3P8BB

X-ray crystal structure of pyrococcus furiosus transcription elongation factor spt4/5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
AGKIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNKGVVDEAIRGIRHARGVLPGEVPFKEIEHFLEEKPAVSGLEPGDLVEVIAGPFKGQKAKVVKIDESKDEVVVQFIDAIVPIPVTIKGDYVRLISKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA polymerase and transcription elongation factor Spt4/5 complex structure.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase, subunit e''
total genus 33
structure length 147
sequence length 147
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00467 KOW KOW motif
B PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3p8bB02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 3p8bB01
3CXCA 3CCEA 1JJ2S 1QVFA 1Q86U 2K06A 1VQ5T 1NPRA 4RG2A 3CC4T 3H7HB 5A2QE 1K9MC 1VQNA 1YBYA 3I56T 4YTLA 1RL2A 1Q81C 1YJWT 1K9MU 2JOYA 1KHIA 1VQ4T 1YJ9A 1XTDA 2DO3A 1M90U 4CRIA 3CCSA 1NZ9A 1YI2A 1YIJA 1SSFA 3A5ZB 4ZN1A 5IT9E 1VQLT 3J7AF 2QA4T 3LPEA 3CCLT 1W2BS 4QQDA 2QA4A 2QEXA 1VQPT 3LH0A 1YITT 1YJWA 5J3BA 5FLXE 3OYYA 1VQ8A 3I55A 3G6ET 1VQ6T 1Q7YC 1KC8U 3JAME 1VQMA 4X34A 1KD1C 1VQ8T 1Q81U 1KC8C 3ER0A 1YI2T 1KD1U 3LGLA 3G4SA 1YJNA 3G6EA 1M1KU 1VQ6A 1VQNT 2LQ8A 1VQ4A 3CCQA 2E6ZA 5J26A 1YHQT 1K8AU 2OTJT 1VQ7A 3EWGA 1S72A 1X6OA 3CCVA 3CC7A 2OTLT 3CC2A 2OTJA 1NJIU 1VQOA 4ZN3A 3CCJT 1M1KC 3J81E 3CCVT 1Q82C 1YIJT 2EXUA 1IZ6A 3CMEA 1Q82U 1W2BA 3CCJA 1VQLA 1YJ9T 1JJ2A 3CMAA 3P8BB 2JUFA 3CPWA 1NZ8A 3CCMA 3G71T 3CPFA 1Q7YU 5DLQE 3I55T 2LVMA 1M1GA 2MWOA 3PIPA 1VQMT 1QVFS 3CC4A 2E70A 3KBGA 3OW2A 3CCUT 1Q86C 1VQKT 3CCET 1UEBA 1VQPA 3QQCD 3CCUA 3CCRA 1EIFA 3DB3A 3LGFA 2EIFA 3CXCS 1NJIC 5LL6S 3CCRT 5HY6A 1S72T 1M90C 1XNIA 3CD6T 1M1HA 2OTLA 1K8AC 3G4ST 1YJNT 3G71A 3CC2T 3TREA 3CC7T 3CCLA 1N8RU 2OUGA 2CKKA 2JNGA 2XHCA 1N8RC 3DLLA 1VQ5A 2KDSA 2LCLA 1KQSS 3CCST 2KVQG 3DB4A 3J80E 5IAYA 3CCMT 1K73U 2MI6A 3I56A 1KQSA 3OW2S 1K73C 5DM7R 3HKSA 1VQOT 1BKBA 1QVGA 2MWPA 4TVRA 3PIOA 3CMET 1QVGS 2QEXT 1NPPA 2G3RA 1YITA 1VQ9T 2L3RA 3CMAT 3CD6A 1VQKA 3CPWS 3CCQT 1VQ7T 2JVVA 1YHQA 2IG0A 1VQ9A
chains in the Genus database with same CATH superfamily
3LH2S 3SQGB 5IWAF 2LT4A 1ZA1B 2XY5A 1WHWA 3GJTB 2AWZA 1K9MU 3THVA 1RT1A 3IGNA 2P9GA 3UA7A 1PRMC 3QWYA 2LLZA 2EYQA 3IQLA 3A3OB 4PYAA 2LC4A 1CJKB 4NZ6A 3QGIA 3EHQA 4DBQA 5KYWB 5J2MA 2E1PA 2D1XA 3OS1A 4G6VB 4DX6A 5LJ3g 4OX9F 3KFWX 3EZOA 3MP8A 2CQGA 3TR5A 1K0XA 2RQVA 5HL7Q 2UVUA 1VHIA 1OS5A 5J2PB 4DSKA 4PWDB 3OS2A 1IGUA 1YHQT 1X6OA 4E7LA 2DXFA 1R8OB 1ZETA 1KLMB 1RWKB 3M59A 3CMAA 1RHRB 2W8KA 3VS1A 3A13A 4J9PA 2HGNA 2MOXA 3HULA 4TVAB 1J5OA 1U1RA 1GFDA 3MOZA 5A0YA 4M78F 1TFWA 2P0KA 4LJMA 2JS0A 1VQKT 3CDBA 4ANJA 5M9OA 4PG6A 3TVYA 1HI8A 5DJBA 3VS4A 3RR7A 2DGSA 3FK4A 3G1JA 2FY1A 1QCNA 4IUVA 2IC3B 3NOCA 4WCIA 1OO0B 2DBBA 2VYTA 1KP6A 1D3BB 2IJNA 2YNIA 1UZHA 2QIFA 4MDXA 3R6NA 4LNPA 1VQ9T 3CCUQ 1V3SA 2RRAA 1H72C 3KLFB 1RT7A 1S1UA 4ZLNA 4DU8A 3LP2B 5C24B 1VBZA 2YRVA 2PZ1A 2VFRA 5LJ5Y 1RL2A 4WE1A 2RK2A 1UFWA 5KFJA 1K9MR 2CIMA 5E7OB 3T41A 3I4PA 2MKYA 4DEYA 1HHQA 4M5DA 1V3ZA 2BE7D 3WIUA 3L1AA 2A7YA 5KFBA 3M8YA 2B8PA 3EG1A 5KFMA 4TY9A 3H2UB 2ZZNA 4QIFA 1HD0A 1RI9A 1SKUB 4ES1A 2OP5A 3SHWA 1F1BB 3GWCA 1YTYA 2VDIA 1UVIA 3I0SA 3VF0B 3W64A 1IXKA 4DG1A 1KDNA 3KNGA 2PE8A 3MMAB 3HJFA 3OHBA 1F6TA 1HKAA 3TSZA 1BHNA 2GV1A 4N5SA 2EFQA 1IR0A 1CJVB 3DRPB 4QR0A 2QFJA 1ZTWA 2NUPB 1S49A 4ZVFA 3DOLB 1NZ8A 1UWAA 1PSDA 2KN4A 4EEYA 1MROB 2BE2A 1IQTA 4DZDA 3U02A 4ZTFA 4AFSC 2XLKA 2YH1A 1U1SA 3V5RA 1NJYA 2EK1A 4C5GA 3UCUP 2W2OP 4IKAA 3HKSA 3JCMJ 3KK2B 1AWWA 2A2CA 2F4VF 4YMEA 4Q0BA 3UW1A 3OW2P 3R5GA 3HRUA 5HBMB 2H4YB 4IO1A 1FVSA 3TCJA 4XIUA 2A2DA 2UZAA 1OQ3A 2OEJA 4CNZA 4MKAA 3TRGA 2OGUA 1Q8IA 3OPKA 1PBAA 2DH7A 3PO5A 1SJ3P 2VV5A 3Q8PB 1MN7A 3WX4A 1HBNA 2COYA 1UHCA 2IIHA 3HTRA 1TS9A 2E12A 3GP9A 3CBMA 4LFBF 3EH2A 1TMMA 3R97A 1VQNT 4RTXA 2I5JA 4ZPWR 4I68A 3BQ2A 2IA0A 1JLEA 1LWFB 3CCVT 2XMVA 5T14A 1E7OA 4CT8A 1AWJA 4M7AA 2DHSA 4JV1A 5EWFA 5GMDA 2MWOA 3OW2A 1KBRA 3FBFA 4JS4A 3JB9F 2F7VA 1NAQA 2CYZB 4OJGA 1VHFA 2D41A 2KVIA 2CQ4A 1XTZA 3DB4A 2DVEA 5EX3A 2NWMA 1G1XA 4PK4A 3OW2S 3W61A 4RNHA 3TEHB 3PIOA 3UE2A 4OYOA 5KYYB 3K0JA 3TU4K 3KHGA 2NXJA 2YNFA 4RW4A 2AKLA 4DN0A 2KB2A 2ZITA 2LJ1A 5M2PA 5KYYA 1Y3KA 2ZH1A 1HWKA 1H3ZA 1X4HA 4I4BA 1VDHA 5B7WA 1JXOA 1HXDA 3HZEA 2E29A 1A9NB 3M2VB 4PUOA 1KN6A 3U7JA 2R2SA 4AL7A 5FD1A 1XC9A 1M1KT 3DLLQ 1J5EF 3CDUA 5HSPA 1N27A 1U1QA 5IOLA 2XB2D 4M5KA 3OYLA 4F50A 4RW7B 5L23A 2OPQA 3TAQA 3CCJT 5GJWB 1RTZA 2K3YA 1VI7A 4WU2A 3WZ0A 1HSQA 5DS7A 5A2QU 2ALZA 4K2XA 3KTQA 1EP4A 1FVQA 3M8RA 3JCMf 1BB9A 4OYMA 1G3TA 1YITQ 1XN9A 4C11B 4DJBA 1DLOA 1TL4A 3TAPA 1U8SA 1S9GB 5GAN4 3DLMA 2RI3A 1GXLA 2LU1A 1V6HA 1BI3A 4F14A 3AXKA 4ETXA 3VU3C 1TL1A 2FLPA 1WXUA 3DB3A 4U67Q 3R6OA 1RT2B 3BBFA 2FL7A 2BKDN 1XNRJ 2HL3A 3GLJA 4GMKA 1OV3A 2RMOA 1LW0B 4ZK7M 4L76A 4QW9A 2XDBA 2O88A 4OI6A 2DNOA 1TU0B 4DQQA 4I56A 3EFOA 1U1MA 4ED5A 1WEXA 3VGSA 2VA3A 4PKDB 1Y00A 3TQ1A 5KFTA 3G6XA 1FX4A 1Y11A 2KU7A 1RE1B 3R2DJ 1X2KA 1W2IA 4NCGB 3V8LA 5EWEA 1WC3A 2DNZA 1YJWT 4K50A 2NZCA 3SCIE 3KLVA 3EAEA 1I94J 2QC3A 4CH1A 4B3OB 2RHSB 4HHUA 4K0KF 2R8GA 3CCWA 2DYAA 2CNOB 1NDLA 5G4DA 1HD3A 2R2UA 1BUXA 2UVVA 2D1CA 4CYUA 4PJOC 4C98A 3MM9A 2RO0A 1KC8T 3E01A 2XMAA 4M7DF 1RT5B 2HKEA 4WU3A 1H8KA 3CCQS 2PU9B 2EQKA 3CC7A 1JK9B 1WG1A 3H5YA 3CE8A 3DLEB 3CCLQ 3QYYA 4JP8A 2K79A 3OUYA 2ILZA 4QWCA 3MTKA 1WNEA 4EU0A 3MXHP 2BQUA 1T9UA 2KT3A 5A8RA 3CPWR 4ZJQA 3A8EA 3CD6Q 4N4GA 3LGFA 2ZNZA 2WVEA 1ZM3A 4MK7A 1XNRF 2H48B 1OEBA 2XWYA 4OZ1A 5DGAA 1S6PB 3M32A 5CZXA 4U8VA 2G13A 5IHKA 2HMAA 3RAMA 4TVRA 1TTHB 2CA9A 4E7ZA 2ESWA 2JM9A 2QFIA 4JZ4A 2Y1IA 1V1CA 1H73A 3CXCA 3EGDA 4LFCF 3DOMA 3JYTA 3TA0A 4C4WA 2MZTA 4AFQC 3MM8B 2DL4A 2JOYA 2R7UA 4M7DC 1NCLA 3RKXA 4HDGA 4IQXA 1M9SA 4KC5A 5DZ6A 1FT8A 2AGPA 2XS2A 2HGLA 2F8HA 4KFBB 1YJVA 4JV2A 4ZVGA 3LP0A 1IM6A 4PLLA 1TL1B 2VF3A 1JLBB 5D0EA 1WACA 3H25A 4JLGA 5CYMA 2GQIA 1B0TA 2E6ZA 4C92A 5IM0B 3UATA 2IM2A 2OPPB 2OMOA 4F7UE 2OTLT 4JPBW 3HPOA 1NDCA 3QDRB 2N3LA 1Q81R 4BWMA 2D7SA 5A76A 3HD1A 2R7OA 3HF5A 5F8MA 2JVOA 3OT9A 1XMQJ 4QWBA 3TWZA 2NZ4A 1NEGA 3BSNA 4C0FA 5LMNJ 2OTLQ 4FS1A 1CJUA 2JFDA 4EDUA 2DR8A 3MEUA 1QWEA 1SVDA 1VQYA 2AYEA 3JCMb 1F9FA 2XI9A 1UFKA 2DGXA 1CULA 3UDCA 4DPYA 4XO0A 2DVJA 2ZVIA 3MJXA 1GMUA 1FYNA 5KT4A 4JI6J 4LSLA 3KG1A 2Q6BA 4ZHRA 4RWXA 2XO6A 2ASLA 1KHIA 2YKOA 4HKQA 2W2NP 1SL0A 2JN0A 2J6FA 2PA3A 3RB0A 1OPZA 3O3LA 5LJ3Y 1VS3A 2XG8A 3H90A 3LPEA 2VC8A 4NLUA 2C2DA 3EZUA 2ZH9A 1QD1A 2OSRA 1T02A 3VAFA 2UUBJ 2AYBA 1QSLA 2OD6A 4DA4A 1VIEA 3CSKA 1VBYA 3HO1A 4N0AC 3T1YJ 3SEOA 2EW3A 4TU7A 1RHMB 4G3IA 1U24A 1UVLA 1WLPB 1SQEA 2QSFA 2K3KA 4LE9A 3RRHA 4C9DA 2E5LF 2IYGA 2Z30B 3M6XA 1DTQB 3LW5E 3TAMA 2V4JA 2Y0BB 4PQAA 1RGVA 1HFEL 3ITHB 3U1LA 2U1AA 4ECXA 1HBNB 3BGLA 3ZTOA 2CUYA 1FRKA 4DR2J 4D6WA 2NS1B 2G0IA 4WIIA 3UWNA 3UD4P 1I07A 1XK8A 4NLXA 2Q79A 5D3GA 3SWNB 3D3BJ 4G1PA 5I42A 2HZYA 4YR0A 1T03B 1LNXA 1U8RA 1Q86U 3M4XA 2JLGA 4A8MP 1FDNA 4LR8A 1NZ9A 2IIMA 3QBCA 2KJVA 4QW8A 4J9KA 2QA4T 2OI2A 4JRQA 1K47A 2DGOA 3K5OA 4OZ5A 1VQOS 1S76D 2C2NA 3Q83A 5D4PA 4IRKA 2QA2A 4ILRA 1QVFP 4NMLA 5C7PA 1T3OA 4NLPA 1U1KA 1Q7YT 3DOMB 2ZM6J 3D66A 2BE2B 4RBTA 3JB9D 4LT6A 3HVTB 2DF6A 1G5VA 2E65A 1PKTA 4JRPA 2DR7A 2GO9A 3BYRA 4P6QA 1PYSB 1YJ9T 3LOUA 1FKPA 5CK9A 3I5RA 5CCMA 3N01A 1VBKA 3MR3A 1HNVA 4NE9C 3M8SA 4DQPA 3CD6S 1Q79A 3GIKA 5EHHA 3VGUA 2QQAA 1YQHA 1TXQA 2BM1A 1UB4A 5SZTA 2N82B 4B3MF 1NNDA 2UUWA 1UWBB 1YWPA 3PDNA 3DLLA 4MYUA 4RW6B 3RW6A 5GAEI 4FXWA 1U45A 2RM4A 2VJVA 4BI8B 2W8LA 2XY7A 5EGYA 5KAKA 1G2BA 2XBPA 3P6YC 2YPYA 4J91A 4CCHA 3CCUS 1D3BA 3E8OA 2C3PA 1I8FA 1PC0A 2LQNA 4ZN1A 2BJDA 3TVKA 2G2OA 4JI4F 2GAGC 3ET6A 2HLTA 2JOQA 1URNA 1YRXA 5FRNA 2YWKA 5FLXE 3CCVS 2N4DA 3HXMA 2CDTA 3BR8A 1D0XA 4UUWA 4A47A 2XI3A 2KROA 4TLRA 1F5AA 3C6UB 5I42B 4DBHA 2DHXA 1VQ7A 2HRUA 2W9AA 4B3RF 3MZIA 1WI7A 1HA1A 4DR1F 2KEAA 4X9DA 4YDDB 1M4ZA 1F60B 4DPUA 1D9FA 2VXEA 2ADBA 2VICA 2GVDB 4UOGA 4JI7J 2FVSA 2V8VA 4L5GA 4M7DA 1RWMB 2FJVA 3CCLA 3THTA 1JKHA 3TQEA 4X9CA 4USMA 3UDVA 5KFOA 1S97A 1AVZC 4RWWA 1U5SA 3FGVA 3RNJA 2IM0A 2QRRA 3BO2A 2VC1A 3O6QA 4FF4A 4DUYJ 2NSBA 4M94A 2V2VA 2W7PA 4UY85 3BQ1A 4GY5A 4JV0A 1Y9OA 3HHLD 2EEYA 1EX4A 3ZNJ1 1KJWA 2YNHA 5LSRA 4C92C 2OMLA 1ZHIA 2JS2A 1S48A 5D0RA 3SYZA 1QP3A 4XTWA 2P8IA 2D6FA 4UUXA 4QJVA 1B7YB 2MK5A 5B0FA 2EKOA 3OTOJ 3MI7X 1JO8A 2AYMA 4ZHRB 1N0VC 3AOAA 4GKKF 2C2EA 3D1QA 3T3FA 3T6JA 4O4GA 1MUZA 5IS2A 2XDPA 2HNDB 3GJRB 1SC6A 5J1EA 3T1AA 5GAGU 1CEZA 2RUGA 2L9DA 3HZGA 3IGVA 4U96A 2LA6A 2V2KA 2VPXB 4C5EA 5CD4A 2BJ8A 1CJUB 1RXOB 1HNWJ 1RLDA 4DX5A 3DI6B 1BI0A 4L73A 2C3UA 5LJ3h 4Z88A 2ED1A 2WTFA 1U2RA 1RA7A 1NB2A 2FPHX 3VVTA 5KFKA 1HMVB 2BJ3A 4NWBA 4M7AB 2J76E 1ROFA 4YR3A 2AX1A 4C3LA 2GHWA 2L8DA 3J7Z5 2AQ4A 4ZPVR 4EMHA 2XMUA 4OB1B 1D0ZA 4J9HA 3EDQB 1IBCB 2EFNA 1VQ9A 2AZVA 1IKYA 4B08A 1UW9A 1S1NA 4TN2A 2H4WB 2BZXA 2XSJB 5BYQA 4LF9F 3SCLE 5KFZA 4OMOA 4ECWA 4R25A 4M5HA 4ZGEB 2FD2A 3PW7A 1QW1A 5BXIA 1Y57A 4JV5J 3CXCP 3PT9A 5HATA 1U1PA 4ETZA 1FRMA 1QAJA 1YJWA 5KOWA 3W9JA 4PYDA 3KLGA 2BRLA 3RB3A 2OO4A 2BRKA 3EGDB 2OTJS 4NRUA 1S72A 1RHUB 4Q0BB 4OB0B 4HVVA 1YJNQ 4FVMA 1B3TA 5KFYA 1TUWA 5GANj 2QA1A 4PLIA 2UUAJ 1REGX 1CQNA 3ULRB 3J7YI 1QAXA 5ETLA 1VQPA 2DNNA 2FZCB 4I69A 1M90C 2O01C 4KO0A 3P8HA 1G8XA 1Q8KA 3LAMA 2AZ1A 2EYWA 2VZ9A 3K58A 2MQOA 1GCQA 3DC2A 4R5PA 1ZZNA 2H1YA 1E6VA 1X5PA 3V6KA 3OYFA 1JLAA 2J9DE 1X4AA 5KFRA 5H1SV 2VU5A 3W62A 1U1TA 2WONA 4ME7A 3FZ2A 4BACA 3BPSP 1VA7A 2H51B 4RUAA 5L8RC 2JW4A 2F2XA 3EFRA 3CCMQ 4AL6A 3WBZA 3AH6A 3A5ZB 4ECUA 1Z2LA 2U2FA 3NMRA 4ZDNA 3V4MA 4OI1A 2MKKA 1R6YA 3LP2A 4DL7A 1M90R 3ER0A 3HLUA 4RMOA 2KFNA 3AFGA 1SJ1A 1VC5A 3QAUA 2AKWB 4NCBA 2EYYA 4ZN3A 5GAEU 2VA2A 1D1AA 1N34F 3CD7A 4F4WA 1U0SA 3W60A 1FK9B 4QIVA 5IT9Y 2H5JB 4H4OA 4GC6A 4ECZA 4NA3A 3QSUA 5L1IA 2RILA 1RQ0A 5D6GA 2E70A 4HCZA 4UTGA 5HK0A 3NCPA 1GQEA 1HLWA 4ALZA 1OY8A 1DTQA 2ECZA 2GFAA 5D4LA 3IFEA 1J5OB 3PMTA 2G1HA 4KRTA 1MWZA 2Z2LA 3CCRS 1SXLA 2MJNA 3OSSC 3HHNB 1N36F 5IC6B 2R57A 4CLLA 1KK7A 1ZBJA 2A36A 1IBLF 3DLKB 2DM1A 4E7IA 5FROA 3AT1B 4DR2F 2WVDA 1TWBA 2RVJA 5KG7A 4MFBB 4P2MA 1N5YA 2QQ9A 2MHNA 4WFZA 3CC2Q 2XGPA 2DR9A 3GNFB 2HEKA 1X27A 5GAN5 1FD8A 3GYNA 1RBLA 3QXEB 1SRMA 1WHJA 4LF5J 1O75A 3HT0A 4ZIWA 3M8WA 4F4AA 3MF5A 3E51A 5LMUJ 4YR2A 1UFLA 5GMEA 5CKDA 3K5PA 1GXIE 2F9JA 4J37A 1NJIT 3NRBA 3G4SA 2R4FA 4QOTA 3ENWA 1U25A 1HNWF 2J05A 2XY6A 3VAKA 1QVPA 1FERA 5B08A 1KWMA 3X24B 1N5QA 2EGCA 4LF7J 3UDLA 2D8HA 4ECVA 1TV6B 3NG8A 3LO3A 4F0KA 2RQTA 1XOVA 3R5JB 3C8YA 1VQ9S 3EGUA 4J9VA 3GV8B 1VRTA 2XZTB 1N4LA 2D9PA 2VQEF 3H2VE 3W2VA 3CCRT 2DHAA 3NS5A 2RRNA 2OHDA 4PJOE 4DN9A 3EGZA 4RPFA 2H8HA 1S79A 2CJKA 5ADZA 1T3SA 2PNIA 2X4JA 3SDEB 3LH5A 5KCOA 1QVGS 2KJWA 1SB6A 4M77E 4OGCA 2UUBF 1HYSA 1LW2A 2DISA 1QVGR 4QPXA 2NYIA 4ZP6A 4KULA 4GRSA 1XQIA 1VQ4Q 2KZMA 4Q2MA 1SKRA 4DV1J 2RQKA 1Q8BA 1YZ7A 2ZH8A 3CC4S 4LUBA 1YN8A 2MKCA 2CQCA 5CYJA 2HQXA 3IM9A 1WYXA 1MMAA 1VQ9Q 5GMKj 2HNDA 1N32J 1TAQA 2JRSA 2J0WA 3IP0A 2X1FA 2CQ3A 1NJIR 1OZ3A 4M5LA 2KM8B 4DQSA 1AOJA 1UE9A 4RG8A 1QE1B 2JWNA 1G3OA 5L38A 3A12A 2LX7A 4M75A 2LNHB 2IVYA 1SH2A 2OTJT 3W2WB 1X9MA 2ZZMA 2X3GA 3ENAA 3H98A 3SIPB 3GYGA 4F02A 4R55A 2KT2A 2P0QA 1N9RA 2RPNA 3W65A 2M16A 3JB9I 4YOEA 7FDRA 2HBPA 2CZ7B 3SFUA 1M8MA 1BQMB 4FDFA 3PJXA 3BBCA 3TX8A 1JLFB 5C2CA 2ZPFB 2HIQA 2A08A 5A8RB 2EVRA 2VH7A 2OTLS 2HQEA 3LWLA 2AJ0A 2CQ0A 1Y3JA 2XCPA 2EWNA 1QVGP 5IAYA 1U02A 1V29B 2MIOA 1BKBA 1R89A 4K4ZA 1IRXA 4W92B 1WI8A 2PUKB 5GJVB 5LL6d 2B0GA 2FHJA 3TJ8A 4RCCA 3H0HA 4LSNB 2QEXQ 1IKVB 2B8QA 3ZZZA 4C8QG 2HVZA 3M0RA 5HQMA 3ZZPA 4L3KA 2BBEA 3ILJA 5IT9E 2E5HA 1GXUA 2K3IA 2QEXA 4LD9K 2XYHB 2XLIA 1IVZA 2ROEA 1UFFA 4ZVTB 1WF1A 2CZ6B 2VG6A 5CD4H 1FE4A 5HMWA 2FPEA 1RT7B 1SJ4P 3FBCA 1N8RR 4P75A 3CJRA 4BD3A 2FLOA 1OIAA 3I5AA 1UVMA 4B9TA 2K3BA 1ABOA 2LMIA 3CIMA 1AWXA 2ZGWA 1GCQC 4Q44A 1WWHA 2A37A 4NYPA 1TK0A 2EKHA 1FX7A 4I2QA 3KUGA 3PX4A 2GNKA 1HNIB 1NJZA 1WJ9A 3K7RA 4Z7YA 1C4CA 2Y0SD 1SPBP 1WA7A 2L5QA 2X3DA 1YRUA 4DUYF 4DFJA 3FIFA 4DQ2A 1NSAA 2CPIA 1SUQB 4C3KA 3FRZA 5KFWA 5LXYA 3TUPA 2GQCA 1B7FA 4U7UK 1VQLS 3AA8A 1IHWA 2BTTA 4LDUA 4IOBA 4XAKA 5FWBA 2F8MA 4F16A 1X0FA 3JCMc 2VUBA 3TZZA 4KSEB 4JJNK 3AXMA 2MCNA 4QQDA 3HVTA 1Q16B 4IH6A 4PXCA 1T94A 1U8WA 5GAGI 4CTAA 2LXFA 3H20A 4OV1A 1APSA 1HNZJ 3JXOA 3M6VA 3OFHA 3GR1A 3ENQA 4CTAB 3RMQA 2Z0GA 1ZSZC 2HGMA 3LWIA 2V94A 3E3XA 4ATNA 3KK1B 1YWXA 4OHVA 3S3MA 1V9OA 1VQLA 3D4JA 5GAMf 1XMOF 4HH1A 3AD8C 1MNEA 3PW0A 5GANd 3OXFA 3I55T 4UT4A 2W25A 8AT1B 2KDOA 1R3NA 3V81B 1RUWA 3ILLA 3ASKA 3BM7A 2RJEA 1C0MA 4F2SA 4ICLA 2XULA 2ZJPQ 4M7DE 4F7UG 3CCLS 2HNYB 3VAMA 4KBIA 2ZZDA 5GAOq 1WOSA 1B0PA 3CMQA 1NSKL 2EKYA 5IHIA 5E3CA 1K9AA 3QSYB 3VRYA 1VRTB 1UVKA 1U0HA 4K5SA 2J9DA 2M70A 2XQCA 3ULHA 1U1NA 2W4PA 3IN5A 2ENMA 2AGOA 1MU2A 3ONQA 4OZJA 1FXLA 3MD3A 2O2OA 3GZ7A 1EZZB 1YJRA 3PO4A 5KFFA 3O8WA 5DDPC 3NPFA 3C0CA 3TOQA 4ZCIA 1RI0A 2QG9B 2IRYA 1L3SA 1W2BS 3TP2A 2OPSB 5B0DA 1IHVA 1QQJA 4A8KA 4DI6A 3J7A1 5KFEA 1UVJA 6FDRA 3KUEA 4FXDA 1R8PA 4MZTA 2F40A 2Y9HA 5FW9A 1R0AB 4NOHA 1LPLA 4Q5WA 5H9EJ 4MFBA 3T5KA 2B9EA 3PCOB 1BY9A 3LPYA 5DLQE 4OZ0A 5CKEA 2I38A 4OLPA 3M2UB 1OU9A 1WNLA 1MGQA 3QRRA 5K8MA 2ZHOA 1WSVA 2DAQA 2VKNA 5CA5A 2WB4A 1GFCA 1CJTA 1FRLA 2BABA 2J9EA 5HY6A 2OTLA 2RJZA 1BLUA 3JB9G 3M58A 4LRFA 2P0PA 5KYXA 4LBIA 1UGRB 2LCLA 3Q1JA 1M8VA 3C14B 2KRNA 4C0DC 3CULA 3K8WA 1P92A 1IWGA 4RW9B 2VB6A 2F4VJ 2LA4A 4ZP7A 3RBXA 4IR9A 3LGNA 2VIHA 1AXQA 1JLQA 4ECTA 2EG2A 1IR2A 4O23A 2R2RA 4DV5F 1D8YA 5D77A 1F5CA 3Q22A 2E6NA 1TUGB 1NK5A 5ETMA 1BCOA 5AE1A 3NGKA 1B99A 2RA2A 3X20B 5M2RA 4ZPDA 3QFWA 3JAME 4IIOA 1O6XA 1VQ8T 3DOKB 3R8YA 5GMKm 2DKGA 2HWHA 1K1QA 4AFFA 3OYEA 4PFPA 3UA6A 2KHCA 3MEWA 5L39A 1Q82U 1IKWA 4B3MJ 3MM8A 3UR3C 1TOVA 3D28A 1T9WA 4NEZA 1IJFB 3I5CA 1FNXH 2VODA 2FG0A 3MEEA 3PM9A 4O44A 1VRUA 1VUBA 3JSRA 3CCET 4QYZK 4M5NA 3ISND 4ELYC 2PIIA 5EWGA 4ED0A 5HROB 1MU2B 4YEAA 5IFMA 3EVOA 2QE5A 2LFVA 2W7AA 1S6PA 4USHA 2ZAEA 1Z9ZA 2HHPA 1KQSS 1T0JA 3R9LA 2UVRA 2R3VA 4M5IA 5DM7R 1RU1A 2MLZA 2MZ1A 2B4PA 2W24A 3CJ3A 2E44A 1WEYA 4M78E 2VOPA 1C1BB 2WRMA 3VAGA 2R8IA 1H98A 5CQXA 2CVIA 3SFGA 3QIPA 2YKQA 4BE2A 1Q81C 4DSEA 2M51A 3CC7Q 3GSDA 1YJ9A 4JYAJ 4RNFA 2GBQA 1UW4A 2CPXA 3KJQB 1WUUA 2QQSA 4CT9A 4DR3F 1VGYA 4ERDA 4ANDA 1FKOA 2VGNA 3R7BB 1BI2A 4WCEQ 5GANf 3E2UA 1LK7A 1RCXB 4RTTA 1EETB 2PI5A 1PKUA 2W9BA 1KFSA 3M2RB 4LF1A 1Q4RA 2Q1LA 3X26B 3D3CJ 5LJ5e 3PVLA 3M2UA 5CAAA 2VC0A 2HAFA 2YWGA 3M9OB 1U2FA 1H2TZ 2I9SA 4EBEA 1O51A 2P9CA 4A8QA 3G4SQ 5E41A 4U95A 2BEFA 4OJ3A 1R0AA 1PAUB 3VTIA 4E0DA 9ATCB 2OFGX 3P8BB 1ZSGA 3KFVA 1YJ9S 3WDOA 4ZA1A 2ZPGB 2AP6A 2JL9A 2UXBF 1YSJA 4OGEA 3CCRA 2HFOA 1C4AA 2SXLA 2F69A 3I56S 2CREA 3OS5A 1SJRA 2VG7A 1AWOA 4B9UA 4ILLA 2X9HA 2KVQG 4BB7A 4XPCA 1AUSL 5D78A 1KQSA 1LWFA 3NBPA 3P45B 5E5NA 1KQFB 1M3BA 1GTEA 2OLWA 3MEAA 1YITA 3GOXA 4M75C 5KT5A 4ED6A 3MPWA 3H2LA 5HQ8A 2RJDA 2C3YA 1WJQA 4LF2A 4UC4A 2Q66A 5J2QA 2J0QD 3QMQA 3NBPB 2FLLA 4A48A 3NCQA 2KRRA 4OL8A 4B02A 2HWIA 4MIWA 2BYCA 3HFVA 2MQQA 2J6SA 3N5BB 2YLBA 2XICA 3OL7A 2LQ9A 1KC8C 3NTKA 2Z2MA 2E1HA 4PUOB 4NZ0A 3REAB 5KG2A 5F3TA 2MSTA 2RU3A 2G6FX 3I0RA 4AXIA 2J06A 4J9BA 2VFVA 3FJ2A 2B7CB 4E2FB 2QTXA 2KT8A 5CKFA 3PVXA 3M0QA 2RUSA 3NTIA 2YT6A 4OMPA 2G0JA 2BUDA 5AXKA 2M7SA 3JAMY 3VQTA 4ENOA 1AHJB 2HAIA 2CQDA 2V8JA 2CZ9A 3M2RA 1P1LA 3EGVA 4WYWA 2E5GA 2HHHJ 4Q2LA 1UGQB 3J7ZT 1WJSA 2OFHX 2HVHA 2B9WA 2A6OA 3PMIA 4FL6A 1W1FA 3NEKA 1S0OA 1D1UA 3IRXB 1VC6A 4L6V3 1NPPA 2IVFB 1CC8A 1F2GA 4PJOG 2W01A 3D6HB 1AB8A 2X1GA 3IS9B 2AW0A 2PMWA 3FMBA 2GQ2A 3AA9A 4RTUA 1FKAF 2KYMA 4RG2A 1JJ2R 3MEGA 4DSIA 4DL2A 4JDSA 1NEEA 1SIWB 1VCTA 5F41A 4YY3J 2AYGA 1JLEB 5CR2A 1SSFA 2DNUA 4JS5A 2HDAA 1FDBA 2G4BA 2AGQA 3VS5A 2J8AA 4ZKAA 1OYEA 3G8TA 3H4BA 4DV0F 3FCWA 1YLXA 3PG9A 1PWTA 4URQU 2ZPHB 4J9FA 3NKYA 3W2WA 1ZUKA 1YJNA 4HTIA 4OI0A 4FT2A 5L1KA 1BXNA 2YNIB 3PYEA 4ZLPA 2EQIA 4BBYA 1VISA 2AD9A 3G6YA 2DGWA 2N7YA 4J9RA 3JYTB 4YDXA 2M0YA 3HKZD 5KG1A 3K89A 1CLFA 4M75D 5IT4A 2KRMA 3OY9A 5IV3A 2DVIA 3WC2A 3CCES 3MECA 3R5AA 2Z8QA 2ZM6F 4EMGA 5CH7B 2M5YA 1S6QB 4QVCA 1JBMA 1PSEA 3F0NA 2JT4A 4PEOA 1SL2A 3TUIC 4WP9A 2XGQA 4M77D 5E3QA 4CLTA 1TH7A 2LEAA 2M3DA 2KHDA 3M1VB 3CCTA 1EB0A 2F5GA 2DRMA 3LGHA 5DGBA 2CXEA 3DOLA 2VQFJ 2DXTA 2V63A 1CKBA 3VUZA 1H2UX 4DV2F 2CYYA 2DK3A 2LQBA 4AG1C 1ZH5A 2FTRA 2P2CB 2R42A 3IR5B 2KXFA 1HIYA 2MGZB 5KG6A 2R7XA 2VPZB 2R7RA 4GC7A 3PKMA 4HYKA 4HT8A 1PGZA 4AFUC 4YP3A 3I55S 1KVKA 4JI4J 3OL6A 2BMBA 3NGTA 4F7VA 3BGOP 2A10A 2HBRB 4FSXA 2RD1A 5A2QY 1M2VA 4IYQA 2R5MA 4IRDA 5GMKi 4HHJA 3GJSB 3KDNA 1Q53A 2QX0A 2I0NA 1LFWA 2IDEA 4JI2F 4Y34A 4DMZA 2HD0A 5I4MA 1VYAA 2ROGA 1B70B 2ROPA 4P5NA 1JWWA 1N8RU 1LW0A 1VMBA 4C0OC 3KMSA 1HWUA 2KDSA 5GAN7 1HYOA 3G86A 3QIDA 3SSSA 3P5BP 5F8JA 1S9EA 3ZZYA 2G3RA 4C2MA 1RKIA 3I9V9 1AEYA 4D3GA 5HMZA 3QGGA 2V8IA 3QWUA 1N6AA 2GFFA 2VBWA 3VAIA 5KFCA 1RTHA 3LP1B 2GHPA 5C25A 1RT4A 3NGDA 4C92F 1YIJA 4R8UB 4H4OB 3EHRA 1LWCB 1N9SA 4K5RA 1K1ZA 1RK8A 5FU7B 5C25B 3HD2A 4G1IA 1S7IA 3V8JA 2XYPB 3I55A 5D4OA 1QVFR 5CIUA 4A8OA 3MEDA 4DV3J 3HX9A 2FVQA 2RRBA 1PBUA 1UMJA 1YWOA 2JXBA 4DZ6A 1M30A 1QLYA 3SCKE 4F7UA 4AQYF 1CJKA 8ATCB 3CCSS 5GAMe 1R8BA 3R7SB 3ET6B 2OI3A 3KXDA 2K9GA 4JI0F 2VFSA 2LVMA 2MJUA 1QVFS 1ZUYA 5HVFA 4M75F 4AMCA 3M8ZA 1U6BA 4QCLA 4QR1A 1M5OC 5L46A 2ASJA 2AEJA 2BJ9A 1NH8A 3PFEA 5KE3A 3OR1A 4RNMA 2R8HA 5IQ6A 2B8AA 4AXJA 3E9GA 4ZPCA 1G83A 2DA9A 1K1SA 4X4UA 2QASA 2IFXA 2I2LA 1AZSA 4P7VA 2YNHB 1M5SA 3A8JA 3VWSA 2PVGB 1CS4B 3BV8A 1UEKA 3C94A 4BLGA 1QTMA 1M90U 4J83A 4Y2IA 3C6TB 4Q43A 1L3KA 1QKXA 1WPYA 1QKWA 4J5YA 1Y71A 2DX1A 3L2QA 1H74A 4RBUA 2HMIB 1GH8A 3R5BA 2DLPA 3M57A 2K7KA 4PQUB 2B4OA 1O5JA 2GVDA 2GIQA 4RZRA 1YJNS 4J9LA 2DPJA 2JDJA 4KHPF 5C0MA 1WD6A 3MCMA 5L1JA 3TSWA 4DUZF 1Q82C 3NLCA 2J6TA 1UAWA 2DPPB 1WTFA 4CC2A 2XKOC 3G6EQ 4DLGA 2NPFA 3CJTA 1EKRA 3HSBA 5BYSA 3GJQB 2XSJA 2LU2A 1B64A 1S57A 3GLXA 2FQQB 4OMNA 4NLYA 3CEDA 2YX1A 3FJPA 4QYZJ 2B4VA 4PG7A 2FIUA 4JJDA 4USIA 4CWBA 2CG8A 2FVPA 4K0KJ 3WVDB 2NXCA 1LEOA 2JVRA 1I94F 4NPOA 2MI6A 4NXMF 3HFKA 5LOQA 2ZUGA 1XNQJ 5HVHA 1FMVA 2WHOA 4KY3A 2V50A 1Z4UA 2KXCA 2YVSA 5KFSA 1FFSB 2JZ5A 4AG2C 3KUHA 1V5IB 1FWKA 3KJFB 1KSWA 2DO3A 1HQEA 4RW8A 1PHTA 3VZIA 3CCJQ 4I2PB 2RQ4A 2EYXA 4NXMJ 1BE4A 1N54B 1RWNB 3NOGA 2GTOA 5DO2A 1RISA 2DXUA 2CH4W 3VYHB 3L42A 3P4UB 2M2BA 3HKWA 1WXTA 1KD1C 1KD1U 4TKTA 3SWNC 2HBYB 4FVCA 1WF0A 4HH0A 3MO8A 2DNGA 5KFPA 1HJDA 2Y8YA 1T0HA 2YX7A 2VG5A 4RL1A 3A8KA 1M1FA 5LJ3j 2M1HA 1RHQB 3PW5A 3DGPA 2L41A 1H38A 3V6HA 3OW2R 4J9SA 2MLYA 1Q82T 1Y10A 3CJQA 3KBGA 1X4FA 3MKDA 4LF6F 2MEWA 1BQNB 3VYGA 1DRZA 3S01A 2ZH4A 1TKXB 3MAAB 4M7AD 1Q7LB 1RI7A 2HCKA 3N28A 3UNYA 1SRLA 4MZMA 4PL6A 1PYOB 2IVMA 2J7KA 3BN4A 3TO8A 3LYIA 3PIOQ 1JLCB 2MHEA 4TYAA 4Y91A 4LRCA 3M4GA 2YUQA 2CQ1A 2OSQA 2MKSA 2VKZG 5GAMj 4IG3B 1Y5LB 2L9WA 1HNXF 4FW2A 1XTDA 4CLFA 2J6OA 1W6XA 4PZVA 4F04B 3NGRA 3NCRA 3RGIA 2LNVA 4J9DA 2L0AA 1G2EA 3IWXA 5I21A 4M77C 2L3MA 4LIRA 1B34A 4WFXA 1KC8U 5KCHA 1TK8A 1Q81U 2DO0A 2HFVA 3MCOA 2FC8A 2O31A 4DV6F 1JLGB 3CGIA 1IQZA 3MMCA 1X9SA 2W4CA 4CQ1A 4ECQA 1YCYA 2RIJA 2M88A 1FHTA 2HWTA 3HM9A 4JI0J 3CC2A 4IDKB 4PJLA 3KK1A 1GT8A 5E3AA 3BGFA 1NLKL 4CNYA 4ZVHA 4EZ6A 2RJFA 2EGAA 2CVEA 3D0GE 1WKJA 2UXDJ 1ZPWX 1DTTB 3HSJA 5GANg 2EJGA 1ICEB 4K11A 1LCKA 2ZBIA 2EFPA 4OYBA 1TKTB 2HVEA 4FF3A 3OTBA 1VQ6Q 4RCBA 1KKHA 1A6LA 3C4SA 2DNYA 4WXWA 2RH2A 4DR5F 2Y1JA 2QQBA 1XR7A 3K59A 3CQTA 1G7CB 4V2SA 1RT3B 1IKXA 2OELA 1YHQA 4EMKB 4C6AA 1NLOC 3CCZA 4F4XA 3Q8VA 1REVA 4LFBJ 1GMVA 2RF2B 2MZQA 1GK8A 2FPFA 1TKZA 2EBPA 1FKPB 5KT7A 1JLGA 4E7SA 5SUHA 3RR6A 3BSAA 2HKNA 2EBEA 1RYSA 1EJ7L 1H3HA 5AJ3F 2HQ3A 1Q7YC 1IBMF 5J1NA 3F73A 1X4EA 2MYSA 4KT0E 2HBZB 4KB7A 3N6LA 4LN2A 4B9NA 5DY9A 2K2VA 4RNNA 2OAWA 1HWIA 2AMCB 1G3SA 2DO4A 4IQMA 5E2QA 1UP1A 4HLBA 4CO2A 2X7IA 5L9XA 3M30A 2ZDOA 3K17A 4DUTA 2PN6A 2Y3YA 3PR4A 4U9RA 2ZBPA 3QZ7A 4RKUE 2J7WA 2MPXC 1Z2ZA 4OMLA 1S1UB 2Z2ZA 2RN8A 3OSPA 2RU9A 1LJOA 3WIVA 2FLNA 5LJ3d 2RQRA 4LQ9A 3DHWC 3VRZA 1KC8R 4BC9A 4OHYA 4FKXA 1R8HA 2PFDA 1NXIA 4QWDA 5GADU 1TL7A 3G71S 2VQFF 3PNWC 1HR0J 4ED1A 4XTVA 1RT2A 1R7IA 1UGSB 2KI2A 1E6VB 4PQUA 2JJ9A 4RW6A 1X7VA 3DCAA 1ZQ1A 1CPZA 2HBWA 1E6GA 2B43A 1UA1A 2KY9A 2RDIA 2ZHBA 4PJJA 3EE3A 2HS0A 3IWNC 3A8GB 2QN6B 1Q86R 1K8AR 4KKOA 4Z2XA 4Y2KA 5GAN2 2YUOA 1FJGF 3V7SA 2LECA 5GAOr 3JCMX 3IRWP 1KS2A 5K8NA 1WFWA 2RF0A 1FWLA 4MMLA 4LSZB 4CRJA 2IJFA 1HNVB 2MQ8A 1OX9A 2VBYA 4ECSA 3DLEA 2OAUA 5I2SA 2JHEA 1W2BA 4YY3F 1RT5A 2CSQA 1DQ9A 4HL9A 1RT1B 3IG1A 2UV8G 2PI4A 4LR9A 1TL7B 1JJ2P 3RRKA 2HYIB 1GNKA 1I4K1 5HCKA 1FE0A 3CDWA 2MXYA 4DUZJ 1S59A 4WK3A 3R27A 5EX0A 2LKZA 1WQWA 4X64J 1WDTA 4OHZA 3URGA 1AA1B 1RLPC 3PRBA 1A0OB 1CVJA 1K73C 4YUDA 1BQXA 1RACB 4WFBQ 2JLFA 2QEXT 4PXEA 4KPCA 3QJ6A 2E9ZA 1QY7A 1U6ZA 3B82A 2K06A 4OYZA 2AK5A 3E2EA 3SWNA 3O2IA 5D3GB 4K4TA 2LP4A 2LDIA 3RBDA 2YKNB 1VQ5Q 2VPWB 3MPVA 1SIZA 2H65B 2ATLA 5I3UA 3RR8A 4LRBA 1IM4A 4JI5F 2QI2A 3OBYA 1IO6A 4WWSA 5KYUA 4IFVB 1SCJB 4MYTA 2A1BA 5GAN8 1U1OA 1PCXA 1FJ7A 5GAN6 4OYPA 2DTIA 3D6TB 1TKDA 1KG1A 4DHVA 3CTRA 4BE0A 4M7AG 4DCJB 3QKJA 4AQYJ 2NPIA 2DB1A 2CP3A 4MMKA 1JLCA 5HQLA 4X65F 5DG8A 4H4KA 3N9UC 3MWBA 4D8DA 5A0LA 4B3TJ 3C19A 3CD0A 2BACA 2F63A 3JCMP 3MAAA 2RQCA 4DFMA 3CO0P 1HW8A 3QO9B 1P6TA 2QSWA 2D3ZA 2RNAA 3WXMB 5F3ZA 3LWMA 3UR0A 2D3O1 3IWLA 2D3OR 3UO0A 2CWKA 1H0HB 2YPZA 1RTIB 4ZJOA 4IR1A 1R31A 3FZBA 2F65A 2JTFA 1M2VB 2JNGA 5I11A 4IKFA 1NK4A 1RAOA 3BKUA 3FFIB 4A53A 1OX8A 3BF4A 3RJMB 2WSFC 1NK8A 1DAXA 2VG5B 3TNVA 3G82A 4CZCA 2LX9A 1O8BA 2YUPA 5CVIA 2B9YA 4PWUA 7AT1B 1SH3A 2V1RA 3D7SB 3CCEA 2DNPA 3I9QA 1UJ0A 3M9NB 4WPAA 2KRBA 1UJYA 2V67A 1W2BP 5JVHQ 1N0UA 1VQ7Q 3SD4A 1MROA 1NBEB 1E6HA 5A8WB 4CIOA 1JKHB 4JLIA 4RW8B 3KDOA 2K1RB 2C3OA 3RUBL 3PR5B 1WF2A 4FF1A 4QU6A 3INZA 1RWVB 1WGSA 2IHR1 1XWLA 2FHKA 3CT9A 3VAHA 5DLGA 3GB0A 3JAMU 2UUCJ 1LWCA 3IM8A 5DRKA 4M7DG 4LF5F 3PACA 1A7GE 4B3OA 5HN0A 1S6QA 2DL8A 4UOCA 2XM3A 2PEHA 4G65A 5KOXA 1FDDA 2D0NA 1X6GA 4LRAA 5GAOp 4W98A 3BZQA 3R3TA 2CJQA 2P84A 1FXDA 4NS5A 3QJJA 4RO0A 1ZM4A 2HRTA 3GMGA 2OD4A 2WACA 3TVTA 3R7NB 3QO3A 3GIMA 2UXCF 4PJMA 1M90T 1Q1KA 3DU6A 3JSMA 3AJ1A 2GGPA 3FCVA 4KQZA 3S6EA 3DRXA 4QQBA 4ZVPB 4CRIA 3QYGB 1OY6A 4F17A 4TQSA 3MMJA 2ZH5A 5K14B 3RIRA 2XEXA 4M7AF 3LW5C 4WF2A 3NAHA 3LLRA 4XTYA 4JV5F 3CMAQ 3QAEA 1N5ZA 1UJ6A 4J6WA 1DBDA 2DGUA 3FEZA 3GFYA 5HMYA 5FU6C 5KG5A 1FCAA 4P9SA 1IXDA 2E1RA 1RAGB 2ZJRQ 3H4DA 3T5JA 3ZBDA 4OVAA 4ESRA 3G9CA 4C5HA 4O4RA 2MZJA 1NO8A 5ETVA 2XHWA 4E7HA 2ZZTA 3ETOA 1VQSA 2F8EX 4WXOA 2QMWA 1T05A 4JB8B 2YNGA 2RDDA 2DGTA 3I82A 2ROTA 3BDUA 4GVBA 3M56A 1RABB 1BQMA 2LCWA 2KR3A 3RBBB 1P27B 3CC7T 4Y65A 4K4WA 1NH7A 4M5DB 1FFWB 1RKJA 2VL1A 2Z57B 3TYTA 3H0PA 2E5IA 3CCMT 2LDMA 5F9NA 1SJFA 1OJ4A 4PFOA 4B6MA 5AT1B 2RQMA 1GCPA 2CPEA 1S77D 2VGMA 3SBMA 3OVSA 3EGWB 1UGPB 3W63A 2BV3A 4O3QA 5IC4B 4A4EA 3HVRA 3MOJB 2KL8A 4IH5A 1YJTA 4DU7A 3QWXX 3OSVA 4DXLA 4ELUA 2FZGB 1NJWA 1RT4B 3RDVA 4FPIA 4ZNXA 4OI2A 1T0TV 3V7CA 2YBVA 1R0BG 2BOAA 4C11A 1VIXA 1EP4B 3PYDA 2OTJA 4MT1A 1FWZA 2IJRA 4IFVA 4LR7A 2O5DA 1WELA 5THWA 1N56A 3D68A 2Y90A 3DM2B 4CM0A 4LUEA 3DYAA 1JU5C 4ZJLA 2AHJB 2UXDF 2IRUA 2CJAA 3W66A 2W2QP 4HVWA 1N32F 4DV3F 4N8NA 4M77B 3SFMA 3UD3P 3OFEA 1SKSA 3DLHA 3IRXA 3VUBA 4ZIVA 3GFZA 2MDAA 5D0GA 1I5LA 5KYWA 5J2MB 5C42B 3W8PA 2XHCA 4Y28E 3W8GA 5DG7A 1X2QA 3JCMV 1VQMQ 4K2JA 2C42A 4J9NA 2X3XD 5KT2A 1VQOT 4PJNA 3UPUA 3BO3A 4LF9J 1D3WA 1FJCA 4DR1J 1TKXA 2CP5A 4CLWA 1RWWB 1CULB 1CQMA 3EDRB 3VS3A 4L3NA 2DCUB 4K4VA 1GX5A 1WHXA 4KGVB 1LFPA 3MUVP 4ID8A 5I2MA 4IUUA 4QQ6A 2E5KA 1VQPQ 4IDKA 1PCAA 4F7UB 2GHVC 4ZCMA 2DTJA 3CC2S 1ZAWA 3I6PA 4GVLA 2BJ7A 5IN1A 5ETNA 4ECYA 4FYYB 4EBDA 5JJBA 4X84A 1UTAA 1UZDA 2FB7A 3IA0A 5KH6A 2DNHA 4HI2A 4X4QA 1QMCA 1H3DA 2CQHA 3KLIA 2V26A 5HAOA 2QA4Q 3FCHA 4ZPAA 3T1YF 3RB6A 2FO0A 2A3LA 2O66A 2MLXA 1UVNA 2C0TA 4Q5VA 1WG4A 4IUPA 1R43A 3NY0A 2J0XA 3CB4A 5KFQA 4WE1B 2QLBB 1HPZA 1C2PA 3NS6A 4NXNF 3KMQA 5DDQC 2IAJA 2V1QA 5CCAA 3PFSA 3DDIA 2X35A 1SJQA 2E5JA 1BI1A 2EKNA 1Y0HA 2QYCA 4CO4A 2BANB 1KR4A 4A46A 3I56A 3D1OA 2KRSA 3QT8A 3V6JA 4EZ9A 3R5CA 4C8LA 1HBOB 1QUVA 3QGHA 1QSSA 3L2WA 3RRGA 4QVDA 2KG0A 3CPWS 4X4NA 2G1DA 4I0WA 1TFYA 4O3OA 5KFUA 5DG9A 1VC0A 3OYJA 3CDEA 1N88A 4ZGDB 4PABA 2JC1A 3JQMA 4QIGA 2YUNA 5I22A 4M78G 5T7LB 1VQMS 2WSEC 4CH7A 4FYVB 4OP0A 2HQDA 4BCAA 5KFNA 1NHVA 3N6NA 2V4RA 3M6UA 1FXRA 2WOMB 3N79A 5CABA 1NK9A 3P96A 4CO0A 1BCMA 4JUVA 3IR7B 3FRYA 2QA4S 2AJ4A 1FTRA 1FKOB 4NL3A 5JMNA 4JZ3A 2XS5A 1M1KC 2JNJA 4DPXA 3PRVA 2K5LA 2E9RX 2QO3A 2CP7A 2HW3A 1HQEB 1TUDA 3SEMA 3BN7A 2FB0A 1D8ZA 3UCGA 2J6UA 4NYOA 3M9QA 1Y96B 4DPOA 1WG5A 3M8QB 2MAMA 2BXJA 3CF5Q 4RTZA 3W3SA 2HK2A 1BBZA 1D9DA 1T3LA 3OYNA 2X4WA 2XMJA 4N56A 2CPZA 2ZBRA 2X1BA 5E33A 3OLAA 1IBMJ 2DXBA 5AJ3J 3GF5A 1L3UA 2F1FA 4WJBA 3PTWA 2BQ3A 1NZAA 2PDAA 4M7AC 4RJVA 3KHHA 1JQQA 3FFIA 1JXEA 2VBXA 1VQKA 2GNCA 1T03A 4LF7F 2RI5A 3I87A 2J7IA 4ANEA 1RP5A 1IREB 4H4KC 5IWAJ 5ITHA 3K57A 1QCOA 2E64A 4B9WA 1IJEB 2H9ZA 2DTOA 3EXCX 3CC7S 4NLTA 3MAQA 4TNOA 2GCXA 5B0BA 5E3PA 3LH0A 1M0SA 3G6ES 3FMWA 4C0DB 2V5HG 3BH6B 4FNHA 2E3IA 2DFUA 2RS8A 4F26A 1YJWQ 1PD0A 4ELVA 2R8JA 4GKKJ 1VQ4A 2QDLA 2L9NA 3HSGA 4NCAA 2CPYA 2HG4A 2CPFA 5I3QA 1BIBA 1YG0A 1FJEB 3J81E 1W25A 3EMTA 2D0QB 1KTVA 1ZS6A 2CJXB 2Y4XA 2V8DA 2VG7B 4R8UA 3CJSA 2HEQA 3IS9A 5J2PA 3OYGA 1W2BR 4I7FB 4U7UD 1GMWD 2E7XA 1HQUB 1L5UA 4OYIA 1WC5A 2KXHA 2B3TB 3DGVA 1VIOA 2GVZA 1XMQF 1Q7YR 2ABYA 3HHKA 4FP9A 3Q2TC 4IURA 1NK7A 1TL3A 4LBPA 2CWXA 1QVGA 3UFCX 1UEVA 2AT1B 2DYBA 3EPGA 2IBKA 5CZVA 1T8EA 1RAEB 3SQGA 2DD8S 4KGKA 3J7AN 2C2RA 1QVFA 4LQ3A 3SV4A 4O4GB 4DV1F 2KYZA 3PY8A 4XU3A 1YI2Q 1YBYA 3OB9A 1HBUB 5B0AA 4DDFA 2HNZA 1EKSA 2YNGB 3RG6A 2MF2A 4EYIB 1PJ6A 2HSPA 2FVCA 5CYQA 3CCSA 3UWTA 1M2OA 2H5IB 2IPOB 2HHWA 2COZA 2O9VA 4DFKA 2VPYB 3DMJA 2RHIA 1U26A 3M5AA 4LDVA 1WOPA 1W70A 2WBMA 3N5BA 2CH4A 2CNNB 3S3NA 1UHFA 1UTIA 3BSOA 4W90B 3FUYA 2GC8A 5K5MA 4LBHA 2KVQE 3M8PB 4KT0C 2HFNA 4OZ2A 3FNNA 2R8KA 1S99A 4C92D 2DL3A 2DKOB 1F2HA 5GVQA 2FGCA 4YS2A 4PAAA 1AROP 2DXDA 5BJRA 4HDHA 1LOJA 4TXSA 1Q95G 4I2QB 2PGCA 2ZBQA 3G8SA 3L09A 3D9BA 4WFNQ 4TY8A 2E5QA 1GXTA 4DV7F 4GKJF 1JX4A 3MPDA 4KHRA 4OX8A 2MQLA 1X75C 3VR1A 1B7TA 2K7JA 2KZZA 2FJEB 3U1NA 2QA4G 1NDKA 1S1VB 3T1HJ 1TR0A 1JJ2S 4DSJA 2VG6B 4X66F 2CS7A 4BI3A 2M0GB 2NXEA 4OMFB 4NI2B 1R27B 2W9CA 2VWFA 4OJHA 1BK2A 3MCAB 4LF4J 3CBPA 4UOHA 3H59A 5LJ5d 4OMQA 2IM1A 3MTJA 4UQTA 3LX7A 4C97A 4R56A 5HKCA 1RBOB 4DF8A 1AZGB 1UPPA 4LSNA 4EGLA 4ZGJB 2EGEA 1KNZA 3TJ9A 1OPLA 2I2YA 2CFXA 5DQHA 4A8WA 1UETA 1KTQA 3K5LA 2L3PA 4X4PA 4RW9A 4DL4A 1S1WB 2NUPA 3A3PB 2MQNA 3V2UC 3RMSA 5ETOA 1VQLQ 3CCJA 3OS0A 5H9FJ 4C8QE 1IBKF 1UWBA 5G0RA 1PSFA 3CDAA 2RK1A 1C1BA 2YWWA 1QTNB 1BD6A 2DEIA 2Q3PA 3LAKA 5DETA 1Q86C 1MV3A 1UUEA 3HSDA 1AZEA 1DZ5A 4OX7A 2CSIA 2NUTA 2I0XA 4H54A 3S6WA 4HXJA 5K20B 2ZOGA 2Z2YB 4O3PA 1VOMA 3KJNB 2P4RA 4CO3A 2FY8A 2GFUA 3RERA 3LQVA 3TANA 2YHTA 4C92E 2MSSA 2C2OB 4FKYA 4LDWA 2ACYA 1C1CA 4CLKA 2D9OA 2D9TA 2KYBA 2EFIA 1LWEA 3J81j 2HK3A 1VJWA 1XIQA 2GGPB 2DRBA 2PFFB 2VQEJ 3W1YC 5L1LA 1I1JA 3M0SA 4PJOA 4NXNJ 3Q89A 5F8NA 2CUDA 1LXJA 2BW2A 3WQPA 3J81U 2VVKA 2E41A 4O6JA 1U1LA 3P3DA 5GMKa 1HBOA 3QO9A 4WK1A 3U1MA 3JCMh 1Q78A 4C8YA 2O4XB 4NASA 2YXLA 3C46A 1Q8LA 1VQNQ 2X51A 4OYWA 3T9NA 2PMHA 1MWYA 2EJFA 3G6ET 1KEKA 3CIZA 4X4VA 2Y8WA 2IVWA 3MP6A 3EZ5A 2CZ1B 1B34B 3DRRB 4DR4J 2MTLA 2KO1A 4FT4A 2MMPA 1BC6A 1XEZA 1S1XB 1NEBA 2AV5A 1T9TA 2ROLA 5A8KA 1MMDA 4X62J 4M63A 4Q8EA 3U27A 2XIDA 1PJ7A 1HMVA 3HHLB 1NYGA 5KFAA 2JMAA 4DOWA 3CCUT 3ZC4A 4WZMA 1JXVA 4DS4A 1S7HA 1SF9A 3WVEB 1MMNA 1RYRA 4JUZA 3UF4A 3CVKA 4BC7A 2V8KA 4AFZC 1KVJA 4KV8B 4A54A 3BREA 5FLXY 1IUJA 1S5ZA 3PV8A 1SC3B 4XTXA 1KHWA 3W9HA 1K9MC 3KG0A 2DE0X 1KQKA 5CKHA 1X4BA 1HBMA 2ZH6A 2QQRA 3DRSB 4P74A 4DOZA 1O0PA 4N4HA 1S0VA 1TKTA 4GKJJ 3NWGA 2LEPA 1N5TA 4PR6A 2O9SA 2XS7A 4M77G 2QYGA 3DRYA 1WHKA 2MKJA 4X34A 2Q43A 2DZCA 4B9XA 2RKIA 2WVBA 1M1KU 3R1LA 4HACA 1RWPB 1X5SA 3JQJA 4Y00A 2JEJA 3ZTRA 3QZ9B 4EMKC 4XDDA 4DS5A 2CZ0B 3J7YU 1RBAA 1PNJA 4NLQA 2V2ZA 4USTA 3RU0A 1YCSB 1CBKA 2HS3A 3ETMA 1U48A 5K8OA 1NU4A 1OYXA 2WBRA 1HYSB 3IR6B 4Y2MA 1ZBTA 1H641 4PXDA 2QGFB 1WI6A 3HVWA 3ZFJA 3OYCA 4F67A 2NXNA 4RU9A 1ZSZA 2EW9A 4WFYA 3OYAA 3CJ8A 2QT7A 1V3RA 1YP5A 4MZPA 1MLAA 2V6AA 4NA2A 3KG4A 3DLJA 3C6UA 4YB6A 3VCDA 2RB7A 1JLBA 5KE2A 4RTYA 4MKYA 3I56T 4N0AA 1VRUB 2KFYA 4QR2A 3I4HX 5IXBA 3C16B 4B3TF 3V4IA 5LSOA 2AX0A 5DQGA 3OFGA 4WKYA 3JCMd 2J0SD 3D54A 2O4XA 3CC4Q 1W7WA 4BDPA 4PJOD 4ELTA 1FX2A 1VQ4S 1IKWB 4ELZC 1VIFA 2B6AB 4FXVA 2B9XA 1ZOTA 4O3RA 2DJQA 1EQ0A 3BDEA 2DETA 4M78C 2UXCJ 1EETA 3AD9C 3FLGA 1U3OA 4B9SA 5ETTA 5E3RA 2IBOA 3MUTP 2JC0A 2YKAA 4WP3A 4Q8FA 5L8RE 5J2NA 1SPKA 1JJ2A 1I6JA 3MAHA 1S1TA 1F9HA 2ZKTA 2PEBA 2IRXA 4BHQA 2CQ2A 3PIPA 3Q8RB 4RLEA 3A98A 1M3AA 3I9ZA 4URSA 4E98A 2XNRA 2DIQA 1N34J 5KFLA 4URGA 2JLEA 5G0RB 2V69A 3O44A 3OUYB 2HFSA 5F0UA 4V19J 4DV0J 3GIBA 1I0CA 2PSZA 2DGQA 1S9FA 3TW0A 4QKUA 5HLFA 3MEKA 2Q6CA 2XMKA 3B4DA 3PGGA 4CI0B 2MQPA 2FPDA 1HI1A 1BU1A 2XO7A 2OH2A 2LQJA 1YI2A 2R7TA 4DV4F 4DL6A 2QA4A 2W9CB 3IBFB 3DOKA 3L4BC 4I64A 1SV5A 2DEUA 1TAUA 1RAIB 3UD5A 5C2GA 1UJ5A 4C8QA 3JQKA 3NGSA 4ZOSA 3POTA 2V4QA 1NLPC 2A0FB 5F8LA 2X1AA 3NNCA 2GF7A 2XDDA 3MM7B 2RQUA 5HK3A 3BGUA 1IZ6A 2J6KA 2ZPBB 4OMMA 2DEJA 1EHWA 1SHFA 4ITSA 2KI7A 3D2WA 3D1HA 3QGPA 2LJ0A 5E0OA 3Q24A 1WIEA 1PO6A 4RX6A 4DSLA 2QGGA 4CLPA 3AHPA 3S3OA 1MSWD 2XMWA 2BJ1A 4ZVSB 3C6TA 3TI0A 3BH7B 4K7QA 3RB4A 2XNQA 3OYIA 2IMWP 3T5LA 4OZLA 5FU6B 1VQPS 5GMKh 4XU0A 3MGJA 5B0CA 3QSIA 1RU2A 1OI1A 2CQPA 3ISNC 5C6SA 5GMKl 5CCLA 1P1TA 1T7PA 1UJ4A 4ZTJA 1HD1A 1VQ4T 1ABQA 4F0HA 1YVFA 4X4TA 1M5KC 1GL5A 3H9NA 2FHJD 3MR6A 2H54B 4KRWA 1RTJA 3M0TA 5B0GA 2R9LA 1QM9A 2PMZD 1U47A 4HTJA 4OF1A 4CLUA 3HT3A 4A4KA 1UEUA 1HNXJ 5KG3A 2F2WA 2XTJP 1HL6A 3W9IA 2VHGA 1NHUA 4LFCJ 4H4MA 4BUGA 3N0VA 4PNOA 4DL3A 2H3JA 3ZTPA 4I2PA 1NM2A 1C1AA 2AZSA 5F8IA 1KFZA 2DZ9A 2DCLA 9RUBA 1M27C 3JSBA 3L2ZA 3NGUA 3PE0A 4XTZA 3B8HA 2HQIA 3PYFA 3QWPA 3KWMA 3M1VA 4M8LA 2OPRB 1M1HA 3TREA 5EDWA 1VQ5A 4NLSA 4P52A 3CCST 1RTDA 1SUQA 4AUKA 3PX0A 1JB0C 4Q45A 3FBEA 1PG5B 5GADI 3DRRA 2XK0A 1VR6A 3RTVA 5IHNA 3MURP 1X5TA 1ELOA 1FRXA 2HNIA 1K9MT 1XERA 3CC4T 3MEEB 1H7XA 2DR6A 2YX4A 5GAHU 2VONA 2YKMB 3GR0A 4OFZA 5HANA 2FRYA 3OVBA 3C15B 5IZHA 5LM7E 2ZOMA 2NREA 4Z37A 1RWOB 2YXYA 3G96A 2HFZA 3VAJA 1ZX6A 1PRLC 5ECAA 3ADAC 3MP1A 3KJVB 1WDXA 3GCWP 3MM5B 2MQMA 4ED4A 1WC1A 5CQYA 1QAIA 1VQOA 5KT6A 2E1MC 1ACMB 4DEXA 3QPIA 3MR2A 4LXCA 4Z8AA 2HBQB 2XMFA 3C95A 1X0PA 3PVQA 3CPWA 1FFGB 1JJ4A 3G6VA 5H9FK 2AU0A 3A8IA 4YHHF 4LF8J 1NB7A 2W2MP 4DR4F 5DZ7A 3MEGB 5KTQA 1EIFA 1RLQC 4FCYA 4ZMMA 1HR0F 2KM8C 2DT9A 1DJ0A 1S1TB 3BJYA 5HJXA 3FVYA 4NRTA 3QHSA 1ZM9A 3JB9k 3CMET 3OXGA 2ZE2A 2QAZA 3L95X 4R0KA 1R6VA 1KOHA 5B09A 3PJ9A 4M78A 4J9CA 3UDEA 3GILA 1LQ9A 2DITA 1X5OA 3GQCA 4OX9J 3JCMW 1ZYQA 3NMAA 2V8GA 4N77A 3HPWA 3CPWP 3QT5A 1U2CA 2ZEJA 1WHVA 4OIXA 3HSZA 1YIJQ 3QIIA 5KFGA 2JJ4D 3H5XA 1JB0E 2J5AA 2KFZA 1JXLA 3X3UA 4TLQA 4NI2A 2DY1A 4BY6B 2ZD1B 4J9OA 1JNZB 3CNQP 3L3CA 1WHHA 2KMTA 1AD5A 2LQ8A 3QLHB 3CCQA 1XQHA 1FI4A 4E47A 1NMEB 1SC4B 3EFOB 2YLCA 4PG8A 1M5Q1 2ZC4A 1H92A 2K6DA 3WC0A 1JJHA 2FGOA 4M75G 2P6TA 1IBKJ 4J9EA 1Q7YU 2D3UA 3MEVA 4WTOB 3NNHA 3QFHA 4L74A 3SDZA 5A0GA 3DXSX 3RZAA 4ED2A 1FA0A 1JLAB 4CM2A 3ZEHA 4NYZA 1H6KX 1GX6A 2DMOA 1IBLJ 1P8GA 2RD5C 3J80U 5D6XA 2FYXA 2B86A 3TA2A 5ETQA 4FBTA 1TKZB 2DR5A 4Y2CA 6FD1A 4KO0B 2NLUA 4DV6J 4JOUA 1K73U 3QJYA 2RI2A 3M05A 1K44A 3HHTB 1UCNA 3HP6A 3H8ZA 1JLFA 2XC9A 2WCXA 4KJIA 3KLIB 1LNQA 1FEEA 5JXSA 6AT1B 5GAMd 4O3NA 4BS2A 4C8QC 3HL8A 4EMKA 1WHGA 2ZBCA 1U06A 2RKIB 4FNIA 5BR8F 1G3YA 4B3SF 2EQMA 3DMJB 1E6YA 1MNDA 2K3XA 1OZ2A 3P49B 1B0VA 3PEJA 5U47A 3H6ZA 5LJ3e 3EYZA 3HHEA 1J27A 2KKHA 2DNLA 5DLFA 1FMWA 4PG5A 4F2RA 3FC3A 5KFXA 3RYLA 4CLZA 3BDPA 3L7PA 5IXUA 1QE1A 4IRCA 3EXYA 4NA1A 4F4YA 3OYHA 2B6AA 1JMTA 2OPSA 3ILIA 5B0EA 2VXFA 5L9NA 4ZLJA 4JI2J 2YKMA 2K8GA 2P9EA 4USUA 2FHDA 3CMEA 2C06A 1FRIA 2MGZA 3F44A 4J9QA 4C8KA 3C16A 1TP7A 1NG2A 1CKAA 3CPFA 4ZS6A 3LALA 2Y1LB 1IKYB 3CEYA 3EICA 1QLNA 2UU9F 4C8QF 3QIPB 4N41A 1NSPA 4CC7A 1V5VA 5D7UA 1BWVA 3D67A 1HNZF 5DDRC 3I32A 4NLRA 2AEMA 4ILMA 5FLXU 4X4RA 4P2FA 1CC7A 3FB9A 1N33F 2P5VA 5JVGQ 4TYBA 3NNAA 3GPLA 3C66A 1YGYA 4DBFA 1C6VX 2V4JB 4C92B 3EGNA 1QAYA 5IM0A 3TAMB 1VQ5S 2QTVA 1KOOA 2EWHA 1OSDA 4P10A 2GZOA 4HT5A 4ZCLA 3CMEQ 4IUTA 5LJ5g 1YK9A 2E9TA 4C8QD 3BBBA 1HHSA 1MMLA 2O67A 4WYLA 2I6WA 4AYBD 4IUFA 2EVZA 4OQJA 3PYGA 4NL2A 5LXRA 4F7UF 4LVNP 1XBWA 2DBMA 4R0EA 2JEIA 2YY3A 3X1LB 3B4MA 1YITT 5GAOl 2ZOFA 3B54A 4C0HA 2KNBB 1SQGA 3PW4A 1RA6A 1RHJB 2DEQA 2AHOB 3TX0A 3LF0A 3M7VA 1AFIA 4MTPA 2GQQA 2LQWA 4IOAQ 4KAIA 2QK0A 4EFAC 5F8GA 2EQUA 2CT3A 1NJIU 4EI2A 3KK2A 2QEXS 4DR7J 4WF9Q 1TK5A 2BZYA 3RBEA 1DURA 4OI3A 4GLMA 1RJJA 2RSQA 2R7WA 2LQ5A 2UUTA 2L89A 3B78A 3BGRA 4C0ZA 3JB9H 4LSLB 2E1CA 2AZ3A 2GJIA 3VKIA 2BKOA 2HQCA 5I3PA 2YDLA 2DRDA 4HT7A 2JMCA 3JRZA 1OMSA 3DLKA 1DARA 2C0IA 1WOOA 3FRNA 4KPYA 1PC5A 1WEZA 2K5IA 3T1HF 2QMXA 4KV8A 5A6WA 5LSLA 3CD6T 4F36A 2ZHAA 1T9VA 5FDLA 1HWLA 4CC4B 2JFKA 1RAAB 4Y92A 4M7DB 2HHQA 3LANA 5D4NA 1HNIA 3ZTQA 3GG1A 4FPRA 4JJBA 4P7TA 3CMAS 3E01B 3ZZ0A 2QTWA 3HHLA 2MY8A 4USVA 3FC9A 2E1AA 2W1BA 4LDXA 2WOMA 3EG2A 3SXLA 3LWHA 1FRHA 3OVAA 1WC6A 2GS8A 3X28B 4UZBA 2OPPA 2JEGA 4NX9A 4KH1B 1AFJA 2EFVA 2KXNB 4PJOF 2DNQA 4HEA9 4XDCA 2YWHA 1N48A 4XU1A 4QIWD 4J7FA 4RU2A 3G7ZA 1YI2T 3VS2A 3G6EA 3JS9A 2YQ1A 3FDSA 2GX8A 3M30B 4ZPBA 2ALYB 2A18A 3NS7B 4V1Ak 4RTWA 2GMHA 3VS0A 2HHVA 2XLJA 5IH2A 1IKVA 2IC3A 3BEGB 1I81A 2QYZA 1NUEA 2R58A 4U7CA 4HVUA 3F41A 2NUHA 3DDKA 4MMOA 4DPWA 4OLOA 4JI3F 1UA0A 4KGXB 3A4TA 3M8PA 2DIGA 3R2CJ 2F5KA 2KSSA 1KD1R 3OBWA 2CNLB 1TZ0A 1DFDA 1TL5A 3CWJA 2C2ZB 2DRAA 4HHHA 1FDAA 2VFUA 2EC2A 3OL8A 3HI9A 2FYKA 3JV3A 4PWDA 2JVVA 2YH0A 3ZZTA 3UN5A 2V0NA 5ETSA 4EO8A 3EX7B 3C14A 4DLEA 5KYXB 4K8RA 2PO4A 3MM5A 1YZ6A 3KLEB 1YJ9Q 5K9FA 1SEMA 1N5SA 3TARA 4ED3A 4JI8F 3OYYA 4U6PA 5DDOC 4L75A 4MIBA 4MH8A 2QL9B 4CH0S 4DL0C 3G4SS 4NZ7A 4ED7A 3MFIA 2DRKA 2HL5C 2EG1A 3T9ZA 2UU9J 3G82B 1EX8A 2NCKL 1GTHA 4MDWA 1M1KR 2FVRA 1FTCA 3F56A 3OBIA 1OPKA 1S4EA 3ZZOA 5F9LA 1X01A 3GONA 1F3FA 3C3LA 4AE5A 4M77F 2R7QA 1AT1B 1F3VA 3NWRA 2NR0A 2V2QA 3SI8A 3HFZB 1ARKA 3N4WA 1UEBA 1MHNA 1WXBA 1MW7A 4F0MA 4WP8A 3UVJA 1OPIA 2BQRA 4KUDK 2RHQB 3GCXP 2D69A 3US5A 3L7UA 4DR6F 5A8KB 1JEGA 3UCZP 1UDLA 3ILOA 1YFNA 5GMKe 2WZ1A 5GAHI 4EYHB 3CJ0A 3DI6A 3W5ZA 3BE3A 3OTOF 2ASDA 2BKNA 5HROA 1KQ1A 1VQ5T 2PVDB 4L6V5 3H42A 2RHZA 5RUBA 1JQGA 2DH8A 4F4KA 2MKHA 5KYUB 4RNOA 2HQHA 3A3NB 5AE2A 4KFBA 3OFFA 1IB8A 2F9DA 4FZVA 3Q8QB 2HZAA 2K7AA 4FN5A 3HDSA 1RHKB 3ZFVA 3MM7A 1WQ7A 2AJ1A 1DQ8A 2W7OA 3KHRA 2RNEA 5HBMA 2M02A 4D8KA 3JTOA 4JYAF 2A6MA 1K73R 2ZPIB 5J26A 4B3SJ 2E10A 1SV5B 2CZ4A 3MMBB 4E7JA 4DPTA 3A8HB 1YIJT 3T5HA 4OV6A 2DGVA 2DERA 4KR0B 4K4UA 1N5YB 2HHUA 2QMUB 3SMZA 4LFAF 2ZH2A 3RKWA 3DLGA 1VQMT 1JLQB 2EFGA 1N52B 5GAOn 2HAXA 5MAOA 3DU5A 3I5BA 1YITS 1X43A 3ELHA 5KFVA 1TUCA 3IG1B 4XAXB 2CG4A 4EPCA 2L08A 3G2XA 3CBOA 2OUGA 3MHYA 1Y96A 4J6YA 5LJ5j 1QUPA 2GVZB 2W0ZA 1RLCL 2BJEA 3LA0A 2COWA 5HK4A 4FW1A 3IBWA 1YRTA 2RHUA 1I51B 3E9FA 4AD6A 1S1WA 4ID5A 3GYXB 3AHUA 1R8AA 2XZDB 4DG1B 4DV5J 3S1TA 4K59A 3Q86A 2CJ9A 1ZAVA 4YB7A 2V9KA 4FIBA 2EAYA 2Z58B 1UECA 1EIYB 4FYWB 4Z02A 1R8CA 4LVOP 4RBVA 2VUGA 4RTVA 4FU6A 1X8DA 1DJ7B 1DHMA 2FJBB 5FWCA 3UNGC 5LJ5h 2VJUA 2KT5A 1VK8A 2EBGA 4N4IA 2XYGB 3M53A 2E7VA 3EUNA 4MKVA 5CO7A 4OYAA 1KHVA 1W26A 2ILYA 4M5MA 2WW4A 1S6UA 2G0CA 4LFAJ 3PX6A 1TMJA 3CXCR 4G1QB 2EPDA 3FEOA 3BS9A 2KG1A 2LJ3A 1NDPA 2KYXA 4M78B 1H7WA 3K2YA 3M0PA 1D1BA 3TEEA 5HLFB 3EVWA 3HHLC 5H9EK 1F9EB 4PFZA 4DL5A 5KYNA 3GP8A 4FF2A 4Q7AA 2GIFA 2CJBA 2I8EA 2GAHC 1ZSZB 4X1VA 4X2BA 4DR7F 1KLMA 2YRDA 3SDEA 3TA1A 2CDRB 2KH9A 4ZITA 1CS4A 1J3TA 1VBXA 1KLNA 2ZWOA 1N6QB 4XTTA 4X65J 1D1CA 4RUCA 2RT3A 1YNZA 3UVJB 4BI4A 2IM3A 3H7HB 3CJ2A 3BFMA 3IMQJ 3TUJC 1CSJA 1K0SA 5J2NB 2GMJA 1JXMA 3M2VA 4IO9Q 4X62F 1TV6A 3LUYA 4EO6A 4OX6A 3KJVA 2UUCF 2DXEA 4PG4A 1TQLA 4B9LA 2QJ3A 3S7RA 2L3QA 2GIRA 2QL5B 4CYUB 2R2TA 4P72A 2MKIA 2M9UA 3W5XA 3QJLA 3BQ0A 1RT3A 1IN0A 4CC3A 5CHCB 4QZVB 2XCAA 3MUMP 4C48A 3HMJG 1VQ6S 1KRPA 3UT1A 2CQBA 4F3OA 2LTOA 1M5HA 3BR9A 3PXGa 2CKWA 1RT6A 2HURA 3O5ZA 1MG7A 3O5TB 1OQ6A 4KHPJ 1OOTA 2G2YA 2WK4A 4QQGA 2JSXA 1YBUA 3UQSA 2GJ2A 1ZBXA 1ZTTA 4USWA 2LT1A 3A8LB 4NLDA 1XR6A 3G4ST 3DYAB 1NKEA 4YQWA 3DM2A 2JM8A 3OD2A 1WKKA 4IFYA 1JIHA 2BIVA 3LP1A 3FEXB 4CP5A 5J2QB 1WZOA 1IR1A 3HVAA 2XMMA 2JX2A 4UF4A 5LMUF 2DBKA 1XMBA 1LW2B 3SV3A 3FQLA 2MMYA 2QLFB 3MPYA 4J5OA 2UUAF 1IGQA 3JCMg 1D9AA 3OMGA 2WVFA 4J8OA 5GAOm 4EBCA 2N3OA 5J1EB 3QRQA 5KT3A 2NYHA 1L3VA 1WDDA 1UG1A 4JI6F 3CCVQ 3BB5A 4YN3B 4ICLB 2YKNA 2L48A 1U7LA 1ZAXA 3HCXA 4PKCC 4EWTA 1JNRB 3LGLA 3A1YG 3Q8SB 4DV2J 2PQWA 1GEHA 4J9UE 1P9YA 2OEMA 3G8QA 2L2PA 1FXXA 2RH3A 1HBMB 3VQSA 1HBUA 3G71T 4LD6A 1Q0NA 4IG0A 3MM6A 3GFHA 1BQNA 2DHGA 4WIQA 2K4YA 3MFHA 4C8ZA 2Z56B 1RAJA 3BO4A 3BKTA 2WSFE 4MK9A 2ZKUA 1NYFA 2FHOB 1GBQA 4A63B 1C1CB 3VS7A 5AXMA 4NMXA 2DILA 1T9XA 1KFDA 2BKPA 4DV4J 2FVUA 3V8KA 1E6YB 4ZVEA 4Y3CA 2IY5B 2QLJB 3OSNA 2QXFA 3RESA 3CD6A 5D15A 3IAM9 4OYXA 4B3RJ 2MYFA 4C0BA 1Q81T 1C0UB 4EMDA 4A4FA 2EK6A 4CI0C 1T11A 2YQ0A 5KFIA 4A8FA 2W10A 2LVWA 3UN2A 3CJKA 1ULRA 4OI4A 3C12A 5FIIA 3MECB 3NXZA 4BWJA 2M8DB 2M0OA 5A0DA 2M4MA 3K8VA 3T19A 3LGMA 1VQ6T 4KYZA 3GV7B 4M75B 3JSMB 2LXIA 2LYVA 5AE3A 4EUVA 1MV0B 3FBBA 4JI8J 4I1TA 1VYUA 4N8OA 4OJ1A 5LT5A 3QPHA 4G1QA 1FWPA 5DM7Q 1S6OA 2KT1A 4O0NA 3C15A 2J8SA 5HO4A 3I96A 1SI9A 4C7QA 1S12A 2AF6A 1X9WA 2CP6A 3EG3A 3AQPA 3IAS9 4I6AA 3RAQA 3CC4A 4ES3A 3P5TL 3IXQA 2CP2A 2HHTA 2ADCA 4HA8A 2ZD1A 4ZLLA 3KHLA 3KK3B 3GSIA 2ZWPA 1EFNA 3PIPQ 1D0EA 4M7DD 1NJIC 1YHQS 1KQGB 3ZXWA 2C1EB 4QW2A 3GIRA 2VASA 3GG0A 4KH0B 3D6FB 1X6BA 2NUTB 2FC9A 1C0UA 1EARA 2HHSA 3EG9A 2ZH3A 2M52A 4FYXB 1PM3A 2WONB 2IG0A 4QIEA 4A4HA 4HCCA 1FF2A 1WHLA 3PEHA 1NPRA 5CXTA 3ITHA 3MPUB 4ID5B 4XK8E 1F5BA 3DN9A 4YTLA 4DV7J 3REBB 1U49A 1Z1ZA 4LDYA 2K1RA 3CD5A 3E19A 4M95A 4CO1A 5LJ3f 1VQLT 3U23A 2R7SA 4OB2B 3RUXA 3UI3A 4XK8C 2XZWA 1UL3A 3VJPA 5HP1B 4KUIA 5AYFA 2LDYA 1LK5A 4S0MA 2J9CA 5DQIA 4ES2A 1VYTA 2KBTA 4LMZA 2QL7B 4IG0B 4HACB 2ZVSA 3DLGB 1K8AT 1HK9A 1S72S 2HZCA 1GBRA 3BGRB 1LKZA 1TVRA 2WW8A 5K14A 1N8RT 5FU7C 3JSYA 4JI5J 1J5EJ 4C8MA 4Y0FA 3MMBA 1OY9A 3ZZUA 3RKYA 3S8SA 2ATCB 2JUFA 3A8MB 1JJCB 1SBRA 3VALA 3HRTA 4RUGA 2G9OA 1S1VA 4PXBA 2CUBA 4PCQA 3JTPA 2ACMA 2W2PP 4B9VA 3OTDA 3PHEA 1BWEA 3G87A 1FMKA 3JSCA 4DWIA 2DTHA 2ASYA 3ME9A 2CADA 5K8PA 1BIAA 3T6BA 3WX8A 2NLWA 1J2VA 3PZPA 2E7WA 3Q8UA 2XI2A 3CCQT 3OHAA 4KE5A 3KXTA 3CCRQ 2XWXA 5A0YB 2DK2A 1RCOB 1X4DA 4M5GA 3KKFA 3TEGA 1RWXB 1B3QA 5DM6Q 4QT7A 3P8DA 3OYMA 2X4XA 4DX7A 4QPTA 1VK3A 5ETKA 3J7AF 5I3UB 3UPFA 2OPRA 2POKA 4ZVUB 2OKQA 3RW7A 3NL0A 4E6RA 3H5SA 2PD1A 3I56Q 4Y6IA 4B17A 4DF4A 1YKWA 3A1PA 2CRLA 1LWXA 1WHYA 3I5SA 5CYMB 1PKSA 1SHGA 4ECRA 1S9EB 4DFPA 3MCSA 3H0FA 3TJAA 4H4MB 3QZ5B 3BW1A 3GV5B 2MB0B 1WC0A 1WJRA 2VBZA 2VDHA 1AYEA 2HLUA 4Z89A 4UW2A 2BVZA 3OYBA 2OJ2A 4JI1F 3JB9J 3OR2B 2BUNA 3QT7A 1YIJS 2K5FA 1SG5A 3I35A 3NAIA 2N7CA 2W9BB 1ZPVA 3H40A 1T05B 3KLEA 2MPUA 4NLVA 3EG0A 2ZE2B 3DGPB 4DCPB 4NLWA 4F3QA 1B4SA 1U4BA 1S72Q 4DOVA 1DY3A 4C0GA 3OYKA 4KTQA 4LF6J 4M78D 4LUDA 1VLYA 3HRSA 1NHKL 4QU7A 3L2UA 1KIKA 1NSQA 1VQNA 2FJXA 1FRJA 3VZHA 2X4YA 2RAQA 3OMCA 3M4YA 3PW2A 1B07A 5ETRA 4PRFA 1NK0A 2FDNA 4ZP9A 3QNWB 2HVIA 1LXNA 4DEZA 1KQ2A 2BA9A 3BYPA 3J81Y 4YB5A 4WKRA 2OIHA 4JBCA 1VQMA 3PRDA 3TZYA 1S4FA 3I0SB 3N5FA 1QJHA 2DNKA 2YSQA 2C3MA 2XMTA 1YJWS 2JZ2A 1D09B 3GIJA 1P9QC 4J9MA 1HHTP 3VGVA 5FRMA 4MK8A 3KLHA 2E3HA 1FJGJ 2ZDPA 1Q5VA 1WTBA 4KGZB 2B51A 5DLOA 5AXLA 2RMLA 2NUZA 2NXUA 5C24A 3CCUA 1XNQF 4IIMA 1NJXA 2EFOA 5F8HA 1WX6A 4RUHA 1XNIA 2F2VA 2CQIA 2BE9B 5FJ4A 1H2VZ 3M32B 4DR5J 2GMLA 1SH0A 2HQFA 2JTEA 2QDYB 1FESA 2DL5A 2WSCE 3OTCA 1RAHB 2F5TX 2B5JB 4YHHJ 4LF8F 2DJZA 2ZJQQ 1ZM2A 2EC0A 1U09A 4ZP8A 5JUMA 2DIUA 1RTDB 4TQRA 5LMNF 1Q86T 4KHMA 1ZA2B 4TY8B 5J1PA 4C5IA 4MAKA 4AT1B 2LEBA 4BDYA 5CAIA 2IAJB 1YX2A 2H5EA 4YFUA 4FM4B 2LCCA 2CZVC 1CJVA 3DRPA 1S9GA 4DQIA 2UVWA 1TUVA 2CGHA 1URRA 4UY8T 2EJ9A 2FHMA 5IV4A 4ZVOB 4N47A 2RHXA 4CO5A 1NRKA 2ZH7A 1CJTB 2C28A 1OWXA 5M2UA 1EAYC 1RDRA 4ORZA 2QLWA 4ATOA 4KKOB 4X4OA 3M9MB 2MZSA 4M1KA 2HVDA 5HVGA 1I3OB 2HS4A 1K8AU 5T7LA 1RUSA 2VKRA 4O5VA 3QBYA 4W4MA 2ZFHA 3A8OB 3OQ2A 1G6BA 1YI2S 3W5YA 1RTJB 1UGVA 2H3EB 2AIRB 3V7RA 1QP2A 5HJYA 5KG0A 5EUHA 1X4CA 3EVMA 3IBCB 2FJAB 3MD1A 3TZXA 4CLYA 4A8YA 1ZLMA 1SC1B 1DQAA 1SL1A 3GE9A 3H5UA 3Q23A 1M5VC 3SB2A 3MM6B 2DY9A 5IT9U 4OZ3A 2PC6A 2GW8A 4BDZA 1VJQA 1RAFB 5EN1A 3J80E 4M75E 1TL3B 3CJ5A 3OQ5A 1Q82R 3AJDA 1PILA 4UOFA 1PAEX 1KHCA 1G4CA 2AKKA 2CJYB 1FNOA 3MMCB 3IC1A 3PHTA 1GFWB 1DLOB 1QWFA 1FEHA 1FD2A 2WAQD 2DPIA 5A2QE 4NOYA 4OHXA 3V6DA 3OJSA 3SQOP 1K73T 2GJFA 4RW7A 2HNYA 4N7TA 3L2VA 4F25A 2JTMA 2E4HA 4XPEA 4ED8A 1OQKA 2SEMA 3GPAA 2Z4PA 4TU9A 2BDPA 2MY7A 4U8YA 3OYDA 1RTHB 5BR8J 5LJ5f 4FYDA 5CKBA 3AY0A 3V81A 3DKMA 4E8UA 3C2PA 2A28A 3QRPA 1WHMA 1NPKA 3D0IE 4JI1J