB 4GC7A 1R0BG 1IN0A 3AD7C 5U47A 3TAPA 3OYIA 1OSDA 2FJAB 4CM0A 2CPXA 4C2MA 4F02A 3KXTA 3BO3A 3OYLA 3A8LB 2LQBA 4Y6IA 2CP3A 3JRZA 3MEWA 1B4SA 1SC1B 2DH8A 4XK8C 5J1NA 2CADA 1NDCA 3H20A 4YR2A 2DD4A 5E3CA 2V68A 2BVZA 4ZPDA 1R0AA 3RKXA 2GO9A 1R0AB 4HCKA 3MZIA 3RBEA 2E7WA 1FXXA 4PG4A 2J6UA 3VUZA 3VYHB 3KDOA 4CYUA 4CYUB 1HBOA 3I5SA 1J5EJ 1HBOB 4DPYA 1KK7A 2HS4A 2B9XA 5CKBA 4C5GA 2LVWA 5E3QA 2BE2A 2BE2B 2LJ1A 1S1XA 3HRUA 1YJ9A 3QO3A 1SH0A 1S1XB 1VQOA 2HRYA 4NXNF 3ETMA 1OEBA 4M78F 1OPKA 2VKRA 4RU2A 2G1HA 1CS4A 3HHDA 2BR0A 1CS4B 3QT8A 2YX4A 3TWZA 3CD6S 2L89A 3NGPA 3G1JA 1H0HB 2MZSA 1J2VA 3H0HA 4DX7A 1VQ9T 2UUBF 1JLAA 2AYBA 5CQYA 1FHTA 3M1VA 1S99A 1JLAB 3M1VB 1ABQA 2ZBPA 2X4YA 2AEFA 3MPYA 1FJ7A 1W2BP 2ESWA 1U47A 2LDIA 4PZVA 1U45A 2Y90A 1FNXH 3L2RA 1OY9A 5JXSA 3SFMA 4RL1A 1QY7A 2L48A 3PX4A 1J5OA 1T3OA 1VYUA 2C3YA 2HLUA 1S12A 1FWPA 4KSEB 1J5OB 4ZJLA 4MDWA 2N7YA 5HJXA 2LFVA 4B6MA 4BBYA 5KFNA 1IBKF 4ECWA 4GO5X 4Q2LA 1OZ2A 2BA9A 1CBKA 3MM9A 3MM9B 2DD5A 4PLIA 1TL4A 5E2QA 1YRUA 1OI1A 2ZOGA 4CO1A 2UV8G 4R56A 4L3KA 2NUUG 4OZJA 1Q86U 2P0QA 1F2GA 2YXLA 1KQKA 2RSQA 2Z2MA 3CJRA 3QWPA 4LRDA 4I67A 1O75A 2HNYA 2DEIA 3QRRA 2YKAA 2HNYB 3SQOP 4QU7A 3WIUA 4LF6J 3JSCA 3R8YA 3GFXA 2BDPA 1FWKA 4DBFA 4J6XA 4Y3CA 3HFZB 2LXIA 4RNOA 3JCMh 4JV5F 1NNDA 5GMDA 4ILRA 4OQJA 1HXDA 1C4AA 4FS2A 4A8FA 3Q86A 2I5JA 4FCYA 3ZXWA 3QGPA 2I5JB 1QP2A 3I4HX 4ECTA 2YRVA 3R5DA 2C0IA 1LKZA 3BGFA 3KMSA 3CCUS 2HL5C 2CPHA 2SXLA 2F5GA 3KJVA 4ANJA 3KJVB 1OV3A 4MFBA 5E3RA 3K5LA 2V9WA 2CZ0B 4MFBB 4MK7A 1N0UA 5KAKA 4KQZA 1U09A 3BH7B 5A8WA 5A8WB 4OI4A 2BKDN 2QI2A 3DM2A 4IRKA 1Q86C 1VQMQ 3DM2B 2I0NA 4ZPAA 3UA7A 3DDIA 4KH1B 5D6WA 4QVDA 3EG0A 1UJYA 1UZHA 3OMCA 1YJNQ 4KUDK 2G13A 2D74B 1F1BB 3DRYA 3UN3A 4HCBA 4L6V3 2KZZA 1WTBA 1RKIA 4FPIA 4G65A 2N3OA 3N6NA 4ECZA 4ESRA 5LJ3f 4B3OA 3Q0AA 4NLGA 2EKHA 3OTOJ 4DFJA 1W7WA 4B3OB 2L3SA 4X65F 2EEYA 1JIHA 2Y1LB 1SCJB 4J7IA 3R7NB 5KFGA 5I4MA 1KQGB 2P5VA 3NKYA 2YWFA 4OYWA 1AWWA 4M7DA 2BKOA 2R7XA 4M7DB 2NLWA 3NGRA 2PVOB 5A0LA 2OEJA 2ATLA 1X5PA 3QDRB 1E6YA 3GR0A 3ZFVA 1E6YB 2D0QB 2OMOA 2UVRA 2V34A 4NRUA 3E9GA 1KQSR 1YJTA 4F25A 3RMQA 4WP3A 1G3SA 1Q82U 1G2BA 4JI7J 1I1GA 1V3RA 1ICEB 1O0PA 1WHGA 3DCAA 2DXEA 5L8RC 3D68A 3NG8A 1UGRB 4DV4F 3PYFA 4WE1B 2IYIA 1BWVA 3T1YF 4LF2A 3LGLA 1VQ6T 2ADBA 5CYJA 5LSLA 3CC4Q 2XMMA 2RUGA 3W9JA 1UVIA 3JCMb 1WEYA 1OO0B 1RTJB 3MI7X 1HD0A 5AXLA 2BXJA 2LP5A 1VQPA 4MKBA 4TQSA 4OMPA 1URNA 4M75D 2VWFA 3HLUA 1N6QA 2KVIA 1N6QB 2PD1A 2LU1A 4QIEA 3CCMA 4OHXA 4C8QE 1CKAA 3CJQA 1M5SA 3THPA 3JTOA 1NRKA 2X51A 1G3WA 2BYCA 2GQCA 3OYFA 3PIOA 1RCOB 4RUBA 2UU9J 4R0EA 4LF5J 1P1TA 4XTTA 1W6XA 4PUOA 2K3XA 3PKMA 4PUOB 4DUZF 4R0KA 1A0NB 3FFIA 4QWDA 3FFIB 3EH2A 2ZBRA 2L2PA 3TVZA 2QTXA 2AGQA 4HCCA 2L3QA 4LSNA 2ZHBA 4K2JA 3K57A 1BUXA 3VS5A 1MV3A 4LSNB 2AYMA 2FIUA 3BDLA 2Z0WA 3D0HE 1D9DA 2FVRA 1N5TA 3MECA 1ZAXA 2E70A 3MECB 2FVPA 1M8VA 4FNHA 4HKQA 2O31A 3I5AA 2K1RB 3ASKA 4ANCA 3JCMc 4N4GA 2JNGA 1PSEA 4YHHF 2RQMA 1P6TA 3AQPA 3FEXB 4U95A 5GMEA 1WXBA 4CLYA 2DY9A 2KT2A 4XK8E 1IWGA 4X9CA 2W24A 2G2OA 1Z9QA 1ZSZB 1JJHA 4FYDA 1AUSL 3AOCA 5K8NA 5HMYA 4GKKJ 2GF7A 5HY6A 2BV3A 4PWDA 1BKBA 3P45B 4PWDB 3RW6A 3H2LA 3DOLA 3I31A 1VLYA 3DOLB 1SIZA 2XS5A 3GJTB 4BY6B 2AQ4A 2CZ6B 4M75F 1WF2A 2ASDA 3ZTPA 4TYAA 3W61A 1ZZNA 4WYLA 4FVMA 3ISNC 4FPRA 3REAB 2PFFB 1K9MU 2FJBB 1QSYA 2VC0A 2AIRB 2J8SA 2UXBJ 3G96A 1JEGA 1QSSA 1Q0NA 2YNIA 1VQ8S 2KXFA 1X2KA 2FLNA 4BUGA 2OGUA 2DO3A 1VQ4A 2GQVA 3CWJA 3M58A 3IRWP 5HCKA 4XTZA 4LDVA 3MM5A 1KQFB 5JVHQ 5HVFA 3U1LA 3MM5B 4HLBA 4AG2C 4KBMB 4PXDA 2ZPHB 2DVJA 1SKRA 2YKMA 2YKMB 2ZD1A 2HKQB 2F69A 2ZD1B 4V19X 4PJMA 1G3TA 2WSEC 3PFEA 1NLOC 4FDFA 3CCRS 3RERA 2WRMA 2H54B 1RI7A 1UJ5A 2WB1D 5ETOA 4IURA 2R8HA 4JLGA 3VQTA 2AMCB 1VRTB 4E7ZA 1U25A 5LM7E 2DHXA 4AFQC 1BIAA 1N9RA 2ZOMA 1QKWA 4OLPA 5I42A 5I42B 1UGQB 3K7RA 1RT1A 1RT1B 3PJXA 1ULRA 4UOCA 5CQXA 1N8RU 1JKHA 4P6QA 1VQ4T 1JKHB 4NLSA 2MF2A 2F5KA 2L9NA 3CUNA 1RU1A 5D6GA 4FU6A 1QVFR 1PM3A 2NREA 3DFEA 1ZSGA 1VYVA 3S3MA 4A4JA 1MW7A 4IKFA 3VU3C 5KT3A 4E0DA 4DL6A 1MUZA 2CZ9A 1X5OA 4UY8T 4JJNK 1GEHA 2R7TA 3NWRA 2DNQA 1U1PA 3RBDA 1U5SA 4UQGA 3EG2A 3D1HA 4J7FA 2PEHA 3SWNC 2YRCA 3G86A 4LD9K 2RNAA 2EKOA 2KO1A 1I5OB 2DAQA 3RUBL 5IC4B 3GONA 2J6OA 4X4VA 3RTVA 2E6ZA 2DXTA 3Q8VA 2XNRA 4NZ6A 3FK4A 2DXDA 3CCVS 1KKHA 1YZ6A 3PDNA 3H7HB 5GANf 1JLGB 2RHIA 5HAOA 1G4CA 2QYGA 2VGMA 3UDEA 3KBGA 4KKOA 1RYSA 1S9GA 4LUEA 2M2BA 4KKOB 4IIOA 1S9GB 3QZ8A 4RW9A 4RW9B 1YQHA 3K58A 5MAOA 3URGA 4FYXB 1JNZB 5GAN7 2JL9A 3O6QA 2OPQA 3V8LA 2OPQB 2OLWA 2KM8B 3DOMA 3CDBA 4L59A 3GQCA 1B34A 1MMLA 2LMJA 1YJ7A 3IP0A 2A7YA 1N52B 1B34B 2CVEA 4OJ1A 4A47A 4ZJQA 1AZEA 4DL4A 2ERRA 1ZBXA 5D4PA 2WVCA 4GMKA 2LCLA 4HHHA 3PACA 1YNZA 4KE5A 2NWMA 1N33J 3CC7S 1BIBA 3R6OA 1XR6A 3H90A 1BYMA 3OYBA 3D1QA 4UC4A 1HNWJ 4XU2A 3CJ5A 4YDDB 1AWJA 2LQNA 4M63A 1H2VZ 1FJGF 2E12A 2IY5B 1KS2A 1H7XA 3JAMU 5L8RE 5F8JA 2HEQA 3M9OB 2RK1A 1RP5A 2YWKA 4BWJA 2ILZA 1ZUYA 3AXMA 3J80U 3JXOA 2FC8A 4WCIA 2FPEA 4J9CA 1XR5A 5KG3A 2VA2A 2OTJT 4J9UE 4NWBA 4UOFA 3Q23A 4XU0A 1VQLQ 4FF3A 3B4MA 2V4QA 4KFBA 3ZZRA 2CP0A 2FJXA 4KFBB 3JB9J 3LGHA 4PXCA 4PJOG 4H4KA 4ZOSA 5HLFB 5IXBA 5HSPA 2GMHA 5KFHA 2BJ8A 1I5LA 2KT5A 1LNXA 3RDVA 1BGXT 5ECAA 1IQZA 4ED5A 3I5RA 4BS2A 3FBFA 1AEYA 3L2QA 3PNWC 4PJLA 4A8MP 2JNJA 2RNEA 5HQ8A 1U8RA 4R55A 2QQRA 2OD4A 3RR6A 3AOAA 4B3RJ 3BB5A 2YNGB 3QNWB 2HL3A 2WVFA 2YKNA 3QJ6A 3HMJG 4A4GA 2YKNB 4PKDB 2GAGC 5KYWA 2Z58B 2WACA 2KXHA 5KYWB 2FGOA 2CDTA 1F5AA 1MN9A 1F9FA 3HFNA 3EDQB 2KXNB 2PFDA 3I87A 4AFUC 2BJ3A 5GAEI 5IOLA 2NXCA 9RUBA 2XEXA 4O3QA 4JOUA 2BM1A 4CLFA 1JWWA 2GMLA 1WG5A 2DNRA 2W7PA 2OPRA 3W5ZA 2LEPA 5H9FJ 1LWCA 3B54A 4DF4A 4JI3F 1N34J 3RKWA 1LWCB 3SEMA 2V8HA 3EDRB 3MR2A 2ZGWA 5GANg 1TV6B 1X5SA 3LQVA 4P2MA 3MJXA 3R6NA 4PCQA 1WC0A 4FF2A 3CCEA 2WOMA 2CJKA 4DR3F 5ETNA 2WOMB 4M5KA 3PVLA 5CZXA 4M5JA 2DZCA 1QTNB 1VQ9Q 3M8QA 2CJYB 3M8QB 4BI3A 3A8IA 3CCSA 2HVEA 2CQPA 3CJ2A 3MCMA 1KC8R 2OSQA 3JSYA 4HVVA 1W2BR 1VBYA 1WHYA 5J3BA 4WF2A 1UW9A 3DB3A 3DLEA 2QG9B 3QZ7A 4JI4F 3DLEB 3SYZA 1XERA 1EARA 3CXCS 2VPXB 5CR2A 5AXMA 2R4FA 3CPWS 1OSCA 3H6ZA 3P4UB 1VQ7A 1WDXA 1AWXA 2B4UA 3PXGa 5L1LA 4ED4A 1MWZA 3OQ5A 4QQDA 2IMOA 5AE3A 2V2VA 3I5CA 1PJ6A 1VC0A 3VGTA 3M4YA 4GLMA 4ATOA 1RHJB 2WSEE 2F3JA 2P0KA 2CPFA 3UA6A 2LNVA 3CCET 1GQEA 3PMTA 2R8JA 4KIAA 2LNHB 1L3TA 2DNYA 3PYDA 4DL5A 5KT4A 1JLBA 1EIFA 1JLBB 2DRDA 3CCST 3PYEA 4XTXA 3EGWB 1NEBA 2QMXA 4RWXA 5C42A 4L5GA 5C42B 2NXJA 2R7UA 1GH8A 4NL2A 3M6UA 4QU6A 1GBQA 3MEUA 3DU6A 1UJ0A 2RI3A 2GBQA 4G1QA 4K4XA 4G1QB 4HXJA 1YFNA 5KFYA 4TYBA 4FSXA 2WBMA 1Q16B 3CTRA 2PDAA 2QSFA 4ZITA 3RRHA 4PFOA 4WP9A 3SSSA 4F4AA 1KNZA 3I6PA 2J9CA 3PX0A 1WHWA 2D3UA 2NUZA 1Q5VA 2W2NP 2C2KB 4UUWA 2ZH2A 4BLGA 1Y00A 4A4FA 3M6VA 2YQ1A 4CLKA 2YUPA 2M16A <