3P8BB

X-ray crystal structure of pyrococcus furiosus transcription elongation factor spt4/5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
b'AGKIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNKGVVDEAIRGIRHARGVLPGEVPFKEIEHFLEEKPAVSGLEPGDLVEVIAGPFKGQKAKVVKIDESKDEVVVQFIDAIVPIPVTIKGDYVRLISKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase, subunit e''
publication title RNA polymerase and transcription elongation factor Spt4/5 complex structure.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/transcription
total genus 33
structure length 147
sequence length 147
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00467 KOW KOW motif
B PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3p8bB02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 3p8bB01
2LQ8A 2G3RA 1VQOA 1VQNT 3I56A 1SSFA 3G71T 3CCJT 1YJ9T 1YITT 1K8AU 3CMET 3J7AF 1KD1C 2JOYA 3CD6T 3CCVT 3ER0A 1N8RU 5J3BA 3CCQT 1VQPA 1VQ5A 1VQ7A 1VQOT 1K73U 3G6EA 3I56T 4RG2A 3CC2A 1JJ2S 3CCLA 2OTLA 4QQDA 1S72A 2QA4T 1BKBA 3JAME 3CC4T 1Q81U 1KC8C 1K9MU 3CCRA 3I55A 1VQPT 1VQ5T 1VQ7T 2MI6A 2IG0A 3G6ET 1Q7YC 3P8BB 1W2BS 3CC2T 3LGLA 3OW2S 1M1GA 2K06A 1YJ9A 3CCLT 1NJIC 3CMAA 2OUGA 1JJ2A 3H7HB 1S72T 3G4SA 3CCRT 3I55T 3CCQA 1EIFA 3CCUA 1VQ6T 1KHIA 1W2BA 3CMAT 4ZN1A 3OW2A 1Q86U 3PIOA 3G4ST 1M1KU 3PIPA 2CKKA 2QA4A 2JUFA 1K8AC 3CC4A 2XHCA 5HY6A 3CCUT 1YHQA 1IZ6A 1KQSS 5J26A 1M90U 1N8RC 5LL6S 1YJNA 1K73C 4YTLA 2L3RA 3CPFA 3LPEA 1YBYA 3DB3A 1YHQT 4X34A 1Q81C 1VQ6A 2JVVA 1K9MC 5DLQE 1Q82U 3KBGA 1KQSA 1YJNT 1VQ9T 2DO3A 2E6ZA 3CPWS 3CXCS 3A5ZB 5A2QE 1M1HA 4TVRA 1VQLA 2QEXA 1YIJA 1RL2A 1XNIA 1VQ8A 1NPRA 2MWPA 1UEBA 3CCMA 3CPWA 3CXCA 1VQLT 1VQ4T 2QEXT 1Q86C 1YIJT 1M1KC 1NPPA 3TREA 1VQ8T 1VQKT 1VQ9A 3CCMT 2LCLA 1M90C 3DB4A 2KVQG 1YJWT 1VQMA 2E70A 3LGFA 3J81E 2OTJA 1KD1U 1Q82C 5FLXE 2LVMA 1YI2A 3HKSA 1VQMT 1QVFS 2EXUA 4CRIA 3CCEA 1VQ4A 2KDSA 1XTDA 3CCSA 1VQKA 2OTJT 5IAYA 1YI2T 1KC8U 1YJWA 1QVGS 3CCET 3EWGA 3DLLA 1Q7YU 3CC7A 3OYYA 1QVFA 1X6OA 3LH0A 5DM7R 3CCST 2JNGA 5IT9E 1NJIU 3QQCD 2EIFA 1VQNA 1NZ8A 2MWOA 3G71A 3J80E 3CCJA 1YITA 2OTLT 1NZ9A 3CMEA 3CC7T 3CD6A 4ZN3A 3CCVA 1QVGA
chains in the Genus database with same CATH superfamily
3A12A 2H48B 4J6XA 4BE2A 3CMET 3KHHA 4USTA 2OEJA 1IKWB 2Q43A 3LP0A 2BW7A 2EFQA 5EGYA 2J6FA 5KT6A 3V4MA 2PUKB 1M1GA 1SUQB 4PL6A 5D4PA 3DLGA 1E6YA 4Q8FA 2XNQA 1NJZA 2YRDA 2ENMA 1K0SA 2PN6A 3BO4A 2VIHA 2V8VA 3TEEA 1UVIA 3LP0B 1LQ9A 4ED8A 3CD7A 2NXUA 1WFWA 4ECQA 3R5DA 1Q86R 2GFAA 2RT3A 4PQAA 4OX8A 4DX6A 2RB6A 4M7AE 3OBWA 4O23A 5KCOA 2W8KA 1E6YB 1Q82R 1G1XA 4RUBA 4TU7A 4IUFA 5C24B 1FFWB 2C2KB 3AD7C 3L2QA 4JI0J 3TOQA 3CCUQ 4DSJA 1L3VA 1FKPA 4IUPA 4IYQA 1NG2A 2X7IA 3TEHB 4F02A 2B0GA 2PFDA 1X6OA 5HBMA 1OU9A 5CIUA 4ED3A 2C2NA 3AA9A 2CUDA 2X3XD 1HR0F 4TNOA 1IKVA 2VH7A 4KC5A 3BBCA 2A6MA 4NX9A 4CQ1A 2LTOA 1IKYA 2C28A 4NEZA 4J9PA 4ELYC 2DNUA 1FKPB 2KZMA 4MKVA 3EPGA 3P8BB 1NSPA 1KRPA 2EGAA 2YQ1A 4P2FA 4MH8A 5HBMB 4EMKA 3FBCA 1XMQJ 1JJ2R 3IRWP 3L7UA 4YR3A 4M8LA 1I0CA 1SKRA 3MCMA 5ETRA 4HL9A 1IKVB 1U0HB 4X84A 1WHJA 1BQXA 4F4WA 3I32A 2YKMB 2ZPBB 2H9ZA 5L1KA 1SJRA 2OFHX 2KQWA 2JS0A 2MZTA 4JV1A 2WRMA 4K0KJ 3NMZC 3TAPA 3H8ZA 4ED6A 1Y0MA 3GF5A 4C11B 4J9IA 1BD6A 2LKZA 2RK2A 3RESA 3H25A 1MV3A 4AFZC 3HLUA 1W1FA 2NUZA 2DD4A 3GPAA 3QLHA 5LJ3e 1D0YA 4J9RA 4C3MA 2XCAA 3O8VA 2LNHB 1GMVA 3VVUA 2B43A 2BOAA 2QJ3A 4K4TA 2XMFA 5EHHA 2HHVA 1TUCA 1FDAA 2MYFA 3FQKA 3CCSA 4DPTA 3E2UA 2ZBIA 1IM4A 2L9NA 1LNXA 3FBFA 1YBAA 4L73A 1MU2A 2K2PA 3G6YA 4C8LA 2RH3A 5T7LB 5LT5A 2A7YA 1F2HA 2G2OA 2E1PA 1JJ2P 5ETQA 3R5AA 1V29B 2O4XA 1KR4A 4FKYA 4C8ZA 1B7YB 1CSKA 1FA0A 2R5AA 4DR1J 2RRBA 4PWDA 4RPFA 4O3QA 3GV7B 1HQEB 4NZ6A 1ABQA 4ZJLA 1B34B 4DSIA 4DUYJ 2KM8B 3BV8A 2SRCA 2XG8D 1N0UA 1P8GA 2BE2B 2QC3A 3NCQA 3RR8A 4DPUA 3G4ST 4P75A 2O4XB 2LU1A 4WTOB 4LDVA 3T1HF 2XY5A 1FTRA 1YTYA 3HRTA 3X26B 4PWDB 4IH7A 2WHOA 2D6FA 4X64F 3RAXA 4MDXA 2K2VA 1U2RA 1N36J 5ETPA 4C92A 5KFXA 4N5SA 1ZA2B 1VQPQ 2C3YA 1NPPA 3DYAA 4ZOSA 5KFEA 5IWAJ 1EARA 4GMKA 1FWLA 3PM9A 2B86A 3W65A 2B5JA 4OMQA 1RBLA 1XR6A 5L39A 4HACA 1M0SA 4LRCA 1NSQA 2JSXA 2CJ9A 3A8EA 1O8BA 2X3GA 5CD4H 2GQCA 2VPXB 4C92B 2QQSA 2F7VA 2LJ1A 4WCIA 3LOUA 4DF4A 4W92B 3DYAB 5DO2A 2RK1A 4C3LA 4HLBA 2ASDA 2AJQA 1UVLA 4JI4J 2J7UA 1HARA 3G71T 2EYWA 2M7SA 1QVPA 5BYSA 2NSBA 4YS2A 1DARA 3X3UA 4DR3J 4KGXB 5DM6Q 4WF9Q 4FT4A 2V67A 2B51A 3MMJA 3SSRA 5JMNA 4C8QB 5KFCA 1B0VA 4MIAA 1RA7A 1RT6B 1IBCB 5KYWB 1S1NA 4OV6A 3GYGA 4DU7A 2CWXA 4O3OA 1LXJA 3AHPA 5LMUJ 2YVSA 2DA9A 3QAEA 2IAJB 2WSEE 1F9EB 2GHVC 2RQUA 1Q53A 1IKXB 4K4ZA 5LJ3h 3BQ2A 1UPMB 5D0HA 1L3TA 3RRGA 1HBMA 2GIQA 3M9OB 2A2DA 1RA6A 4F67A 4F7VA 4B3OA 3HSJA 3SYZA 4KH0B 2COLA 4WFBQ 1Q0NA 3THVA 4NL5A 5A8RA 7FDRA 3CJ0A 4Y0FA 3AAWB 4YR0A 4YP3A 1GRIA 4I6YA 1PC0A 2OTLT 4L72B 2HZYA 3QFHA 1UA0A 4HH1A 1REVB 2FYXA 1YJRA 1HBMB 5ECAA 2AEJA 4RUCA 3BM7A 4F3OA 5IXUA 2KFZA 2KGTA 3MM6A 4IR1A 4LF7F 5KYNA 3TZXA 3AD8C 4DFPA 5A8RB 3KXTA 4KQZA 2KT5A 3FEOA 2CH4A 1R6YA 4WJBA 2V68A 3PYDA 2J8AA 3DI6A 1CJKB 2NLUA 3W5XA 3FLGA 3MOZA 3GP9A 3MM6B 4QU7A 3W63A 3VR1A 1C1CB 2KXNB 1I1GA 2GMHA 4E7JA 2M3DA 5GADU 4PG4A 3CCMA 5EWGA 3KK2A 3J7Z5 5KYUA 4CP5A 3DI6B 1AFIA 4CLZA 2HHTA 2LX9A 2BJ7A 2CXEA 1SQFA 1NHKL 4URGA 4MZMA 1X7VA 4OYIA 1M8MA 3UDCA 2A36A 1YLXA 1VQKA 1HNVB 2YX4A 2MJNA 5DG7A 1FRHA 1D1CA 3WIVA 2NYIA 4IG3A 4NA2A 2BTTA 2F63A 5KYUB 3JSBA 4JRPA 4NLOA 4DV7J 1PAEX 1RAIB 1RHJB 3K57A 2CDQA 3QT6A 3CCRS 4LF2A 5KFZA 2V4JA 2C2MB 1OYDA 1XBWA 2B3TB 2DFUA 4QYRA 2BQRA 1S72A 3CCQS 3RB6A 2D9OA 2XSJA 5KTQA 1GTHA 2H5JB 2ZZDA 1F5CA 2OD6A 4K4XA 4DSLA 4IG3B 4F7UA 3HKWA 1K9MR 1ZA1B 1RAJA 1D9AA 1RP5A 1SL1A 1M9SA 4F4AA 5KFMA 2QLJB 1HNIA 2DY1A 5KG3A 4OB0B 4EBDA 3FZBA 3O5ZA 1YIJS 4J9VA 2NUPA 3HFZB 1H7XA 4I6AA 4CIOA 4B9MA 2XC9A 3T1YJ 1LCKA 1CQMA 1PJ6A 1YRUA 2K8GA 5H9EJ 2RQRA 4HEA9 3GV5B 1WSRA 2LU2A 4F7UB 3IO1A 1KLMA 4CNZA 3K5MA 3OT9A 3MEEA 4ZJOA 1LW0A 3GMGA 3ZTOA 4J83A 4M77G 1V1CA 5B08A 2DAQA 3RKWA 1OSCA 4D8KA 1JMTA 1GX5A 1RLCL 2IC3A 2BQ3A 1FMWA 5D0EA 4N8NA 1O9SA 4I6WA 3OFHA 1U1NA 3ZZOA 3IN5A 1K9AA 3TYTA 2ZOFA 3CCVS 2I38A 3OV7A 3D2WA 2Y0BB 2QDLA 1LW0B 2V94A 4X62F 2DR9A 5C25B 1R27B 3H6ZA 3HSGA 2B9WA 2JEFA 3OSNA 3TZZA 1RQ0A 5HQ8A 2J6TA 4WP8A 4C9DA 2Y1RI 3EHRA 4LD6A 1GMWA 4RU9A 3QZ9B 2PI5A 2QIFA 3KLEB 2WVBA 5E3AA 1IUJA 3CD0A 3TA0A 3HFKA 4M7DG 4AXJA 2FPEA 3GFHA 1YITQ 2BJDA 2XZTB 4M78E 1A6LA 5EN1A 5HSPA 1GQEA 2KTQA 1KHIA 2GF7A 1W2BA 1U09A 1IGUA 1EETB 3OBYA 2W10A 5FLXY 5LL6S 2PC6A 4M5KA 4DBRA 5DLFA 1BU1A 4UY8T 3RJMB 3J81j 1WGSA 4C0OC 3MM9A 2CQ4A 5GAOr 3W7BA 5AE3A 2CSQA 2Z58B 3EMTA 3GCWP 4QU6A 3W60A 1H98A 2DLPA 2BANB 4JJDA 2EEYA 2P4RA 2QXFA 3M8QA 4FF4A 4DL3A 1Q82T 1M27C 2ZHAA 3I6PA 3EZUA 1VIOA 3AQOA 5HMZA 3JV3A 5HK0A 3MMAA 2JRSA 4E0DA 5IT0A 2D1XA 2V8HA 2DCUB 1VQ4A 3D1HA 5B0BA 2YWGA 2L3QA 3MM9B 4JI2J 1UP1A 1YCSB 1YFNA 1NYGA 2I2YA 5J2NA 1OY6A 3I82A 5DM7R 1NDKA 3E8OA 3WVDB 3M8QB 4HCBA 2DGXA 3UT1A 2DD5A 2BJ1A 2GGRA 2E5KA 2CNOB 3CD6T 4BC7A 4YMEA 1FJ7A 4CLUA 3NCRA 2VG5B 4DG1A 2EYYA 2RAQA 3DLMA 1JXEA 4USUA 3A3PB 5J2NB 1WG5A 3CCLT 4M5DA 1KQSP 2HQGA 1H2VZ 3MGJA 4P2XA 2E41A 2V8JA 2DHGA 5GANe 4DFKA 4NI2B 3D4JA 4Z88A 2COYA 1X5OA 2QK0A 1VQ6S 3KK1A 2APOA 3V6DA 1WHVA 2JTEA 1D3BA 4BE0A 2AHJB 2FZGB 4HVWA 3PJXA 1HHTP 4F4XA 1GCQC 4GC7A 4NLPA 3LYIA 3KBGA 2UUTA 3JCMV 4AXIA 3QT5A 2DEJA 4OLOA 2JZ5A 2FJWA 3TJ8A 3GNFB 1VQMS 2CPHA 3UA7A 2GHPA 3MPUB 1WACA 1VQ8T 3WBZA 3DLKB 4Y2IA 3KK1B 1U25A 3V6DB 1X8DA 1M5HA 2NSCA 1HR0J 5HMXA 2QYGA 2O01C 4OZ2A 5KYYA 3AJ2A 2UP1A 3DNCA 1PSDA 1QWFA 4FM4B 1L3KA 3H5UA 2DVIA 1FWPA 1UVJA 3OTCA 3LGNA 5F8LA 1J5OA 2BZ2A 3GSIA 5CZVA 4AQYF 4M5LA 1D8YA 4IQXA 1UDLA 3ONQA 4C0FA 4NXNJ 1U3OA 4M5MA 4HT5A 3BQ1A 1LPLA 3DDKA 5AXNA 1DRZA 4J5OA 4QR0A 3INZA 1G3OA 4CC2A 4B08A 2BACA 4ID5A 5IHNA 5AE1A 1ZBTA 3EXYA 3PHTA 5A0LA 5LJ5f 2DD8S 3JAME 2KXFA 2OX7A 5GAN3 1KC8C 4OJGA 3TCJA 3TP2A 4PG7A 2FQQB 1YSJA 5EWEA 2J5AA 5IHIA 1U6FA 2QMUB 3QIPA 1EIFA 1JU5C 2KKHA 5C2CA 1WNEA 4OV1A 3E01A 1AZEA 2RS2A 2YXLA 3OPKA 3KDOA 4WIIA 1QW1A 2NPFA 1HIYA 4C5EA 2CQDA 1CJVA 3OBIA 5GAHU 2NXNA 4G3IA 1S1VB 2CT4A 2HSEB 5HK3A 1WDTA 2KU7A 3KJFB 3QIPB 2QA4Q 4ELZC 4LSNA 1M1KC 2Z30B 9ATCB 1HNWJ 5LJ5d 1TU0B 3FUYA 1SQGA 2AJ1A 1DZ5A 4AG1C 2HVIA 2F5KA 4ED0A 4IDKA 4ED4A 2YTCA 2V2VA 1QVGP 3DDNA 2LJ3A 3W9JA 4HVUA 1XTDA 1KC8U 4UUXA 1MWZA 4G1QB 3I56S 2WW8A 4IUQA 4O44A 1N5SA 2R7TA 2YNFA 2VA3A 4DI6A 2PEHA 7AT1B 4M75E 1WF2A 2A10A 3ZC4A 1S48A 1TSFA 2LQ8A 2ZEJA 1Z2ZA 2E1AA 3PYFA 1WUUA 2J76E 4J9DA 5C42A 5CKBA 1KK7A 5CYMA 5C7PA 4DJBA 2BDPA 1MSWD 4B9XA 3LUYA 3OXGA 2AZVA 3CC4S 3BYPA 3DDIA 4HH0A 2YNFB 4QIGA 2DGSA 1P6TA 2OI2A 1YI2Q 2HHUA 2HQXA 1M1KU 5I4MA 5I21A 1HMVB 1JXOA 1N8RC 1WEYA 2YUNA 2F40A 3GOXA 3FBEA 2DJWA 2DNPA 3HP9A 2CQPA 4PYDA 3A8OB 4H4MA 2FB7A 1SKWA 1NLPC 2I9SA 3SXLA 3EH2A 1BB9A 4HCKA 2BMBA 1VQSA 4DQPA 1BQNA 3IQLA 1VISA 2JTFA 1B0TA 4J9HA 3EGWB 2X51A 2GX8A 2KFYA 1Y00A 2D3OR 4CLFA 2KI2A 3GJSB 4P6QA 1I51B 2L08A 2EK6A 3EG0A 3A8JA 3BSCA 4DPOA 4H4MB 2Z4PA 1YQHA 3OLAA 2W9BA 1ZAWA 2LA6A 1OZ2A 1Z2LA 3EAEA 3CJ5A 5LSLA 1BQNB 4EMDA 4UOHA 2E10A 1ZTWA 2CP7A 1NZ9A 3HSZA 5LSRA 3ITHA 1O6XA 1RE1B 4RO0A 1SSFA 2C06A 1RTDA 4JOUA 3NCPA 3JTNA 1RAAB 3AOCA 1N8RU 2KBTA 2AIRB 3HP6A 1S6OA 2LJ0A 5GAOn 2KJWA 2W9BB 4I2QB 2X4JA 1KQGB 3JB9I 5F0UA 3THTA 5HN0A 2VG7A 4J9BA 3C0CA 3CMAA 2UUBF 2OHDA 1YJNS 3HVTA 3OW2A 2V8KA 1WX6A 4ZLPA 1PJ5A 4DV1J 4DPXA 2OPRB 2LT1A 3HZEA 2E1RA 1RTDB 1QTMA 2LEBA 2BJEA 2H8HA 4WFYA 1OO0B 3H41A 4O4GA 3JRZA 5M2RA 4Z89A 3HJFA 1S9EA 3MEGA 4RWWA 5A2QE 1LVKA 1XK8A 4PJOB 4WPAA 1I3OB 2DIQA 5KFBA 3J80Y 1R6VA 2Q6BA 1IR2A 3OQ2A 3QWUA 2A0FB 4IFYB 2L89A 1RB0A 4ZGJB 2RF2A 4RTUA 1PD0A 3CQTA 2QL9B 4HR2A 1FRIA 2GQ2A 2F65A 2DISA 3FEZA 4O4GB 1WXUA 2BABA 3MEGB 2OIHA 4YHHF 5K14A 3W3SA 4HTIA 2VA2A 3ME9A 5ETVA 1YJWA 1WHKA 2CPZA 4KHPF 4ZVPB 3BGFA 4DFMA 4GVLA 1I81A 4JBCA 1ZQ1A 2DTOA 4LT6A 2N82B 2IRUA 2Q6CA 1X9MA 1QUVA 1YBUA 5HMWA 3QJYA 2QMXA 1YJ9S 1HI1A 3MAHA 1BYMA 1WXTA 1HWLA 2BYCA 5T41A 1QKWA 3EGUA 3LP1A 3AOAA 2Y4YA 1KQFB 2ZZMA 4OVAA 3FEYB 2HFUA 4U7UD 5C5JA 4DQSA 3CULA 3N5FA 2UU9F 1Q79A 3ZFVA 2VJVA 3SWNC 4RBTA 3LW5E 2CQ3A 1WG4A 4OZ5A 4NL3A 1UEUA 2MLZA 3MUTP 4ECSA 3X25B 4PEOA 2HVHA 2GNKA 3EJMA 1YP5A 1I1JA 2AKKA 4ECWA 2GFUA 1CC8A 3QWPA 1H38A 5FW9A 1M1FA 2M51A 3AB4B 1FHTA 2DXUA 3JCMb 3F44A 4DL4A 1FWZA 2QASA 1IWAA 4BLGA 2HZVA 4E7HA 4QWBA 1UGSB 3UO0A 4RTZA 3TZWA 3TW0A 2XY7A 1Y5IB 5GMKl 2KRSA 2NR0A 2LDMA 1UVKA 4M7AA 2L41A 1F3VA 3CMES 2DK2A 2B9XA 3TUJC 2XZDB 4E98A 5BYRA 4USJC 2J6UA 5J39A 1X4DA 5D4OA 1VQNT 2GC8A 5DZ7A 3MCOA 3KFWX 4EDUA 2F4FA 4DBFA 2VBWA 3CCSQ 3GJTB 3DU5A 3CC2A 1SSHA 3HRSA 4NLRA 1S6PB 1FK9B 2E1CA 4M7AB 1Q7YC 3HSBA 1DLOA 2ZNYA 4C8MA 2M8DB 3M54A 2O67A 4DV6F 2W0ZA 3V8KA 4FVMA 2CP2A 3A8MB 4KULA 4ILLA 5FU7C 2HS0A 2DHAA 2BZ8A 1XMOJ 4ZCIA 3BGUA 2MZRA 2BKOA 2ADCA 3KXDA 1VHFA 3THPA 3L2RA 2E5QA 4W90B 2VF3A 1VIEA 1JLCB 4ZPTR 3TAMA 1JK9B 4OZ1A 4R5PA 3OL8A 2IM2A 1NDPA 4LF5F 1HQUA 4TU9A 3VZIA 2F2VA 3D6TB 1WORA 1UGRB 1U06A 2RHYA 2ZPIB 1BK2A 5LJ3d 4A4KA 1QY7A 1Q7YU 3TUZC 3VS4A 2HAIA 1RUWA 3MM8A 4B9LA 4R5PB 1FVSA 3P8HA 4ES2A 2VFVA 2MPUA 4ICLB 1HQUB 2RMOA 2XO7A 5AJ3F 3O1LA 5KFSA 4XPCA 1VQOA 4CO3A 2RQCA 3BF4A 1VQLQ 5IT4A 5IZHA 4XO0A 3N9UC 4I2PA 2LMJA 1TK0A 1G4CA 3PKYA 4UOCA 3WXMB 2LQJA 1EP4A 1PNJA 3MR3A 3MM8B 2OUGA 2WBRA 2C2RA 5GAGU 3I55T 2HHQA 3UN3A 1JLEB 4YY3F 2YNIA 2XKOC 2YHTA 4QT7A 1T9XA 3ILLA 3PTWA 4F8RA 4EZ6A 1X4HA 1UJ6A 2BRKA 2P9GA 1O51A 4BC9A 1QAXA 4OB2B 2VONA 4CTAA 1BBZA 3GU0A 1QM9A 1V5IB 2BBEA 2QEXT 3VUBA 1F5BA 1VDHA 2QN6B 2R7QA 1QCOA 2ZPGB 2E4HA 3QGIA 2ZD1A 1YNZA 3I9ZA 3BS9A 2RJDA 1KC8T 5CKDA 2HHWA 1OY9A 2M5YA 2R7UA 3EVMA 1SHGA 3CXCR 1PWTA 3PRBA 2VBZA 1BWEA 4JI8F 4O0NA 3CCJA 2F3JA 1AD5A 4RNHA 1ZZFA 4GLMA 3SV3A 2MCNA 1EQ0A 1OJ4A 5KAKA 1BMQB 1QAJA 1WC5A 2ED0A 4C0DB 2V9WA 2B9YA 2HFZA 5C0MA 2ZD1B 3G4SS 2M70A 3PEJA 2ZH3A 2XQCA 2K79A 5KFPA 2COWA 2HHXA 3DOMB 1RT7B 1X2KA 3MR2A 1K8AT 4ZCMA 2VPZB 5KG7A 5CYQB 1SJ3P 3SHWA 1RLQC 1JKHB 2G1DA 1S72S 2QQ9A 1IVZA 1OPIA 1TL7B 2ZWPA 1JNRB 3CC7Q 1GK8A 1PKUA 2Z8QA 1SIWB 5K8NA 4ANJA 5DRKA 2DNHA 1VOMA 3RMQA 1EKSA 3M5AA 4KPYA 3OYKA 3PFEA 3OYIA 3EFRA 2DH7A 1VQ9S 5GAMe 2E1MC 4J9SA 3FZ2A 4LVOP 2D9TA 3G6EQ 2GJ2A 3VYHB 4QVDA 3CXCP 4UTGA 3M32A 4TLQA 4TYBA 3TUPA 2OPSA 3R9LA 1JQQA 4NWBA 3GYNA 4A4JA 4DPYA 3HF5A 1WC1A 2Q79A 2G13A 4DOZA 3A4TA 1R8OB 4F4KA 5DDPC 3G71S 1S77D 3SFGA 4HHUA 4WIQA 3HHLA 4DCPB 2FVUA 2KRMA 3DRRB 5HP1A 4ZIWA 2V2KA 2IJNA 1T03A 1N8RT 1FXRA 2OPSB 2ILZA 2LCCA 2IJFA 2FJAB 1T3LA 1VQKQ 3V7RA 2MQQA 2ILYA 4RG2A 1QD1A 1ZUKA 3BSAA 4NYPA 2Y8WA 1PBUA 3AH6A 1YZ7A 3HHLB 4X66F 3LP2B 2P84A 4LRAA 2XMWA 1XR7A 5KFGA 1U2FA 2E65A 3RBZA 3I35A 1WHHA 2E9ZA 3QSIA 4BBYA 4DWIA 3QDRB 1T03B 4R8UA 5GJWB 3OYNA 1NB2A 3X1LB 3IGVA 3B8HA 4KGZB 3LPEA 1D0ZA 4M77A 3TRGA 1JXMA 3FB9A 4LF4J 3MEAA 4JJCA 2MKYA 5FD1A 1LWFA 4WFNQ 3AFGA 4OX9J 2OPPA 2KH9A 3CJTA 2EPDA 2B7BB 3P5TL 1HJDA 4ZITA 2ZZNA 1M90C 3PJWA 3QNWB 2IA6A 3E9GA 2IDEA 4P5NA 1RT2A 2WSFC 1DQ8A 2YKNA 4AMCA 4DL0C 3M0RA 4AL5A 1X4BA 2MAMA 1R31A 1ULRA 5E2QA 2QSWA 4OYAA 1I94J 3GR1A 3E3XA 2CQHA 2DYAA 2OPPB 1T05A 3Q24A 3M0UA 4M7DA 1ZBXA 3BDLA 2PDAA 1RTJA 1TL3A 3OTDA 4Y3CA 2MY7A 3G8SA 3N4WA 5IOLA 8ATCB 1VQ5A 1A7GE 1FNXH 3GFXA 4R0KA 4H4KC 2W7PA 5KT2A 3V2UC 1IJFB 2BUDA 2FJXA 5B0FA 3DGPB 4UQTA 4F0MA 3RW7A 1RU2A 5HLFA 4Q43A 2VICA 1TL3B 2BJ8A 4DUZF 5E3CA 4PG8A 1M90U 1LK7A 4A8YA 5CCMA 1K73C 2CQ1A 4IH6A 3R1LA 1EB0A 4FNHA 5KT3A 4XQ3A 5GAMh 1KWMA 1SEMA 3OJSA 4DL7A 2CNLB 1QLYA 1OWXA 3A8IA 1UL3A 3NGDA 2VV5A 4M5JA 3MO8A 4ID8A 2HHSA 1CPZA 2W1BA 1TUGB 2HNYA 4ERDA 1CKAA 2F9DA 1LOUA 4KY3A 3PDNA 4CLYA 4JI6F 4IOBA 3PNWC 3MMCA 1N27A 3IWLA 1LOJA 2P9CA 8AT1B 1Y71A 2OTJT 2HRUA 3VGSA 3RGIA 2XSFA 3LH0A 3PX6A 5ETNA 3MPVA 1TXQA 2FTRA 1CSJA 1JLGB 4RNMA 2W2QP 4PJMA 4NEYA 3IP0A 5AXLA 1XR5A 2F2WA 1MROA 2I0XA 2EYQA 1VQ4Q 2Z57B 4C92D 2CUYA 3CJKB 4JV2A 1WPYA 4JI7F 1K73U 2E9RX 3JCMX 2L48A 1M5PC 2OTLA 2AEFA 4CC4B 3Q2TC 4UQGA 1H3ZA 3ZL7C 1FRXA 1UFFA 3DKDA 3NGRA 3CTRA 1R8CA 5DETA 3CCUA 5E3RA 2MK5A 2FHJD 3CBMA 1YWOA 3FMWA 3IS9B 3QO9B 3C19A 3JQJA 3VKIA 5BR8F 3TU4K 1HBOB 2FY1A 1FVQA 2MHNA 2MB0B 1H73A 2UXDF 4C8QD 4YHHJ 4U9RA 3RKYA 2LQBA 4M78A 3NS6A 1IRXA 4K8RA 1R3NA 2M4MA 4YB1P 5F8NA 1N48A 1FESA 3AA8A 5G0RA 3DOKB 2DL8A 3CO0P 5HQLA 3BH7B 3U1LA 4E8UA 3MMBA 4N77A 4MT1A 4M78B 2MZ1A 4RG8A 4PJNA 5IT9E 5GANf 5IV4A 4LF6F 2KSSA 2EQJA 3UN2A 4RNFA 3MEWA 3H2VE 3K59A 4NCAA 4DEZA 2ZVIA 5G0RB 4DX8H 4YDDB 1SXLA 2EFIA 3KLGA 3RIRA 4NS5A 4J7FA 2AHOB 3BSOA 1DFDA 2YDLA 3MMBB 4FYYB 1T0JA 3PACA 4A8XA 4B3MF 2HNDA 1UWBA 3KUHA 2BVZA 2F1LA 5D8HB 1UCNA 3M58A 4NLDA 1REGX 3AHUA 2DR8A 4J5YA 1NBEB 3A8HB 1N88A 1WHGA 3TVZA 3EDQB 2DZCA 4QW2A 2LQNA 1Z4UA 2X1GA 3PJ9A 5GANd 4PPZA 2VUBA 1Q81C 3OHBA 1YRXA 3ENQA 2DXBA 2XULA 1M2VA 2HNDB 1IBMJ 2M9KA 4KR0B 4AE5A 2KK4A 3NP5A 1TFYA 1VQ7Q 4XU0A 3AJ1A 4ZCKA 4TQRA 1S1TA 3VWSA 1O75A 1E6HA 1DURA 2H5IB 1PRLC 4Z7CA 3LQVA 3OSVA 5IQQA 2A37A 4RW7B 1M1KR 4BI3A 4FCYA 2DEIA 3JTPA 3LGFA 5FWBA 4CT8A 1K0XA 5GAN7 4K4SA 1W7WA 4CI0C 5T14A 4DMZA 1M2VB 1UFWA 3R5BA 4TVAB 2ZJQQ 3OS5A 1QVFA 1S0OA 3E9FA 2VKRA 1ZSZB 5H9FJ 1HBUB 2ZBQA 5BYQA 4RNOA 3M9NB 4WKYA 3R6GB 2HKEA 2LRQA 4CM0A 1CJTA 2EFOA 3EFOA 2BKDN 1KJWA 1VQPA 1FO1A 4DU8A 1JJ2S 4II1A 1YJ7A 1Q81U 1OX9A 2I1RA 1GEHA 5CH7B 3META 1X4FA 2JS2A 3L09A 3MWBA 4GBQA 2D9PA 1X69A 1WQ7A 3N28A 5IM0A 1N34J 3MCAB 5H9EK 2GGPA 2NLWA 1FDDA 1CJTB 1E6VA 3WX8A 1SQEA 2K5LA 4BE1A 1N32J 5ADZA 2L3RA 3AJDA 4GY5A 1VQ8S 4X34A 1W2IA 3H0HA 3GLJA 1JO8A 3TUIC 2J0XA 3CPWA 5IM0B 2WOMA 2NCKL 2IVFB 3Q8SB 4ER8A 2EQMA 5AJ3J 2LCLA 1X75C 2DL3A 4KH1B 1E6VB 3JCMh 3QXEB 2Q1LA 5GJVB 1EAYC 2U2FA 2DRAA 2FC9A 4ZVSB 2AKLA 3VAHA 3FGVA 2BOPA 3W66A 4ZGEB 1SJFA 4XTZA 3K0JA 3PIPQ 2X3WD 4DV3J 4KT0C 4PKDB 3ZNJ1 1H2UX 4F36A 1XMBA 2LEAA 1HHSA 2ZWOA 3BO2A 1GTEA 2I8EA 2V8IA 3BDUA 3M2UA 2FRWA 3IG1B 4RL1A 2HMAA 4USMA 4V2SA 1YITT 1CULB 3ZTPA 5GAHI 2DXTA 1KD1C 2ABLA 2JOYA 3LWLA 3CCQT 3UVJA 4NCBA 3OQ5A 3F0NA 1N56A 4ZTJA 2D41A 4DPWA 3TJ9A 1X0FA 4LR7A 3R3TA 2HNZB 2ZBCA 5D4LA 3HT0A 1GXUA 2JNJA 5GMKa 2VODA 4DN9A 4USHA 3CCEQ 2F1FA 4XDDA 5LJ3g 2VG6A 1X4GA 2KXDA 3PIOA 2KM8C 2OPQA 1PG5B 2R2TA 1NJXA 3HVRA 3CJRA 1FTCA 4RW6A 3UVJB 4ANCA 1G3YA 1T3OA 2XMKA 3R1HA 2MGZB 2XDPA 4NA1A 3CMAQ 3GPLA 1CC7A 2DHXA 1NXIA 5A6WA 1Y7XA 3PO5A 3IBCB 1RTZA 5LJ5j 4JI8J 4EZ9A 5CKHA 4O3RA 3GFYA 2OPQB 4MFBA 2DXFA 5E3QA 4M7DF 1DJ0A 2EFGA 2EKNA 1AROP 1S76D 1SC4B 1FX4A 1KD1U 4C8KA 2CA9A 2C42A 4P71A 2XS2A 5L8RC 3CEYA 3GJRB 2VC0A 2C2EA 1RT3A 5AXKA 1XC9A 3TR5A 3MM5A 2YNHB 2DHSA 1N33F 2HQIA 2VOOA 3SMZA 3NS7B 3BDEA 3R7SB 2ZVSA 3B4DA 5AYFA 4WFZA 5U47A 1SF9A 4C92C 2EGEA 2L0AA 2HEQA 2YPZA 3ZZYA 4ILRA 2J05A 3C16A 2DRBA 2XMTA 5BJRA 1VGYA 3ET6A 3NNAA 1YJWQ 1R43A 1RT3B 1YK9A 3MM5B 2UUCF 1S97A 1SJQA 4HCZA 3H40A 2SEMA 3C46A 1X4AA 5FLXU 4FYXB 4NLTA 4KB7A 1M90T 2VDIA 4JDSA 2R7SA 1K0VA 1TMJA 4I56A 3NGTA 5MLCV 2DNGA 4B9SA 1IHVA 3NAHA 4OF1A 4C8QC 4ZVGA 1OYEA 1S99A 4DFJA 2I0NA 3NKYA 2Y1IA 2LA4A 3BSNA 3BDPA 1V5VA 4NCGA 3K7RA 3D5MA 2CP0A 2JJ9A 2CG8A 4QWDA 2OSRA 3K17A 4RTVA 2X1AA 4NXMF 2ROGA 2XZWA 5B7WA 2QAZA 4F0HA 5DDRC 4OHWA 4DOWA 2EC2A 2DJZA 4BHQA 3GIMA 1MGQA 3G82A 3J81E 5HMYA 3OVSA 1LV5A 2RHQB 3ZZZA 3DLJA 4YB7A 1H0HB 1RT4A 2C3UA 4Q45A 2B6AA 3CJSA 4OJ1A 1WJSA 3OR2B 1ZBJA 3DU6A 3Q83A 1VRQC 1L5UA 5K8OA 3A8KA 3SDEA 3M8PB 3N01A 4AFFA 4OGCA 3CWJA 4FP9A 2HDAA 1BI3A 5KG6A 3GIJA 3DRYA 1YX2A 4RBVA 5F8IA 1IXKA 2VGMA 4DR2J 2IVYA 3FRNA 2QG9B 1VMBA 4OZ0A 1RT4B 5GAN2 2DMOA 3T9NA 2EK1A 1U4BA 3N6MA 4OB3B 4Q5VA 4OI4A 1C1AA 2R58A 1GT8A 1MWYA 2B8AA 3Q8PB 2V4QA 2L9WA 3SDEB 1VQ6T 1Q7YR 5HATA 3POTA 5LM7E 1NH8A 4OMFB 3VJPA 4DX7A 1SRMA 3L95X 1X5PA 2DXCA 3CC2Q 2NYSA 4KO0A 3BBBA 3HVAA 2YWHA 2KG0A 3UNGC 3HX9A 2XIDA 4ZPBA 1V3ZA 3TWZA 4J37A 3L2UA 2LECA 1NK8A 1ITPA 2P5VA 3G9CA 4FXVA 3CXCA 4I69A 1AA1B 5LL6d 4J9UE 2XDBA 3T5JA 2VBYA 2QX0A 1LW2B 3DRSB 1TKZB 3E1SA 2ZITA 2EXUA 2AD9A 5KFVA 1HL6A 2VHGA 1RWMB 3E19A 5ETOA 5HVGA 3Q8YA 3T9ZA 2YSQA 1HI8A 4WWSA 4RTTA 4CC7A 1RAGB 2DZ9A 2PA8D 2IDLA 1DHMA 2PQWA 1JLFA 3KJVA 2DL4A 3OYDA 4DUZJ 1SG5A 4V19X 1KDNA 3ER0A 2QT7A 2ZUAA 1FJGF 3VAIA 2HZCA 2P6SA 4QIFA 4LF9J 2XM3A 3QHSA 4UC4A 4LBIA 1IXDA 2V6AA 4RUAA 2LDIA 2BM0A 4QOTA 1VQOQ 4ZP9A 2HW3A 2DK3A 3KMQA 2G0CA 1WC0A 3OS1A 4CYUA 2E7XA 3KJVB 1H72C 1K44A 3NMRA 1DY3A 1BCOA 3EICA 3N79A 3JYTB 5AT1B 1HWUA 2LC4A 5A0YA 1MG7A 3PNIA 3T6JA 3P96A 1CBKA 1RADB 3CMEQ 1JJHA 1WWHA 4FF2A 2XMMA 1MN9A 2YNGA 3UR3C 2HL5C 2R8HA 2A3JA 3S6WA 2VOPA 4PPDA 5IFMA 2K3KA 4X4RA 1SC6A 3M53A 3NGSA 2MMYA 3MUMP 2KVQG 3W2VA 1ZAXA 3EHQA 1UW4A 4MAKA 2AK5A 1OSDA 2RI5A 1RWUA 1F5AA 1X60A 4Y28C 3JAMY 2DILA 4PJLA 4OYXA 3CIMA 1VQNS 4EU0A 1WXBA 3H5YA 2QLBB 1AWOA 4DR4J 1RWPB 1N9SA 4F4YA 4EBCA 1Q4RA 2G1HA 1UEKA 2CYZB 2YXYA 1KBRA 1WJRA 3W2VB 4L6V5 2JM9A 3IBWA 3MECA 1FE4A 2OAUA 2X4YA 1EKRA 2P0QA 3CF5Q 3GIRA 1FI4A 5BR8J 4O6JA 3PVXA 1Y57A 1NJIT 1FFSB 2F4VJ 2P4TA 3CC4T 3RKXA 2W2MP 3CCJQ 1JLAA 5DQGA 1RAOA 2AGQA 3ADAC 4X4TA 1UTAA 4Q2MA 5K5MA 3MDFA 1AZSA 2UV8G 3MEDB 4L76A 2LXFA 2C22A 4JI1J 1W2BR 1XTZA 1B07A 2B9EA 4LUBA 1KQSS 1WTFA 3M1VA 4C8NA 3HKZD 1WI8A 3IC1A 3TARA 1VRUA 1RXOB 1B4SA 2EVZA 4ECRA 3D54A 5HROA 2R7RA 4D6WA 5ETMA 5EWFA 4LDXA 2HWIA 1NHUA 4F2RA 1XNRF 3CJ3A 2XMJA 4KGKA 4ZHRA 3V8JA 3X28B 4LUEA 3AY0A 5LXRA 3JTOA 1Y3KA 1WOOA 3I0RA 4HA8A 3LTOA 2W8LA 2CSIA 4PJOD 2Q66A 2B4UA 1X0PA 3W2WB 3VS3A 1U8WA 4XK8E 3RR7A 2M1HA 3OSSC 5LJ5Y 1G3TA 5LJ3j 4ZP7A 1N5VA 5HROB 4L6V3 2GTOA 2CP3A 3VAFA 1ZETA 1FNOA 2DO0A 2CZVC 2G2YA 2ZDOA 4LSLB 4B9VA 1YKWA 4ZHRB 4K2JA 1SKSA 1VC5A 1XWLA 2EQUA 4LFCF 1KVKA 2XG8A 5L46A 3OYMA 3TVTA 4KGVB 5KG4A 3U27A 4C8OA 2BX6A 1W2BP 4HYKA 2AW0A 1QLNA 1BY9A 3ENAA 3WQPA 4JYAF 1NK0A 1RTIA 3P4UB 3M56A 3FFIB 1JLQB 2DNZA 2IFXA 1XN9A 4ZP6A 3OJUA 3IR7B 1VQ5S 1JJ4A 2DRMA 2LQ9A 2AX0A 3TANA 1S6QA 4Z37A 2W2NP 3R6NA 2CKKA 4XTUA 3THKA 1S5ZA 2VPWB 1YHQA 1PCAA 3KG4A 4X4SA 1F3FA 3MR7A 2QEXS 3PY8A 2RHSB 3J80U 5L23A 1T3NA 2VQFF 4PJOF 4J9NA 4B6MA 2A3LA 3L7PA 3BN7A 4TVRA 4UOFA 3VGUA 5K8MA 3SCIE 3BO3A 2MZJA 1LXNA 1T9TA 2EYXA 3CIZA 4RCBA 1S6QB 3UD3P 2WVCA 3TREA 2RILA 2MXYA 5HO4A 2QMWA 3MCSA 2J6OA 2JC0A 4H4OB 1SPBP 2VDHA 1FWKA 4B9UA 5GAMd 4QQBA 1TUVA 1U1KA 3G4SQ 2IM0A 3AD9C 2PTKA 1YI2A 3I9QA 3PFSA 2VC1A 3V4IB 3O5TB 2X35A 1VLYA 4JV0A 3PX0A 3QRPA 3OYFA 4MTPA 1QVGS 1AVZC 4HI1A 3CCST 3GIIA 5GANg 4LRBA 4B02A 2MPXC 2CDTA 2VGNA 4IIOA 4FDFA 1TUDA 4PUOB 1KIKA 1YJ9T 2FGCA 3QYYA 2YKOA 1D8ZA 1ICEB 2CAJA 3IWNC 4YOEA 5A2QY 4TY9A 2Y8YA 4QQGA 1Q8LA 2CQ2A 1MMNA 1NCLA 1PILA 4E7IA 2V63A 3D9BA 3OFFA 3R7NB 3OVBA 2HQHA 4B9NA 1GCQA 2Y3YA 4Y92A 5I2SA 1CLFA 4FF1A 1B7FA 2L3MA 2RVJA 1BUXA 4M7AD 3QZ8A 4LE9A 1WDXA 2Y90A 3CCUS 1VYVA 4ITSA 3G71Q 4ZK7M 4X4OA 1K73R 1ZOTA 3GG1A 1M5KC 4X9CA 2AYBA 3FDSA 4P2SA 1V3SA 2V8GA 1M8VA 1U8SA 2OEKA 2QTWA 2QYZA 1WKLA 2NS1B 3C6TA 5LSOA 3CW2C 4FBTA 3FSYA 2HWHA 3TQ7P 4RMOA 4WFXA 2CPXA 4ZLJA 4CLTA 1NRKA 2OMOA 3UPFA 2LVWA 1KSPA 3FJ2A 2DRKA 3SDZA 2EFNA 3MM7A 3TSWA 2VU5A 2CQ0A 2HHHJ 4K50A 2AZ3A 2JL9A 4BB7A 5ETLA 1TR0A 4ED1A 1B64A 1PGZA 1U1QA 4LN2A 1V6HA 1S49A 3HJVA 2WAQD 1TELA 4ECZA 1WC6A 2D74B 3CJ4A 3JQKA 5I3UA 2EKOA 2FG0A 5EDWA 3DLGB 2ZKTA 4C5IA 1YRTA 2GCXA 3FC3A 1Q7LB 3NGPA 2CGHA 2OTLQ 4G65A 1VBXA 2E5LF 3OL7A 3FBBA 4R56A 2X1BA 2Z2YB 2XYGB 1AUDA 5DLQE 2WSCC 3UPUA 3A5ZB 2DR5A 1RL2A 5EX0A 3KNAA 1N33J 1URNA 2GZOA 1Q86C 1GFDA 3H8YA 1D09B 3OXFA 5KFDA 3M57A 4JJNK 1ZHIA 2GA7A 3OFGA 2GIRA 1Q82C 4CLSA 4K4WA 4ZVUB 3P6YC 1SH3A 4PFPA 4RX6A 2DGOA 3PR4A 4OI1A 2E12A 2DF6A 4NOYA 1ZM4A 2YLBA 4RBUA 2XD0A 1EIYB 2BEFA 3O3LA 4B3SF 1AWJA 1HYSA 3LAKA 3HHTB 3JB9J 5DGAA 3WC2A 3KHGA 4B3TJ 1TK8A 4QQDA 3RR6A 1IKYB 3H90A 2ZJPQ 3BPSP 1RI0A 1FX7A 2GFFA 2ASYA 4EMKB 5KFQA 3M30A 1Q86U 2VZ9A 3OW2R 3EG3A 4KAIA 1FJEB 1HYSB 4JRIA 3EDRB 3MFHA 3TI0A 1FRJA 2RMLA 3R6LB 1Q82U 1RU1A 3GYXB 5B0AA 3QAUA 3ICLA 3S7RA 5I3QA 2HHPA 4CO0A 1Q81R 5DGBA 1YCYA 3QRQA 3OYEA 1QMCA 1ZUYA 5I22A 2OTJS 2W25A 3CCMT 4OZ3A 4PJOC 1U49A 2K3BA 4ANEA 2HGLA 3QLHB 2DNLA 2ASJA 2UUWA 4OYZA 2LT4A 5CR2A 5F8GA 3CSKA 3D68A 3QIIA 2IBKA 2PE8A 1HK9A 1MUZA 2FLLA 1M2OA 1HWIA 2CQIA 4HKEA 4A47A 1FERA 1VCTA 2XMUA 1UJ0A 4DBHA 1MU2B 2RN8A 5GAOm 1R8PA 1OY8A 2LCWA 3OW2P 2ZC4A 1T11A 3JSYA 2J9DA 3CBPA 2JC1A 4DZ6A 2HFOA 1Q8BA 4IQMA 4ELVA 3LGLA 1ROFA 1S72T 3HMJG 1KHVA 4F0KA 5E33A 2QZ8A 4IUVA 2DNYA 1WF1A 2PVOB 3CVKA 1HW8A 3PFOA 2JFDA 1EJ7L 2BJ9A 2DY9A 1DAXA 2HNIA 4OZNA 5E0OA 3CPFA 3FRYA 2FB0A 5F41A 4YR2A 4DL2A 3ZXWA 4A8OA 2CZ9A 1VQ9T 3UFCX 3HK2A 3PX4A 3KNGA 4EK2A 3O6QA 1VQLA 3EE3A 3FIFA 1X5TA 2W4DA 3HCXA 4EO8A 2HQDA 2AJ2A 1WC3A 3K58A 3O2IA 2D1CA 3KUEA 2B8QA 4NLWA 5D78A 4C3KA 2K4YA 3C6UA 1BGXT 4MZPA 2B5JB 5CCAA 3MP1A 2EFVA 1X2QA 4HACB 3KHRA 2YUPA 4B3RJ 2QL5B 4L3NA 1XIQA 1KKHA 3OTOF 2IVMA 2P8IA 1C4CA 2LZ6B 2RU3A 2UVVA 2HBZB 3SV4A 3CDAA 5CK9A 1FKOA 1D0XA 3M0SA 1YJVA 1BIBA 1TKDA 3DM2A 3LF0A 2I6WA 1VIFA 4ENOA 1J5EJ 1OYXA 4C92G 2RJFA 2BA9A 2YRVA 2UXCF 3HD2A 3U1NA 3H5XA 3OY9A 1K47A 4PCQA 2VKZG 1H8KA 4IRCA 1TL1A 1AWXA 2CT3A 1KD1R 1G8XA 3US5A 3OR1A 4A8SA 4M5GA 4S0MA 3SWNA 2H51B 1TL5A 5FU6B 3UD4P 3PW7A 3RERA 3AXKA 2P6TA 1HHQA 5GANj 2QFIA 3DRXA 4YEAA 1WI6A 4ED5A 1UECA 1TL1B 4C8QG 3IGNA 3CD6Q 3OR1B 2K3YA 4I7FA 2AX1A 2N7YA 3SWNB 3EGZA 3PIOQ 5IC4B 1NLOC 4OMLA 2R7XA 3CCLQ 3P8DA 3QWYA 4P72A 4GKKF 2PEBA 2FJBB 3W8PA 2RH2A 4OQJA 1U1PA 4CRIA 4PXCA 1OI1A 1FKAF 4GKJF 3JB9H 2ZBPA 4B3OB 4L3KA 4I7FB 4BWMA 1WHYA 4M77E 4IFVA 3CC7A 2PU9B 3H2UB 3QGPA 4RCCA 1VLOA 2CQGA 2WZ1A 2PMHA 4OIXA 3HO1A 3BE3A 1YN8A 3GIKA 4LF8J 4YDXA 2DBKA 1HQ2A 4QYZK 3G6EA 2ZUGA 4G6VB 3V6JA 1FD8A 4ZLNA 4IFVB 1Y4ZB 1RWOB 3JB9D 3R27A 4ECVA 2J0QD 1BXNA 4A63B 2V2QA 3C12A 3NXZA 5ETSA 3SEMA 4WZQA 5IV3A 5A0GA 4JI0F 3S01A 3MAAA 4M7DE 4NLSA 3A8GB 4QIEA 4YFUA 1UFKA 4MK8A 5DS7A 3BGOP 5D7UA 2HK3A 3FSIA 1DJ7B 1M1HA 4JPBW 2G0JA 1FYNA 1IWGA 4N0AC 3C95A 3AOBA 1R77A 2DNOA 2FVRA 3KK2B 1W25A 2LFVA 3SD4A 3RBEA 3TX0A 4ME7A 1KVJA 3MAAB 4ZS6A 1YJTA 3PMTA 5KG1A 4DL5A 2VKNA 2DT9A 2E64A 3C94A 1XMQF 3WC0A 1YITS 3PW4A 3VS1A 2DH8A 3R2CJ 3JQMA 2OO4A 5I3PA 1UZDA 2K7KA 3M6VA 2EIFA 4DCJB 2R8KA 2HVDA 2AWZA 4KUIA 2K6DA 2R57A 5KFLA 1ZYQA 3C3LA 2P0PA 2XEXA 4M78D 2MKHA 3VS2A 3WX4A 4K0KF 3HULA 5KT4A 4QVZA 4C97A 4IUTA 2V4JB 2DITA 5AXMA 3KDNA 1M5SA 4C0DC 4DR7J 3PW0A 1PYSB 4NLQA 4QWCA 1YG0A 2XSJB 1UKUA 3MAQA 1D9DA 3C15A 2BXJA 2KHDA 2XHCA 1VFJA 5J26A 2PVDB 1XNQF 5KH6A 4ESRA 2CQCA 1VYUA 2M2BA 1HNIB 3V6KA 2W7AA 4DV5J 3PYEA 1K9MC 3L2ZA 2NUPB 4PXDA 4U7UK 1T9WA 2GAHC 4GO7X 2MWPA 2D8JA 1UG1A 3BB5A 1S1UA 4DL6A 3MP8A 4QW9A 3RB0A 1KLMB 2W9CA 3MEEB 4DR1F 1KN6A 5KFYA 5H9FK 3GJQB 3MZIA 4LDWA 3QJ6A 5A76A 4F7UG 4DUYF 1UAWA 1AT1B 2IC3B 3SSSA 1WHMA 5I42A 2E9TA 3LWIA 2IM3A 4NMLA 4FU6A 4WYLA 2H4YB 2DBMA 4EYIB 2R7OA 2MIOA 4FYWB 2BZXA 3QQCD 2YQ3A 2Y0SD 4I1TA 2HLTA 3G86A 2M0YA 4PJJA 3UA6A 1CJUA 2ALZA 3H4BA 1ZM2A 2RQVA 4L74A 3M9MB 2OH2A 2BR0A 1DTQA 5B0EA 1NKCA 4DV4J 1N36F 3REAB 1IQTA 1Q8IA 3BKFA 5I42B 4CLLA 2CJKA 1K9MU 3CCRA 2C3MA 5GAMg 3RMSA 3TVKA 1NK9A 1UTIA 2XI9A 5IWAF 4ATNA 2KRRA 2FDNA 4QPTA 2EWNA 1Q86T 3SCJE 3CCQA 4XTYA 2O9VA 1CJUB 1UFLA 1F9HA 3OMGA 2XMAA 4J9CA 2WSEC 3G1JA 1G2EA 3HTRA 4Q0BA 2X4XA 2G9OA 2NUTA 3M4YA 4X4UA 3W1YC 1KQ2A 5B09A 1DTQB 4QIVA 4OHXA 2OJ2A 2UVUA 1OS5A 4F50A 2XHWA 3LGHA 3G8TA 1TKTA 3SSQA 3L2VA 4TKTA 5LOQA 4IOAQ 2FRYA 4DA4A 1YIJA 3EX7B 2FIUA 5IT9Y 1XNIA 8RUCA 3OSPA 2W24A 4JI4F 5DQHA 3HFVA 4Q0BB 2CREA 2Z2ZA 4XAXB 3DLHA 3SB2A 3AB2B 3UF4A 4PWWA 3VS5A 1KTQA 2KI7A 1TKTB 4RKUE 3MMAB 1LWCA 2LYVA 5D6YA 4D3GA 2AKWB 2AJFE 2D7SA 1RACB 4TXSA 1AFJA 4CLPA 3OD2A 4CH1A 1TL4A 1SB6A 3CCVA 2IYIA 2DCLA 2UV8A 2E5LJ 4N76A 3DOLA 3PVLA 4A54A 5LMUF 1LWCB 3M8RA 4DEXA 3J7A1 1K1ZA 2P9EA 3CNQP 4TN2A 2KXHA 2RRAA 4DG1B 1LFWA 2PA3A 2QA4S 3Q8RB 4J9GA 4A8QA 4M5DB 4O5VA 2N3OA 3U23A 3CMAT 2RHUA 1S9FA 1RI7A 4YQWA 1SHFA 3KK3A 2R2RA 3VU3C 1GFCA 3RB3A 3DOLB 4DR6F 2OELA 4ZVRB 1MMDA 2DXEA 2CKWA 2RQ4A 2QLWA 1S0MA 1D3BB 5KE2A 4DN0A 4WZMA 4P10A 1UW9A 2XB2D 3D3CJ 4IG0A 3CB4A 2CZ1B 1SH0A 1R8HA 2RD5C 2VBXA 5LMNF 5KYXA 2K7JA 2JZ2A 3KK3B 2E1HA 2JOQA 3BYRA 2CZ4A 2O88A 3W61A 5KYYB 3Q86A 4M75D 3VYGA 3DRPA 1I8FA 3C66A 1UA1A 2JDJA 3TSZA 3I0SA 1OQ6A 3MEUA 3X20B 4OL8A 2E7VA 2OSQA 2V4RA 1VK8A 3HHEA 1J5OB 2V1RA 5KYXB 4H4KA 3HDSA 3EPIA 1OZ3A 4YB5A 2BW2A 2CPFA 2GJIA 4RLEA 1J3TA 1QWEA 5J3BA 4RTYA 1VQ7A 4I68A 1EX4A 3DRPB 4KRWA 1JBMA 4ID5B 5E5NA 1BKBA 2CIMA 2MI6A 4WFAQ 3SQGA 2LP5A 5A0DA 3R2DJ 3M7VA 3UATA 1TQLA 3OFEA 2MQOA 2HS3A 5GAOq 4PK4A 1K8AC 2HBQB 5HY6A 3UI3A 1P1TA 2O31A 3OVAA 3TVYA 1NO8A 3E01B 4YTLA 5KOXA 3DB3A 3KUGA 4LQ9A 4TLRA 1VQNQ 1VQ6A 4EEYA 1CJVB 4K11A 1PKSA 4MKAA 1FT8A 5CABA 2AV5A 3K89A 3G96A 4M75F 4AUKA 2F5GA 4DV7F 3U7JA 2DJQA 4QCLA 2XYHB 3BY7A 1YHQQ 4CWBA 4KV8A 3B78A 4J9MA 4LSNB 3JCMc 1VQMA 1MMLA 3DMJA 1X27A 2DKOB 4R0JA 4BUGA 3KLFA 4F04B 2BM1A 4IDKB 3T1HJ 4FBUA 4LDUA 3M6XA 4X64J 2QLXA 2YWFA 4OMPA 1JXVA 4ANDA 4O44B 3CMQA 2C3PA 3M2RA 1UPPA 3DMJB 4CO5A 1K8AU 3T1YF 4RW4A 4Y00A 3I4PA 4ZP8A 3GTYX 3TZYA 1SJ1A 5C42B 4ZIVA 3Q0AA 5CYMB 1TAQA 3T5HA 3CC2T 2P0KA 1V76A 1QAYA 3WHIA 1H6KX 3SQOP 3OYGA 2PFFB 3QO3A 2GAGC 1QSLA 2K9GA 4U96A 3QGGA 4C5GA 1JLBA 3PIPA 3GB0A 3ZZTA 4RW4B 2GVDA 3JCMg 2HBPA 3GIBA 3FKBA 2YLCA 1SH2A 4YUDA 3SEOA 2R2SA 2R5MA 2G6FX 4ED7A 1PRMC 3TJAA 2Y1LB 1Y3JA 4QJVA 1WJ9A 2GQIA 1U48A 3UR0A 3SZ2A 5LJ5h 3I55Q 2DGQA 3BZQA 1KP6A 1VRTA 2A18A 1EHWA 1N4LA 1WHXA 1MV0B 3PT9A 4O3SA 4A4FA 4WF2A 1RUSA 3CCEA 5DLGA 4MMLA 1RYSA 2QE5A 5L38A 1QCNA 1HBNA 2O3DA 3MHYA 3C8YA 3HFOA 1QVFR 3PGGA 4LBPA 3UE2A 1VBYA 2KYZA 1YWPA 2FD2A 2ZH1A 1HWJA 1IKWA 3I56A 1VRTB 1SL0A 2QEXQ 4ES1A 3ITHB 3FCVA 1ZSZC 5KFUA 3EZOA 1VQOT 2FHMA 1T9UA 2KYXA 2JLFA 1HBNB 1SUQA 1FRLA 3PRDA 1PHTA 2OKQA 4CZCA 2KZZA 4W98A 4HT9A 4BY6B 1RHQB 2VG7B 2EG1A 2HFVA 3PRVA 1K4US 2AP6A 3URGA 3LWMA 4C98A 2FL7A 3CC4A 4Y6IA 2KROA 1LWXA 4IUUA 1UVMA 3HVTB 2R8GA 1VS3A 1B7TA 3J81Y 2EI5A 3L7OA 5LXYA 2K5IA 5CZXA 4JI2F 4GKKJ 2WB1D 1FCAA 3RAQA 2GNCA 1GX6A 2DO3A 2V0NA 4GKJJ 1CEZA 4EO6A 1S9EB 2HBRB 4LF7J 2FJVA 2YX7A 5C24A 2M8HA 5DLOA 3CPWR 1QVFP 2CFXA 2C0TA 5GAMj 4PJOG 3CCSS 1RAEB 2RF2B 2K57A 4G1PA 1SBRA 3AQPA 2DYBA 2W4CA 5GAEU 4OFZA 2HVZA 2M0GB 3OYCA 1R0CB 1AW0A 5K14B 2MTLA 3QDFA 4C0ZA 2ZHBA 1HNZF 4CI0B 3BN4A 2WVDA 1ACMB 4OZJA 4EI2A 6FD1A 3JSRA 2J0WA 3MURP 4URQU 3CCJT 1U1TA 5KG5A 4PXBA 1HA1A 3PYGA 4OMOA 1ARKA 4OLPA 1K9MT 1NPKA 1PC4A 2GHWA 1VHIA 2JVRA 1AOJA 5CQXA 4LSZB 2IG0A 4DBQA 3PVQA 1F9FA 1P9YA 4FVCA 4DCOB 5A8WA 4BCAA 1T9VA 5E41A 3SFUA 3LP1B 1X31C 1X4EA 1U0HA 3BJYA 5HKCA 1TV6A 2DERA 3MCNA 3CPWP 1IZ6A 4NL2A 3R6OA 4JS4A 1G5VA 1W70A 2YKMA 1YJNA 2P2CB 3V6HA 4E7SA 4Y2AA 4E47A 3F56A 3VAMA 1Y5LB 2DL7A 4JP8A 4C11A 2KG1A 5A8WB 1CKBA 4NXNF 3VRZA 2LQWA 3P49B 5MAOA 1GBRA 3JAMU 1TV6B 4CCHA 5D0RA 2EYZA 2Y4XA 3ZTSA 1VQLS 2IA0A 3KLVA 3CT9A 3X24B 4I4BA 1T8EA 4M75C 2CZ6B 4VUBA 2O66A 4UZBA 2AF6A 4ZKAA 2RRNA 1MHNA 1S7HA 3HT3A 1BIAA 4N4HA 2XCPA 5T7LA 3E2EA 2CJQA 4XU3A 4CO4A 3GR0A 2KE9A 3UD5A 4XTVA 1XQIA 4PRFA 2FGOA 1JX4A 2AQ4A 1XNQJ 5GAOp 5LJ3f 1HQEA 1B3QA 1B34A 3DCAA 1RT5A 4QW8A 1BC6A 3EGNA 4PFOA 2RHXA 2BE2A 1HNWF 1YJ9A 2JMAA 4ECYA 2BJ3A 1DLOB 2CJAA 2FPFA 2QO3A 3GP8A 4M7AG 2LEPA 1U6BA 3VS6A 3CDWA 1RBOB 1RTHA 4X62J 1NM2A 1WF0A 1RT5B 2JVVA 5J2MA 1Y9OA 3HHNB 1G7CB 4HXJA 4C0BA 3J7AN 1LK5A 1NDLA 3GWCA 1PSEA 4X65F 1VBKA 3TAMB 3CJ8A 1XOVA 2XGPA 4U8YA 1D9FA 4YN3B 2JXBA 1RTHB 2X1FA 2M88A 3SI8A 3A13A 1AEYA 1M30A 2F69A 4BDPA 5J2MB 2ZPHB 4C0GA 4L75A 2KXCA 1RCXB 2YKPA 1U02A 3MOJB 5GAN6 3JXOA 2ZPEB 3PXGa 3OS2A 4HT7A 3CMEA 2WVEA 3TNVA 4L59A 4HHJA 2E7WA 4DUTA 3CC7S 2FHJA 2ZE2A 3H98A 2EBEA 2MQMA 3HD1A 3RB4A 4I2PB 1B3TA 2EJ9A 2RUSA 1VQ5T 2DPIA 3IMQJ 1HSQA 3OMCA 1EP4B 2L9DA 4QQ6A 3D6MB 4RUGA 4C8QA 3G6ES 2VPYB 2OTJQ 3UDEA 5BXIA 1WJQA 2POKA 4O0IA 4ALZA 1RT6A 1RABB 2YNIB 2ZE2B 2GQVA 2V5HG 5KYWA 3OTEA 4KSEB 2KMTA 1S1WA 3KLIA 4I0WA 3CD5A 3CCMS 2DGVA 2IAJA 2M52A 2FVQA 2J7KA 3QATA 2IYGA 1NDCA 3ETMA 2DRDA 1H641 1IKXA 2H3JA 1KQ1A 4Z02A 3QT7A 4J8OA 3ZZ0A 3W62A 4CTAB 1HFEL 4M5NA 4Z8AA 3QMQA 2OGUA 2OJ3A 3AXMA 1WKKA 2NWMA 2HGMA 1VQKS 1L3SA 1S1WB 4A4HA 3KLIB 3SBMA 3ILJA 2KO1A 5GMKe 2JT4A 1U0SA 2MKKA 2HD0A 4HT8A 4KBMB 2JX2A 4NPOA 1OQ3A 3WIUA 2HIQA 1WOPA 2DETA 1APSA 3BPDA 3L42A 2OI3A 4DV1F 1NZ8A 4EUVA 2FHKA 1REVA 3EH1A 5A2QU 2GQQA 4HVVA 5DDQC 2ALYB 1UHFA 3D3BJ 1YJUA 4DR6J 3R7BB 2CVEA 4XDCA 5HQMA 1S59A 4LMZA 1SJ4P 4CH7A 5CA5A 4JB8B 3D0IE 3G87A 2VWFA 3LW5C 5FWCA 1U1RA 5CAIA 1SPKA 1CJKA 2CP6A 4AQYJ 5JVGQ 1HNXF 3EUNA 5LMNJ 2HIYA 4NRUA 3CCUT 5KG2A 3OL9A 1XEZA 1KLNA 4B9WA 1IO6A 3NG8A 1C1CA 3R8YA 1YZ6A 1SC3B 2CUBA 3N5BA 2BUNA 5F9LA 5KFTA 4ATOA 2D3O1 3RW6A 2CWKA 1RHMB 3LPYA 2JLEA 3Q8QB 3OS0A 3GLXA 3Q8VA 2UUAF 1ZAVA 3M32B 4USVA 3HM9A 3P45B 1SCJB 3Q23A 5HANA 3N5BB 1HNVA 3CDBA 2MEWA 2RHIA 5I11A 1NMEB 4LRFA 2DR6A 1RT1A 2QQRA 2GW8A 1NH7A 4FPRA 1FXLA 1N5TA 4LDYA 2O01E 4WK1A 3CDUA 4AYBD 5HP1B 2JEGA 4PFZA 1U6ZA 1IQZA 4DSFA 2M16A 3REBB 3A8LB 2C2DA 2EKHA 5GAOl 2L3SA 4U67Q 2PZ1A 1VI7A 3ZFJA 1R8BA 2HQ3A 2FHOB 1RT1B 3A3NB 1W2BS 3HPWA 3M4XA 3TA2A 3L4BC 3UDLA 4DS4A 3G4SA 3PE0A 1Q95G 4QPXA 4LFAF 3NAIA 1NU4A 3HHKA 2VD3A 2JEIA 1SIZA 4AFQC 2JVOA 4NLVA 7FD1A 4R8UB 3VAJA 3I96A 2GTJA 4OJ3A 2CJYB 5E3PA 4Q44A 3QRRA 2RM4A 1N6AA 3D67A 3K5LA 5HVFA 2ZCFB 4QWEA 2HFSA 4M77B 3GG0A 4P9SA 2E5HA 2ZZTA 1VR6A 4Q8EA 4DQQA 4LQ3A 2EKYA 1LWFB 4J9OA 2IRYA 1KSWA 1JRIA 1VQ9A 1VQ4S 5GMKh 2SXLA 3VS0A 2YBVA 4LR9A 4UT4A 3ZTRA 1QE1A 1RT2B 4IRDA 2YKNB 5L1JA 2QLFB 2QQBA 5IHKA 4Y34A 4FXDA 3VS7A 2DGWA 1CQNA 2XGQA 5IXFA 5GADI 4IOCQ 1KNZA 4CO2A 3DGVA 4J9QA 5C25A 2AU0A 2HLUA 2XY6A 3G71A 1T05B 4TYAA 1LNQA 1XMOF 4M7DB 3NNHA 2ACMA 1KFZA 3M0TA 1RTJB 3KLEA 1QE1B 3BEGB 3CCZA 3VV2B 4RU2A 3MFIA 3DLBA 1IM6A 2Z0WA 1C0UA 1VQPT 1Y07A 2I5JA 3CUNA 3T19A 3DKMA 4GRSA 3ZEHA 2OFGX 3NRBA 3CGIA 1VK3A 4XTWA 2ED1A 1EETA 3S6EA 3VRYA 5HLFB 3PW5A 2H5EA 3CCRQ 3H0PA 2FYKA 3M8YA 1C0UB 4ZA1A 2I5JB 3CCQQ 2FUG9 3OLBA 3GNGA 2BANA 4PR6A 1HKAA 1UEBA 3NTHA 2EWHA 1TWBA 3U02A 1OPKA 2EW9A 1IN0A 4DEYA 2UUBJ 1QSSA 2FJDB 1X6BA 1AXQA 3BGRA 2HNYB 4DSKA 2CPEA 1NNDA 1NSAA 3BQ0A 1KQSR 2EJFA 1YIJQ 1V9OA 4DF8A 1M5Q1 2QA1A 2W2PP 3MMCB 2YT6A 4JZ3A 1NSKL 3FNNA 1X9WA 2YY3A 3DN9A 4FYVB 1QQJA 5KT7A 3JS9A 2H54B 2VC8A 4J9FA 5EUHA 1UEVA 3BGRB 2AEMA 3HVWA 1MROB 4FSXA 2KNBB 4QYZJ 2VG5A 3H59A 2JH3A 4R0EA 1WD6A 3MEKA 4FNIA 3JB9G 2RD1A 2HFNA 1E7OA 3MPWA 1DQAA 3H42A 3CCVQ 3IBFB 4NI2A 2GJFA 1VQ7S 2N7CA 2ZH6A 5L1LA 2I2LA 2VYTA 3DFEA 4KHPJ 3N6NA 5FJ4A 2AZ1A 2JUFA 1N6QA 4Q5WA 3RBDA 3ULRB 4HCCA 3KTQA 4J6WA 1CG2A 4WXWA 5HAOA 4GC6A 3PTAA 3MR5A 2FEIA 4KHRA 3GILA 2E6ZA 4LRDA 3JCMe 1B0PA 4IR9A 2J9DE 2KT8A 2C2ZB 2V8DA 4C92F 4PYAA 1OOTA 1H2TZ 4OGEA 2BKPA 4LR8A 5GAN5 4XU1A 2MKSA 3TO8A 1HNZJ 3DLKA 2JN0A 3F70A 1GXTA 1R0BG 3PMIA 4EFAC 2FLNA 1N6QB 2MYSA 2CJBA 1WNLA 2QSFA 4V1Ak 1TS9A 4CLKA 2CADA 3ZTQA 5D4NA 4C5HA 4TY8A 3G6XA 1ZH5A 2UU9J 2DHHA 4F26A 2AYEA 3MR6A 2DPPB 2R8IA 3GQCA 4D3HA 4OZLA 5KFAA 1NHVA 2RQKA 5F3TA 4C8QF 1Y11A 1KC8R 1K1SA 2JMCA 3LAMA 3T6BA 3Q89A 4M78G 1B70B 2UVWA 4FW2A 2KYMA 2D0NA 4TY8B 1U1LA 3KLGB 4C8YA 3ENVA 3FMBA 4FT2A 2MKCA 4IO9Q 1NJIC 1M3BA 5KE3A 1VC0A 3G6VA 3QT8A 1QVGR 1UWBB 5H1SV 4ZPVR 2E29A 4NLUA 4FF3A 1P9QC 2J8SA 2EJGA 1U7LA 1QP3A 1JEGA 3Q8UA 2ZOGA 4ZVFA 2GMJA 1NUEA 1K8AR 4NLYA 4MMOA 1S1VA 3W5ZA 3LANA 1F2GA 2KAFA 3D7SB 2EGCA 3MPDA 2ZJRQ 1RWXB 2L3PA 3W5YA 2KB2A 2ASLA 1RLPC 2QDYB 3Q1JA 5GAN8 3MPYA 5M2PA 3KMSA 1PJ7A 5ITHA 4FSSA 4DV6J 3IA0A 3QZ7A 1S1TB 1VQ6Q 5JVHQ 2XU8A 1VA7A 4E7KA 1R0AA 1G2BA 2ERRA 4X4VA 2M9UA 1D1BA 2CYYA 4G1QA 1S0NA 3NTIA 4RTXA 2FY8A 5K9FA 2RJCA 1OPZA 1NJIU 3CCES 1VQMQ 2V34A 1OPLA 4J9LA 5D15A 3T5KA 3GV8B 2YH0A 1X4CA 1JB0C 2L8DA 4LF5J 2MZSA 1BLUA 1PYOB 4LF4F 1R0AB 3CMAS 4U7CA 1FRMA 3EFOB 4B17A 5KFIA 4OX9F 2HVEA 3OW2S 2R3VA 1N8RR 3HL8A 3ISND 2QI2A 1O0PA 4ELUA 4X65J 2YQ0A 1HMVA 2XBPA 2VFSA 2W2OP 2GGPB 3KYLA 2LNVA 3PKMA 4QKUA 2NXJA 1NK4A 2KDOA 4EMKC 4EYHB 1I94F 2NREA 4PAAA 1KOHA 3NBPA 2FZCB 5GANh 1VBZA 1Q5VA 2XLJA 1EX8A 1TVRA 2HQFA 2E3IA 3MUVP 4PG5A 3D1QA 2W7OA 1WQWA 3NFCA 2QL7B 2VQEF 5THWA 4JUZA 4FZVA 3TA1A 2WOMB 3FVYA 4DS5A 4OP0A 2IMWP 4YY3J 4DXLA 4KE5A 2OAWA 4DV2F 1ZPVA 1YJWS 4BS2A 3NBPB 4CT9A 4M4ZA 1TVRB 1YDLA 2QYCA 1U26A 4NYZA 2HL3A 4RJVA 5D0GA 2RJZA 2IJRA 3UCZP 3IWXA 4CDIA 4Y91A 4MYTA 3CD6A 3HSDA 4MKYA 3W9HA 3D6FB 3M2UB 2LP4A 4U6PA 2LMIA 4USKA 4RNNA 5IQ6A 5F0WA 4HDHA 4I2QA 5DQIA 3JSCA 3CCLA 4HDGA 2XICA 4KKOA 3LWHA 2D8HA 1Z1ZA 5J1EA 1JJ2A 4NZ7A 1Q5YA 3VQTA 4LXCA 3JCMW 3I56Q 4F7UF 5ETKA 4ECTA 2C2OB 4JUVA 1M4ZA 3NLCA 2OPRA 2LX7A 2NZ4A 1GMWD 1UZHA 2LDYA 3I4HX 4DQ2A 2VG6B 4KTQA 2ZOMA 3LH2S 1FJCA 4XU2A 4RW6B 3MKDA 2OD4A 4PJOA 4KKOB 4Y2MA 4DDFA 5J1EB 1J27A 5IC6B 2ZPFB 1OULA 1RWVB 1VQ8A 2JW4A 2G0IA 3CC4Q 2K3IA 4IFYA 2ZH9A 2FO0A 1K76A 1Q1KA 4LF1A 4QR1A 2FJEB 1M5VC 5M2UA 3DB4A 3MI7X 3UWTA 4PKCC 2MLXA 5D6WA 4MFBB 4MYUA 3K8WA 2DX1A 2VL1A 2VJUA 4M75G 2JTMA 1IB8A 4LBHA 1JXLA 2W4PA 3NGKA 2MQLA 1W6XA 2CP5A 3M4GA 4CH0S 2KEAA 1SKUB 2C0OA 3ASKA 4LFBF 1GBQA 4FPIA 3RZAA 1OU8A 3HFNA 3VHQA 2JM8A 3CC2S 3B54A 1HNXJ 2CH4W 1UGQB 2AZSA 2XLIA 3QBCA 3CDEA 3C16B 2KT1A 2RU9A 4XIUA 4DLEA 3ET6B 3M8SA 1URRA 1W4SA 5KFWA 5CXTA 3V81A 1G6BA 4PZVA 2Y1JA 1GAOA 4ZPWR 5L1IA 2BV3A 5J2QA 1T02A 2UUAJ 2RQMA 3NPFA 5IT9U 1BCMA 1S1XA 5FU6C 1GMUA 3HI9A 3QWXX 3RRKA 2CG4A 2QTXA 2XDDA 5F3ZA 1RSCA 3V81B 1LKZA 2RJEA 2A2CA 3FCWA 4NCGB 2QFJA 2NUHA 4X66J 3RNJA 1G83A 1GXIE 2COZA 2R4FA 4XAKA 3QUIA 1YJNQ 1QKXA 1OIAA 5J2QB 4P74A 3J7YU 4DV0F 1PM3A 4Y2CA 4ZCLA 1NK6A 1S1XB 1N54B 3HZGA 5KG0A 1JWWA 1VYTA 4ECXA 1S4FA 2GVZA 3G82B 2KHCA 3IAS9 1UETA 3CEDA 1Y0HA 1DBDA 1UJ5A 2JEJA 2KVQE 3DLLA 2HQEA 1VQOS 4F14A 3IM8A 2B6AB 2HWTA 4LFAJ 2CQBA 3JB9k 4DQRA 1UJYA 3RUXA 1S6PA 3JSMA 2PVGB 5J1PA 2GVZB 1FK9A 1A0NB 4LVNP 3L9ZA 1IBKF 3UW1A 1IBMF 2ATLA 2QA4T 2NQPA 2MSTA 1MNDA 3A3OB 2DEUA 2E5IA 3H20A 3IR6B 3FRZA 4KJIA 2CDRB 1KVIA 5HK4A 3KOAA 4JLGA 3ZBDA 1IGQA 4OI0A 2BZYA 3POTB 1UB4A 2WCXA 1FDBA 3GBQA 2MOXA 3KWMA 1RAHB 2O9SA 5GAEI 4DSEA 3JSMB 3CE8A 4KO0B 4LREA 1YHQT 1YJ9Q 4OMFG 1L3UA 2A28A 1JLCA 2WVFA 2RDJA 3IFEA 1T0TV 4JI5F 1KS2A 3PHEA 2ROLA 3B6BA 1MLAA 1ZPWX 5D3GA 4UUWA 2ZM6F 3VZHA 3BGLA 5FIIA 2RE1A 4AG2C 2V69A 4F4ZA 2MKJA 3BREA 4MIBA 2HURA 1N5ZA 5F8JA 4MDWA 5HL7Q 1UMJA 1RJJA 3PV8A 1HI0P 2ZC3A 5JUMA 2KDSA 3CCJS 4FL6A 1YI2T 5D3GB 2PMWA 1N34F 2FVPA 1HYOA 2ACYA 4LNPA 4ICLA 1RWNB 4JV5F 2MWOA 4LUDA 1LJOA 2WSFE 1TH7A 5IH2A 1N32F 3H2LA 5CO7A 2J9EA 2RIJA 1TG0A 3M6WA 5JXSA 1JLFB 5KFJA 3RAMA 2J6KA 3W64A 3TQEA 2VVKA 3ISNC 4JI6J 5ETTA 2RA2A 2H65B 5I2MA 1JLEA 1ZM3A 3QGHA 3ZNUA 2MKIA 2NXEA 3K5NA 3LA0A 2BE9B 5CVIA 3N6LA 2PT0A 4CYUB 4N0AA 4IRKA 4KBIA 4IH5A 4B9TA 4DV3F 3S1TA 2EFPA 2GO8A 2Z56B 3UN5A 5A0YB 4O3NA 2GMLA 1X9SA 4EPCA 4JI7J 2YKQA 2ADBA 2ROPA 4Z2XA 2YNGB 2AYMA 2YX1A 2MQPA 3H4DA 3VCDA 3MTJA 1JQGA 2K3XA 4WCEQ 2RUGA 2DVJA 3M59A 3TQ1A 2DE0X 3PEHA 1KONA 5CCLA 4K2XA 4ZNXA 3D28A 4A8MP 2DNQA 2H3EB 1PO6A 1UJ4A 1O5JA 1WEZA 3NEKA 4XTXA 3DXBA 1BQMA 2CNKB 3F73A 4RWXA 2EQKA 2JWNA 2R42A 4BWJA 2EC0A 4HHHA 2UXDJ 2B4VA 1WYXA 2V26A 2DGUA 2YPYA 4K7QA 3JCMQ 3RBBB 1H3DA 2RS8A 3RUBL 4IKAA 2QGFB 3MECB 2JLGA 4K5SA 3DOMA 2RSQA 1HLWA 3MP6A 1BQMB 1RT7A 3U1MA 3OB9A 1SVDA 4UF4A 5CYQA 3KHLA 2BE7D 4J7CA 1JKHA 2AMCB 1JLAB 2C3OA 3NOCA 1TL7A 1AZSB 1FDNA 4ZVTB 5SZTA 2F8EX 3NGUA 3R5JB 1MW7A 3TX8A 5HJYA 4GO5X 4LF6J 2KFNA 4BDYA 1U45A 4KUDK 3M1VB 4ETXA 2CRLA 1BHNA 5KFOA 1QUPA 1TZ0A 5EX3A 2OEMA 5DZ6A 1VRUB 1GH8A 1OMSA 2EBPA 1UGVA 4QWAA 3EGDA 2E5JA 2DIVA 2Z0GA 1M1KT 2HBWA 5GAGI 3NTKA 1FFGB 4PABA 5C6SA 1D1UA 4B3MJ 2IVWA 3P5BP 3J7ZT 3FEXB 1C4AA 2ECZA 2M02A 2XWYA 3I0RB 1F0XA 3MD1A 3BH6B 1UGPB 3AT1B 3EGDB 2UXBF 2DTHA 1RK8A 3DRRA 5IS2A 2A08A 5RUBA 2FPDA 4BDZA 1KTVA 5J2PA 1RWWB 1VQNA 1N0VC 1ZM9A 1U1OA 5GAMf 2DBBA 3D0HE 3MEVA 1GFWB 4MMKA 2QA2A 4XTTA 2BRLA 1S7IA 2PIIA 3CCMQ 1C0MA 1KQKA 2U1AA 1Q16B 3LP2A 4J90A 2DGTA 1RTIB 3JCMJ 2C0IA 4USWA 2LCSA 5J2PB 3J81U 3I5BA 3IM9A 4QR2A 2DNNA 3EVWA 4EMHA 4AFSC 1QJHA 3M9QA 3BW1A 2DXDA 3DHWC 4ED2A 1WHWA 1I6JA 4P7VA 2CJXB 3NOGA 4NMXA 1NB7A 4PLIA 3FJPA 1KQSA 4RW9A 3ISZA 1LWEA 3EG1A 1M90R 4CLWA 3LGMA 2QA4G 4IURA 3GCXP 4ZPAA 4O4RA 1TFWA 4X1VA 2RB7A 3QSUA 4PG6A 3EG2A 3B4MA 1S72Q 4ZPDA 4K4UA 4DR2F 2DL5A 3QJJA 5B0DA 2IBOA 1FE0A 2K2MA 5CD4A 2ZH2A 1NKEA 1QAIA 1UVNA 2JJ4D 4RW9B 3OYBA 1LWEB 5D77A 2RI3A 4R25A 4WXOA 1UHCA 3C2PA 3CO9A 3ETOA 4WP3A 2CVIA 2VXEA 1WSVA 2DB1A 2J06A 4QIWD 1AYEA 3ILIA 1ZZNA 1VQ9Q 3HRUA 4CNYA 5GAN4 4A8KA 1NJYA 1AUSL 4A8FA 1Y10A 2OTLS 1H3HA 1RLDA 3BR9A 4QVCA 4E7LA 3J7AF 1HXDA 4YB6A 2HSPA 4BI4A 5FDLA 4N8OA 5M9OA 5FRNA 2V9KA 3QG1A 4ZVEA 3I55A 2HCKA 3DGPA 4NZ0A 3QKJA 2DNRA 1WKJA 1N5YA 3H0IA 4TQSA 3HPOA 1ABOA 1Q8KA 1NEGA 4ZN1A 2VQEJ 2CPJA 4D8DA 3D66A 1C1BA 2IPOB 3T5LA 3C4SA 5LJ5g 2PMZD 5FDLB 3K2YA 4DV2J 1FNMA 2YUQA 1DTTA 3M8ZA 3Q22A 3IAM9 1RWKB 1X5SA 1JB0E 3F41A 2QEXA 4E7ZA 1FXDA 2LXIA 4A46A 5IXBA 1N5YB 3I5SA 1VQLT 1C1BB 1RDRA 1R89A 4LF9F 3C6TB 1MNEA 4F16A 4NE9C 1I4K1 1RZMA 2KYBA 1DTTB 5CHCB 4K4VA 2C1EB 4HTJA 4WKRA 2NPIA 4M7AF 5IAYA 3RU0A 1RKJA 1Q78A 2RNEA 1U5SA 1JLGA 3OHAA 4EWTA 4ZLLA 2VFRA 3MM7B 4FKXA 1QVGA 4EMGA 3I5CA 3CJKA 2XYPB 4BACA 1LEOA 3IXQA 2XMVA 4OI3A 1S9GA 2F9JA 1SC1B 5J1NA 4KT0E 1RHUB 3D1OA 3PCOB 4WYWA 2KT3A 1QDUB 2B4PA 4DR5F 1YGYA 1RHKB 4U95A 3AODA 2Y9HA 2K06A 4A4GA 3H7HB 4KGMA 4FS2A 1C6VX 3VGTA 1OV3A 3IS9A 3QO9A 3QFWA 1OX8A 5KFNA 4QZVB 5I3UB 2AGOA 3EZ5A 4JI3F 1S9GB 1HBOA 2MJUA 2E5GA 4A8WA 3OUYA 4FXWA 5CAAA 4DR4F 4RW8A 3UDVA 3VTIA 3NWRA 3CBOA 1WC4A 3IR5B 3Q2SC 1M3AA 4XK8C 5HVHA 1NPRA 1ZLMA 2BKNA 1S79A 1AWWA 1YWXA 3O8WA 3A1YG 2ZFHA 4LFBJ 2UUCJ 3EYZA 2CPDA 1KHCA 3SCKE 2G4BA 2VFUA 3RDVA 4C2MA 4ETZA 2F4VF 1IREB 3DOKA 4J91A 4OHVA 5L9NA 3OUYB 2FVSA 5EG2A 2XLKA 2AT1B 4RW8B 1T3SA 5FLXE 1QVFS 3HKSA 3T1AA 1SV5A 4OI2A 3D6HB 1NEBA 1VJQA 1PYTA 4M95A 1X6GA 4JI1F 2VFTA 3CC7T 1VQPS 3L1AA 3NL0A 1TUWA 5L8RE 2AJ4A 1TP7A 4XPEA 3G7ZA 1QP2A 1Q7YT 4NXMJ 1CS4A 5KOWA 2DPJA 1P92A 4K5RA 1SV5B 2V2ZA 5KFKA 1C2PA 3JCMf 2O1PA 3G6ET 2FLPA 4Y65A 2A6OA 2AGPA 5F8MA 4C92E 3A1PA 2HGNA 3S3OA 3NS5A 4HI2A 3WDOA 1T7PA 1ZSGA 1NJIR 3SFMA 1NZAA 5GMEA 1TAUA 3M30B 4DV0J 4BY6C 1CS4B 3L3CA 4O3PA 4FYDA 4RUHA 1HPZA 3CPWS 2QQAA 2MZQA 4AT1B 2RPNA 2MLYA 3KG1A 4N7TA 2O2OA 2H1YA 2CPYA 2DNKA 3OA6A 4F25A 1PSFA 1VQKT 3LLRA 2GIFA 4C8QE 3JCMd 4RW7A 5A6PA 3RG6A 5LJ3Y 2K5FA 2ATCB 2YWWA 2JHEA 2WW4A 3FJ5A 5CQYA 3K8VA 3NMAA 2RHZA 3EFSA 4E2FB 1C0TA 1HPZB 1IBKJ 3VALA 3KFVA 2OP5A 3KUFA 3VQSA 3EGXA 2XI3A 1IHWA 4KHMA 3VAKA 6AT1B 2ESWA 1ZSZA 3R5CA 1HBUA 4ZGDB 3M8WA 1NE8A 1FMVA 2HMIA 3QYHB 3V7SA 2XNRA 1D1AA 2NUUG 1RISA 1PCXA 4ZDNA 2KT2A 2HPUA 1CVJA 1TMMA 3ZZPA 3VAGA 1C0TB 3HHLD 2LXUA 4N56A 3CD6S 4J6YA 3VGVA 4RR5A 3EGXB 3PW2A 2KVIA 4JI5J 1DQ9A 2EPIA 4KIAA 2B4OA 2HMIB 1WI7A 2ZM6J 2N4CA 3CCLS 4PQUA 3DXSX 1YVFA 3KKFA 3VVTA 1WOSA 2R7WA 1ZS6A 2GS8A 3G2XA 4CO1A 4ZTFA 4X4NA 4FS1A 5B0GA 4TU8A 1UWAA 4K4YA 3IRXA 1FJGJ 4IIMA 3KJNB 4JS5A 3NNCA 1NAQA 2FVCA 4Q2LA 2RDDA 4OYWA 3WZ0A 4K59A 4A4EA 4F17A 1NK7A 1IR1A 4P73A 3OYAA 4JV5J 3VV0A 4PQUB 3RTVA 4M77D 1JIHA 2R8JA 1KFDA 4ZVOB 2WACA 2OLWA 2OTJA 3C6UB 2MQNA 3PO4A 4MKBA 1WDDA 3QZ5B 2VB6A 1H74A 3IRXB 4F2SA 2WBMA 2DTIA 4OMNA 3EWGA 4OMMA 3OTBA 3I9V9 4P7TA 3I87A 2KL8A 2PUOB 2XS7A 2WTFA 3ENWA 3IG1A 3ILOA 5AE2A 4ZN3A 1CULA 1FKOB 3M2VA 3DM2B 3T41A 2ROTA 2QTVA 4M7AC 3UCUP 1IBLF 3NWGA 1WHLA 3MHXA 2DTJA 3QBYA 2VXFA 1WZOA 3BFMA 3GFZA 4UZCA 3OYJA 1VIXA 2YKAA 3V8LA 2KRNA 4M5HA</