3P8CE

Structure and control of the actin regulatory wave complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
64
structure length
64
Chain Sequence
REIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and control of the actin regulatory WAVE complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
total genus 28
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2010-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8cE01
3HD7B 1N7SD 1N7SA 3VOPA 3RK2B 1L4AA 2NPSD 4LGDE 3RK3C 1L4AB 1GL2A 4JF7A 5CCGC 1JTHB 3B5NC 4N78E 1SFCD 1KILC 1L4AD 5CCGA 1URQB 3RL0C 1HVVA 2YMYA 4W7YA 5KJ7D 3RL0B 2KOGA 4OH8B 1SFCB 3B5NB 1URQA 1KILD 1L4AC 1SFCC 3B5ND 3HD7A 2N1TA 4WY4D 1JTHA 5CCHA 3RL0D 5CCHD 3HTKB 3HD7D 1URQC 1KILA 1URQD 2WZ7A 3RK3B 1T3JA 1KILB 2HFED 2N1TB 4W7ZA 5KJ7C 4W80A 4WY4C 5KJ7A 3RK3D 2PP6A 3RK2C 2HG5D 3M0DC 3TSIA 5CCGD 1XTGB 2M8RA 4WY4A 2H8PD 2N1TD 3HD7C 3B5NA 1SFCA 1N7SB 3KYQA 2NPSC 4WY4B 3RK2D 1GL2C 1GL2D 5CCHC 1N7SC 2NPSA 2N1TC 1GL2B 1NHLA 2XDJA 2NPSB 3P8CE 3PP5A
chains in the Genus database with same CATH superfamily
3W67A 1U7JA 1IFNA 4GOEA 3D71A 1J1DC 1U7MA 3S1KA 3KDPB 3A3YB 4ASWA 2K1AA 2P7JA 1NU1G 2WPVB 3GF3A 3MTUE 1MFTA 5B5EE 1HBWA 3L74E 1QL2A 3IFMA 4DCKA 1L4AA 3CXHD 5AVVB 2O1JA 4HH2A 1NGMB 3II6A 1FZCB 4KT0J 3CCQP 1SQQK 1SQXD 1NU1J 5CHXA 4PJ0E 5AW5B 3RK3C 4YPCA 1BCCD 3KHUA 1L4AB 2JO1A 2JWDA 1VQNP 3I5CA 2G8YA 4JF7A 3CL3D 4U3FE 4DJGA 2PAJA 4JYBA 4I7ZB 3SWYA 5AW0B 3VMXA 2P67A 1SFCD 2E76D 5B66E 1KILC 2KSEA 2C9LY 1G1JA 3H32A 1LTAC 1OIPA 3H1LJ 3TGUG 2Z5IA 3P7KA 1L0ND 1AV1A 3L73J 5CCGA 2GM4A 1ZXGA 4O9BA 2Q3IA 3USSA 1L0LK 1LTJA 3H1HJ 2JP3A 1MV8A 2N9BA 1S72P 3IF4A 1S2EA 3JSVC 2CPSA 1KYOI 3LIEA 3L75G 2RKLA 4OGQD 1QVGO 1QGKB 2A06E 3FXDA 4EOTA 1LNQA 3L75D 1JMBA 1FS0E 3F5HA 4L74A 5AVRB 2ZYGA 4YXWH 1DH3A 2OYOA 2A06G 2R44A 1GD2E 1IFPA 4Y99C 4IFFA 1AQTA 2KOGA 2IZ0A 3U1AA 1SQVD 1FE6A 3IR9A 1GW3A 5CBOA 1CW5A 3AEBC 3F89A 3CX5E 4WBAA 2O01N 4UB6H 1EXJA 1X79B 4HYTB 1KB9E 1NTZD 1SQPJ 3H1KD 3CWBJ 1M56D 3H1JD 3LW5H 4PV1C 5DJTB 2Q1KA 2N1TA 3CCEP 2XNXA 3EFFK 4YTPC 1SQXJ 1H0TA 4AQRD 1Q7YQ 1LT9A 1BCCG 1FZEA 3AE5C 4H0LC 5KLVJ 3CC2P 3RGUA 1DD4A 1SQXG 5CCHD 3H1LD 2M0BA 1N73C 1FC2C 4A7PA 3D6ZA 3NMDA 1LTTC 1TU3F 3WMM0 2W6JH 2WT7A 3OA7A 3V4QA 1FZGA 1E5WA 1YYCA 1GU5A 1JY3O 3GMAA 3TNUB 2OYIC 1HWTC 2QM8A 5H2FE 1SQVG 1NU1D 1T3JA 2QJKB 3L74J 4H13B 4JBZA 1T3UA 2KK7A 2W6BA 3A0BE 3H1ID 3A2AA 4GT1A 3PJSK 4U7JA 1S5LH 1D7MA 3JCUE 2IPPA 3H1IJ 2WSCH 1OFCX 1YIJP 4I6MC 4OVNF 4AUWA 3L74D 4HKZH 3CXHE 1S1CX 2HYNA 2R3CA 1KTMA 2IBZG 2WQYC 2W27A 1RHZB 5L8RJ 2AEFA 2BCCD 3RK3D 1VF5C 1AVYA 2PP6A 2ZXXA 1OW7A 1KQFB 1YJNP 4EI2A 3L37A 1OWAA 3H1LE 3NXSA 5AW3B 3TGUD 2OTLP 3CLQA 2WPRA 1IC2A 1XTGB 1LJ2A 2ZT9D 4RJTA 2M8RA 2POHA 3HE5A 1GMJA 4WY4A 1YJWP 1OVRA 1W2EA 3MGNA 3WU2H 1X0TA 3B5NA 1JY3P 1LTJB 2IBZE 2KYVA 1GZLA 3V4WA 2K37A 5H2FH 2NPSC 2WPSA 3M9QA 1P84E 4WY4B 1NTKG 1JM0A 1PPJE 1GL2C 3L70D 4PJ0H 1GL2D 5E79E 1N7SC 5CCHC 5KAIH 4MN4C 4L75A 3AE8C 2NPSA 3AE4C 2ZT9B 3JC22 1AQ5A 3L75E 4H13C 2YO3A 1SQQE 2QJKC 3MUDA 3VN0A 3TF5A 1OX3A 2NRGA 1FDOA 1KILE 3WU2E 1YJ9P 5GTHE 1NO4A 2PGDA 5AVZB 3EQ2A 4B86A 1BE3E 1M7LA 2KLVA 2LKMA 3HD7B 1MKMA 1K04A 4IL6H 5AW8B 2YKOA 2WSFJ 1RY3A 2XU6A 5AW9B 3T97A 3V5BA 2CPBA 3FWNA 3U1CA 3OJAB 2WWWA 2ZFCA 5KAIE 4BRYA 1Q82Q 1NTKK 1DX7A 3H1HG 1NH4A 3RK2B 1FZBA 3ABVC 3T97B 1YHQP 1T2KC 3CPWO 1AFOA 2Q9IA 4WB4A 3L73D 3H1HE 1L0LE 1USDA 1ZP0C 4JYCA 3WUUA 4YXDC 4LGDE 1DIPA 1JUNA 2YXRB 1WMKA 3G71P 5C39A 4BWNA 2W6AA 2E5TA 4PV1B 4OGQB 2IYOA 1EZVI 1GL2A 1NTME 1VQ8P 1KORA 1CI6A 2QEXP 1VDFA 2A45H 2D2CC 5APTA 1DEEG 2HPCA 2OYHC 1KB9H 1EZVG 1WT6A 3B5NC 1BCCJ 3L71G 1RQVA 1JY2P 3KXDA 4N78E 4ZMDA 3GLMA 3CCRP 1YI2P 1BGYJ 1PP9J 3H6PA 1SQBD 2OYHA 2YKPA 2M3EA 2FY8A 2HPCB 2XKMA 3N7NA 4C7NA 3L71J 2FXPA 2K88A 5BU8B 1VF5D 2HR3A 3CCUP 1BE3G 2E74C 2XNDH 1YTZT 3CX5H 3VMAA 1VQLP 1HVVA 3H25A 3CCLP 4N6JA 1ZMEC 3AE7C 1SQQG 1NTKJ 3L71D 4PD4H 2RH0A 3AECC 1HUCA 2ZYDA 3M06A 1K05A 3KZIH 5B66H 4UB8E 3CMAP 3D70A 3HTKA 3KPEA 2P1JA 3L72D 2DW3A 1NTMJ 1W5CE 3CWBD 3H1JJ 4OH8B 1SQPD 3H1KJ 4WVZA 2MJZA 2FBWC 4K35A 1RF0C 1FZFA 2C9NY 3VMYA 1NTMD 1JCCA 2WTYA 1VQ7P 5GTIH 4PD4I 4IL6X 5AVQB 1NTMG 1HF9A 1SQVJ 1A02F 1KYOE 1FDIA 3MD0A 3S4RA 1S5LX 3MP7B 1IK9A 3AEFC 2C0XA 3FX0A 3A0BH 5CCHA 1QL1A 2VRSA 1GTWA 2ZJSE 1Y8AA 5APUA 3CC4P 1SQVE 1CSBA 1T8ZA 4HB1A 1LT9C 4UB6E 2ZT9C 2E43A 1QLED 1J1DB 3A7OA 4TLFA 1IFMA 2E74B 1ZV8A 2LXBA 1T2KD 3H1JE 1AJYA 1KILA 3KQGA 2G3AA 3L72E 3OW2O 3AEEC 2W8ZA 3RK3B 2I1KA 4DT0A 2Z4EA 1RE4C 2O01H 2IDBA 2AEJA 2HFED 2N1TB 2WSEJ 5GTIE 1ZLLA 3RBZA 3E1IA 2QSIA 3HUSB 5CJ4A 5E79H 2PFXA 2GUVA 2I1JA 4H44B 2B87B 4C7NB 1EDIA 1NTZE 1EXIA 1KV4A 1Y47A 3CMEP 1JY3N 2QJYB 2ZAEB 4OGQC 4W80A 2WSCJ 3H1KG 2WMMA 3GF7A 3VP9A 1VQ5P 1JY2N 3AEGC 1VQ6P 3BCCD 1CI6B 1OMIA 1NOHA 2PRRA 3Q5SA 3WUVA 1AA0A 3TGUJ 3BCCJ 1PGJA 1Q90D 1SP4A 2HG5D 3OAKA 3I55P 3ZDMA 5CCGD 2OYIA 1IFDA 3L74G 2M5AB 2H43A 5CBNA 2H8PD 2E5YA 2FFDB 3Q1MA 1LT1A 3GW6A 3HE4A 4ZKUA 1ZR2A 3V2RA 2H7HA 2LR2A 1HH0A 3H1IG 4BRYB 2RMZA 2N9YB 1JO5A 4D6TJ 4IL6E 2KZIA 2H88C 1J1EC 3H32B 1MFZA 1G2CA 2AXTE 2FYUD 2R5DA 1HJ0A 1RF0A 1KQGB 3JCUH 2YNYA 2WSFH 3L70G 1E79H 2I8DA 2K9YA 2FXMA 3M9BA 4JPZB 2E75D 1NYHA 2N1TC 4I1LA 1PZQA 4Z1MH 1H8AA 1FDMA 3CCMP 1MZ9A 1NTKE 3D6YA 2NPSB 1R5LA 1YQ4C 2IBZI 3PP5A 3W68A 1PFIA 2Q7CA 2E75B 2Y0DA 1N7SD 4HJGH 2XZRA 2KI7B 1N7SA 2P10A 1EDLA 1KMIZ 3H1KE 4RKUJ 5KLVD 3CI9A 4M3LA 1JY2O 2FXOA 1IFJA 3H1JG 1M57D 2YIUB 1IFIA 1VL2A 1VF5B 1PGOA 1YBKA 2OQQA 2QG4A 3AE1C 3FGAD 3MZWB 2O1KA 4D6TE 3CCSP 1OVUA 4GIFA 1P84D 4XFJA 1M1KQ 1HJBA 4GKGA 1DD3A 1NAFA 3GHGB 3H1IE 3M91A 2HLOA 2O3JA 4QMAA 4Y99B 3U59A 1LWUB 1EDKA 2QJPB 5APYA 5KKZC 1H88A 2P2UA 2WSSH 5CCGC 1NJIQ 3BVHA 2RN0A 1ZW0A 1VQ9P 1S9KE 1H0TB 1OW6A 3PHLA 2BASA 1DEBA 1LT9B 1N7LA 1WRGA 1KYOH 4PV1D 2WITA 5GTHH 2BCCE 3RK3E 1FJKA 4L76A 1PGPA 3L75J 1FBMA 1URQB 1HGZA 2AXCA 3A0HH 1NU1K 1QX8A 4EIJA 4U3FJ 3Q2YA 1L2PA 1RH5B 1USEA 2M3BA 3A5TA 3PTZA 1EZVE 4IFDK 3SFDC 2V4HA 1N73B 2YMYA 1YITP 1FU1A 2CK3H 3B71A 4OWFA 4U3FD 3RL0B 1Y9BA 3GHGA 1J2JB 3MUDC 4H0LB 3SFEC 3AE2C 1EDJA 1ZR4A 3L4FA 1IK7A 1IJDB 3IN6A 3R4YA 1SQBE 4RO0A 1L0LG 2E74D 3CXHI 3EWKA 5AVYB 3B5NB 2R5BA 5DJUB 1LTIC 1JMMA 2D2CB 2QIWA 2WVRA 5AW6B 3L70E 1FOSE 2FYUG 2ZXEB 5APXA 1RE3C 1BE3J 1SQVK 4BXLA 1KILD 2Y9YA 2QE7H 3B5ND 5KLVK 4PD4E 2IBZD 3E7KA 4TT3H 4WY4D 4DZOA 3CXHH 4GOFA 3A0HE 3PRJA 5AVXB 2QM7A 1N8RQ 2OTJP 2ITAA 1NTMK 1U57A 3P8CD 1Z56A 4H0LD 5EFWB 3Q5RA 1RF1A 1SLQA 3RL0D 3HRNA 4RESB 3VP8A 1SQPE 5AW1B 1K73Q 1K9MQ 2IX7C 1Q81Q 1M90Q 1FZCA 5APWA 1ZOYC 4ZNCA 3HTKB 1M8OB 2HODA 2WSEH 1G2CB 3SWKA 1FJPA 4D6TG 1QVFO 4AYCA 5KLVG 3HD7D 2E42A 1KYOD 1RF1B 1L0NG 1URQC 2IFMA 1FAVA 1URQD 2JWAA 1N2DC 1SVFA 4C46A 2R32A 2FYUK 1VQ4P 3RBXA 1JNMA 2WPQA 2XV5A 1L0LD 1M1JA 3M0DA 1KILB 1OZHA 5KLIC 1AVOA 4XE5B 1YQ3C 2KS1A 3H1LG 1LTSC 3G9RA 5AVWB 3G6EP 3O6QA 4W7ZA 3LW5J 1LWUC 2KLUA 1VPCA 2JKVA 1YTZI 2QJPC 1L0LJ 4IOIH 2Y0EA 5APQA 4WY4C 1A02J 4N78D 5KJ7A 1LWUA 1FZAA 3ITKA 3O6QB 1JB0J 2KS1B 2Q3EA 3N4XA 2YIUC 1GK6A 3FWLA 1OVVA 3TYYA 1EC5A 1NTZG 1SQBJ 2BCCJ 1PPJG 1NWQA 1KQSO 1NU1E 2JJLA 2NZ2A 3C8VA 1NAYA 2K9JA 1S9KD 1KB9D 2QJYC 2P58A 2KZJA 2ZVOB 2E75C 2N1TD 2YXQB 1MUUA 1NVOA 1PIXA 3QH9A 1N7SB 2A06D 1SQQJ 2FYUJ 2YMKA 3AE3C 3KYQA 4R4MA 1SQXE 3CX5D 2L5GB 1KZUB 3RK2D 2K9JB 5AVUB 2Y9ZA 1XTCC 1LTGC 3P8MC 2OARA 3P32A 2LXCB 1GW4A 4KHXA 1KN7A 5AVSB 3NFQA 3TGUE 5KLIB 4KJMA 3BCCG 1NHLA 1ZRTD 4C7RA 5KAFE 1VQPP 2BEZF 2AEMA 1BCCE 3VYIA 2K3RA 1BSNA 3CWBE 4LC1A 2KIKA 2V7QH 1IZNB 1G1IA 2KB7P 3B8EB 2IYPA 1UIXA 2D2CD 1KFMA 2KNCB 1M1JB 1X22A 3VOPA 1FOSF 2A45G 1L0NE 4ASVA 1GK4A 2NPSD 2YKQA 4IFMA 4UB8H 3M0AA 1S3JA 2AXTH 5M1BA 3K5BA 1NKNA 3EFGA 3M9HA 1X9VA 2OGUA 4CPGA 4H44C 1R5SA 3VMZA 3WUTA 1JTHB 3CC7P 3E1RA 3HUSC 1Q86Q 1H89A 1BDCA 1L4AD 5KAFH 1LP1A 3BCCE 2KXPB 3HUSA 2YO2A 3LIDA 2JEEA 3G3ZA 3SSUA 2SPZA 3V2NA 3BRTB 4L73A 5AVTB 3H1HD 2B89A 3Q3DA 1W2BO 3CWBG 3RL0C 2C0WA 5APSA 2A45I 2JDIH 2BEQD 3RL0g 2FYNC 4GODA 1KB9I 2Z5HA 3AEAC 5AW4B 1L0NJ 4EYYQ 3G4SP 4Y28J 5AW2B 3TNUA 4W7YA 1OXZA 5KJ7D 2J5UA 3VTPC 3AE6C 3SWFA 2J59M 2FKWB 4LLHA 3L72G 4JQ0D 1SS1A 1X8YA 3NTNA 1HTLC 3CX5I 1PGQA 1RE3A 1S4XA 3O8ZA 1VQKP 2V7QJ 1BE3D 1RQUA 1K8AQ 1BDDA 1N73A 2H89C 1SFCB 2E76B 3L72J 1NTZK 5KTBA 1SQXK 2Q6QA 2W83C 2Y0CA 3B4SA 2R3SA 3AEDC 1BSHA 1HGVA 1LP1B 3I56P 1KC8Q 1IO4A 2QA4P 1SQPK 1EZVD 1URQA 1L4AC 1JOCA 1NTKD 1SFCC 2E76C 3CCVP 3HD7A 4NPEA 3GHGC 3L71E 4XA4A 4R4LA 1SQBG 5CMZA 3PLNA 1FZCC 3IAOA 3PH0A 1PV3A 1JTHA 2O01J 2QRXA 5K5GB 1VQMP 1JCDA 3BRVB 2KUBA 2FYUE 2OTKE 2QVAA 3TDKA 4N3YB 1BGYD 1PP9D 3V2QA 4EDFA 1LTBC 2UWJE 1Q2NA 1ZN5A 2GUSA 4K3AA 2FYNB 3BATA 3GG2A 4I7ZC 3L73E 1NTZJ 1ZRTE 3KZIE 1KQLA 1R8EA 1SQBK 5KKZB 2FFDA 2WZ7A 3CD6P 3AE9C 5TISE 4ZKPA 1EQ7A 3HE4B 1SQPG 1UIIA 1NKZB 3Q5PA 3HE5B 3QWOC 2B9BA 2M5AA 2ZVNB 2OYHB 1LTJC 2WT7B 1BGYG 1L0NK 1PP9G 2KSJA 4WWIA 5KLVE 5KJ7C 1PL5A 3FXEA 1J1EB 4PD4D 1SQQD 3CCJP 1P84H 4I2LC 3C1LA 1KFNA 1PPJD 2KP8A 3TK1A 2B87A 3MHVA 5TISH 1GU4A 3RK2C 1BGYE 1PP9E 2Q5UA 1M1JC 1N86A 3M0DC 5AW7B 3TSIA 3R2PA 4H44D 1RE4A 1OW8A 1QEXA 1S5LE 3V6IA 1LGHB 3MIWA 4NPDA 4U3FG 1P84I 5BVZA 1VQOP 4NPFX 4H13D 3C9IA 4DOJA 3HD7C 3S9OA 5CJ0A 3V2PA 1SFCA 1KD1Q 1GDTA 2MKVA 2KNCA 3L70J 2FYZA 2HODB 3L35A 2GA1A 3UIAA 2OYIB 2ZYAA 5APVA 4GDOA 2IFNA 5TJHA 1RF1C 2W90A 2B88A 3L73G 2J58A 1CZQA 5B5EH 2IZ1A 2JR8A 2FFDC 5BU5A 3L36A 4D6TD 1GL2B 1JEKA 2BCCG 2XDJA 3P8CE 1T6AA 2L91A 3BASA
chains in the Genus database with same CATH topology
1IFNA 1J1DC 3KDPB 3A3YB 2P7JA 1HBWA 3MTUE 1QL2A 3IFMA 1L4AA 5AVVB 2O1JA 4HH2A 1FZCB 3II6A 1SQQK 5CHXA 5AW5B 3RK3C 1L4AB 3I5CA 4JF7A 3CL3D 2PAJA 4JYBA 3SWYA 3VMXA 5AW0B 2P67A 1SFCD 1KILC 2C9LY 1G1JA 3H32A 1LTAC 2Z5IA 3P7KA 5CCGA 2GM4A 4O9BA 2Q3IA 1L0LK 1LTJA 1MV8A 2N9BA 2CPSA 3LIEA 4EOTA 5AVRB 1GD2E 4Y99C 4IFFA 2KOGA 3U1AA 3IR9A 1GW3A 1CW5A 4WBAA 1X79B 4HYTB 3LW5H 2N1TA 2XNXA 4AQRD 1LT9A 1FZEA 5CCHD 1N73C 3NMDA 1LTTC 3WMM0 2WT7A 3OA7A 3V4QA 1FZGA 1E5WA 1YYCA 1GU5A 1JY3O 3TNUB 2OYIC 1HWTC 2QM8A 1T3JA 1T3UA 2W6BA 4GT1A 3A2AA 2IPPA 2WSCH 4I6MC 4AUWA 2HYNA 2R3CA 2W27A 3RK3D 2PP6A 3L37A 1OWAA 3NXSA 5AW3B 3CLQA 2WPRA 1IC2A 1XTGB 2M8RA 2POHA 3HE5A 4WY4A 1W2EA 3MGNA 3B5NA 1JY3P 1LTJB 2KYVA 1GZLA 3V4WA 2NPSC 2WPSA 3M9QA 4WY4B 1GL2C 1GL2D 5CCHC 1N7SC 2NPSA 1AQ5A 2YO3A 3VN0A 3MUDA 1NO4A 5AVZB 3EQ2A 4B86A 2LKMA 2KLVA 1M7LA 3HD7B 5AW8B 2YKOA 5AW9B 1RY3A 2XU6A 3T97A 3V5BA 2CPBA 3U1CA 3OJAB 2WWWA 2ZFCA 1NTKK 1DX7A 1T2KC 1NH4A 3RK2B 1FZBA 1AFOA 2Q9IA 4WB4A 4JYCA 1JUNA 4LGDE 2W6AA 1GL2A 1CI6A 1VDFA 2A45H 5APTA 2HPCA 2OYHC 1WT6A 3B5NC 4N78E 2H43A 1JY2P 3H6PA 2OYHA 2YKPA 2HPCB 2XKMA 3N7NA 4C7NA 5BU8B 1YTZT 1HVVA 4N6JA 1HUCA 3M06A 3HTKA 3KPEA 2P1JA 4OH8B 2MJZA 1FZFA 2C9NY 1RF0C 3VMYA 2WTYA 1JCCA 5AVQB 1A02F 3MD0A 1IK9A 2C0XA 5CCHA 1QL1A 2VRSA 1GTWA 5APUA 1T8ZA 1CSBA 1LT9C 2E43A 1J1DB 3A7OA 1IFMA 1T2KD 1ZV8A 1KILA 3KQGA 3RK3B 2I1KA 2Z4EA 1RE4C 2O01H 2HFED 2N1TB 1GU4A 1DH3A 1ZLLA 5CJ4A 3E1IA 3HUSB 2GUVA 2I1JA 4C7NB 1JY3N 4W80A 3VP9A 1JY2N 1CI6B 1NOHA 2HG5D 1SP4A 3OAKA 5CCGD 2OYIA 1IFDA 2FFDB 2H8PD 4ZKUA 3HE4A 1ZR2A 3V2RA 1HH0A 1JO5A 1J1EC 3H32B 1MFZA 1G2CA 2R5DA 1RF0A 2YNYA 2WSFH 5APYA 3M9BA 2FXMA 1H8AA 2N1TC 4I1LA 1FDMA 1MZ9A 2NPSB 3PP5A 1PFIA 2Q7CA 1N7SD 2XZRA 1N7SA 3CI9A 4M3LA 1JY2O 1IFJA 1IFIA 2O1KA 4GIFA 1HJBA 4GKGA 3GHGB 1NAFA 3M91A 3U59A 2HLOA 4Y99B 1LWUB 1H88A 2P2UA 5CCGC 3BVHA 1S9KE 2BASA 1LT9B 1DEBA 1N7LA 1WRGA 2WITA 1FJKA 1FBMA 1URQB 1HGZA 1NU1K 4EIJA 2M3BA 3A5TA 4IFDK 1N73B 2YMYA 1FU1A 3RL0B 3GHGA 1J2JB 1ZR4A 3L4FA 1IJDB 5AVYB 3B5NB 2R5BA 1LTIC 1JMMA 5AW6B 1FOSE 2ZXEB 5APXA 1RE3C 1SQVK 1KILD 3B5ND 5KLVK 4DZOA 4WY4D 5AVXB 2QM7A 1NTMK 3P8CD 1Z56A 1RF1A 1SLQA 3RL0D 3HRNA 4RESB 3VP8A 5AW1B 2IX7C 1FZCA 5APWA 3HTKB 2WSEH 2HODA 1FJPA 1G2CB 4AYCA 3HD7D 2E42A 1RF1B 1URQC 2IFMA 1FAVA 1URQD 4C46A 1N2DC 1SVFA 2R32A 2FYUK 1JNMA 2WPQA 2XV5A 3M0DA 1M1JA 1KILB 4XE5B 1LTSC 5AVWB 4W7ZA 1LWUC 5APQA 1VPCA 1YTZI 4WY4C 1A02J 4N78D 5KJ7A 1LWUA 1FZAA 3N4XA 1GK6A 3TYYA 1NWQA 2JJLA 1S9KD 2N1TD 1MUUA 1N7SB 3KYQA 2L5GB 1KZUB 3RK2D 5AVUB 1XTCC 1LTGC 3P8MC 2OARA 3P32A 4KHXA 1GW4A 5AVSB 3NFQA 1NHLA 4C7RA 3VYIA 4LC1A 1G1IA 2KB7P 3B8EB 1KFMA 3VOPA 1M1JB 1FOSF 2A45G 1GK4A 2NPSD 2YKQA 4IFMA 3M0AA 1NKNA 3EFGA 3M9HA 1X9VA 3VMZA 1JTHB 3HUSC 1H89A 1L4AD 3HUSA 3LIDA 2YO2A 2JEEA 3G3ZA 3V2NA 3BRTB 5AVTB 3RL0C 2C0WA 5APSA 2A45I 2Z5HA 5AW4B 5AW2B 3TNUA 4W7YA 1OXZA 5KJ7D 3SWFA 2J59M 2FKWB 4LLHA 1X8YA 3NTNA 1HTLC 1RE3A 3O8ZA 1N73A 1SFCB 5KTBA 1NTZK 1SQXK 1HGVA 1IO4A 1SQPK 1URQA 1L4AC 1JOCA 1SFCC 3HD7A 3GHGC 4XA4A 5CMZA 1FZCC 1JTHA 1JCDA 3BRVB 3VTPC 3V2QA 2H7HA 4N3YB 1LTBC 1ZN5A 2GUSA 3BATA 1KQLA 1SQBK 2FFDA 2WZ7A 4ZKPA 1EQ7A 3HE4B 1NKZB 3HE5B 2OYHB 1LTJC 2WT7B 2KSJA 1L0NK 5KJ7C 1J1EB 4I2LC 1KFNA 2KP8A 3TK1A 3RK2C 2Q5UA 1M1JC 1N86A 3M0DC 5AW7B 3TSIA 3R2PA 1RE4A 1LGHB 3MIWA 5BVZA 3C9IA 4DOJA 3HD7C 3V2PA 5CJ0A 1GDTA 1SFCA 2FYZA 2HODB 3L35A 3UIAA 2OYIB 5APVA 2IFNA 1RF1C 2J58A 1CZQA 2FFDC 5BU5A 3L36A 1GL2B 2XDJA 3P8CE 3BASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 B;  1N7S D;  1N7S A;  3VOP A;  3RK2 B;  1L4A A;  2NPS D;  4LGD E;  3RK3 C;  1L4A B;  1GL2 A;  4JF7 A;  5CCG C;  1JTH B;  3B5N C;  4N78 E;  1SFC D;  1KIL C;  1L4A D;  5CCG A;  1URQ B;  3RL0 C;  1HVV A;  2YMY A;  4W7Y A;  5KJ7 D;  3RL0 B;  2KOG A;  4OH8 B;  1SFC B;  3B5N B;  1URQ A;  1KIL D;  1L4A C;  1SFC C;  3B5N D;  3HD7 A;  2N1T A;  4WY4 D;  1JTH A;  5CCH A;  3RL0 D;  5CCH D;  3HTK B;  3HD7 D;  1URQ C;  1KIL A;  1URQ D;  2WZ7 A;  3RK3 B;  1T3J A;  1KIL B;  2HFE D;  2N1T B;  4W7Z A;  5KJ7 C;  4W80 A;  4WY4 C;  5KJ7 A;  3RK3 D;  2PP6 A;  3RK2 C;  2HG5 D;  3M0D C;  3TSI A;  5CCG D;  1XTG B;  2M8R A;  4WY4 A;  2H8P D;  2N1T D;  3HD7 C;  3B5N A;  1SFC A;  1N7S B;  3KYQ A;  2NPS C;  4WY4 B;  3RK2 D;  1GL2 C;  1GL2 D;  5CCH C;  1N7S C;  2NPS A;  2N1T C;  1GL2 B;  1NHL A;  2XDJ A;  2NPS B;  3P8C E;  3PP5 A; 
#chains in the Genus database with same CATH topology
 3W67 A;  1U7J A;  1IFN A;  4GOE A;  3D71 A;  1J1D C;  1U7M A;  3S1K A;  3KDP B;  3A3Y B;  4ASW A;  2K1A A;  2P7J A;  1NU1 G;  2WPV B;  3GF3 A;  3MTU E;  1MFT A;  5B5E E;  1HBW A;  3L74 E;  1QL2 A;  3IFM A;  4DCK A;  1L4A A;  3CXH D;  5AVV B;  2O1J A;  4HH2 A;  1NGM B;  3II6 A;  1FZC B;  4KT0 J;  3CCQ P;  1SQQ K;  1SQX D;  1NU1 J;  5CHX A;  4PJ0 E;  5AW5 B;  3RK3 C;  4YPC A;  1BCC D;  3KHU A;  1L4A B;  2JO1 A;  2JWD A;  1VQN P;  3I5C A;  2G8Y A;  4JF7 A;  3CL3 D;  4U3F E;  4DJG A;  2PAJ A;  4JYB A;  4I7Z B;  3SWY A;  5AW0 B;  3VMX A;  2P67 A;  1SFC D;  2E76 D;  5B66 E;  1KIL C;  2KSE A;  2C9L Y;  1G1J A;  3H32 A;  1LTA C;  1OIP A;  3H1L J;  3TGU G;  2Z5I A;  3P7K A;  1L0N D;  1AV1 A;  3L73 J;  5CCG A;  2GM4 A;  1ZXG A;  4O9B A;  2Q3I A;  3USS A;  1L0L K;  1LTJ A;  3H1H J;  2JP3 A;  1MV8 A;  2N9B A;  1S72 P;  3IF4 A;  1S2E A;  3JSV C;  2CPS A;  1KYO I;  3LIE A;  3L75 G;  2RKL A;  4OGQ D;  1QVG O;  1QGK B;  2A06 E;  3FXD A;  4EOT A;  1LNQ A;  3L75 D;  1JMB A;  1FS0 E;  3F5H A;  4L74 A;  5AVR B;  2ZYG A;  4YXW H;  1DH3 A;  2OYO A;  2A06 G;  2R44 A;  1GD2 E;  1IFP A;  4Y99 C;  4IFF A;  1AQT A;  2KOG A;  2IZ0 A;  3U1A A;  1SQV D;  1FE6 A;  3IR9 A;  1GW3 A;  5CBO A;  1CW5 A;  3AEB C;  3F89 A;  3CX5 E;  4WBA A;  2O01 N;  4UB6 H;  1EXJ A;  1X79 B;  4HYT B;  1KB9 E;  1NTZ D;  1SQP J;  3H1K D;  3CWB J;  1M56 D;  3H1J D;  3LW5 H;  4PV1 C;  5DJT B;  2Q1K A;  2N1T A;  3CCE P;  2XNX A;  3EFF K;  4YTP C;  1SQX J;  1H0T A;  4AQR D;  1Q7Y Q;  1LT9 A;  1BCC G;  1FZE A;  3AE5 C;  4H0L C;  5KLV J;  3CC2 P;  3RGU A;  1DD4 A;  1SQX G;  5CCH D;  3H1L D;  2M0B A;  1N73 C;  1FC2 C;  4A7P A;  3D6Z A;  3NMD A;  1LTT C;  1TU3 F;  3WMM 0;  2W6J H;  2WT7 A;  3OA7 A;  3V4Q A;  1FZG A;  1E5W A;  1YYC A;  1GU5 A;  1JY3 O;  3GMA A;  3TNU B;  2OYI C;  1HWT C;  2QM8 A;  5H2F E;  1SQV G;  1NU1 D;  1T3J A;  2QJK B;  3L74 J;  4H13 B;  4JBZ A;  1T3U A;  2KK7 A;  2W6B A;  3A0B E;  3H1I D;  3A2A A;  4GT1 A;  3PJS K;  4U7J A;  1S5L H;  1D7M A;  3JCU E;  2IPP A;  3H1I J;  2WSC H;  1OFC X;  1YIJ P;  4I6M C;  4OVN F;  4AUW A;  3L74 D;  4HKZ H;  3CXH E;  1S1C X;  2HYN A;  2R3C A;  1KTM A;  2IBZ G;  2WQY C;  2W27 A;  1RHZ B;  5L8R J;  2AEF A;  2BCC D;  3RK3 D;  1VF5 C;  1AVY A;  2PP6 A;  2ZXX A;  1OW7 A;  1KQF B;  1YJN P;  4EI2 A;  3L37 A;  1OWA A;  3H1L E;  3NXS A;  5AW3 B;  3TGU D;  2OTL P;  3CLQ A;  2WPR A;  1IC2 A;  1XTG B;  1LJ2 A;  2ZT9 D;  4RJT A;  2M8R A;  2POH A;  3HE5 A;  1GMJ A;  4WY4 A;  1YJW P;  1OVR A;  1W2E A;  3MGN A;  3WU2 H;  1X0T A;  3B5N A;  1JY3 P;  1LTJ B;  2IBZ E;  2KYV A;  1GZL A;  3V4W A;  2K37 A;  5H2F H;  2NPS C;  2WPS A;  3M9Q A;  1P84 E;  4WY4 B;  1NTK G;  1JM0 A;  1PPJ E;  1GL2 C;  3L70 D;  4PJ0 H;  1GL2 D;  5E79 E;  1N7S C;  5CCH C;  5KAI H;  4MN4 C;  4L75 A;  3AE8 C;  2NPS A;  3AE4 C;  2ZT9 B;  3JC2 2;  1AQ5 A;  3L75 E;  4H13 C;  2YO3 A;  1SQQ E;  2QJK C;  3MUD A;  3VN0 A;  3TF5 A;  1OX3 A;  2NRG A;  1FDO A;  1KIL E;  3WU2 E;  1YJ9 P;  5GTH E;  1NO4 A;  2PGD A;  5AVZ B;  3EQ2 A;  4B86 A;  1BE3 E;  1M7L A;  2KLV A;  2LKM A;  3HD7 B;  1MKM A;  1K04 A;  4IL6 H;  5AW8 B;  2YKO A;  2WSF J;  1RY3 A;  2XU6 A;  5AW9 B;  3T97 A;  3V5B A;  2CPB A;  3FWN A;  3U1C A;  3OJA B;  2WWW A;  2ZFC A;  5KAI E;  4BRY A;  1Q82 Q;  1NTK K;  1DX7 A;  3H1H G;  1NH4 A;  3RK2 B;  1FZB A;  3ABV C;  3T97 B;  1YHQ P;  1T2K C;  3CPW O;  1AFO A;  2Q9I A;  4WB4 A;  3L73 D;  3H1H E;  1L0L E;  1USD A;  1ZP0 C;  4JYC A;  3WUU A;  4YXD C;  4LGD E;  1DIP A;  1JUN A;  2YXR B;  1WMK A;  3G71 P;  5C39 A;  4BWN A;  2W6A A;  2E5T A;  4PV1 B;  4OGQ B;  2IYO A;  1EZV I;  1GL2 A;  1NTM E;  1VQ8 P;  1KOR A;  1CI6 A;  2QEX P;  1VDF A;  2A45 H;  2D2C C;  5APT A;  1DEE G;  2HPC A;  2OYH C;  1KB9 H;  1EZV G;  1WT6 A;  3B5N C;  1BCC J;  3L71 G;  1RQV A;  1JY2 P;  3KXD A;  4N78 E;  4ZMD A;  3GLM A;  3CCR P;  1YI2 P;  1BGY J;  1PP9 J;  3H6P A;  1SQB D;  2OYH A;  2YKP A;  2M3E A;  2FY8 A;  2HPC B;  2XKM A;  3N7N A;  4C7N A;  3L71 J;  2FXP A;  2K88 A;  5BU8 B;  1VF5 D;  2HR3 A;  3CCU P;  1BE3 G;  2E74 C;  2XND H;  1YTZ T;  3CX5 H;  3VMA A;  1VQL P;  1HVV A;  3H25 A;  3CCL P;  4N6J A;  1ZME C;  3AE7 C;  1SQQ G;  1NTK J;  3L71 D;  4PD4 H;  2RH0 A;  3AEC C;  1HUC A;  2ZYD A;  3M06 A;  1K05 A;  3KZI H;  5B66 H;  4UB8 E;  3CMA P;  3D70 A;  3HTK A;  3KPE A;  2P1J A;  3L72 D;  2DW3 A;  1NTM J;  1W5C E;  3CWB D;  3H1J J;  4OH8 B;  1SQP D;  3H1K J;  4WVZ A;  2MJZ A;  2FBW C;  4K35 A;  1RF0 C;  1FZF A;  2C9N Y;  3VMY A;  1NTM D;  1JCC A;  2WTY A;  1VQ7 P;  5GTI H;  4PD4 I;  4IL6 X;  5AVQ B;  1NTM G;  1HF9 A;  1SQV J;  1A02 F;  1KYO E;  1FDI A;  3MD0 A;  3S4R A;  1S5L X;  3MP7 B;  1IK9 A;  3AEF C;  2C0X A;  3FX0 A;  3A0B H;  5CCH A;  1QL1 A;  2VRS A;  1GTW A;  2ZJS E;  1Y8A A;  5APU A;  3CC4 P;  1SQV E;  1CSB A;  1T8Z A;  4HB1 A;  1LT9 C;  4UB6 E;  2ZT9 C;  2E43 A;  1QLE D;  1J1D B;  3A7O A;  4TLF A;  1IFM A;  2E74 B;  1ZV8 A;  2LXB A;  1T2K D;  3H1J E;  1AJY A;  1KIL A;  3KQG A;  2G3A A;  3L72 E;  3OW2 O;  3AEE C;  2W8Z A;  3RK3 B;  2I1K A;  4DT0 A;  2Z4E A;  1RE4 C;  2O01 H;  2IDB A;  2AEJ A;  2HFE D;  2N1T B;  2WSE J;  5GTI E;  1ZLL A;  3RBZ A;  3E1I A;  2QSI A;  3HUS B;  5CJ4 A;  5E79 H;  2PFX A;  2GUV A;  2I1J A;  4H44 B;  2B87 B;  4C7N B;  1EDI A;  1NTZ E;  1EXI A;  1KV4 A;  1Y47 A;  3CME P;  1JY3 N;  2QJY B;  2ZAE B;  4OGQ C;  4W80 A;  2WSC J;  3H1K G;  2WMM A;  3GF7 A;  3VP9 A;  1VQ5 P;  1JY2 N;  3AEG C;  1VQ6 P;  3BCC D;  1CI6 B;  1OMI A;  1NOH A;  2PRR A;  3Q5S A;  3WUV A;  1AA0 A;  3TGU J;  3BCC J;  1PGJ A;  1Q90 D;  1SP4 A;  2HG5 D;  3OAK A;  3I55 P;  3ZDM A;  5CCG D;  2OYI A;  1IFD A;  3L74 G;  2M5A B;  2H43 A;  5CBN A;  2H8P D;  2E5Y A;  2FFD B;  3Q1M A;  1LT1 A;  3GW6 A;  3HE4 A;  4ZKU A;  1ZR2 A;  3V2R A;  2H7H A;  2LR2 A;  1HH0 A;  3H1I G;  4BRY B;  2RMZ A;  2N9Y B;  1JO5 A;  4D6T J;  4IL6 E;  2KZI A;  2H88 C;  1J1E C;  3H32 B;  1MFZ A;  1G2C A;  2AXT E;  2FYU D;  2R5D A;  1HJ0 A;  1RF0 A;  1KQG B;  3JCU H;  2YNY A;  2WSF H;  3L70 G;  1E79 H;  2I8D A;  2K9Y A;  2FXM A;  3M9B A;  4JPZ B;  2E75 D;  1NYH A;  2N1T C;  4I1L A;  1PZQ A;  4Z1M H;  1H8A A;  1FDM A;  3CCM P;  1MZ9 A;  1NTK E;  3D6Y A;  2NPS B;  1R5L A;  1YQ4 C;  2IBZ I;  3PP5 A;  3W68 A;  1PFI A;  2Q7C A;  2E75 B;  2Y0D A;  1N7S D;  4HJG H;  2XZR A;  2KI7 B;  1N7S A;  2P10 A;  1EDL A;  1KMI Z;  3H1K E;  4RKU J;  5KLV D;  3CI9 A;  4M3L A;  1JY2 O;  2FXO A;  1IFJ A;  3H1J G;  1M57 D;  2YIU B;  1IFI A;  1VL2 A;  1VF5 B;  1PGO A;  1YBK A;  2OQQ A;  2QG4 A;  3AE1 C;  3FGA D;  3MZW B;  2O1K A;  4D6T E;  3CCS P;  1OVU A;  4GIF A;  1P84 D;  4XFJ A;  1M1K Q;  1HJB A;  4GKG A;  1DD3 A;  1NAF A;  3GHG B;  3H1I E;  3M91 A;  2HLO A;  2O3J A;  4QMA A;  4Y99 B;  3U59 A;  1LWU B;  1EDK A;  2QJP B;  5APY A;  5KKZ C;  1H88 A;  2P2U A;  2WSS H;  5CCG C;  1NJI Q;  3BVH A;  2RN0 A;  1ZW0 A;  1VQ9 P;  1S9K E;  1H0T B;  1OW6 A;  3PHL A;  2BAS A;  1DEB A;  1LT9 B;  1N7L A;  1WRG A;  1KYO H;  4PV1 D;  2WIT A;  5GTH H;  2BCC E;  3RK3 E;  1FJK A;  4L76 A;  1PGP A;  3L75 J;  1FBM A;  1URQ B;  1HGZ A;  2AXC A;  3A0H H;  1NU1 K;  1QX8 A;  4EIJ A;  4U3F J;  3Q2Y A;  1L2P A;  1RH5 B;  1USE A;  2M3B A;  3A5T A;  3PTZ A;  1EZV E;  4IFD K;  3SFD C;  2V4H A;  1N73 B;  2YMY A;  1YIT P;  1FU1 A;  2CK3 H;  3B71 A;  4OWF A;  4U3F D;  3RL0 B;  1Y9B A;  3GHG A;  1J2J B;  3MUD C;  4H0L B;  3SFE C;  3AE2 C;  1EDJ A;  1ZR4 A;  3L4F A;  1IK7 A;  1IJD B;  3IN6 A;  3R4Y A;  1SQB E;  4RO0 A;  1L0L G;  2E74 D;  3CXH I;  3EWK A;  5AVY B;  3B5N B;  2R5B A;  5DJU B;  1LTI C;  1JMM A;  2D2C B;  2QIW A;  2WVR A;  5AW6 B;  3L70 E;  1FOS E;  2FYU G;  2ZXE B;  5APX A;  1RE3 C;  1BE3 J;  1SQV K;  4BXL A;  1KIL D;  2Y9Y A;  2QE7 H;  3B5N D;  5KLV K;  4PD4 E;  2IBZ D;  3E7K A;  4TT3 H;  4WY4 D;  4DZO A;  3CXH H;  4GOF A;  3A0H E;  3PRJ A;  5AVX B;  2QM7 A;  1N8R Q;  2OTJ P;  2ITA A;  1NTM K;  1U57 A;  3P8C D;  1Z56 A;  4H0L D;  5EFW B;  3Q5R A;  1RF1 A;  1SLQ A;  3RL0 D;  3HRN A;  4RES B;  3VP8 A;  1SQP E;  5AW1 B;  1K73 Q;  1K9M Q;  2IX7 C;  1Q81 Q;  1M90 Q;  1FZC A;  5APW A;  1ZOY C;  4ZNC A;  3HTK B;  1M8O B;  2HOD A;  2WSE H;  1G2C B;  3SWK A;  1FJP A;  4D6T G;  1QVF O;  4AYC A;  5KLV G;  3HD7 D;  2E42 A;  1KYO D;  1RF1 B;  1L0N G;  1URQ C;  2IFM A;  1FAV A;  1URQ D;  2JWA A;  1N2D C;  1SVF A;  4C46 A;  2R32 A;  2FYU K;  1VQ4 P;  3RBX A;  1JNM A;  2WPQ A;  2XV5 A;  1L0L D;  1M1J A;  3M0D A;  1KIL B;  1OZH A;  5KLI C;  1AVO A;  4XE5 B;  1YQ3 C;  2KS1 A;  3H1L G;  1LTS C;  3G9R A;  5AVW B;  3G6E P;  3O6Q A;  4W7Z A;  3LW5 J;  1LWU C;  2KLU A;  1VPC A;  2JKV A;  1YTZ I;  2QJP C;  1L0L J;  4IOI H;  2Y0E A;  5APQ A;  4WY4 C;  1A02 J;  4N78 D;  5KJ7 A;  1LWU A;  1FZA A;  3ITK A;  3O6Q B;  1JB0 J;  2KS1 B;  2Q3E A;  3N4X A;  2YIU C;  1GK6 A;  3FWL A;  1OVV A;  3TYY A;  1EC5 A;  1NTZ G;  1SQB J;  2BCC J;  1PPJ G;  1NWQ A;  1KQS O;  1NU1 E;  2JJL A;  2NZ2 A;  3C8V A;  1NAY A;  2K9J A;  1S9K D;  1KB9 D;  2QJY C;  2P58 A;  2KZJ A;  2ZVO B;  2E75 C;  2N1T D;  2YXQ B;  1MUU A;  1NVO A;  1PIX A;  3QH9 A;  1N7S B;  2A06 D;  1SQQ J;  2FYU J;  2YMK A;  3AE3 C;  3KYQ A;  4R4M A;  1SQX E;  3CX5 D;  2L5G B;  1KZU B;  3RK2 D;  2K9J B;  5AVU B;  2Y9Z A;  1XTC C;  1LTG C;  3P8M C;  2OAR A;  3P32 A;  2LXC B;  1GW4 A;  4KHX A;  1KN7 A;  5AVS B;  3NFQ A;  3TGU E;  5KLI B;  4KJM A;  3BCC G;  1NHL A;  1ZRT D;  4C7R A;  5KAF E;  1VQP P;  2BEZ F;  2AEM A;  1BCC E;  3VYI A;  2K3R A;  1BSN A;  3CWB E;  4LC1 A;  2KIK A;  2V7Q H;  1IZN B;  1G1I A;  2KB7 P;  3B8E B;  2IYP A;  1UIX A;  2D2C D;  1KFM A;  2KNC B;  1M1J B;  1X22 A;  3VOP A;  1FOS F;  2A45 G;  1L0N E;  4ASV A;  1GK4 A;  2NPS D;  2YKQ A;  4IFM A;  4UB8 H;  3M0A A;  1S3J A;  2AXT H;  5M1B A;  3K5B A;  1NKN A;  3EFG A;  3M9H A;  1X9V A;  2OGU A;  4CPG A;  4H44 C;  1R5S A;  3VMZ A;  3WUT A;  1JTH B;  3CC7 P;  3E1R A;  3HUS C;  1Q86 Q;  1H89 A;  1BDC A;  1L4A D;  5KAF H;  1LP1 A;  3BCC E;  2KXP B;  3HUS A;  2YO2 A;  3LID A;  2JEE A;  3G3Z A;  3SSU A;  2SPZ A;  3V2N A;  3BRT B;  4L73 A;  5AVT B;  3H1H D;  2B89 A;  3Q3D A;  1W2B O;  3CWB G;  3RL0 C;  2C0W A;  5APS A;  2A45 I;  2JDI H;  2BEQ D;  3RL0 g;  2FYN C;  4GOD A;  1KB9 I;  2Z5H A;  3AEA C;  5AW4 B;  1L0N J;  4EYY Q;  3G4S P;  4Y28 J;  5AW2 B;  3TNU A;  4W7Y A;  1OXZ A;  5KJ7 D;  2J5U A;  3VTP C;  3AE6 C;  3SWF A;  2J59 M;  2FKW B;  4LLH A;  3L72 G;  4JQ0 D;  1SS1 A;  1X8Y A;  3NTN A;  1HTL C;  3CX5 I;  1PGQ A;  1RE3 A;  1S4X A;  3O8Z A;  1VQK P;  2V7Q J;  1BE3 D;  1RQU A;  1K8A Q;  1BDD A;  1N73 A;  2H89 C;  1SFC B;  2E76 B;  3L72 J;  1NTZ K;  5KTB A;  1SQX K;  2Q6Q A;  2W83 C;  2Y0C A;  3B4S A;  2R3S A;  3AED C;  1BSH A;  1HGV A;  1LP1 B;  3I56 P;  1KC8 Q;  1IO4 A;  2QA4 P;  1SQP K;  1EZV D;  1URQ A;  1L4A C;  1JOC A;  1NTK D;  1SFC C;  2E76 C;  3CCV P;  3HD7 A;  4NPE A;  3GHG C;  3L71 E;  4XA4 A;  4R4L A;  1SQB G;  5CMZ A;  3PLN A;  1FZC C;  3IAO A;  3PH0 A;  1PV3 A;  1JTH A;  2O01 J;  2QRX A;  5K5G B;  1VQM P;  1JCD A;  3BRV B;  2KUB A;  2FYU E;  2OTK E;  2QVA A;  3TDK A;  4N3Y B;  1BGY D;  1PP9 D;  3V2Q A;  4EDF A;  1LTB C;  2UWJ E;  1Q2N A;  1ZN5 A;  2GUS A;  4K3A A;  2FYN B;  3BAT A;  3GG2 A;  4I7Z C;  3L73 E;  1NTZ J;  1ZRT E;  3KZI E;  1KQL A;  1R8E A;  1SQB K;  5KKZ B;  2FFD A;  2WZ7 A;  3CD6 P;  3AE9 C;  5TIS E;  4ZKP A;  1EQ7 A;  3HE4 B;  1SQP G;  1UII A;  1NKZ B;  3Q5P A;  3HE5 B;  3QWO C;  2B9B A;  2M5A A;  2ZVN B;  2OYH B;  1LTJ C;  2WT7 B;  1BGY G;  1L0N K;  1PP9 G;  2KSJ A;  4WWI A;  5KLV E;  5KJ7 C;  1PL5 A;  3FXE A;  1J1E B;  4PD4 D;  1SQQ D;  3CCJ P;  1P84 H;  4I2L C;  3C1L A;  1KFN A;  1PPJ D;  2KP8 A;  3TK1 A;  2B87 A;  3MHV A;  5TIS H;  1GU4 A;  3RK2 C;  1BGY E;  1PP9 E;  2Q5U A;  1M1J C;  1N86 A;  3M0D C;  5AW7 B;  3TSI A;  3R2P A;  4H44 D;  1RE4 A;  1OW8 A;  1QEX A;  1S5L E;  3V6I A;  1LGH B;  3MIW A;  4NPD A;  4U3F G;  1P84 I;  5BVZ A;  1VQO P;  4NPF X;  4H13 D;  3C9I A;  4DOJ A;  3HD7 C;  3S9O A;  5CJ0 A;  3V2P A;  1SFC A;  1KD1 Q;  1GDT A;  2MKV A;  2KNC A;  3L70 J;  2FYZ A;  2HOD B;  3L35 A;  2GA1 A;  3UIA A;  2OYI B;  2ZYA A;  5APV A;  4GDO A;  2IFN A;  5TJH A;  1RF1 C;  2W90 A;  2B88 A;  3L73 G;  2J58 A;  1CZQ A;  5B5E H;  2IZ1 A;  2JR8 A;  2FFD C;  5BU5 A;  3L36 A;  4D6T D;  1GL2 B;  1JEK A;  2BCC G;  2XDJ A;  3P8C E;  1T6A A;  2L91 A;  3BAS A; 
#chains in the Genus database with same CATH homology
 1IFN A;  1J1D C;  3KDP B;  3A3Y B;  2P7J A;  1HBW A;  3MTU E;  1QL2 A;  3IFM A;  1L4A A;  5AVV B;  2O1J A;  4HH2 A;  1FZC B;  3II6 A;  1SQQ K;  5CHX A;  5AW5 B;  3RK3 C;  1L4A B;  3I5C A;  4JF7 A;  3CL3 D;  2PAJ A;  4JYB A;  3SWY A;  3VMX A;  5AW0 B;  2P67 A;  1SFC D;  1KIL C;  2C9L Y;  1G1J A;  3H32 A;  1LTA C;  2Z5I A;  3P7K A;  5CCG A;  2GM4 A;  4O9B A;  2Q3I A;  1L0L K;  1LTJ A;  1MV8 A;  2N9B A;  2CPS A;  3LIE A;  4EOT A;  5AVR B;  1GD2 E;  4Y99 C;  4IFF A;  2KOG A;  3U1A A;  3IR9 A;  1GW3 A;  1CW5 A;  4WBA A;  1X79 B;  4HYT B;  3LW5 H;  2N1T A;  2XNX A;  4AQR D;  1LT9 A;  1FZE A;  5CCH D;  1N73 C;  3NMD A;  1LTT C;  3WMM 0;  2WT7 A;  3OA7 A;  3V4Q A;  1FZG A;  1E5W A;  1YYC A;  1GU5 A;  1JY3 O;  3TNU B;  2OYI C;  1HWT C;  2QM8 A;  1T3J A;  1T3U A;  2W6B A;  4GT1 A;  3A2A A;  2IPP A;  2WSC H;  4I6M C;  4AUW A;  2HYN A;  2R3C A;  2W27 A;  3RK3 D;  2PP6 A;  3L37 A;  1OWA A;  3NXS A;  5AW3 B;  3CLQ A;  2WPR A;  1IC2 A;  1XTG B;  2M8R A;  2POH A;  3HE5 A;  4WY4 A;  1W2E A;  3MGN A;  3B5N A;  1JY3 P;  1LTJ B;  2KYV A;  1GZL A;  3V4W A;  2NPS C;  2WPS A;  3M9Q A;  4WY4 B;  1GL2 C;  1GL2 D;  5CCH C;  1N7S C;  2NPS A;  1AQ5 A;  2YO3 A;  3VN0 A;  3MUD A;  1NO4 A;  5AVZ B;  3EQ2 A;  4B86 A;  2LKM A;  2KLV A;  1M7L A;  3HD7 B;  5AW8 B;  2YKO A;  5AW9 B;  1RY3 A;  2XU6 A;  3T97 A;  3V5B A;  2CPB A;  3U1C A;  3OJA B;  2WWW A;  2ZFC A;  1NTK K;  1DX7 A;  1T2K C;  1NH4 A;  3RK2 B;  1FZB A;  1AFO A;  2Q9I A;  4WB4 A;  4JYC A;  1JUN A;  4LGD E;  2W6A A;  1GL2 A;  1CI6 A;  1VDF A;  2A45 H;  5APT A;  2HPC A;  2OYH C;  1WT6 A;  3B5N C;  4N78 E;  2H43 A;  1JY2 P;  3H6P A;  2OYH A;  2YKP A;  2HPC B;  2XKM A;  3N7N A;  4C7N A;  5BU8 B;  1YTZ T;  1HVV A;  4N6J A;  1HUC A;  3M06 A;  3HTK A;  3KPE A;  2P1J A;  4OH8 B;  2MJZ A;  1FZF A;  2C9N Y;  1RF0 C;  3VMY A;  2WTY A;  1JCC A;  5AVQ B;  1A02 F;  3MD0 A;  1IK9 A;  2C0X A;  5CCH A;  1QL1 A;  2VRS A;  1GTW A;  5APU A;  1T8Z A;  1CSB A;  1LT9 C;  2E43 A;  1J1D B;  3A7O A;  1IFM A;  1T2K D;  1ZV8 A;  1KIL A;  3KQG A;  3RK3 B;  2I1K A;  2Z4E A;  1RE4 C;  2O01 H;  2HFE D;  2N1T B;  1GU4 A;  1DH3 A;  1ZLL A;  5CJ4 A;  3E1I A;  3HUS B;  2GUV A;  2I1J A;  4C7N B;  1JY3 N;  4W80 A;  3VP9 A;  1JY2 N;  1CI6 B;  1NOH A;  2HG5 D;  1SP4 A;  3OAK A;  5CCG D;  2OYI A;  1IFD A;  2FFD B;  2H8P D;  4ZKU A;  3HE4 A;  1ZR2 A;  3V2R A;  1HH0 A;  1JO5 A;  1J1E C;  3H32 B;  1MFZ A;  1G2C A;  2R5D A;  1RF0 A;  2YNY A;  2WSF H;  5APY A;  3M9B A;  2FXM A;  1H8A A;  2N1T C;  4I1L A;  1FDM A;  1MZ9 A;  2NPS B;  3PP5 A;  1PFI A;  2Q7C A;  1N7S D;  2XZR A;  1N7S A;  3CI9 A;  4M3L A;  1JY2 O;  1IFJ A;  1IFI A;  2O1K A;  4GIF A;  1HJB A;  4GKG A;  3GHG B;  1NAF A;  3M91 A;  3U59 A;  2HLO A;  4Y99 B;  1LWU B;  1H88 A;  2P2U A;  5CCG C;  3BVH A;  1S9K E;  2BAS A;  1LT9 B;  1DEB A;  1N7L A;  1WRG A;  2WIT A;  1FJK A;  1FBM A;  1URQ B;  1HGZ A;  1NU1 K;  4EIJ A;  2M3B A;  3A5T A;  4IFD K;  1N73 B;  2YMY A;  1FU1 A;  3RL0 B;  3GHG A;  1J2J B;  1ZR4 A;  3L4F A;  1IJD B;  5AVY B;  3B5N B;  2R5B A;  1LTI C;  1JMM A;  5AW6 B;  1FOS E;  2ZXE B;  5APX A;  1RE3 C;  1SQV K;  1KIL D;  3B5N D;  5KLV K;  4DZO A;  4WY4 D;  5AVX B;  2QM7 A;  1NTM K;  3P8C D;  1Z56 A;  1RF1 A;  1SLQ A;  3RL0 D;  3HRN A;  4RES B;  3VP8 A;  5AW1 B;  2IX7 C;  1FZC A;  5APW A;  3HTK B;  2WSE H;  2HOD A;  1FJP A;  1G2C B;  4AYC A;  3HD7 D;  2E42 A;  1RF1 B;  1URQ C;  2IFM A;  1FAV A;  1URQ D;  4C46 A;  1N2D C;  1SVF A;  2R32 A;  2FYU K;  1JNM A;  2WPQ A;  2XV5 A;  3M0D A;  1M1J A;  1KIL B;  4XE5 B;  1LTS C;  5AVW B;  4W7Z A;  1LWU C;  5APQ A;  1VPC A;  1YTZ I;  4WY4 C;  1A02 J;  4N78 D;  5KJ7 A;  1LWU A;  1FZA A;  3N4X A;  1GK6 A;  3TYY A;  1NWQ A;  2JJL A;  1S9K D;  2N1T D;  1MUU A;  1N7S B;  3KYQ A;  2L5G B;  1KZU B;  3RK2 D;  5AVU B;  1XTC C;  1LTG C;  3P8M C;  2OAR A;  3P32 A;  4KHX A;  1GW4 A;  5AVS B;  3NFQ A;  1NHL A;  4C7R A;  3VYI A;  4LC1 A;  1G1I A;  2KB7 P;  3B8E B;  1KFM A;  3VOP A;  1M1J B;  1FOS F;  2A45 G;  1GK4 A;  2NPS D;  2YKQ A;  4IFM A;  3M0A A;  1NKN A;  3EFG A;  3M9H A;  1X9V A;  3VMZ A;  1JTH B;  3HUS C;  1H89 A;  1L4A D;  3HUS A;  3LID A;  2YO2 A;  2JEE A;  3G3Z A;  3V2N A;  3BRT B;  5AVT B;  3RL0 C;  2C0W A;  5APS A;  2A45 I;  2Z5H A;  5AW4 B;  5AW2 B;  3TNU A;  4W7Y A;  1OXZ A;  5KJ7 D;  3SWF A;  2J59 M;  2FKW B;  4LLH A;  1X8Y A;  3NTN A;  1HTL C;  1RE3 A;  3O8Z A;  1N73 A;  1SFC B;  5KTB A;  1NTZ K;  1SQX K;  1HGV A;  1IO4 A;  1SQP K;  1URQ A;  1L4A C;  1JOC A;  1SFC C;  3HD7 A;  3GHG C;  4XA4 A;  5CMZ A;  1FZC C;  1JTH A;  1JCD A;  3BRV B;  3VTP C;  3V2Q A;  2H7H A;  4N3Y B;  1LTB C;  1ZN5 A;  2GUS A;  3BAT A;  1KQL A;  1SQB K;  2FFD A;  2WZ7 A;  4ZKP A;  1EQ7 A;  3HE4 B;  1NKZ B;  3HE5 B;  2OYH B;  1LTJ C;  2WT7 B;  2KSJ A;  1L0N K;  5KJ7 C;  1J1E B;  4I2L C;  1KFN A;  2KP8 A;  3TK1 A;  3RK2 C;  2Q5U A;  1M1J C;  1N86 A;  3M0D C;  5AW7 B;  3TSI A;  3R2P A;  1RE4 A;  1LGH B;  3MIW A;  5BVZ A;  3C9I A;  4DOJ A;  3HD7 C;  3V2P A;  5CJ0 A;  1GDT A;  1SFC A;  2FYZ A;  2HOD B;  3L35 A;  3UIA A;  2OYI B;  5APV A;  2IFN A;  1RF1 C;  2J58 A;  1CZQ A;  2FFD C;  5BU5 A;  3L36 A;  1GL2 B;  2XDJ A;  3P8C E;  3BAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...