3P8BB

X-ray crystal structure of pyrococcus furiosus transcription elongation factor spt4/5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
b'AGKIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNKGVVDEAIRGIRHARGVLPGEVPFKEIEHFLEEKPAVSGLEPGDLVEVIAGPFKGQKAKVVKIDESKDEVVVQFIDAIVPIPVTIKGDYVRLISKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase, subunit e''
publication title RNA polymerase and transcription elongation factor Spt4/5 complex structure.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase/transcription
total genus 33
structure length 147
sequence length 147
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00467 KOW KOW motif
B PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3p8bB02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 3p8bB01
3P8BB 3G4SA 1VQLT 2CKKA 1YJNA 5DM7R 1UEBA 1QVGA 1KD1U 3OYYA 3CCJT 2K06A 5A2QE 1VQMT 3CD6T 3G71A 5LL6S 3CCUT 3CCRA 1M1GA 3CCJA 1Q86C 1VQMA 3LGLA 3CD6A 1N8RC 3CPFA 1M90C 1JJ2S 2JNGA 2XHCA 3H7HB 3CCST 2JVVA 2OTLA 4ZN3A 3CCSA 2JUFA 3PIOA 3I56T 3ER0A 1X6OA 1YBYA 3I56A 5IT9E 1VQOT 1YJ9A 1KC8C 3CCET 1KQSA 3A5ZB 5FLXE 3J81E 1YHQT 1VQOA 1VQ7T 1QVGS 1M1KU 2OTJA 1K8AU 1K9MU 1YHQA 4ZN1A 1RL2A 1VQ7A 3CXCA 1VQLA 3OW2A 4TVRA 1YIJT 1EIFA 2KDSA 2G3RA 4CRIA 1QVFS 1Q7YC 3HKSA 3CC4T 3KBGA 3CCUA 1K73U 3CMAT 1VQ8T 1Q82U 4X34A 3CMAA 1NZ9A 3I55T 3DB4A 1YJWT 1NJIU 1VQ8A 3QQCD 1XTDA 2IG0A 3G6ET 1KD1C 2DO3A 1VQ4T 4YTLA 1KQSS 3G6EA 4RG2A 3CPWA 3CCLT 1VQ4A 3LGFA 1IZ6A 3CCLA 1Q81U 3CCEA 4QQDA 3OW2S 3DLLA 1VQKT 1NPPA 2EIFA 1M1HA 1YIJA 3CMET 3CC4A 2LCLA 3CMEA 5J26A 1M1KC 2LVMA 3DB3A 2QA4T 1YI2T 1S72T 1K8AC 1Q86U 1K9MC 3J7AF 1VQ6T 2QEXT 5DLQE 1W2BA 2QA4A 3I55A 1S72A 3G4ST 1YJWA 1N8RU 3CPWS 2JOYA 1M90U 1VQ6A 2MI6A 2MWOA 2KVQG 1YITT 3LH0A 1XNIA 1VQ5T 1KHIA 3CC7T 1VQPT 2LQ8A 3G71T 3CCMT 1K73C 1YITA 1VQ5A 3CCRT 1VQNT 3LPEA 3CXCS 1BKBA 3CC7A 1Q82C 1VQPA 3CCMA 2EXUA 1NJIC 1NPRA 3CC2T 3TREA 1VQNA 2OUGA 2MWPA 1KC8U 1QVFA 1VQKA 3CC2A 3JAME 2E70A 5IAYA 1NZ8A 2OTLT 3J80E 2E6ZA 1VQ9T 5J3BA 1JJ2A 3CCQT 3CCVT 1W2BS 1Q81C 1VQ9A 1YJ9T 2L3RA 1Q7YU 5HY6A 3CCQA 1SSFA 3CCVA 3EWGA 1YI2A 2OTJT 1YJNT 3PIPA 2QEXA
chains in the Genus database with same CATH superfamily
4LRCA 1S49A 4WFBQ 5EN1A 2LKZA 3NOGA 1CJKB 1Z2ZA 3E1SA 4JOUA 2LQBA 2ENMA 1WHKA 4X9DA 3FFIA 3PIOA 1YI2S 2ACYA 2G2YA 2XO6A 1Y7XA 1BQNB 1NK7A 4EMGA 3OYAA 1QVGS 1B7YB 5F8IA 3SFMA 1WEXA 2UXDJ 3S3MA 4BHQA 2UVWA 3UPUA 2GO8A 3D1HA 2C3YA 1PWTA 2HCKA 4C0DC 3CMAT 1HI1A 4KAIA 3FBBA 1T9UA 2QZ8A 1Q8BA 2KAFA 2F63A 2OTJQ 3MI7X 4Y3CA 4TU9A 1HHSA 2E1RA 3CMQA 2QQBA 2YKAA 3KLVA 3QLHB 4E47A 3CCUS 1X4CA 1CEZA 4M77C 3EJMA 2VBZA 3DRRA 3PFOA 4CLPA 3BO4A 2GQ2A 3TW0A 2RKIB 5GAGU 4LF6F 5L9XA 5KFFA 3FMWA 3DLKB 4RW6B 4LJMA 1N8RU 2J6SA 1M90U 5E7OB 3PYFA 2BMBA 2HQHA 2HMIA 3THTA 1WLPB 2V69A 1VQNT 3B82A 1PBUA 4AUKA 4HCKA 3CPWR 3KUGA 1R0AA 1DHMA 4X62F 4G1QA 1JLCA 1KS2A 2QE5A 2KXFA 1FRMA 2M0GB 2X3GA 3I31A 2NCKL 2J6KA 3UA7A 4JI7J 4AFUC 1R89A 2A3LA 3VTIA 2VONA 4IH5A 5KYYA 4HTJA 3OFGA 3MM6A 1U1MA 2GF7A 4P5NA 2NZCA 2D8HA 4QU6A 2E3IA 4DEXA 2GNKA 2HWIA 4KHPF 2G0IA 2G9OA 1Q86R 3IBCB 2PO4A 2CJXB 2W1BA 2DIGA 2UUWA 2UUTA 3J81U 4F7UA 3MHXA 2CNKB 5E33A 2KFYA 4JI3J 4JLGA 2LMIA 1V76A 1YJ9A 3L2WA 3CJRA 2HFUA 5A0GA 1NMEB 4LF2A 1HNWF 1SVDA 3PR4A 4LF1A 2F3JA 4CO0A 3THPA 2HFZA 1VQ8T 2RB6A 5IWAJ 3OXLA 4P7VA 3HO1A 3RZAA 4ED1A 2W7PA 1G2BA 3BO3A 5I2MA 4D6WA 1LXJA 3IWLA 1SHFA 2WK4A 2VQFJ 1KQFB 3S6WA 3POTB 2DKGA 5KT5A 3NPFA 1UFKA 1M30A 3SMZA 2MI6A 4F4YA 1D8ZA 1OSDA 4ZK7M 2FYKA 2YNHA 4N8NA 1RWNB 2EVZA 4M7DF 2GHPA 1FESA 2ROTA 3A1YG 3CXCP 5HVFA 3LYIA 1UGRB 2YHTA 4OIXA 1GT8A 1RBOB 4DV4F 2OTJT 2YNIB 1FKPA 2MZTA 3OTBA 5DETA 3KNAA 2V8GA 3SQOP 1U06A 5LL6d 3EGXA 2UXBJ 4LFCJ 3L9ZA 4J9MA 5L23A 3M53A 2ILZA 1BXNA 3JSMB 1YITQ 3G4SS 4RTWA 2M4MA 5DJBA 3MMCB 2X51A 5M2RA 2O4XB 3G7ZA 2G3RA 2RHQB 3BQ1A 1Q82U 1AHJB 1PNJA 2GGRA 1FFSB 4ZVHA 3MM5A 1WD6A 5HQLA 3KK3B 4HVWA 2MKYA 1M5PC 1MSWD 4LR8A 1B0TA 3CD6Q 3X26B 4ICLA 3UN2A 4NXMJ 4GKJF 5GAMh 2R2SA 3CF5Q 5FWBA 2L3QA 2YKQA 2FQQB 2L5QA 3LAMA 3M6WA 1YJUA 1TS9A 1MWYA 1HBMB 4HA8A 2G6FX 2PUKB 2EJFA 1SC4B 2AD9A 4M7AC 4UC4A 1YHQS 3LP1A 4X64J 1UWBA 3DOMA 2VG6B 5C7PA 2UVRA 2RPNA 5IV4A 2MWPA 2VC8A 1QVFA 3X24B 2YNFB 2ROEA 2ZBQA 2K3BA 4ZS6A 3OJUA 2YRCA 1YP5A 1JJ2A 1SKSA 1M5OC 4ATOA 2HQGA 1JXOA 3QT7A 1BIBA 1UKUA 5B0BA 1S1VA 4BD3A 3DU6A 2RRBA 2ADCA 5DM7R 2MEWA 1K9MT 5G0RB 2XZTB 4ZTJA 5GAHI 1A7GE 2YX4A 2KXDA 3VQSA 1K73T 4DQIA 1TMJA 4KTQA 2CREA 4LF8J 1OYEA 4NLYA 4F2SA 2BE2A 2CDRB 5IH2A 4Y2KA 3FKBA 1NB7A 2IY5B 1WKLA 4IO9Q 1JQQA 1W7WA 2XNQA 2JFDA 5B0FA 1D0EA 3CT9A 4I4BA 2E44A 3M0TA 1JU5C 1VR6A 1I0CA 1GX5A 5BYQA 2JH3A 2O66A 4DL0C 2HEQA 2R7OA 1AZGB 1ZBJA 1FDBA 3VS4A 2Q6CA 5KT2A 1AUDA 2RMLA 1RKJA 3ZXWA 2ZFHA 3RG6A 3RJMB 3DGVA 4QPTA 1S1TA 2PFFB 3MR2A 1MMAA 3DM2A 3EH1A 5IM0A 4WJBA 4WZQA 5IXBA 2XB2D 1RTHB 1YITT 3NWRA 3A3NB 2FJXA 2UU9F 3I87A 1MWQA 2W24A 1WQWA 1JLAB 5GMKj 3THKA 1Q8IA 4OQJA 3D3BJ 3KJNB 1Y5NB 3VUZA 2D9PA 1Y3KA 2QMXA 2B8AA 4IUVA 2NUTB 1IBCB 5JJBA 2E65A 2CQ0A 2KHCA 2KDOA 3VAIA 2MZSA 3CD6T 1MMNA 2CDTA 3CIMA 3TR5A 2EFPA 4RWWA 1X4EA 4HT5A 3DLGA 3NS6A 1IKVB 2EAYA 1MU2B 1Q78A 2FHJD 3MM7B 2BJDA 4DL7A 3HX9A 3L2VA 4UUWA 2H54B 1S1WA 3KJQB 4A4KA 2JOQA 1TKTB 4RNNA 4NXNJ 1BUXA 4HHUA 4K5SA 2P84A 3WIVA 4YTLA 1AEYA 4ZITA 3BGRB 5BJRA 2F4VJ 5A6PA 3PYGA 4FN5A 3PYEA 2J6OA 2XMMA 2KYXA 5KG3A 5DDOC 4IRDA 3ENWA 1D0XA 4JRKA 2LCLA 1RT7A 3MR7A 3OW2R 5DM6Q 4N8OA 3AXKA 3DOLA 1SBRA 2JNJA 2XYHB 2RQMA 1FXLA 1H8KA 3FBEA 2RE1A 2O5DA 2XS2A 4C3MA 1HMVB 4HACA 1KFZA 5ETQA 3M8WA 2DETA 1PSFA 2AJQA 2KMTA 4HHJA 2B6AB 1U02A 4Y00A 1K0VA 2ZE2A 3MAAA 2YUPA 2RSQA 4ZVUB 2B8PA 2AJ1A 4PJOD 1NRKA 3L7OA 2Z56B 4DV3J 2DR8A 5HMWA 2DXBA 1TVRB 4NEYA 4PZVA 3D68A 2RK1A 2CQ2A 1RADB 4B3RF 1VJQA 3UE2A 4E0DA 2K9GA 1N4LA 4OX9J 2D7SA 4OYIA 1V3SA 2AP6A 4CP5A 3QO9B 4U7UD 3DLBA 1W2BP 3NFCA 5A8RB 6FD1A 3EG9A 1OO0B 2DO0A 5FU7B 1H98A 5A8WB 1HWIA 3UI3A 3LPYA 3U27A 3D6FB 4Z8AA 1BIAA 2QL9B 2KJVA 2P6SA 4AT1B 5K20B 4DS4A 5E2QA 2DZCA 4GVLA 1NPPA 3RW6A 2W2MP 1VK8A 2DNMA 4HDHA 2DK2A 2IIMA 4CYUB 1M1HA 4ZCKA 4RUAA 4JRPA 4ZPCA 3V4MA 1TK0A 3CJQA 1LOJA 4I56A 5ETMA 4CT9A 5HJYA 3T5KA 4KGZB 4ZP7A 4HVVA 1H3DA 1VRUA 3HKZD 4MKVA 3EFOA 5KG0A 3A8JA 4VUBA 1FD2A 2XICA 2DEUA 1WIEA 4K0KJ 4L72B 1FRIA 4UF4A 2HS4A 2IM1A 2HFVA 2HHTA 2DRBA 3JCMV 3QYGB 4CO1A 1LQ9A 5SUHA 2NS1B 1WG4A 2Y8WA 2BABA 5IT9E 5GAOm 2OPQA 3WX4A 3GJQB 1N5VA 2WOMB 3KJVB 5IXFA 4LE9A 3IN5A 1ZSZB 5EC7A 3D28A 3OJSA 4LREA 3ET6A 2RJZA 1B7TA 4H4KA 2X3WD 2NUPB 3OHAA 4M5KA 1YK9A 5H9EJ 4RTZA 1C0TB 3H25A 3CCJQ 3FRNA 1SJRA 4BB7A 4N76A 2Z0WA 2KFNA 2YQ3A 1KIKA 4U9RA 4C6AA 1JJHA 2XMJA 2IBOA 3Q22A 4HKQA 2G2ZA 4O3QA 1CJUA 4TU8A 1S9GB 2GIQA 2DFUA 3ULRB 2RRAA 1PJ6A 1MROB 2VBXA 2HGNA 1PC0A 1Y3JA 4P73A 4JV5F 3Q8PB 1VQKA 1KTVA 4F7UG 4ECYA 4OF1A 1OI1A 4NLTA 2IRUA 2YWWA 3MEVA 2VBYA 2M9KA 3S6EA 3IR7B 2CPIA 3A8GB 3SWNB 1N36F 5F3ZA 4XDCA 3LLRA 4MYUA 1VIXA 2MKJA 1ZPVA 2OPPB 3DMJB 2JVVA 1NJIT 3HXMA 2HQEA 2IMWP 5SZTA 2IHR1 3O3LA 4CLFA 4EK2A 4MKBA 1VIOA 2JXBA 3G71Q 2LP4A 3N6LA 3OYNA 2X3DA 2VIHA 4KIAA 4ETXA 2B3TB 2FLPA 2UUBF 2CQPA 3K7RA 3PJ9A 2PDAA 4DV6F 4PWDA 2JFKA 2RD1A 4BY6B 1M1FA 1HKAA 2DK3A 2IVYA 5KYWA 3RKYA 4M75A 1RT4A 4RG2A 5KYNA 2CPFA 4LF5F 1X4HA 4GKKF 2CQHA 1QE1A 1G3SA 4B9LA 2GFFA 2ROLA 4FT4A 4QVZA 2XQCA 5KFSA 4UOGA 3GR1A 2O2OA 3M9OB 2DXTA 5J26A 3VU3C 5KFBA 3ZNUA 4LRDA 2B7CB 1Q7YT 2RQ4A 2I2YA 1ICEB 1EQMA 3MD1A 2B9YA 2MPXC 1RKIA 3ENAA 3T5HA 1HBUA 5J2NB 1KD1T 1YIJQ 3NMZC 2RHZA 2XY5A 3CB4A 4W92B 1KC8U 3CC4Q 2HBYB 3UDVA 4JJNK 2F5GA 4XAKA 4ZVGA 2DD4A 1R8CA 1EARA 2E5HA 2BJ9A 4EYIB 5U47A 2ACMA 3P45B 2RI2A 4J9GA 5FW9A 3CCLQ 2DGTA 1G6BA 1WZOA 2O9SA 2NXUA 2R7TA 1B70B 3LOUA 3O5TB 3D6HB 4NMXA 3CCJT 1Y7PA 3R5CA 3INZA 2EJGA 3OS5A 2MQQA 3REAB 2OPSB 4M1KA 4C8QD 2RDDA 2WSFE 2WSFC 3FIFA 3CVKA 3PHEA 2BZ8A 1X5OA 5DZ6A 4NL3A 4E8UA 2YUQA 1H92A 1LK5A 1S0VA 1EIYB 4L59A 2JEGA 1HNZJ 3R6LB 1QJHA 2H4WB 2GHVC 2ATLA 5B08A 2HHHJ 4LF7F 2Q43A 1CKAA 3LGFA 1JNRB 1FHTA 2PI5A 1U6FA 4JJCA 5A0DA 2M3DA 1RTJA 3AY0A 4UY8T 1MGQA 1IQZA 3Q8YA 1GFWB 3O44A 3DRYA 4Q0BB 2IAJB 1WJRA 4C92C 2DXDA 2VBWA 2ZNZA 4RNHA 2XU8A 5GMKa 3G71T 3QZ5B 4ANDA 4KBMB 1JKHA 2G1DA 4Q5WA 1NKEA 2EFNA 3MECB 3UDEA 3VJPA 4KR0B 3JB9I 4USUA 4OMFG 3G6EQ 5FJ4A 4WBFA 2L89A 3MEWA 4M95A 1HQEB 2HBRB 3C2PA 1K4US 2EFVA 1IVZA 1SG5A 4Y0FA 1VYUA 2QTXA 1SQFA 3UCZP 2BKOA 3TQ1A 2O3DA 4OMLA 1PKSA 2BE9B 2CP6A 2P4RA 1F2GA 4PG6A 4S0MA 2XI2A 1SRLA 4X66F 2BJ8A 2WCXA 2VJUA 3IR5B 1VQ5Q 2HFNA 5I11A 4DV0F 2CWKA 4K4XA 5I22A 3A8HB 4BUGA 3F44A 2MPUA 1YIJT 3HULA 1FT8A 4RCCA 3CC4T 3KKFA 3MEGB 1RLCL 1U2FA 1FK9A 2WONB 1RWVB 2ZZNA 1U8SA 4X4RA 5HLFB 3M4GA 4RU2A 1LW0A 3CCLT 2ZZTA 4C8QA 2J8SA 5HCKA 3OYBA 3E2UA 3HM9A 1RWWB 3UQSA 1HBOA 4HH1A 1QKXA 3KK1A 4NMLA 2EKHA 1WELA 2UXDF 1YJVA 1Y11A 2LQKA 4FBUA 4JI1J 4F14A 1VRTB 3CCES 1YCSB 4PPZA 1M5Q1 4JRIA 2DR7A 4JDSA 3PW2A 2K3XA 2ZHOA 3TREA 5J1EB 4IQXA 3G82B 2RHIA 2KTQA 3NGPA 4F4AA 2QTVA 3GFHA 3EHRA 1VQ9A 1NSAA 4MTPA 2X7IA 2D74B 3GYGA 1FXDA 1KEKA 2KR3A 1EAYC 3KMSA 2DERA 4YS2A 3BPSP 2LEPA 3JS9A 1PYOB 1VGYA 3M8SA 4F8RA 3QGHA 1VQ6Q 2LXUA 2YKMA 1EKSA 3ILOA 3ZZTA 3V2UC 2VG7B 2R7XA 2OIHA 2EQMA 4MK8A 1Q7LB 2PEBA 3CC7S 4W90B 2PGCA 2KYBA 4J9RA 1OY8A 3KG4A 4B9UA 4YY3J 3PIOQ 2MMPA 3CULA 1TV6A 3AB4B 3W2WA 4EMHA 3PRDA 3T6BA 3VS0A 3G6ET 3N79A 4OMMA 4NCGA 1HW8A 3D1QA 2NYIA 1NK8A 1RHRB 1IZ6A 2P0KA 2AF6A 1RACB 3CDBA 3TAMB 2W9AA 2NWMA 1BE4A 5AE3A 4HVUA 3R2CJ 4JI3F 1NJYA 1GNKA 1T02A 2NXJA 4ZCLA 4DSJA 4M5DB 2MQOA 1K8AC 1Q86U 2GX8A 2A2CA 2OEMA 3RTVA 4DU8A 4TN2A 1NJWA 2YBVA 1VQ5T 1UEUA 2WBMA 2E5LJ 1BC6A 3FBCA 5D78A 5IWAF 1FWLA 3RB4A 2CQDA 1U8WA 4DR6J 1T05A 1KQSP 1WXTA 2ZPBB 1SJFA 2GGPA 5CA5A 3HHLD 2DL4A 1FRKA 2V34A 4DR5J 1JXLA 1ZOTA 4PKCC 4F4ZA 4ZJOA 3OVSA 3MEDB 4CRJA 2VQFF 3JB9k 1HD1A 3OYDA 2VHGA 1PILA 3FVYA 2WVDA 5HATA 3D6MB 4DSEA 3QO3A 4Q2LA 4L6V5 3CE8A 3TAPA 2IA0A 1I3OB 3TA2A 3KLHA 1MMDA 2LQ9A 2EEYA 4DLEA 2RIJA 2HG4A 1ZHIA 3I56A 2KM8B 2Z8QA 2J7IA 5K8MA 5DQIA 3JAMY 2YRDA 5BYRA 1GH8A 5GAN4 5HBMB 2VPWB 2QGFB 2ASJA 1YJ9Q 4IOBA 4C5GA 2V2ZA 2RH3A 4TLRA 3I82A 3X20B 1OQKA 4FYYB 3NHNA 2R7VA 2UXBF 4LFCF 2JL9A 3E01B 1YWOA 3I4HX 3C66A 1NDKA 4LDYA 2DPPB 1SPBP 1EKRA 5D4NA 2XNRA 4O3OA 1X01A 5EWEA 2K7JA 1VQ6T 2JWNA 2DLPA 3KLGA 3JAMU 3MCOA 1QTMA 2JS2A 3PR5B 3OBWA 5EDWA 1WTBA 3FFIB 2H3JA 4AYBD 3JCMJ 4A54A 5D6WA 4BE1A 3H5YA 1M5VC 1YBUA 5LJ5f 4LUEA 4I1TA 4LSZB 1VDHA 1XQHA 5T41A 4RUHA 3GG0A 3NY0A 1I1GA 2K79A 4I68A 3UR3C 2WW4A 3JCMe 1FKOA 2JMCA 3BR8A 4PJOG 2CZ6B 2VFSA 4U8YA 4C2MA 2LCSA 4CLWA 3MHYA 4OJHA 3JRZA 4X64F 2JUFA 2E6NA 3KHGA 3DRRB 1NLPC 1VQPQ 3Q1JA 2VL1A 3JCMd 1J2VA 2HMIB 1RAIB 2DNUA 5DG7A 4WIQA 1FMVA 3W5YA 3R1HA 3HFNA 2M2BA 5A76A 1REVA 1G4CA 1K8AR 3RAMA 1XTDA 4CNYA 1R0AB 1X43A 1T9WA 4G1QB 1JLCB 3QAEA 1Q81U 4DJBA 5T7LA 4LF8F 1TQLA 1AWOA 2QLJB 3CD7A 5KYYB 6AT1B 3NS7B 3MM6B 3OTOF 1UGSB 2HQIA 1X2QA 1RK8A 2QXFA 4UZBA 2QT7A 1WJSA 2VPYB 4F7UB 5GJWB 1H72C 3KK2B 4F3QA 2X4JA 1E6VA 4WFNQ 3HHNB 2D3OR 3OSSC 5HVHA 1VHFA 2KYZA 4M7DE 2EXUA 2GFUA 2AKKA 4A46A 2YKOA 3B4MA 4WKRA 2APOA 2HHSA 2Q3PA 3EH2A 2Y0SD 1YJ9T 3CUNA 1F5AA 1FYNA 1NLKL 2EBPA 4D8KA 4ZJLA 1SV5A 8RUCA 3R7SB 7FD1A 2FVUA 5D0RA 3FGVA 2XCPA 4YR2A 4ILLA 2FEIA 2DL7A 3VKIA 3BQ2A 4LF9J 4MZTA 5I3UA 1N0VC 3M4YA 4YB6A 4NA2A 3RR8A 5KFMA 5AE2A 1DQ9A 4X4UA 1VQ7A 1PYTA 1LEOA 3D0GE 4ITSA 3OYHA 2LCWA 4BS2A 1Q4RA 1TFYA 1NZ9A 1CSJA 3N28A 4F3OA 2JX2A 2D6FA 4NLWA 2K4YA 3TSWA 1KQGB 1W70A 4BI4A 2CQBA 1ZYQA 1OJ4A 2R3VA 3PHTA 1VQMS 1FKPB 1X60A 3E3XA 1I5LA 3TARA 4F16A 4FS2A 3EGXB 2KZMA 3HSGA 4PXDA 3GIKA 1UFLA 5F8GA 4PFZA 4ED0A 5KYUA 3DOKA 1I1JA 1VQPT 5B09A 2GQCA 4ZCMA 2EYXA 2BV3A 4NXNF 4RX6A 1TL3A 2O01E 1HNIA 5FROA 2BOAA 3F70A 3J7YI 3JCMc 2F4VF 4QIEA 4AQYJ 3IRWP 2RHYA 3VAJA 3HHKA 1YI2A 2XMAA 4CCHA 3P8BB 3MM5B 3O6QA 1M1KT 1QVGA 3CPWP 2DBMA 4I6AA 3AJ2A 2J7WA 3I5BA 5KFDA 1B7FA 3ZZZA 4ICLB 3VQTA 3P5BP 2B43A 2QA4S 3EG2A 4NZ0A 1NYGA 3BM7A 1QP3A 4F0MA 1S0OA 4AFQC 2FB0A 5D6GA 2CZ4A 5AT1B 2CP0A 1QP2A 2EPDA 2J6FA 2OFGX 2VU5A 1HL6A 1BQMB 4ILRA 2DNYA 2ESWA 2DGXA 3CCUA 5K8OA 5KFWA 3LP1B 1UWBB 3DOMB 3M57A 4CLZA 5FU6B 4DV3F 3P49B 2FG0A 1QCFA 3SB2A 3QKJA 2CGHA 2AHOB 3OPKA 1LWEA 4PFPA 3OFHA 3GJSB 2D0QB 2L41A 2PMWA 4TVAB 4JV1A 3JCMW 2GJ2A 1OU8A 2OKQA 1S1VB 5KFIA 2G4BA 4OX9F 1Q16B 3HVAA 3AQOA 1Z1ZA 4DPYA 2DXFA 4M94A 1U3OA 4B3SJ 1U48A 4R55A 2DRMA 3P96A 5EX0A 2R7WA 4J5OA 3EXCX 3M9MB 3BH6B 4QVDA 1F9HA 2D1CA 1D9AA 1VQOS 2R58A 2BE2B 1QLNA 5KAKA 4OMFB 4BWJA 2P8IA 1FX2A 1XQIA 2IVFB 3SFGA 5J3BA 1H73A 4R0KA 1W2BS 3I55S 2K57A 2ZC3A 3V81A 5D0HA 2FZGB 3OBIA 1ZM3A 1FFGB 2HQCA 1KSPA 2NQPA 4DV5J 2CAJA 1KOHA 2KHDA 2FHMA 2KH9A 3X1LB 5C25A 3VS7A 1S72Q 1QUPA 2GZOA 1ZAWA 2RK2A 2VPZB 1NYFA 4MIBA 1U1PA 3TUPA 4UOCA 1S1TB 3Q2TC 1ZM2A 2VXEA 1OOTA 3MM9A 4C8QG 3DM2B 4HKEA 5IM0B 3CC2Q 2ZBPA 1IBKF 3BYRA 3DC2A 5E3AA 1T95A 3EG1A 3CMAA 3KLFA 3TUJC 2CUBA 1RTZA 1EJ7L 3W60A 4Z7CA 3HHDA 2MGZA 4QQDA 2LVWA 1N54B 2V2KA 3K58A 4RW8A 4CH1A 2CT3A 4BI8B 4OYBA 4DR4J 2ZOGA 4RBVA 2ATCB 4ZP8A 1Y9OA 1LCKA 2DJWA 1CJVA 3FRYA 5JVGQ 3ZTSA 1RWKB 2AV5A 2GQVA 2YUOA 4Y28E 1FMWA 4Y28C 1C0MA 2CPEA 1BGXT 3DLGB 3W1YC 1XR6A 4KV8A 1BKBA 4F7UF 3MCNA 4HT9A 4XU0A 1VQNA 2EG2A 2M5YA 4DUYJ 2KI2A 4Q8EA 2Z0GA 4MJKA 3GPAA 1S1WB 2AX1A 1T3SA 5HMXA 1H641 4MMKA 4BLGA 4OB2B 3G4SA 3RRHA 1AD5A 5DY9A 1QUVA 1QVPA 3LWHA 5B0EA 5I3PA 2B51A 4RR5A 1A0NB 3T1YJ 3P4UB 4DBRA 1N8RC 2X4WA 3BN4A 1M90C 2HHXA 4DS5A 4WYWA 3RERA 5D15A 3QSUA 3DLHA 4DV2J 4E7LA 1NDCA 3CCMQ 3IAM9 1RT7B 4MKAA 4H4OA 1JO8A 3OA6A 2DHXA 3DOLB 2RN8A 5ETLA 2RO0A 4OI3A 2RJDA 4OMPA 2ASLA 3NNCA 1X6GA 2BR0A 1JLQA 4KHRA 4IR1A 1VQ8A 4HACB 2WVBA 2A08A 1WC5A 4R5PA 5ETKA 1UW4A 2ZE2B 4J7IA 2EKNA 2LT1A 4C8KA 2BKDN 4EBDA 4QT7A 4PAAA 4ECZA 2LVMA 1S72T 3HFVA 1M0SA 3VAMA 2HZVA 1NK6A 3BBFA 2FPDA 3CC2T 2B4UA 3F0NA 4URQU 1Q8LA 2CFXA 4O4GA 1B64A 4Z2XA 1HBNA 2NLWA 3N4WA 1R8HA 1O6XA 3M4XA 1N6QA 2RQUA 3OSPA 3W7BA 5FLXY 4PYDA 1Q53A 2Z2ZA 3D67A 3G8SA 1VQKQ 4EYHB 2FHOB 2DYBA 3OB9A 1WC0A 3N6MA 5K5MA 1W1FA 3UD5A 1KVIA 4JI2F 4J6XA 1KLMA 3CMEQ 3HKWA 2DHHA 5LJ3d 1YBYA 4XU3A 3BKTA 5CQYA 2M1HA 3GZ7A 1AWWA 2LQJA 3FEZA 2PTKA 4I7FB 1QSSA 1H2UX 5GAEI 3J7ZT 4QR0A 1C1AA 3BQ0A 4A63B 3LP2A 4JP8A 4P71A 2CQ4A 5KFNA 4ES1A 1QAXA 1VRUB 2DGVA 1HFEL 4CZCA 4X4SA 3EFOB 2MLYA 2LYVA 1S77D 2EW3A 1R8BA 1ZAXA 3ZTPA 2KU7A 4RNOA 4X4NA 2KL8A 3FEYB 1NM7A 1SJ1A 3GIBA 1OY6A 2KRSA 2WSCE 1PM3A 3H2LA 2EYYA 1WHMA 4ECXA 4ECRA 3W8PA 3LH0A 3CCMT 5C2CA 4F4WA 2O67A 2F2WA 1Q82C 3QJ6A 1IN0A 2KB2A 2LFVA 4J9DA 2ZCFB 4OI2A 4NLXA 2HHHF 4AE5A 1N8RR 3LH2S 2FHDA 1KJWA 1M90R 2V63A 1P6TA 2OPQB 3OW2P 1CULA 4OZ2A 3DHXA 1UGVA 2PU9B 1Q79A 3CBOA 2FZCB 1CKBA 2KNBB 1C1CA 2JZ5A 3ET6B 4AFSC 4C0GA 3LGLA 2HMAA 3GWCA 5CHCB 3C6UA 1PKTA 2NPFA 1ZZFA 5F0WA 3PNIA 4ECVA 2RU9A 1CJUB 1TKXB 4BACA 2UUAJ 3O5ZA 1LV5A 1MG7A 3PRBA 5DLOA 4QYZJ 3JCMh 5KFYA 4CI0B 1DBDA 3OY9A 3JQKA 2LEBA 4OZNA 3N5FA 1X5SA 2LZ6B 4ANCA 2E41A 3GB0A 4P72A 1VQKT 5ETTA 2J0SD 1TELA 1D3BA 4F0KA 3CMET 1Q95G 5GADU 4C0FA 2R5MA 3E2EA 4N7TA 1K9MR 2YNGA 4F3MA 5DLGA 1YITA 1RLDA 3EZUA 3NGUA 2FJAB 3U1MA 2H48B 2OEJA 4M4ZA 2W2NP 4WFYA 4BC7A 4JYAJ 4OL8A 2UVVA 1UVMA 4BC9A 5AXLA 2ZPIB 3JYTA 3ENQA 4EEYA 2K2MA 2DL8A 3NAIA 4PWDB 3RBEA 2XKOC 1IJFB 2BM1A 3D3CJ 4Y2MA 1DY3A 3G1JA 4ME7A 4PNOA 1OYXA 5KYWB 3V5RA 1RAEB 4M75B 1RT4B 4JI1F 3CD6A 2LRQA 2VWFA 1JMTA 3BZQA 1IR0A 2JDJA 1QE1B 4ZIVA 2PA8D 5GAN5 2EGAA 2V68A 1U1RA 1TL7B 5L1JA 2E5KA 4LR7A 5JUMA 4FZVA 4IR9A 3NMRA 2QL5B 3M0UA 1C1BA 1HBUB 3JTPA 5FU7C 4UZCA 2SXLA 4R0JA 3G96A 1GEHA 3PFSA 5KT3A 4C5IA 3E8OA 1RJJA 3QIPA 2MAMA 1X4BA 2XBPA 1WI8A 5J1PA 4ELYC 1UVLA 4KY3A 3LWLA 4HT7A 2HNZA 3I0RA 1TL4A 2FC9A 4DI6A 1J5OA 5LJ5g 2EPIA 4QWCA 3TJ8A 3UW1A 2F2VA 3DRXA 1QTNB 3MTJA 5JVHQ 1NK0A 3KFWX 2P0QA 5CKBA 1BY9A 2L3RA 5F0UA 3RAXA 2XMVA 1S7HA 2R8IA 3AXMA 2FPEA 4EMKC 3VV0A 4JB8B 4ANEA 4Q2MA 4CIOA 1H7XA 2BJ1A 4L73A 3ULHA 1OX9A 2QI2A 1HNXJ 5FDLA 4RKUC 2E5LF 2X35A 3X28B 1WF1A 5DDQC 4J90A 4DR6F 3CCWA 3HTRA 1RTJB 4QIFA 4ED6A 4C11A 3R1LA 4K4TA 5IV3A 3EXYA 2W9BA 2IVWA 2V4RA 2VFUA 4DR5F 4HI1A 3W65A 3CCRS 2HK3A 1QWEA 2CJAA 5GAOq 2LLZA 3JCMP 5LMNJ 1JKHB 1VOMA 1SXLA 4Z02A 2YKPA 2R2UA 3MGJA 3IWNC 1ZSZC 1DJ0A 1DQ8A 1KQSS 1WKJA 4LQ9A 1FJGF 2Z4PA 2RUGA 1HPZA 1GCQA 2FVQA 3OVBA 1NBEB 4LIRA 1TAUA 1RWXB 5DO2A 3G87A 2A6MA 2HIQA 2Z2LA 5ETRA 3K2YA 1PO6A 4XIUA 4RTXA 1ZS6A 4CLKA 1VYAA 2ZOMA 3QWYA 2OP5A 4YB1P 1VK3A 2VPXB 1OQ3A 3L7UA 1S57A 1J5EJ 4F04B 2PVGB 3OYKA 3P6YC 3D6TB 4CWBA 1VQ4Q 1NEBA 1FK9B 4PJOF 1TOVA 3SWNC 3UT1A 1LW0B 2F9JA 2QQRA 1FWKA 1WC6A 2F8EX 5GANe 3ZZYA 4C8QB 1FXXA 4O0NA 4PYAA 1EP4A 2ERRA 5LJ5Y 4OYAA 2A7YA 2MYSA 1Q8KA 3OTEA 3OVAA 2V6AA 4K4WA 3KK1B 1XWLA 2C1EB 3FUYA 1O51A 2JC1A 5GMKm 4EI2A 1V6HA 2KDSA 1WHXA 2DNOA 2H3EB 3QGGA 5GANd 3EVOA 3M8PA 1RYRA 3EG3A 2HS3A 2OPRA 4GBQA 1CQMA 1TUGB 4YDDB 1PG5B 1YJNQ 4J9FA 4DN0A 2L9NA 4YDXA 4M78F 4U95A 1HJDA 4PXEA 5CYJA 3R6GB 1U0HA 3PZPA 4B9XA 1W6XA 1HWKA 1WHYA 2XLKA 1I6JA 3CCSS 1LOUA 1A9NB 1HR0F 5A0LA 2ZZDA 2LTOA 2YKMB 2VV5A 1FRHA 2E1CA 3S8SA 2OUGA 3OSVA 3PNWC 3X3UA 1W4SA 4NEZA 1GXUA 5C0MA 3CSKA 4M5HA 4KH1B 2FY8A 3ISZA 1RBLA 3QDFA 3Q23A 4KYZA 5GMDA 1QAIA 2BKNA 4OHVA 3DI6A 4KO0A 4ZA1A 1TV6B 3W2WB 3PCOB 3KYLA 2EKYA 3M8YA 2MK5A 4FS1A 4F26A 1G3WA 1VQYA 2MLZA 2VASA 2R7QA 1M9SA 5D4OA 4GY5A 1KHWA 3RDVA 2XMKA 1YJTA 1VYVA 3HRSA 3V6JA 2DGWA 1NH8A 5KFRA 1EQ0A 2UZAA 2GJFA 4NS5A 2JTMA 3WBZA 5FLXE 2PA3A 3M2VA 1NEGA 3TRGA 4ZGDB 2CADA 5KG6A 3Q8QB 3IMQJ 2CSIA 2VKNA 1ZAVA 2J0WA 5B0DA 4KHMA 4DSFA 1TUCA 4OJGA 2AYGA 3C16A 3OS0A 1T05B 2HQ3A 3GNFB 1RA7A 3EDQB 5LJ3f 3OTDA 2GGPB 1VQ4T 3BGLA 3SFUA 4OI1A 3L1AA 2COWA 3H0PA 4NLSA 1SL0A 5F8JA 3GIJA 4LF9F 1FXRA 2JSXA 2C0TA 2DNPA 3JSYA 1HIYA 1ZQ1A 3OR2A 4YFUA 4OMNA 4DV7J 5LJ3j 4DFMA 1JIHA 2HKNA 1RGVA 1D1UA 4MFBA 2KY9A 2HFOA 3KLHB 2F40A 1S1NA 2HZCA 4X4PA 3FSYA 4FVMA 3C15A 2OAWA 2AYMA 1NJIR 1K1QA 3LW5E 1RT5A 3A8MB 3BDLA 1OYDA 1NUEA 3OT9A 5AXKA 1IBMJ 1TUWA 2COZA 3OLBA 1YJWS 2QYCA 3NGSA 2JRSA 2MLXA 1YJNT 3PXGa 1T0HA 2MQMA 3O1LA 2ASYA 2U1AA 4HVZA 4RU9A 4ECWA 3GU0A 3PVLA 2I5JA 3CCJA 3H42A 4M7DD 5DM7Q 4I2QA 2CJKA 3RUBL 2RVJA 1VHIA 2E9ZA 2R7SA 2XMFA 2DCLA 3PMTA 3VRYA 4I6YA 3GYXB 1KC8C 2X4XA 4J8OA 2MF2A 3D5MA 5GAMd 3NNHA 1IR1A 3PJWA 4DCPB 3KLGB 4AQYF 4C8NA 4A8XA 2HGMA 3EPGA 5T14A 3QFWA 3DB4A 3MEAA 4DEYA 2W8LA 2OGUA 1UTIA 2XTJP 3KHLA 5HSPA 1SIWB 3CCEA 2BX6A 1R6YA 2D3ZA 3IBFB 3FSIA 1G3YA 2WSEC 3ILLA 4LSLA 2DH9A 1FKOB 3T5LA 1WACA 4C0DB 5MLCV 2XCAA 3OHBA 3W9HA 3FBFA 2P9CA 5D77A 3PE0A 4EUVA 3CPWS 2XIDA 4ELUA 2MWOA 4ID5A 1RB0A 3NTIA 3MCAB 4LF4F 1UETA 3SBMA 1S1UA 3IWXA 4DSKA 4HDGA 3WDOA 4DQ2A 5LOQA 1X4AA 2BDPA 4R25A 4XPCA 3PFEA 2LCCA 1PD0A 1S97A 2HZYA 5I3QA 3HPWA 4HCZA 1WEYA 1KK7A 1REVB 4I69A 3O8VA 5FIIA 2ZDOA 4OYZA 4B3SF 3U1LA 2XDPA 3D4JA 3ADAC 3H20A 4NLPA 4OJ1A 4N5SA 4L75A 3TEGA 2PC6A 4E7JA 4XTXA 5T7LB 5KG4A 1RI7A 1ZA1B 2V2VA 2WHOA 1YI2Q 1S79A 3NKYA 2E1HA 3ISND 4CM2A 3T1HJ 3ZBDA 3CDEA 3G8TA 3HSJA 3BB5A 2W0ZA 1NEEA 1PHTA 4X1VA 1T9XA 2IVMA 4ED5A 1H74A 1BWEA 1KQSR 1YBAA 5KFXA 2MSTA 1E6VB 1F0XA 4OZ0A 2OJ2A 2EK1A 2ZH2A 3SSQA 3I5RA 2GTOA 4DV5F 5I2SA 4B08A 2HZAA 4M7DA 2HEKA 1N32J 1G8XA 2AKLA 5KG7A 3CCLA 1F5BA 1MMGA 5C42A 1FJCA 3WVDB 3QNWB 4ECQA 2Q66A 2ZH8A 3CCUQ 2A2DA 2JM8A 3MTKA 3DKMA 1Y57A 4ZHRA 2VOOA 2RHUA 1SV5B 4X9CA 4KULA 1L3VA 1UCNA 1EB0A 1I81A 3KXTA 3CD5A 1CC7A 1VQSA 1WHJA 2G0CA 2YKNA 1KN6A 1VC6A 4PQAA 4J9UE 1SL2A 1QD1A 3PKMA 1GFCA 1UW9A 3K5NA 3OMCA 2ED1A 1E7OA 5I3UB 3P8HA 2ZUAA 5HROA 4WU2A 4IDKA 2E6ZA 1NDLA 1U5SA 4QWEA 1NO8A 4CC3A 3QPHA 2QMUB 1FRLA 4TLQA 1KC8R 2QLWA 3QWXX 3MP1A 3GYNA 2Y8YA 1YBTA 2OELA 4DR4F 4M5LA 1JEGA 3TUZC 3FC3A 1RCXB 2M9UA 2VFRA 2R4FA 1MHNA 1RT1A 1TMMA 4C5EA 5D3GB 3JQJA 1D0YA 3MEEA 3N01A 4F02A 4DUYF 2AKWB 4PRFA 2KQWA 5KFOA 3M1VA 1S0MA 3IRXA 3CXCA 3D7SB 1XC9A 5KYUB 3QGPA 1IKYA 4XDDA 3ZFVA 3KUHA 1S6UA 2A18A 1U1QA 4X34A 2LT4A 1R31A 1TL3B 1HNIB 1HI8A 3T1YF 3G6EA 5D7UA 1UMJA 1VQLS 2COYA 3ENVA 3MP6A 4OYWA 4LSNA 2EQKA 5GAN2 2ZWPA 3M56A 2Q79A 5IHIA 2EW9A 2N3OA 1YI2T 2W8KA 4J83A 2KG0A 1X69A 4J7CA 3C94A 4X4OA 3OYIA 3A8OB 1VQ5A 2DNZA 3JB9H 3HVTA 1NPRA 2DCUB 2DBBA 4U8VA 3BW1A 2XDDA 5AE1A 2XSJB 5FRMA 1RU2A 3SI8A 2KT1A 1NHVA 2FY1A 5DZ7A 2DD5A 2BIVA 1NCLA 5KFLA 3QPIA 2BJ3A 4W98A 5B0CA 2RD5C 3H5XA 3H2VE 3Q8RB 1M8MA 1Y96A 2U2FA 3CCUT 4USHA 1Q86C 2CG8A 2C3PA 2RRNA 3RB6A 1KR4A 1Z9QA 4FBTA 4L76A 1Y5IB 4QWBA 2A10A 2VODA 3UN3A 1GX6A 4ZN3A 3HD2A 1UG1A 3AH6A 3F56A 3G4SQ 2N82B 1TXQA 2QX0A 2J9EA 2MZJA 4LFAF 1FTCA 2N4CA 3PVQA 4IYQA 1QVFS 3L42A 4CRIA 2E7VA 4ZVEA 3HJVA 3W9IA 3PTWA 5FRNA 1DFDA 4Y92A 3T9ZA 2CRLA 2ASDA 3S3OA 2CP3A 4C0HA 1M27C 1TU0B 3ONQA 4OMQA 3NP5A 2HRTA 3V81B 2B86A 1SIZA 1JLBA 2FB7A 4WTOB 3NCRA 1KRPA 5E3QA 3MR5A 4KB7A 1RLPC 4DZ6A 2C3MA 1BI2A 2K6DA 2XS7A 5C25B 1VQ6A 2H4YB 2AEJA 1YHQQ 3UVJA 1KHIA 4PWWA 4B17A 3EGUA 1S12A 2BACA 1KBRA 2MQNA 5DQHA 2HKEA 2HK2A 3HFZB 3CJ4A 1WC3A 1U7LA 3U02A 3KLFB 4DFJA 3HHEA 3UDLA 3OS1A 5IQQA 3FNNA 5A2QE 3AODA 3FZBA 5L8RC 1GBQA 3UFCX 4BDZA 3DFEA 3R5AA 3PEHA 3MAHA 3TYTA 2XK0A 3BKFA 2DIUA 2AYBA 2VA2A 3KLEA 2MQPA 1OPZA 1VBXA 4JS4A 1LWXA 4UY85 3SDEB 1SB6A 1CJVB 5J1NA 3PW7A 1IM4A 4Y2AA 2RF2A 1N56A 4M77E 2HVDA 1A6LA 4F0HA 1CPZA 5H1SV 4ED2A 3EPIA 3FJPA 1S7IA 3P3DA 4MZMA 5GANh 4J6YA 1EFNA 4J9PA 4OZ3A 3A8EA 3LTOA 4OYMA 4ELTA 3BGFA 4N0AA 2NXEA 3ZNJ1 3OW2S 5THWA 3O2IA 2FIUA 2CUYA 5J2PA 4P10A 4DBFA 4RZRA 2R8GA 3HFKA 4Y6IA 2NYSA 4EFAC 4EO8A 5E0OA 2R2TA 2UUAF 3EGDA 2I9SA 4B9SA 5IT9Y 3CGIA 5DLQE 3G4ST 1U49A 5L38A 1Z9ZA 3PO5A 1D9DA 4IUPA 3C6TA 1E6HA 2BUNA 1FX4A 5GAGI 2XEXA 1N5YA 3A12A 1OPLA 3NBPA 1KNZA 4H4OB 1RT3A 2DNNA 3M6VA 3HZEA 1Q81C 2LU2A 2N4DA 3GG1A 1TTHB 1SSFA 2J9DE 2PI4A 2B4VA 1XMOJ 1JLQB 4PUOA 2BEFA 1R77A 5CR2A 3L2QA 3RRGA 1OY9A 2Y9HA 4C4WA 2FRYA 2KXCA 1RTIA 2K5LA 2XY6A 5IT9U 5KG2A 5CCMA 4WFXA 2MXYA 4JI5J 1BHNA 1PRLC 1T3NA 1YHQT 4LD9K 4JYAF 3CO0P 5GAN8 1K9MU 3DU5A 4WZMA 1U2CA 3REBB 3DRSA 1RP5A 3N5BA 4AXIA 4J9QA 2PT0A 3GP8A 3AJDA 4WU3A 3RRKA 4N41A 4BE0A 1HBMA 1P27B 1K73U 1KQKA 1WKKA 3AD7C 3CCVQ 2XDBA 2CVEA 3QWPA 2RDIA 2X1FA 2CP5A 2FL7A 3QZ7A 1HBNB 2DPJA 5CYQA 4OLOA 2VG6A 1FDAA 3M0SA 2CZVC 5GAMf 3GPLA 4UQTA 4GC6A 1N27A 1N6QB 2VICA 4RJVA 2XMUA 2RQCA 2NXCA 2D3O1 4E2FB 1KLMB 1W2BA 3I55A 4RUCA 2UV8A 4IQMA 4NOHA 3CDUA 5GAMj 2E5JA 4DA4A 1SJ3P 3BBCA 3CDWA 4PXCA 1VQPA 2BA9A 3VAFA 3LX7A 5CQXA 1U45A 7AT1B 4PCQA 1B99A 4C48A 2A28A 5KFKA 2RS2A 1WI7A 2GW8A 2E66A 2MKIA 3WXMB 1FVQA 2I2LA 5DG9A 3J81j 2QASA 4FSXA 2DIVA 2J76E 3K5LA 3S3NA 4LVNP 3PX4A 1WFWA 3LP2B 2CZ1B 1TL5A 1PD1A 3G2XA 1DJ7B 2KZZA 1QLYA 2FGCA 1DTQA 1FFWB 5CAAA 3CJ8A 3N0VA 3CWJA 3VVUA 3D0IE 2KXNB 2OMOA 3CDAA 2FVSA 1AYEA 2IM3A 1UGQB 4G3IA 2L9DA 3SYZA 1N33J 4ZGEB 3PO4A 3OSNA 3CCQQ 3H4BA 2HWTA 4FM4B 2HNYA 1AFJA 2M0YA 4KRTA 4M7AE 1X4FA 1CULB 1RWMB 1HNXF 4LN2A 2QDLA 1PC4A 3GLXA 3JSRA 3BYPA 3AOAA 2SEMA 2EYWA 3J80Y 1C1CB 1JNZB 2XLIA 3RNJA 3G8QA 3NGRA 4HCCA 1FA0A 4J9EA 2AU0A 1Q81R 3UCGA 3JTOA 2KEAA 4R56A 3C6UB 3W5XA 5LMNF 5D0EA 4ESRA 2VH7A 2DJQA 4HT8A 2XI9A 1AZSA 2ZH9A 3V8JA 2FJWA 2K2PA 2DM1A 1S4FA 4H4MA 3R97A 4USVA 1WC1A 2HHVA 3CCVT 2C2KB 4BDYA 1K76A 5HQ8A 4P9SA 1B3QA 4O5VA 2NUHA 1MN9A 1MLAA 5KCOA 5FWCA 4HI2A 2VDHA 1RAHB 1NK9A 3B6BA 5IOLA 1B34A 2LA4A 2V5HG 2DXEA 1RDRA 2ZH4A 2HDAA 2DD8S 3H7HB 4EGLA 4X4VA 3GJTB 4M7DG 1D3BB 4QIWD 1QVFR 1U1OA 1F2HA 5ETOA 2VC1A 2YX7A 1J5EF 2QYZA 5LJ3g 3VVTA 3ZZUA 1JJ2R 1GMWD 1UPMB 2ROPA 2YNGB 2HBPA 2V8DA 4L3KA 4GLMA 2ZWOA 2K8GA 2PD1A 4PJMA 1NNDA 2IC3A 1K0SA 1R43A 2COLA 4KFBA 2KI7A 2X1GA 2QLXA 2GA7A 4PQUA 2D0NA 3EE3A 3PIPQ 8AT1B 3ZZRA 3OV7A 4WK1A 1JJCB 2DNRA 5E3RA 1CJTA 2IJFA 5GMKi 2HVZA 1KWMA 4PJNA 4RNMA 3OFEA 3JYTB 2P6TA 4ZLLA 4DZDA 1HHTP 5HAOA 4J9SA 1VFJA 2KRRA 1T03A 2AEFA 5FD1A 2J0XA 3QZ9B 2MCNA 4ZPBA 3TNVA 3OLAA 5BYSA 1ZTTA 4DOWA 4K4YA 3IAS9 4RUBA 3P5TL 3MXHP 3AD9C 1WNLA 1C4AA 2CG4A 3V6KA 3VS3A 1RHKB 3CCQT 2KSSA 3V7CA 1C1BB 2AEMA 5KYXA 4ELZC 1T7PA 2AJ0A 4DU7A 3E51A 2F5TX 3M05A 1GXLA 3NTHA 1Q5VA 3CJKA 1RE1B 3H2UB 1T3OA 3QIPB 3SD4A 4IFYA 1MNDA 1W25A 4KGKA 3CCVS 5CCAA 5GAOl 1YRTA 5KFHA 3FRZA 1C0UA 1SC3B 4USIA 4FF1A 2LU1A 2HNZB 2JT4A 3QG1A 3CCZA 3HF5A 3I0RB 3IM8A 2VG5A 4KE5A 1IKXA 1J5OB 2KROA 3KBGA 4XPEA 2IRXA 1HLWA 2CJQA 1YJRA 4F4XA 1L3KA 5KOXA 3FQLA 4K2JA 2YLBA 3OQ2A 3TOQA 5IZHA 2JEFA 1YJ7A 2B9XA 2XMWA 1ZM4A 4MYTA 2UU9J 1GMWA 1B0PA 2KVIA 3EVWA 4HEA9 3DB3A 2FGOA 2WVEA 4EMKA 2F8MA 1S72A 4E7HA 5FDLB 1YWPA 4FKYA 3QGIA 1WG5A 2VYTA 2VB6A 4AL6A 2EBGA 1H0HB 1UJ4A 4C11B 1EZZB 3CC2A 2FJVA 1PAEX 3META 3L2RA 1U1LA 2MOXA 4DQSA 2RF0A 2YWFA 3A3PB 2H65B 3W3SA 1QWFA 4PJOC 5EWFA 3CJTA 2IYGA 2WOMA 3SXLA 4G1PA 4DV7F 1QW1A 4QW9A 3ZTQA 3BJYA 1XR5A 2WVFA 3CCTA 1BB9A 2RAQA 2LC4A 1HPZB 3HPOA 3UWTA 3RIRA 4B9NA 1Y10A 3HCXA 3CCQS 1C0TA 2ABYA 3Q83A 2P5VA 2KGTA 4LUDA 4C0OC 1R8AA 4DSIA 1IBMF 1P8GA 5IS2A 1BBZA 1WGSA 1S1XA 1NHUA 2EK6A 1TKZA 4PLLA 1K0XA 4IURA 1NJIU 4DPOA 3L2ZA 4ZPWR 4A8YA 4M78E 3AA9A 3M0PA 2GQQA 4M78C 1SC6A 2HPUA 4OB3B 4K11A 4DN9A 2DISA 2DH8A 4J5YA 3NGKA 3PGGA 1SHGA 4LUBA 3MEKA 2LA6A 1X9SA 2ZJRQ 4RW4A 1FDDA 2EFIA 4K4ZA 3SWNA 4KQZA 1EP4B 2KT2A 3EM1A 2CPXA 5KFEA 4XTYA 3PY8A 3CCMA 3I0SA 3IQLA 2EKOA 4NI2A 4URGA 4M75D 1SQGA 5CCLA 1D1BA 3MFHA 4B6MA 3VF0B 1Q7YU 1UTAA 1M3CA 4OZ1A 1N5ZA 2QMWA 3M8PB 1VJWA 2OPRB 1KD1U 2ZEJA 5LSRA 3MF5A 3HL8A 5F9NA 1I94F 3B8HA 3W66A 2WB4A 3T6JA 3W61A 5AJ3J 3VGTA 1T9YA 4CC7A 5BXIA 2JEJA 1U0HB 3GFXA 2ALYB 3NGDA 3BV8A 2QEXS 2JEIA 3EG0A 1UWAA 5DRKA 1GBRA 2RHXA 2DGSA 2OFHX 5IT4A 3MR3A 5KT6A 3LF0A 4WXWA 3OUYA 3A1PA 3WHIA 2YPZA 1U47A 1VI7A 4WF2A 2JS0A 4YHHJ 3DGPA 4XK8C 1L3TA 5KE2A 2K5IA 2H9ZA 2P9EA 1RT6A 3QSYB 4LBHA 3DI6B 4KO0B 4P2FA 4NA1A 1N52B 5HANA 1N0UA 2DGQA 4ZVQB 5KE3A 2W01A 1RSCA 1UAWA 3CMEA 3OTCA 3CCEQ 5CZVA 2KVQG 1L3SA 2ZBRA 2ZNYA 1HA1A 3GJRB 2HBZB 5CVIA 2PUOB 3M2VB 1S6PA 4CH0S 3W63A 2VUGA 3MWBA 4OLPA 3K17A 3MUMP 3C16B 2D9OA 1HI0P 1RABB 4RW9A 2AZ3A 3RR6A 1K8AT 4BWMA 3I5CA 4NLQA 3VS2A 3M0QA 3CCRA 1M1GA 6FDRA 2BANA 1XTZA 4DX7A 3CEYA 2LNVA 3PTAA 3BF4A 1H2TZ 2XGPA 3EUNA 2RQRA 2W4PA 4F2RA 4MKYA 4A8FA 3OR2B 3JB9D 4CO4A 3MMJA 1KQSA 3CC7Q 3OR1A 2NREA 2JTEA 4KT0C 2BRKA 4HXJA 2O1PA 1TP7A 2IA6A 4ELVA 3DCAA 2FVCA 2JMAA 3AB2B 3C15B 1ZSGA 1RT5B 1TK5A 3I96A 2UV8G 2KT5A 2DO3A 3IBWA 4NLVA 1WHHA 2W7OA 2QO3A 2FLOA 4NRTA 5DLFA 1FE4A 4EZ6A 1LWFA 5EHHA 1IHWA 3JCMX 1KONA 5KFZA 4DR1J 2XO7A 2I5JB 1ZA2B 3BDUA 2V8VA 3R5BA 2MQLA 2HAXA 3I56S 4I2QB 4FIBA 2VOPA 2IM2A 5IC6B 1JBMA 1XMBA 1JRIA 4HCBA 1BWVA 2W4DA 5GMEA 5HP1A 2G0JA 3J80E 1XIQA 1NKBA 2VJVA 4Y65A 2RA2A 2J05A 1TFWA 2WB1D 3KUFA 5L1LA 2OD6A 3BKUA 3H0HA 3SQGB 3W5ZA 1YNZA 3GOXA 3W2VA 2CZ9A 4C8QC 4EIKA 2BUDA 3UDCA 3R27A 1P92A 4LSLB 3VGVA 4ZCIA 4CLSA 3CCET 1DLOA 2R8JA 3X25B 1S6OA 3V4IA 4EMDA 4D8DA 5A8KA 3B4DA 4N4GA 5GMKe 4W4MA 1GXTA 4LF5J 4DBQA 1S1UB 3A4TA 5CYMA 4LDUA 4C92E 4QR2A 2NSCA 2GHWA 2F1LA 2DX1A 3NNAA 2J7KA 3AOCA 4GRSA 4RTYA 2HWHA 1V3RA 2ZJPQ 3EZOA 2KRBA 2XHWA 3UPFA 4FF4A 4XQ3A 4IKFA 3OYFA 3ASKA 3HHTB 4OP0A 2V1QA 3CC7T 2Y0BB 4JV0A 2YTCA 5I21A 2F5KA 4A8OA 2ZM6F 1VRQC 2FUG9 4DX8H 2RU3A 1JLGA 2JLGA 4OB1B 4JBCA 4IH6A 1FDNA 3W62A 1WUUA 4X65J 1YFNA 5K9FA 1T94A 2F9DA 3QZ8A 2HQFA 4QPXA 2CVIA 1HYSA 2DNKA 3S01A 4M7DB 1WXUA 4OX6A 3K5MA 3D1OA 5LM7E 2W4CA 4F17A 1N88A 4XTWA 4HTIA 2E29A 5C42B 2PEHA 4QQGA 3RKXA 1PRMC 1X0FA 2V2QA 2HQXA 2QQSA 2NUUG 2YKNB 2FTRA 1Q1KA 3WC0A 5GAMg 5LSLA 3MPDA 3S7RA 2AJ2A 2DIQA 2R2RA 5HROB 5KFCA 2YX1A 1HSQA 4IDKB 1VC0A 3BS9A 4NYPA 5HN0A 2OSRA 4DFPA 4ALZA 1VC5A 1J27A 3BO2A 5KFUA 2AT1B 1U6BA 4QWAA 2GBQA 4MMOA 4ED3A 1GAOA 1RT1B 1YJWA 5L46A 4I64A 4IO1A 3SCLE 4NCBA 2C22A 1LFPA 3MEEB 4FW1A 1QY7A 1R8OB 1RT2A 1VQ7S 1IB8A 4J6WA 3M1VB 1T0JA 2M51A 3IRXB 2GIFA 1IKYB 3SCKE 2CUDA 2OD4A 1V5IB 2CYZB 2BJEA 3VAGA 1TZ0A 4MAKA 3NXZA 2HNDA 3G6YA 2XM3A 2XSFA 3DRPA 4JI7F 3KTQA 4DQPA 2LXIA 3I5AA 4QW2A 3QAUA 1CSKA 2J7UA 1O75A 4LSNB 3QT8A 3H5UA 4JI4J 2CH4W 3Q8SB 2A37A 1RL2A 5C6SA 2V4QA 3ZTRA 1S59A 3HI9A 3LA0A 4OGCA 2VKRA 1PJ7A 1GTHA 1HARA 1XMOF 2KRMA 3DDNA 2OTLS 3HVTB 2L08A 2YWEA 3CQTA 3VCDA 1PBAA 3MR6A 1R27B 1B3TA 3ILJA 3CPWA 1VQ4A 3L95X 2NYHA 1G7CB 5CH7B 1VQMQ 2QK0A 1FO1A 2K2VA 4K59A 3TO8A 1JXVA 4JI5F 1TWBA 1OU9A 4O3NA 2DL3A 1QCNA 5D6XA 1YVFA 1UZHA 4M77D 1Y96B 3KNGA 4WP3A 2BRLA 3UD4P 1X31C 3TAQA 1CVJA 3V6HA 1M8VA 1V29B 1IGUA 2ZHBA 3PX0A 2KN4A 2XD0A 4V19J 2J8AA 2DYIA 1K1ZA 4RTTA 2HVIA 3Q0AA 2XWYA 3HHLC 5CABA 1BK2A 4IRCA 4DUTA 1LW2A 3WZ0A 3AD8C 3J81Y 1IBLJ 1YJNA 5E3CA 2YT6A 3N6NA 3EAEA 1UA1A 1IXDA 2CNNB 5L1KA 2QFIA 1SQEA 2QA4Q 2HQDA 1JLBB 2Z30B 1IWGA 1R0BG 1ZBXA 2AX0A 3TQEA 4RBUA 4QYRA 3KMQA 4ZN1A 4FCYA 3RMSA 1UJ6A 3UVJB 4XU1A 5H9EK 4DR7J 2PMZD 5H9FK 4II1A 1PAUB 3KK2A 2M52A 5JMNA 4KUIA 2HSEB 3AFGA 3Q89A 4DOZA 3HRUA 3CEDA 3TUIC 4P6QA 1S6QA 3PYDA 2O31A 2EG1A 4K7QA 4PJJA 1YZ7A 4J9HA 3TVZA 1OSCA 3NMAA 2ABLA 4NXMF 2GIRA 1VISA 5A0YA 1N33F 2XLJA 1VQOQ 1TH7A 4DR2J 1UJ5A 3H8YA 2PN6A 3KLEB 1SRMA 4JRQA 4LD6A 3D54A 2J0QD 2ZKTA 4C8YA 4JUVA 4LDWA 5GAN7 3I55Q 3CMAS 2RF2B 4ES2A 1KLNA 4QWDA 3GBQA 4A4HA 2A0FB 2H8HA 4M77A 1RWUA 2DBKA 3NCPA 4Z89A 2P2CB 1Y07A 2CSQA 2FYXA 1VQMT 3QYYA 2ZD1A 2IMOA 5L9NA 2UUCJ 4IH7A 1RYSA 1Y71A 3NL0A 3BPDA 5J2PB 4M63A 2RI3A 3H0IA 1WOOA 4Y2CA 4ZTFA 2C42A 2Q6BA 1IHVA 3EGDB 1M1KU 1RU1A 4M5NA 4L6V3 1TKDA 3VUBA 2XG8D 1VQNS 1VQLA 1EIFA 2EQIA 2ZH5A 3C6TB 4NYOA 5LXYA 2RJEA 3SSSA 4GO5X 1N5YB 2VA3A 3NBPB 4A8MP 1ZLMA 4EWTA 3EFSA 4J9IA 3BN7A 2J6TA 1N8RT 1M90T 1RT3B 3VGSA 2HL3A 3BSAA 2Z2YB 3ZL7C 1EETA 2R42A 4JS5A 4PUOB 2M02A 2XWXA 3OFFA 5EUHA 3BGOP 2J9DA 1N34J 1RTIB 1KFSA 2QA4T 3J7AF 2QN6B 1FRXA 1U25A 2DVJA 1WWHA 3MM8A 2RNEA 2LQ8A 2CH4A 4M7AD 3LPEA 3RAQA 1URRA 2QA2A 3DRSB 4YP3A 3EX7B 2EFOA 1VQ8S 3N5BB 2F1FA 1KDNA 4M75G 4JZ4A 2L8DA 3JTNA 1ABOA 3LUYA 5GAHU 3RB0A 4FSSA 2LJ1A 1U1TA 1BQMA 2DL5A 2F2XA 1YN8A 5CYQB 2QTWA 2K1RA 4OHWA 1QAJA 2YNHB 3PEJA 1QMCA 2HHPA 4WIIA 2MKSA 4WK3A 2IBKA 2HD0A 4GC7A 5D8HB 1FWPA 2RQKA 4OVAA 1VQOT 2YUNA 3A5ZB 4IG3A 4ZVSB 3RBXA 2POKA 2L48A 2EGEA 4D3HA 2KJWA 2FC8A 4MDWA 1SJQA 4V2SA 4G1IA 1GMVA 3I55T 2EC0A 2AIRB 2ZH6A 3W9JA 2OTJS 1N9RA 3OTOJ 3BH7B 4DL5A 1R3NA 3IO1A 2HIYA 1FTRA 2WW8A 5GAOn 2YQ1A 4DL6A 2XG8A 2F65A 4ZPDA 4FL6A 3KDNA 3HZGA 3KHRA 2CP7A 5LXRA 1DTQB 4XO0A 1LNQA 3K89A 3MD3A 1SUQA 1UP1A 1R7IA 3QBYA 3JB9J 3VS1A 2UP1A 4WP8A 2B4OA 3SSRA 2MZRA 4OZLA 4ZMMA 2BQUA 4NL5A 3TJ9A 2V4JA 4KBIA 4WP9A 4DSLA 2HNYB 2DNLA 3MPVA 3K0JA 2ZKUA 1UHCA 4YMEA 4HHHA 4DPTA 4EPCA 1FD8A 4M7AA 1Q82T 1TR0A 5K8NA 2K5FA 3GV7B 1XK8A 1EX8A 2M70A 1G1XA 1QDUB 2AJ4A 1NXIA 1K47A 3VYHB 4K8RA 4NLDA 3JB9G 4B3OA 3OW2A 4Z37A 1VA7A 4JI0J 3RW7A 4IOAQ 1D1CA 3V7RA 1QVGR 1AZSB 4H4MB 1U4BA 3RB3A 3J7A1 1ACMB 1IUJA 1JLFA 2P9GA 1PJ5A 2MHNA 1U1KA 1N6AA 2ALZA 1RUWA 2BYCA 3U23A 4OJ3A 2P4TA 5GMKh 1T3LA 1B34B 1Q0NA 5ADZA 2B4PA 3RGIA 3QJLA 4Q44A 4L74A 2X1AA 2RUSA 2AHJB 5CO7A 3BR9A 3AJ1A 4TQSA 3KLIA 2CZ0B 4AMCA 4LVOP 5KG5A 5CQGA 4FF2A 1U2RA 2IC3B 4NL2A 4KFBB 3MPYA 4LNPA 2LECA 4PQUB 3A8KA 3RU0A 3CBMA 3GR0A 1H6KX 4NA3A 1CJTB 4UUXA 2B0GA 2XHCA 3FK4A 1B0VA 1OZ2A 5HMYA 3M2RA 4K0KF 3K8WA 4N47A 4X4QA 4OI0A 1T03B 1YITS 1YRXA 3MUVP 2QLBB 1KKHA 2R7RA 2E5GA 1QKWA 1WTFA 2OO4A 1AUSL 2ZH3A 3M8RA 4ECSA 4A8KA 2RQTA 5K14A 4ILMA 1GL5A 1R0CB 1IM6A 4ANJA 5AJ3F 2LQNA 1UVNA 1OV3A 2DJZA 4XU2A 3DLLA 4C5HA 1O8BA 2KFZA 5KYXB 1AZEA 3CD6S 2MKHA 4DBHA 1SH3A 2HSPA 5MAOA 1KFDA 3LGHA 2GCXA 2DGUA 3GSDA 3CJKB 3KG0A 4ZDNA 1RHQB 4IFYB 2WVCA 3ITHA 4M78D 2HAIA 1X7VA 2HYIB 2R7UA 3VS6A 3BBBA 4YHHF 1C0UB 2LDYA 3MAQA 5EG2A 1BI0A 2RQWA 1CC8A 4PG4A 1NHKL 2FHJA 1WORA 2VG5B 1IKXB 1PYSB 5KTQA 3TWZA 4PJLA 1WSRA 3SV3A 1LXNA 3IGVA 1YSJA 4I7FA 5B0GA 1KHCA 4A4JA 3KUEA 2ZAEA 4PLIA 4M5JA 1HQ2A 3SZ2A 2FVPA 2VGNA 1X27A 2CPZA 4GMKA 2EC2A 4E98A 1V9OA 4IG0A 1IBKJ 4CC2A 4BDPA 3J81E 3H98A 2FZKB 4EMKB 3SEMA 3BEGB 1YHQA 1F3VA 4LRFA 3MAAB 1ZETA 5AXMA 3PDNA 2HLUA 1MNEA 1E6YA 4HLBA 2D69A 3HVWA 1IO6A 2NR0A 1RCOB 2VD3A 1QVFP 1B4SA 5KH6A 3AHPA 1PSEA 3EICA 2UXCJ 4NRUA 1JJ2P 3NAHA 5L1IA 1WPYA 3TI0A 2VF3A 3QDRB 2OMLA 3IC1A 3MDFA 2IFXA 5LJ5e 4Z88A 4PJOA 3D9BA 2FJBB 5HKCA 3PACA 3EG9B 1K9MC 5L39A 2V9KA 3RUXA 3TEEA 4QW8A 3TA0A 2CA9A 2B9EA 4FKXA 2DNHA 2PFDA 1RHJB 3FJ2A 4USJC 4WCIA 1K73C 4TY8A 4U7UK 3T3FA 5H9FJ 2DR6A 2ZPEB 1Y0HA 3OMGA 5LJ5d 1S1XB 3RESA 1TKZB 1I5OB 5HY6A 1K44A 1TKXA 4DUZJ 1HWLA 1MUZA 2CKKA 2DMOA 4DR1F 3WVEB 1UE9A 4WXOA 4AG2C 1UVKA 3QIDA 3UO0A 5FLXU 4M78A 5HI7A 1G3OA 2AW0A 3R9LA 3VZHA 2W25A 2IDLA 3M32A 2W10A 4LIWA 3I32A 3CCRQ 4RW4B 3JCMf 4CLTA 3CJSA 4ID8A 3G6VA 3EZ5A 2NPIA 3TZZA 4CTAA 3FJ5A 1KQ1A 3OQ5A 3GIRA 3I0SB 2GAGC 4NI2B 2A3JA 3C14A 5KFAA 1XNQJ 3EDRB 4A4GA 5HO4A 1SEMA 1PC5A 2E1PA 4OV6A 4YQWA 2H51B 1HNZF 1UFFA 3TU4K 2QC3A 1SSHA 1RQ0A 4ZP6A 4K4VA 4DWIA 2ZVIA 5B7WA 4RO0A 2HS0A 2HW3A 2G13A 5DS7A 3H8ZA 1Y4ZB 1CBKA 5I42A 1YRUA 2Y1LB 1BD6A 4M77G 1SJ4P 4JZ3A 4ZLPA 1F9FA 3C8YA 2B5JA 1FJ7A 2RHSB 2PNIA 2MSSA 2JLFA 5DGAA 1Y00A 3H0FA 3LO3A 5C24A 2A6OA 4P7TA 5J39A 3H90A 4OHXA 1C6VX 1TL7A 1CG2A 3OYMA 4B9VA 3OUYB 1Y5LB 4RUGA 3CCVA 4JI2J 2CNOB 1WG1A 2C28A 3DGPB 3ICLA 4DX6A 4ZVRB 2FO0A 4I0WA 2QG9B 3LH5A 3MKDA 1RT6B 2Y3YA 5DQGA 1SC1B 4KPCA 2K3IA 4U96A 4KGVB 1KHVA 2HRUA 2IJRA 3UF4A 4HR2A 4X4TA 3I4PA 1KVJA 3DHWC 2ZVSA 1S10A 3TVKA 2Z57B 3H4DA 3ELHA 2DHGA 3M6UA 5DGBA 4X65F 1UEKA 3U1NA 2QQ9A 4ZPAA 4LBPA 5CKHA 1S6PB 1TUVA 3FEOA 2YPYA 1K73R 1W2IA 5F8LA 4I2PA 3H41A 3HMJG 5BR8J 2BZ2A 1U6ZA 4MH8A 4RW9B 2OLWA 3T1AA 3CCSQ 2H5JB 1RLQC 1VCTA 4WKYA 2BANB 3JXOA 3ZO7A 4C92D 1PSDA 2AQ4A 3DLEA 3K8VA 4J9KA 3IG1A 3CCRT 1TL1A 5I4MA 5GADI 3KJFB 3GFYA 3OR1B 2E9RX 4J9LA 2CQ1A 2B56A 1UJYA 4KKOA 2J5AA 5GAOp 3QT6A 2JTFA 1Z2LA 3CCQA 1S0NA 3TANA 4IUUA 4OHYA 2RT3A 2DO4A 1Z4UA 3NG8A 3NLCA 1TK8A 4QVCA 3VS5A 1AA1B 1GCQC 1LWFB 4URSA 4DL3A 2X9HA 2V50A 3GTYX 2JVRA 1RA6A 4PR6A 4A47A 2EQJA 2QLFB 2RJFA 2YWGA 2LJ3A 2H5IB 5GMKl 2NSBA 2JHEA 1UVJA 4CO2A 2KT8A 4OI6A 3HP6A 3IM9A 1DAXA 4KUDK 4PL6A 3OD2A 1I07A 3MJXA 1LWCA 1T11A 3UA6A 4KSEB 4JI8J 2DRAA 3M6XA 5HP1B 3BDEA 4YY3F 4P52A 4E7IA 4ZJQA 2JM9A 4ZIWA 1G83A 3CJ0A 4B3MJ 2F4FA 4RNFA 1MW7A 3CCJS 4UQGA 2K7KA 1KC8T 2ED0A 1UL3A 4WE1A 2XC9A 4JI4F 3PT9A 3IFEA 5J2QA 4C9DA 4E7SA 5KCHA 1TUDA 2B8QA 4NE9C 4DG1A 1M3AA 3W2VB 3DN9A 4DCJB 1XR7A 3NGTA 7FDRA 3HSDA 3BGUA 5HL7Q 3OYCA 1REGX 1DLOB 2GMHA 3ZZ0A 4RKUE 4M7AG 3V4IB 2BW7A 1ARKA 1YJWQ 1QM9A 5A8KB 1NSPA 2DXCA 2FJDB 1BQXA 3L7PA 3QSIA 4OZJA 2QQAA 1FERA 3PIPA 2QEXA 1RAJA 4JI6J 1S9FA 5CYMB 2RDJA 2DILA 1Y0MA 3UWNA 1D3WA 2DY9A 3K57A 3GCXP 4C92A 2C2DA 2L2PA 3M9QA 4FNHA 1GTEA 3CCST 5F8HA 2DE0X 4R8UA 4DMZA 4O0IA 5D4PA 5DDPC 1ZUUA 1YGYA 1JLEA 4LFBJ 1ZM9A 5EX3A 2CQGA 3G71S 2C2ZB 2MJUA 3DNCA 3MUTP 4X2BA 2WTFA 2HKQB 1IBLF 4O6JA 4NZ7A 5GAN3 4TU7A 3D2WA 1JLGB 4O3RA 4IFVA 1MN7A 1S48A 2CNLB 2GMJA 2GJIA 2CWXA 2EIFA 1T9VA 1SCJB 1HYSB 4E6RA 3RMQA 2E10A 5IHKA 2ECZA 3PW4A 2AK5A 1O9SA 2MMYA 5CD4H 1FJEB 4EBCA 2E1AA 4YEAA 2MTLA 4DR7F 2BQRA 1NJIC 3MOZA 1I8FA 5IHNA 1F6TA 2XZWA 2EVRA 4MDXA 2FLLA 1YIJS 2O88A 1RHMB 3CC4S 3V6DA 8ATCB 3DDKA 1UDLA 1HBOB 4M8LA 1LNXA 2H1YA 4RLEA 3EWGA 2ZHAA 4A8QA 5IN1A 2FD2A 3CCLS 1RTDA 1IQTA 1U0SA 1L5UA 5KT7A 2VVKA 2KE9A 4CNZA 2ZBCA 3DXSX 4DR2F 4ECTA 4AL7A 4NLGA 1MV3A 4NLOA 2GVZA 1H3HA 2M7SA 1N5QA 2QFJA 1DTTA 4BY6C 2D3UA 1YWXA 2DB1A 2FJEB 4KH0B 1G5VA 1NU4A 1AVZC 5CKFA 2A36A 4OMOA 3FB9A 4TVRA 1Q7YC 2IRYA 2EJ9A 1RT2B 1FJGJ 3OYEA 2MJNA 3PW5A 1X9WA 1SKWA 1RAOA 4ED8A 2ZC4A 2I6WA 4YR0A 1YJWT 2OH2A 1APSA 1KD1C 2E7XA 4P2MA 2UUCF 4NLUA 5A2QY 2CKWA 2RI5A 2MDAA 1IRXA 3B78A 3GP9A 2PSZA 1S9EA 2Y4YA 2FDNA 2FPFA 3A3OB 1GMUA 2AYEA 4ZVFA 5EGYA 2HNDB 1QAYA 3DRPB 3M30A 1ZUKA 3F41A 1IKWA 4RBTA 4QCLA 2HURA 1V5VA 4LDVA 2OEKA 1J3TA 4Q5VA 4DPXA 1SH2A 3CXCS 1X5TA 2HHQA 4NCGB 2R57A 3VWSA 1RISA 2VGMA 3HRTA 1LFWA 5IAYA 2QA1A 2MKKA 1FRJA 1FNMA 1BCOA 4M75F 2YXYA 4FVCA 5A2QU 3LAKA 4TYAA 1X0PA 3B54A 4Q43A 3G6ES 3K5PA 2CJYB 2ZPGB 2ZBIA 1N34F 4PEOA 3OYYA 1BU1A 4QIVA 1V3ZA 3M5AA 2BM0A 5RUBA 4MIAA 3MMAA 1ZH5A 4ENOA 5CKEA 2HGLA 1SKRA 1WDDA 3NRBA 2HBWA 2BBEA 4DCOB 1HD0A 1D9FA 4LBIA 4ZPVR 4FU6A 3US5A 3OL6A 4UOFA 1VQ5S 3QWUA 1H2VZ 3E19A 4DV1J 1WEZA 4E7ZA 4Z7YA 4CQ1A 2JN0A 3IS9A 3NWGA 2D8JA 4OB0B 5LJ5j 3UD3P 1L3UA 4NASA 1Q86T 2CJBA 2HBQB 2RH2A 3IP0A 2C0IA 3HHLA 4DR3J 3GCWP 3BSCA 1VQLQ 3M2UA 4B9TA 2MKCA 1UZDA 2LNHB 4IUQA 1LW2B 2FRWA 3SV4A 1HR0J 4QZVB 4OYOA 3BY7A 4YB5A 3TEHB 1YCYA 2V8IA 2VQEJ 1RXOB 4JJDA 2E4HA 2X4YA 2GV1A 2VKZG 2DYAA 2ROGA 3C19A 3ZZOA 2KO1A 5F8NA 2QGGA 1BMQB 1WA7A 1XOVA 1IJEB 1HNVA 4WFAQ 4CH7A 4M78G 4ORZA 1HQUA 2BJ7A 4ZPTR 3AHUA 3WQPA 4H54A 2F69A 1VS3A 4L5GA 5LJ5h 4U7CA 4O3SA 1ZUYA 4DPUA 4ZGJB 3TZXA 2W9CA 1IR2A 2MIOA 4BI3A 2XZDB 2KXHA 4M7DC 1PCXA 1Q7YR 4Q45A 3T5JA 1S6QB 3FSXA 1X4DA 4DXLA 1TG0A 3DXBA 4U6PA 1KD1R 3ER0A 1VQ6S 4QYZK 2HVHA 3VV2B 1K0TA 2V9WA 3JB9F 3K5OA 1WI6A 5A0YB 2WSEE 1RZMA 2LX9A 1UFWA 3M58A 3M8QA 2RB7A 2EGCA 1M5KC 1ZPWX 2RM4A 3TZYA 1WHGA 3QQCD 1XNRJ 2LP5A 2V1RA 1R6VA 1CLFA 4J7FA 3ZTOA 4ATNA 4NPOA 1F3FA 4M77B 3MMBA 4LRBA 3FCWA 4GVBA 1WF0A 3D0HE 5M2UA 2LJ0A 2ZD1B 1VMBA 2LQ5A 4FNIA 5CXTA 2ILYA 2JOYA 2V8PA 3JV3A 3TQ7P 3J7YU 4JI0F 2EQUA 3A8LB 3CC7A 4ETZA 4AFZC 1N5SA 5D3GA 3QBCA 4NX9A 4PPDA 4FW2A 4OV1A 1ULRA 2I0XA 4DLGA 1UGPB 4QBUA 4C8MA 4C8QF 3MO8A 1HXDA 1N5TA 2R5AA 1NH7A 1RI9A 3FQKA 5GVQA 5GAN6 3M55A 5ECAA 1VQLT 2GVDA 3TX8A 3GIIA 3I35A 2YWKA 3QJYA 2O01C 4CDIA 4DOVA 4N4HA 1EETB 1AOJA 2DKOB 2ZITA 1OIAA 2OTLA 3ISNC 1DURA 1VBKA 3OYGA 3LGMA 4ZVTB 4F67A 2OI3A 3UR0A 2XS5A 1KP6A 1FWZA 4YUDA 3QRRA 3QT5A 3DYAA 5D0GA 2DH7A 1Q81T 1BI3A 4A4EA 2ZZMA 3TVTA 3LP0A 5LT5A 3KDOA 2RJCA 3MM8B 2CS7A 3GMGA 5J2MA 5M2PA 4O44A 5GJVB 4C97A 4B3TJ 1FVSA 2IYIA 1M2VA 1YJ9S 2G2OA 3TVYA 2K3KA 3RKWA 4FPIA 1DRZA 2QDYB 2XSJA 1D1AA 3FLGA 4C8OA 1KSWA 2NZ4A 3V7SA 1VYTA 4LF4J 4C0ZA 3R5DA 2CZ7B 2K1RB 1AB8A 3EHQA 3URGA 2YY3A 3ILIA 1FNOA 4DFKA 2GQIA 1WHWA 1FCAA 1QQJA 1RWOB 1S76D 3KFVA 3VRZA 1RHUB 4LT6A 1SF9A 2P0PA 5KFTA 3HVRA 4IG3B 1I4K1 5C2GA 3EMTA 1NPKA 2KM8C 4TY9A 2JJ9A 3LWMA 1AXQA 3PKYA 4C3KA 1VBZA 1GK8A 3LALA 3DOKB 3IGNA 4KGXB 1SPKA 3HK2A 3R7NB 3V8LA 3JCMg 3A98A 1KG1A 4RW7A 1NK5A 3RBDA 5B0AA 1JQGA 3W8GA 1VQPS 4DV2F 1CS4A 4AXJA 4EU0A 2CQCA 2MZ1A 1ZZNA 1SUQB 2M0OA 1SH0A 2CQ3A 3OL9A 3FEXB 2FPHX 1PKUA 3I9ZA 2AJFE 4WFZA 1KVKA 4D3GA 1CJKA 3SIPB 1OPIA 4J9VA 3NOCA 2V4JB 2LQWA 3R6NA 4EZ9A 2N3LA 1BQNA 2JC0A 2W2QP 3PM9A 1WJQA 3QUIA 2H5EA 3CXCR 2SRCA 4F36A 1WSVA 3M59A 3DLLQ 4M7AB 2E1MC 1NB2A 1LWEB 2ZPFB 4LRAA 4C92G 2I8EA 1GRIA 2UXCF 2XYPB 1UJ0A 1GCPA 4B3OB 4PG8A 3SDEA 2AGQA 2MY7A 3Q8UA 3GONA 1BYMA 4HYKA 3DLJA 1OWXA 3QLHA 4GO7X 1CQNA 2LX7A 3TJAA 2RKIA 5KT4A 3DLKA 4RW6A 1JLFB 2BXJA 1JJ2S 2YDLA 2PE8A 2JNGA 4N0AC 3VALA 3P8DA 4GLKA 2IIHA 2WRMA 1JXMA 3PX6A 4ZOSA 2VUBA 1F9EB 3DLMA 3QJPA 4Q8FA 4OX8A 3PV8A 3BSNA 2ZUGA 2HL5C 3RBBB 4DUZF 4WCEQ 4EBEA 4CT8A 4A48A 2EYQA 3KLIB 5GANf 1H3ZA 1EHWA 2CT4A 2N7YA 2DVEA 4F7UE 3GV5B 3BE3A 3R2DJ 2Q1LA 2I38A 4LXCA 5IXUA 3HD1A 4F25A 1RAGB 3MM9B 4A8WA 3MOJB 2KVQE 5GANj 1Q5YA 9ATCB 2EI5A 4M77F 3OXFA 4IKAA 1BI1A 2DTOA 3QFHA 4BBYA 1P9YA 2J06A 3M2RB 3TX0A 2I1RA 5L8RE 5LMUJ 4DDFA 5ETNA 4IIOA 1NSQA 3JAME 2MGZB 1NZ8A 1XNQF 4X84A 1XEZA 3QYHB 4RW8B 2CPJA 3JCMQ 2XGQA 1O0PA 2WAQD 1PGZA 5K14B 3POTA 2QAZA 4KGMA 1AWJA 1VQMA 3I6PA 4KV8B 3I5SA 5LJ3e 4LFAJ 2DTJA 2DEJA 1JXEA 2EWHA 4MZPA 1QCOA 2L3MA 2EYZA 3G6XA 3ETOA 1X6OA 4JUZA 2HVEA 5GAEU 2OTJA 4IUTA 2Z2MA 2E12A 1S5ZA 1HK9A 5KG1A 1YTYA 3ITHB 5DG8A 1X4GA 2YNIA 4EO6A 2FLNA 3HLUA 2GO9A 4CO3A 4PXBA 2PIIA 1XMQJ 4K4UA 4KRWA 2V67A 1F5CA 5KFQA 2QL7B 3C0CA 3MCMA 3HJFA 4WF9Q 1KQ2A 4QOTA 3TA1A 2MZQA 1U24A 4CLLA 1QVGP 3JSMA 1FKAF 2R8KA 3S1TA 2V26A 3MMCA 1M1KC 3CNQP 2O4XA 2QA4A 3TZWA 2Y90A 1LJOA 2GS8A 4IG0B 3MURP 4R5PB 3KK3A 2AWZA 1RUSA 5KFPA 5ETPA 1E6YB 5BR8F 3U7JA 1M4ZA 2XY7A 4ZKAA 2WSCC 4NYZA 4ERDA 3SHWA 5F9LA 2YRVA 1FX7A 4NCAA 2NUZA 5FU6C 4O4GB 2X3XD 2K3YA 4AD6A 1S72S 4QU7A 1FE0A 4PJOB 4FYVB 5HK3A 1VQOA 2YNFA 4LF6J 2MB0B 3NTKA 1WXBA 3CC2S 4FT2A 4A4FA 3MPUB 4TY8B 1WNEA 4YOEA 1NE8A 3H9NA 4HH0A 4DF8A 2UVUA 2L3PA 1OULA 1YX2A 3TP2A 2V8KA 4F7VA 4ZVOB 5G0RA 1QSLA 4X62J 2BZXA 3A13A 1T8EA 2D41A 3EGZA 3GNGA 2BW2A 3CD0A 2OI2A 2EBEA 4C3LA 3GSIA 2VC0A 1WQ7A 2YSQA 4OFZA 3KG1A 3R5JB 1WJ9A 2GMLA 2R8HA 1OZ3A 2DA9A 3LQVA 2RILA 4N4IA 2QV6A 4KHPJ 1OQ6A 4NZ6A 5F41A 1E6GA 2AZSA 1LVKA 2YXLA 3C95A 4M78B 2B7BB 5HVGA 1XNIA 2Y4XA 4C8LA 1LKZA 3CJ5A 4JI8F 3M32B 2I0NA 4M7AF 1HHQA 4PG5A 5DDRC 5M9OA 4ECUA 2KBTA 4XTVA 1OX8A 2C2MB 1EX4A 4QQ6A 3G86A 4B3MF 1HNWJ 2C3UA 2XULA 4CTAB 1G3TA 1X5PA 1N9SA 2YVSA 1RWPB 4V1Ak 2EWNA 4FYWB 4RCBA 4ZLJA 3IXQA 2GFAA 3C14B 1W2BR 5IC4B 2DR5A 1UB4A 3CPFA 3QMQA 5G4DA 1RTHA 3LGNA 4BE2A 3VR1A 4RL1A 2ZH7A 4J91A 1D8YA 3R6OA 4TKTA 4UW2A 2AZ1A 2YH0A 1JLAA 4OYXA 2KG1A 2V94A 3QJJA 4OGEA 3CCMS 2QYGA 2VZ9A 5I42B 2DEQA 2NUTA 2B5JB 4JI6F 5ETVA 3E9GA 1SKUB 1M1KR 3MP8A 5C24B 4J9OA 1WHLA 4P75A 3WX8A 3C46A 2E9TA 3ETMA 3M9NB 1X6BA 3CW2C 4Y2IA 4DV4J 4XTUA 2G1HA 1IKVA 2DF6A 1IREB 1MU2A 4LFBF 3EFRA 3SDZA 2BQ3A 3MM7A 3MZIA 1YLXA 2MQ8A 1NJZA 5AXNA 4U67Q 1UPPA 2V8JA 3J80U 1TKTA 2XI3A 2RMOA 3OS2A 2MY8A 3ZEHA 1S4EA 5CKDA 4OYPA 1VLOA 4A8SA 1Q82R 3OL7A 4LMZA 9RUBA 3BGRA 2C2EA 3FDRA 1ZBTA 2Y1IA 4CM0A 3HT0A 5LSOA 4IIMA 4DHVA 1UEBA 2C2RA 3VZIA 5LL6S 4XTTA 1VQKS 4L3NA 3H5SA 3UNGC 4I2PB 3ZFJA 3G9CA 1IWAA 3T19A 3CMES 5JXSA 2VDIA 4GKJJ 2QEXQ 1HMVA 5CK9A 2LDMA 1NZAA 3Q86A 3AT1B 3CTRA 4Y91A 2B6AA 4C8ZA 3HKSA 3DLEB 3IG1B 1PCAA 1VQ9Q 1TL1B 5E3PA 3GFZA</