3P8WA

Crystal structure analysis of r29m/e81m double mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQMLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIMEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Crystal Structure Analysis of R29M/E81M double mutant of human CLIC1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 76
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3p8wA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3p8wA01
1ABAA 3N9JA 1UN2A 1V57A 4Z7XA 2WS2A 2IMDA 2DJ2A 5A4VA 1QFNA 3UBLA 1QK8A 3P7XA 3F4TA 3M3MA 3P90A 2OADA 4TN8A 4EXJA 3RAZA 2IIYA 1BAYA 13GSA 4TR4A 1JLVA 3KZQA 4K7OA 4V1Ap 4ZXGA 3SBCA 1X9SB 4MLYA 1THXA 1THOA 5A4WA 3BBYA 4K0NA 5D9XA 2V32A 4OFTA 4ECIA 4MJAA 1Z3EA 3HA9A 5F8BA 1O8WA 5ECLB 1DE1A 1R5PA 1TXXA 5H5RA 2CX3A 1U3AA 5ECKB 3LORA 1AXDA 4YQUA 4WF5A 4IW9A 2REMA 2JL4A 1SL0B 4ECCA 3PGTA 1OC9B 4XTSA 2V41A 4KSMA 2PERA 1E2YA 5HR3A 3Q74A 5IOXA 5E4WA 2OBKA 1RK4A 2RLIA 3VLNA 4G10A 5ELAA 5HQPA 5IOWA 4ZL8A 1YEXA 1EP7A 1YKAA 3CSJA 1SYXA 3F3RA 2V6OA 3GX0A 4ZILA 1G7OA 5KN0A 1AQXA 2PN8A 1Z7RA 2GSTA 4NHZA 4GSTA 2LNSA 4BPYA 3EMPA 2H73A 2ON5A 2FA4A 4AJ6A 3VPQA 1XOBA 3GL5A 5IM9A 5D9TA 3LXZA 1FAAA 4EE0A 2K9FA 4V2MA 2VCTA 5J9BA 1ILOA 1GNWA 4WETA 3UOMA 1XIYA 1HD2A 3QPMA 4ZBBA 3VWVA 20GSA 2DIZA 1VF1A 4AGSA 2GSSA 2DJJA 1FVKA 2H19A 4TR0A 5IO0A 1OC3A 1XXUA 2HRAA 4JE1A 3KP8A 1AW9A 3FY7A 5KN1A 3UL3A 4BL7B 4CW9A 3ERWA 3KH7A 2XHFA 1TI3A 1IYHA 2DLXA 1F9MA 3DEXA 9GSSA 4NHWA 2G0FA 5HR0A 4FO5A 2VL9A 1TP9A 3IHQA 2IN3A 4RQRA 1LBKA 4EDYA 3IK7A 5DALA 4OO4A 1XFLA 1YJ6A 2TIRA 3C1RA 3ZIVA 1PL2A 4BWQA 2LTKA 3TKSE 1WWJA 4OCFA 2LQQA 3FYGA 2P0GA 4HEA2 1N2AA 4GQCA 5AIVA 7GSSA 5CO3A 4LMVA 4BVXA 3TUEA 3TGZA 1WP0A 1K0OA 2H1BA 1ZZYA 2AAWA 2HYXA 3HXSA 3VURA 2HSHA 3CRTA 5F05A 2PWJA 2LEGA 4QL9A 2YWIA 2WULA 3GMFA 3HVSA 4IP1A 3D21A 4NPBA 3TOUA 3IBHA 4PNGA 5A4UA 2GZZA 2MMNA 3U5RE 2TRCP 3CYNA 2V2GA 1GSYA 1GWCA 4IP6A 3F9UA 1FB0A 2CZ2A 1PN9A 2CA8A 1UC7A 2VD1A 3GKMA 2MMOA 4I5QA 4IVFA 4PQ1A 3KMNA 2B1KA 1G0TA 4BVYA 3LJRA 5GSTA 2L6DA 1SK0A 3HZ8A 2VAFA 4F82A 4K9ZA 1JFUA 3LQ7A 4XS1A 2N5FA 3DD3A 2IPAA 3I69A 3ISOA 1SK1A 3FZ9A 3R3EA 3C7MA 1XBSA 1NM3A 2JZSA 4KAEA 1TRUA 5D93A 4O92A 5ECHB 2WCIA 1FB6A 4N0ZA 4PGTA 1M2BA 4WF4A 4YAPA 4O7HA 2GGTA 5EY6A 4WEYA 2KHPA 1U87A 4I2TA 2R3XA 2M72A 2O87A 4I2UA 3WGXA 1GSDA 3WGEA 1EV9A 1TU7A 1LJRA 5FWGA 3DYRA 1XVWA 3F3QA 2C80A 5G2ZA 1EOHA 2NDOA 1YF0A 2LQOA 3FEUA 5J41A 2FNOA 2JSZA 4MABA 1A8LA 4Q5FA 4L5OA 4IBPA 3KIJA 5ECSA 3IXRA 1SL2B 1YKCA 4MF6A 1ST9A 2H01A 2DMLA 1PRXA 2AUVA 3F8UA 4XIHA 3FR3A 3KCMA 3KP9A 1TK0B 4ZL9A 1ACVA 3Q19A 1Z5YE 1I5GA 2YZUA 3I6AA 3DVXA 2N5BA 4AF2A 4GF0A 1FG4A 1J0FA 1TRWA 2GTUA 5DAKB 1KEBA 1XVQA 2FWGA 1MD4A 4IHUA 3GN3A 3M8NA 1DUGA 2GLRA 3D6IA 5IMAA 3GKXA 3MDKA 2C3QA 2YP6A 4PQIA 3ME8A 1QGVA 2HZFA 3IPZA 1J08A 3UMAA 5JCGA 2GZYA 2YNXA 1VF2A 3UARA 5G1KA 3KEBA 3LFLA 1WE0A 2RUFA 4JRRA 3ZFBA 1SD8A 4HQZA 3VWXA 2R37A 2QGVA 2VCZA 1GTUA 1TU8A 3VWUA 4TOPA 3F6DA 2B3SA 1PL1A 3U6VA 4LL4B 4NXIA 1TRSA 1WIKA 3HY2A 1K3LA 3D0ZA 3FZ4A 4TXVA 3CBUA 3VFIA 2B5EA 3I43A 3C73A 1T3BA 2YWOA 4KUNA 5AN1A 3TJJA 3BCKA 4HDEA 5IPGA 2B6MA 5CRDA 5DBQA 2B5YA 4MH2A 1F3AA 1GUHA 2H30A 2IJYA 5EL8A 2PU9C 2E2GA 2MMZA 1YF1A 2HQTA 3TRQA 1AQVA 3NZNA 1MTCA 2VCWA 1FO5A 3HKRA 1Z7PA 3US3A 2NVLA 3ZIJA 5GAPD 4FH8A 1DE2A 4KSOA 4YAVA 2KUCA 1WPIA 4TRXA 4BVYB 2X8CA 3IA1A 1YDKA 3E3EA 2MMAA 4ML1A 3ERGA 4KE3A 1QXHA 1G7EA 2H1GA 2HFDA 1SD9A 2EIRA 1JZWA 4F9ZA 4JR6A 4GLTA 3HJOA 2F9SA 5IMDA 1T8EB 2YOIA 3GFKA 3FZ5A 3FK8A 3ME7A 5J3RA 1B48A 4WXTA 5ECQB 3F0IA 5CNWA 4F0BA 2IMEA 3GYKA 2C4JA 2PGTA 2EC4A 4KX4A 1K0BA 2R5GA 1PKWA 1XWKA 1SENA 4G0LA 3TJKA 3IAS2 2GDRA 6GSWA 2YWMA 5C04A 4ML6A 2JZRA 4CHSA 1ERUA 3APOA 3FR6A 2LS5A 2DJ1A 5F0GA 6GSYA 1Q98A 2GVPA 5ECOB 2MZCA 1ZMAA 3VPTA 1AC1A 2YZHA 4PUAA 1GH2A 3APQA 2DC5A 2XPDA 4ACSA 1XZOA 4QQ7A 2AYTA 5H5SA 1HNCA 2ZUPA 3ZRDA 2I3YA 2PVOC 2VLVA 1OE8A 3DVWA 4LL1B 4I97A 1GTBA 2BTOT 4HJMA 1TKDB 5D8IA 3WD6A 2WDUA 3CTGA 3GL3A 2C0EA 2EIOA 5KN3A 4KF9A 4OD7A 1PX7A 3L78A 1C72A 2PUKC 6GSUA 3IC4A 1NSWA 1XOAA 1CQGA 3A2WA 1GTAA 1SJIA 3ZTLA 3ZITA 3IR4A 5CRHA 2VO4A 1GSUA 4NAXA 2V1MA 1SKSB 2XBIA 1JZRA 4ULXA 4MH3A 2C8UA 1ZYEA 2XBQA 4POMA 3M1GA 1VF3A 2O8VB 2WJUA 1SKRB 4FIWA 2Z9SA 3UBKA 1G6YA 1LU4A 4WBJA 4EUYA 5DQSA 1S3CA 1AQWA 2L5LA 3KH9A 2FLSA 5EPFA 3HVVA 2VLUA 1A8YA 3HCZA 2X99A 3MSZA 1FHEA 1TTZA 5H5QA 3TJGA 3A5WA 4PXOA 2XPEA 3LGCA 3Q6OA 4L0UA 3QOUA 4ZBAA 2HT9A 3DRNA 4P3YB 4TKYA 2K18A 1B9YC 1PA3A 5FHIA 4GSNA 5D9WA 1A2LA 4TR3A 2L4CA 2C1YA 4DSRA 2M46A 1OKTA 2YV7A 3IK9A 1J9BA 1T4YA 4KCAA 4LA1A 2GQMA 4KH7A 2JADA 4V2NA 1X5CA 2C0DA 3VK9A 4Q5QA 3UAPA 4HZ2A 2I1UA 1XWGA 11GSA 2DJ0A 5IQYA 2OBIA 2OE0A 3TRPA 1K0NA 4MCUA 4G0IA 18GSA 2HZEA 2WZ9A 1AUCA 3A2VA 4RQXA 2GT5A 4G9HA 2YJ7A 2NBSA 2PVQA 1EEMA 5GAND 2H1AA 2LV3A 5IMCA 2CVKA 2ES7A 1GNEA 3H93A 3K8NA 1V98A 2E7PA 4CDOA 2MYGA 2A4VA 1JHBA 4TVEA 6GSSA 5ABRA 3M9KA 5CRWA 3FR9A 3UEMA 2L5OA 5DVBA 2N5AA 2CVBA 2J9HA 3EVIA 2OKAA 4I6XA 3PINA 2QC7A 1R7HA 2CX4A 2YN1A 4POLA 3MAKA 3HJPA 2MBSA 1PSQA 4D73A 2YJHA 5GSSA 4AJ8A 3ED3A 4K2DA 1K0AA 3HYPA 2H76A 5KN2A 1U88A 1M9AA 4OO5A 3ZLPA 12GSA 4KW6A 5HR1A 1PGTA 1O8XA 1EZKA 4AJ7A 1Z6MA 2GS3A 1BEDA 3P8WA 4PURA 3AY8A 1EP8A 1T4ZA 3ZVJA 2MBTA 3WGDA 4K7IA 2DIYA 3IAM2 2LJKA 5JWRB 3JCML 5CP1A 2LJRA 3W8JA 3D5JA 1O85A 4Q5NA 2BMXA 3ZFLA 3LWAA 2DJ3A 2LNTA 1BQ7A 4OWYA 3RPPA 3ZMLA 1JZOA 5CREA 1MDIA 1DBYA 4TXOA 2C3NA 1W4VA 2HNLA 1SL1B 2GSRA 3G7YA 5B7CA 2HXKA 3LYPA 1V58A 2J23A 4L5LA 3HZ4A 2I4AA 4N30A 1JLWA 4XS4A 3QD9A 2VL3A 1V2AA 5F06A 5LCZA 4GTUA 3QR6A 4EC0A 3GSTA 5G31A 1TI1A 2CT6A 3EYTA 3G7JA 3GSSA 3CRUA 8GSSA 1XWAA 1B8XA 2H6YA 3E0UA 3RHBA 2VCXA 1SJ6A 3QFBC 2R4VA 4MPGA 1GP1A 2IL3A 3HJMA 2AJQB 2R2JA 5AIXA 1K3YA 1GSSA 1MD3A 1TOFA 4EL1A 3GUSA 5E59A 1JZDA 4IN0A 1EGRA 1YEPA 2RIIA 1R4WA 4BWSA 4K0GA 5IPHA 1VRSD 4KB3A 2FHEA 3EE2A 1KTEA 1Z9HA 1ERVA 4PX1A 4NV5A 1XW6A 1U6TA 2YPMA 1I9DA 1V9WA 2H8LA 2I9HA 3UVTA 5C00A 4JU5A 3V1WA 2VD0A 5AGYA 1A24A 1BJXA 3VI5A 5DALB 3WT1A 3UVHA 1A2JA 2E2MA 2FA8A 4MMMA 2CQ9A 4Q5RA 1GL8A 4HOJA 1CQHA 2FGXA 1EV4A 5D9VA 3DXBA 2QSIA 5B6MA 4JZQA 4EDZA 4BVXB 4OMVA 2CZ3A 3ZZXA 2ZNMA 4DVCA 4MZBA 4IQAA 4DEJA 2O85A 4X1UA 1F2EA 2CV4A 2P5QA 2VCQA 3BD2A 2HLSA 1OVNA 3F4SA 4MA9A 3ERFA 4X43A 3TKPA 1GLPA 3GURA 2C0FA 2F8FA 4GWRA 1YQ1A 4N10A 3KMOA 2V6KA 1GTIA 4WKWA 1ERTA 2NPBA 4ZIJA 2GSQA 4EVMA 4YQVA 3KM6A 1VF4A 3IDVA 5G5EA 3CTFA 3IOSA 4ILFA 4V1Ag 2HRKA 1FVJA 1BX9A 2O89A 1SU9A 1OAZA 1W89A 2ON7A 2X64A 4D73B 4EF0A 4H86A 4HUAA 4O5RA 5ECPB 3IRAA 4I8BA 2OACA 3APSA 3HD5A 5ECRB 5KEJA 2H70A 3G9BA 4ZB6A 1YY7A 3D4MA 1EGOA 2D2ZA 2H74A 1A0FA 3EU3A 2H1DA 1NHYA 2VCVA 5J9CA 5DQYA 1K0CA 1XCCA 2A2RA 4JBBA 5B6NA 4LLRA 2OE1A 4F2IA 2AV4A 4RI7A 3H79A 4ISDA 2FWHA 1HQOA 3QAGA 1GSEA 1WOUA 3QFAC 2FY6A 5EVOA 4HZ4A 3RBTA 3LEFA 3L9SA 3C71A 5A5KA 5INYA 2K8VA 5L71A 1UA5A 4XHMA 2JU5A 4GXZA 2TRXA 2H71A 1OE7A 1R5AA 5ID2A 2YV9A 4N11A 3ZVJD 4E8EA 3QCPA 4TXOB 3H4KA 3TKRA 3QAVA 3CSIA 1SYRA 2WGRA 4IKHA 2B7KA 2H75A 2LJAA 1A0RP 4G19A 3CMIA 1HNBA 1B4PA 3D4TA 4XS4B 2H6XA 1Z6NA 3S9FA 1BYEA 1M0UA 4JEDA 1M2DA 2YANA 4RI6A 1ON4A 1R26A 1EWXA 2H0HA 3A3TA 2KP2A 2R6KA 1PD21 5J5NA 4POKA 3M0FA 5DJMA 2JSYA 5D96A 3W8SA 3GKNA 4IQ1A 2ZCTA 1QQ2A 3BOAA 5LD0A 4EKZA 2JACA 1B4QA 1ZGNA 2HE3A 3OR5A 4EO3A 14GSA 4X0XA 4TW5A 1E6BA 1X5DA 3RHCA 3LYKA 3KTLA 5LNKe 2WB9A 1URMA 1OYJA 1RW1A 3F6FA 1PKZA 3TJFA 4XS6A 4K7NA 5F07A 1PX6A 2X8HA 1F3BA 3EWLA 4GRFA 1ZOFA 3LXTA 1GSQA 3TRXA 3L4NA 4KDUA 2F3MA 5IMVA 4E8HA 2KP1A 3GA4A 4JR4A 3MNGA 3N5OA 5D73A 1QMVA 5ECMB 3RPNA 4QL7A 4V2LA 2CVDA 2K8SA 3FRCA 2HSMA 4MF7A 3QDNA 1F37A 5G30A 3MWHA 4K6XA 3TKQA 2L4QA 4PUFC 3C1SA 4HQSA 3F63A 2F8AA 2DBCA 1MEKA 5ENUA 3KXOA 4GQFA 4ZL7A 4NMUA 2H72A 4USSA 4OFMA 3HVXA 3PPUA 5IMFA 3UJ1A 2VM2A 2C0GA 5ECNB 4POBA 5DAKA 3TDGA 4XRDA 2FCHA 3DMLA 3RDWA 3I9V2 4FYUA 3CXGA 6GSVA 2PPTA 2IWTA 5HR2A 1GUKA 5AISA 2RM5A 2HRKB 10GSA 2IMFA 2VL2A 1X9WB 2PBJA 2JZTA 3ZREA 4XCSA 3EINA 1K3OA 2FWFA 2LUSA 4IS0A 2H66A 5HFKA 4L0WA 4NWYA 4XRAA 4LMWA 1A23A 2LRNA 4MPFA 5DDLA 3KGKA 3IC8A 2L59A 1K0MA 2A2SA 2VUPA 1DSBA 4PNFA 3KD0A 2AB6A 3VI7A 1GRXA 4TR1A 3QAWA 4J57E 2L6CA 3WT2A 1FOVA 3EU4A 1M99A 4HU9A 4MP4A 5JCWA 3LG6A 3H1NA 3UIWA 2HSYA 3J7Yk 2RM6A 3TKSA 1YZXA 1ZCPA 1AIUA 3KTBA 4G0KA 2GQLA 1K0DA 4FYCA 3ZMKA 5COHA 2IFQA 1HNAA 2CAIA 1ML6A 3O3TA 1USBA 4DSSA 5ID2B 5JWQB 5IO2A 1Y6EA 3PH9A 4BA7A 1IYIA 3L9VA 1O73A 4O32A 17GSA 1NW2A 3TOTA 1M9BA 2EIQA 4KGIA 3FZAA 1GLQA 2L57A 5FT3A 4HJ2A 2HRNA 3QMXA 2FWEA 6GSXA 1V40A 1TRVA 4YQMA 1A2MA 1OC8A 3O76A 3LSZA 4MJEA 1VGLA 2UZ8A 1B9XC 3GH9A 3BCIA 4K8MA 3CSHA 1TDIA 1GUMA 1N8JA 1TK5B 3PR8A 2KLXA 2DJKA 2PMTA 2P5RA 2I81A 1G6WA 2VM1A 3DWVA 3SWLA 2LRCA 1O7UA 3HHVA 3GX8A 4KCEA 2O7KA 1XWCA 2HI7A 1S3AA 1O81A 2XC2A 4IGJA 3FKFA 2ALBA 3GTUA 2LSTA 1S3DA 2GQKA 1GSFA 2H0IA 4ECBA 4PTSA 2WFCA 3EC3A 4KDXA 1H75A 3GKKA 3GV1A 1FW1A 22GSA 5HFGA 2OE3A 5IIZA 4K1FA 5B8BA 2E0QA 4ZBDA 1X5EA 4F03A 4MK3A 1F6MC 1T1VA 2VIMA 1WRYA 1ZYQB 4J56E 19GSA 4KDYA 2H6ZA 3GRXA 3ZL5A 3EURA 2RUEA 5DJLA 3TB2A 1SKWB 2HSMB 3HDCA 2LKUA 2QKEA 3J7Yb 4L8EA 5J4UA 1NHOA 2CAQA 3L9UA 2DSAA 1WMJA 1BG5A 3M9JA 4J2FA 1UVZA 1MDJA 4KNDA 1AAZA 2DMMA 1EEJA 3E9JB 1TJDA 5JCUA 3GHAA 4N0VA 3GH6A 4MJBA 4MJCA 1KNGA 3IV4A 2VLTA 4GSSA 3TCOA 5DCHA 4IJIA 1TW9A 1OC9A 4WR5A 2KOKA 2VL2C 4OFNA 1T00A 2GZPA 1SK2A 3R2QA 3IE3A 5DCGA 1T7PB 3NOFA 1XW5A 1OKDA 3H8QA 3ZYWA 1HYUA 5ELGA 1EOGA 3BJ5A 3A2XA 1ERWA 1XWBA 3FHKA 2HZEB 4YH2A 2FD3A 3KJYA 3O6TA 3D22A 2IMKA 4ZB9A 4NV2A 1SJZA 2G2QA 3VWWA 4TR1B 3NIVA 2B1LA 3WYWA 5CYYA 1XPVA 1KBNA 4MZWA 2BJXA 2HRFA 3P2AA 4MZCA 5CRGA 5G5FA 3GNJA 2P31A 4FYBA 2YCDA 4DSQA 4MDCA 3GIXA 3TKSC 4HI7A 4RUVA 4KA0A 3W6GA 1PMTA 4WBRD 2C3TA 2AHEA 5G1LA 5JWOB 1RQMA 5BMUA 2OJLA 5IMZA 3L0HA 2IFQB 3DKSA 2B7JA 4DSSB 5HFIA 1PQNA 1TK8B 4F0CA 1GULA 1QUWA 2B5XA 5CAXA 2LRTA 6GSTA 5ECIB 4BL7A 1Y25A 1WJKA 4IJ3A 1ZL9A 1XW9A 4HU7A 3Q18A 4PQHA 4WR4A 3F4RA 2NTOA 1O6JA 2H0GA 4HS1A 1X9MB 1X0RA 3FW2A 4GCIA 2IMIA 2X8GA 1Q4JA 4OCEA 16GSA 3EMXA 1H4OA 3TJBA 1M2AA 2YWNA 3G7IA 2F51A 2K6VA 1MDKA 4MF5A 3DGQA 3DIEA 2WRTA 2M80A 2HSNB 2GT6A 1U3IA 1M7TA 3GTUB 4FQUA 5GZZB 4ID0A 2OA7A 2FUG2 2VOCA 4G2EA 4ZB8A 5B8AA 4ECJA 3C8EA 4IELA
chains in the Genus database with same CATH superfamily
1ABAA 3N9JA 1UN2A 1V57A 4Z7XA 2WS2A 2IMDA 2DJ2A 5A4VA 1QFNA 3UBLA 1QK8A 3P7XA 3F4TA 3M3MA 3P90A 2OADA 1YVLA 4TN8A 4Z2RA 4EXJA 3RAZA 2IIYA 1BAYA 4PI0C 13GSA 4TR4A 1JLVA 3KZQA 2H1LA 4K7OA 4V1Ap 4ZXGA 3SBCA 2R0PA 1X9SB 4MLYA 1THXA 1THOA 5A4WA 3BBYA 4K0NA 5D9XA 2UV8G 2V32A 4OFTA 4ECIA 5J47A 4MJAA 1Z3EA 3HA9A 5F8BA 1O8WA 5ECLB 1ZYPA 1DE1A 1R5PA 1TXXA 5H5RA 1BF5A 4EIPA 2CX3A 1U3AA 5ECKB 3LORA 1AXDA 4YQUA 4WF5A 1SVMA 4IW9A 2REMA 2JL4A 1SL0B 4ECCA 3PGTA 1OC9B 4YKFA 4XTSA 2V41A 4KSMA 2PERA 1E2YA 5HR3A 3Q74A 5IOXA 5E4WA 2OBKA 1RK4A 2RLIA 3VLNA 4G10A 5ELAA 5HQPA 5IOWA 4ZL8A 1YEXA 1EP7A 1YKAA 3CSJA 1SYXA 3F3RA 2V6OA 3GX0A 4ZILA 1G7OA 5KN0A 1AQXA 2OT3A 2PN8A 1Z7RA 2GSTA 4NHZA 4GSTA 2LNSA 4BPYA 3EMPA 2H73A 2ON5A 2FA4A 4AJ6A 3VPQA 1XOBA 3GL5A 5IM9A 2WW3A 4N3ZA 3LXZA 5D9TA 1FAAA 4EE0A 2K9FA 4V2MA 2VCTA 5J9BA 1ILOA 1GNWA 4WETA 3UOMA 1XIYA 1HD2A 3QPMA 4ZBBA 3VWVA 20GSA 2DIZA 1VF1A 4AGSA 2GSSA 2DJJA 1FVKA 2H19A 4TR0A 5IO0A 1OC3A 1XXUA 2HRAA 2QA1A 4JE1A 3KP8A 1AW9A 3FY7A 5KN1A 3UL3A 4BL7B 4CW9A 3ERWA 4O5QA 3KH7A 2XHFA 1TI3A 1IYHA 2DLXA 1F9MA 3DEXA 9GSSA 4NHWA 2G0FA 5HR0A 4FO5A 2VL9A 1TP9A 3IHQA 2IN3A 4RQRA 1LBKA 4EDYA 3IK7A 5DALA 4OO4A 1XFLA 1YJ6A 2TIRA 3C1RA 1BG1A 3ZIVA 1PL2A 4BWQA 2LTKA 3TKSE 1WWJA 4OCFA 2LQQA 3FYGA 2P0GA 4HEA2 1N2AA 4GQCA 5AIVA 7GSSA 5CO3A 4LMVA 4BVXA 3TUEA 3TGZA 1WP0A 1K0OA 2H1BA 1ZZYA 2AAWA 2HYXA 3HXSA 3VURA 2HSHA 3CRTA 5F05A 2PWJA 2LEGA 4QL9A 2YWIA 2WULA 3GMFA 5J4VA 3HVSA 4IP1A 4AKGA 3D21A 4NPBA 4HSCX 3TOUA 3IBHA 4PNGA 5A4UA 2GZZA 2MMNA 3U5RE 2TRCP 3CYNA 2V2GA 1GSYA 1GWCA 4IP6A 3F9UA 1S4BP 1FB0A 2CZ2A 1PN9A 2CA8A 1UC7A 2VD1A 3GKMA 2MMOA 4I5QA 4IVFA 4PQ1A 3KMNA 2B1KA 1G0TA 4BVYA 3LJRA 5GSTA 2L6DA 1SK0A 3HZ8A 2VAFA 4F82A 4K9ZA 1JFUA 3LQ7A 4XS1A 2N5FA 3DD3A 2IPAA 3I69A 3ISOA 1SK1A 3FZ9A 3R3EA 3C7MA 1XBSA 1YEWC 3RGBC 1NM3A 2JZSA 4KAEA 1TRUA 5D93A 4EIQA 4O92A 5ECHB 2WCIA 1FB6A 4N0ZA 4PGTA 1M2BA 4WF4A 4YAPA 4O7HA 2GGTA 5EY6A 4WEYA 2KHPA 1U87A 4I2TA 2R3XA 2M72A 2O87A 4I2UA 3IHGA 3WGXA 1GSDA 3WGEA 1EV9A 1TU7A 1LJRA 5FWGA 3DYRA 1XVWA 3F3QA 2C80A 5G2ZA 1EOHA 2NDOA 1YF0A 2LQOA 3FEUA 5J41A 2FNOA 2JSZA 4MABA 1A8LA 4AKHA 4Q5FA 4L5OA 4IBPA 3KIJA 5ECSA 3IXRA 1SL2B 1YKCA 4MF6A 1ST9A 2H01A 2DMLA 1PRXA 2AUVA 3F8UA 4XIHA 3FR3A 3KCMA 3KP9A 1TK0B 4ZL9A 1ACVA 3Q19A 1Z5YE 1I5GA 2YZUA 3I6AA 3DVXA 2N5BA 4AF2A 4GF0A 1FG4A 1J0FA 1TRWA 2GTUA 5DAKB 1KEBA 1XVQA 2FWGA 1MD4A 4IHUA 3LW9A 3GN3A 3M8NA 1DUGA 2GLRA 3D6IA 5IMAA 3GKXA 3MDKA 2C3QA 2YP6A 4PQIA 3ME8A 2WW1A 1QGVA 5A1NA 3IPZA 1J08A 2HZFA 3UMAA 5JCGA 2GZYA 2YNXA 1VF2A 3UARA 5G1KA 3KEBA 3LFLA 1WE0A 2RUFA 4JRRA 3ZFBA 1SD8A 4HQZA 3VWXA 2R37A 2QGVA 2WVZA 2VCZA 1GTUA 1TU8A 3VWUA 4TOPA 3F6DA 2B3SA 1PL1A 3U6VA 4LL4B 4NXIA 1TRSA 1WIKA 3HY2A 1K3LA 3D0ZA 3FZ4A 4TXVA 3CBUA 3VFIA 2B5EA 3I43A 3C73A 1T3BA 2YWOA 4KUNA 5AN1A 3TJJA 3BCKA 4HDEA 5IPGA 2B6MA 5CRDA 5DBQA 2B5YA 4MH2A 1F3AA 4YKGA 1GUHA 2H30A 2IJYA 5EL8A 2PU9C 2E2GA 2MMZA 1YF1A 2HQTA 3TRQA 1AQVA 3NZNA 1MTCA 4PHZC 2VCWA 1FO5A 3HKRA 1Z7PA 3US3A 2NVLA 3ZIJA 5GAPD 4FH8A 1DE2A 4KSOA 4YAVA 2KUCA 1WPIA 4TRXA 4BVYB 2X8CA 3IA1A 1YDKA 3E3EA 2MMAA 4ML1A 3ERGA 4KE3A 1QXHA 1G7EA 2H1GA 2HFDA 1SD9A 2EIRA 1JZWA 4F9ZA 4Z2UA 4JR6A 4GLTA 3HJOA 3EPTA 2F9SA 5IMDA 1T8EB 2YOIA 3GFKA 3FZ5A 3FK8A 3ME7A 5J3RA 1B48A 4WXTA 5ECQB 3F0IA 5CNWA 4F0BA 2IMEA 3GYKA 2C4JA 2PGTA 2EC4A 4KX4A 1K0BA 1N25A 2R5GA 1PKWA 1XWKA 1SENA 4G0LA 1PN0A 3TJKA 3IAS2 2GDRA 6GSWA 2YWMA 5C04A 4ML6A 2JZRA 4CHSA 1ERUA 3APOA 3FR6A 2LS5A 2DJ1A 5F0GA 6GSYA 1Q98A 2GVPA 5ECOB 1PFOA 2MZCA 1ZMAA 3VPTA 1AC1A 2YZHA 4PUAA 1GH2A 3APQA 2DC5A 2XPDA 4ACSA 4ZB7A 1XZOA 2DKHA 4QQ7A 2AYTA 5H5SA 1HNCA 2ZUPA 3ZRDA 2I3YA 2PVOC 2VLVA 1OE8A 3DVWA 4K5SA 4LL1B 4I97A 1GTBA 2BTOT 4HJMA 1TKDB 4QMKA 5D8IA 3WD6A 2WDUA 3CTGA 3GL3A 2C0EA 4E68A 2EIOA 5KN3A 4KF9A 4OD7A 1PX7A 3L78A 4ICYA 1C72A 2PUKC 6GSUA 3IC4A 1NSWA 1XOAA 1CQGA 3A2WA 1GTAA 1SJIA 3ZTLA 3ZITA 3IR4A 5CRHA 2VO4A 1GSUA 4NAXA 2V1MA 5A1NB 1SKSB 2XBIA 1JZRA 4ULXA 4MH3A 2C8UA 1ZYEA 2XBQA 4POMA 3M1GA 1VF3A 2O8VB 2WJUA 1SKRB 4FIWA 2Z9SA 3UBKA 1G6YA 1LU4A 4WBJA 4EUYA 5DQSA 1S3CA 1AQWA 2L5LA 3KH9A 2FLSA 5EPFA 3HVVA 2VLUA 1A8YA 4K5RA 3HCZA 2X99A 3MSZA 1FHEA 1TTZA 5H5QA 3TJGA 4X4JA 3A5WA 4PXOA 2XPEA 3LGCA 3Q6OA 4L0UA 3QOUA 4ZBAA 2HT9A 3DRNA 4P3YB 4TKYA 2K18A 1B9YC 1PA3A 5BMUB 5FHIA 4GSNA 5D9WA 1A2LA 4TR3A 2L4CA 2C1YA 4DSRA 2M46A 1OKTA 2YV7A 3IK9A 4AKXB 1J9BA 1T4YA 4KCAA 4LA1A 2GQMA 4KH7A 2JADA 4V2NA 1M3JA 1X5CA 2C0DA 5A5HA 3VK9A 4Q5QA 3UAPA 4HZ2A 3TU3B 2I1UA 1XWGA 11GSA 5J4YA 2DJ0A 5IQYA 2OBIA 2OE0A 3TRPA 1K0NA 4MCUA 4G0IA 18GSA 2HZEA 2WZ9A 2WW2A 1AUCA 3A2VA 4RQXA 2GT5A 4G9HA 2YJ7A 2NBSA 2PVQA 1EEMA 5GAND 2H1AA 2LV3A 5IMCA 2CVKA 2ES7A 1GNEA 3H93A 3K8NA 1V98A 2E7PA 4CDOA 2MYGA 2A4VA 1JHBA 4TVEA 6GSSA 5ABRA 3M9KA 5CRWA 3FR9A 3UEMA 2L5OA 5DVBA 2EFEA 2N5AA 1M3IA 2CVBA 2J9HA 3EVIA 2O3EA 2OKAA 4I6XA 3PINA 2QC7A 1R7HA 2CX4A 2YN1A 4POLA 3MAKA 3HJPA 2MBSA 1PSQA 4D73A 2YJHA 5GSSA 1S3RA 4AJ8A 3ED3A 4K2DA 1K0AA 3HYPA 2H76A 5KN2A 1U88A 1M9AA 4OO5A 3ZLPA 12GSA 4KW6A 5HR1A 1PGTA 1O8XA 1EZKA 4AJ7A 1Z6MA 2GS3A 1BEDA 3P8WA 4PURA 3AY8A 1EP8A 1T4ZA 4G01A 3ZVJA 2MBTA 3WGDA 4K7IA 2DIYA 3IAM2 2LJKA 5JWRB 3JCML 5CP1A 2LJRA 3W8JA 3D5JA 1O85A 4AI6A 4Q5NA 2BMXA 3RFRC 3ZFLA 3LWAA 2DJ3A 2LNTA 1BQ7A 4OWYA 3RPPA 3ZMLA 1JZOA 5CREA 1MDIA 1DBYA 3HVNA 4TXOA 2C3NA 1W4VA 2HNLA 1SL1B 2GSRA 3G7YA 5B7CA 2HXKA 3LYPA 1V58A 2J23A 4L5LA 3HZ4A 2I4AA 4N30A 1JLWA 4XS4A 3QD9A 2VL3A 1V2AA 5F06A 5LCZA 4GTUA 3QR6A 4EC0A 3GSTA 5G31A 1TI1A 2CT6A 3EYTA 3G7JA 3GSSA 3CRUA 8GSSA 1XWAA 1B8XA 2H6YA 3E0UA 3RHBA 2VCXA 1SJ6A 5A34A 3QFBC 2R4VA 4MPGA 1GP1A 2IL3A 2VKZG 3HJMA 2AJQB 2R2JA 5BRTA 5AIXA 1K3YA 2WVYA 1GSSA 1MD3A 1TOFA 4EL1A 3GUSA 5E59A 1JZDA 4IN0A 1EGRA 1YEPA 2RIIA 1R4WA 4BWSA 4K0GA 5IPHA 1VRSD 4KB3A 2FHEA 3EE2A 1KTEA 1Z9HA 1ERVA 4PX1A 4NV5A 1XW6A 1U6TA 2YPMA 1I9DA 1V9WA 2H8LA 2I9HA 3UVTA 5C00A 4JU5A 3V1WA 2VD0A 5AGYA 1A24A 1BJXA 3VI5A 5DALB 3WT1A 3UVHA 1A2JA 2E2MA 2WZSA 2FA8A 4MMMA 2CQ9A 4Q5RA 1GL8A 3CHXC 4HOJA 1CQHA 2FGXA 1EV4A 5D9VA 3DXBA 2QSIA 5B6MA 4JZQA 4EDZA 4BVXB 4OMVA 2CZ3A 3ZZXA 2ZNMA 4DVCA 4MZBA 4IQAA 4DEJA 2O85A 4X1UA 1F2EA 2CV4A 2P5QA 2VCQA 3BD2A 2HLSA 1OVNA 2O36A 3F4SA 4MA9A 3ERFA 4X43A 3TKPA 1GLPA 3GURA 2C0FA 2F8FA 4GWRA 1YQ1A 4N10A 3KMOA 2V6KA 1GTIA 4WKWA 1ERTA 2NPBA 4ZIJA 2GSQA 4EVMA 4YQVA 3KM6A 3IDVA 1VF4A 5G5EA 3CTFA 3IOSA 4ILFA 4V1Ag 1Y1UA 2HRKA 1FVJA 1BX9A 2R0GA 2O89A 1SU9A 1OAZA 1W89A 2ON7A 2X64A 4D73B 4K2XA 4EF0A 4H86A 4HUAA 4O5RA 5ECPB 3IRAA 4I8BA 2OACA 3APSA 1SVOA 3HD5A 5ECRB 5KEJA 2H70A 3G9BA 4ZB6A 1YY7A 3D4MA 1EGOA 2D2ZA 2H74A 1A0FA 3EU3A 2H1DA 1NHYA 2VCVA 5J9CA 5DQYA 1K0CA 1XCCA 2A2RA 4JBBA 5B6NA 4LLRA 2OE1A 4F2IA 2AV4A 4RI7A 3H79A 4ISDA 2DKIA 2FWHA 1HQOA 3QAGA 1GSEA 1WOUA 3QFAC 2FY6A 5EVOA 4HZ4A 3RBTA 3LEFA 3L9SA 3C71A 5A5KA 5INYA 2K8VA 5L71A 1UA5A 4XHMA 2JU5A 4GXZA 2TRXA 2H71A 3MIXA 1OE7A 1R5AA 5ID2A 2YV9A 4N11A 3ZVJD 4E8EA 3QCPA 4TXOB 3H4KA 3TKRA 3QAVA 3CSIA 1SYRA 2WGRA 4IKHA 2B7KA 2H75A 2LJAA 1A0RP 4G19A 3CMIA 1HNBA 1B4PA 3D4TA 4XS4B 2H6XA 1Z6NA 3S9FA 1BYEA 1M0UA 1ZYNA 4JEDA 1M2DA 2YANA 4RI6A 1ON4A 1R26A 1EWXA 4CY6A 2H0HA 3A3TA 2WW0A 2KP2A 2R6KA 1PD21 5J5NA 4POKA 3M0FA 5DJMA 2JSYA 5D96A 3W8SA 3GKNA 4IQ1A 2ZCTA 1QQ2A 3BOAA 5LD0A 4EKZA 5A34B 2R0CA 2JACA 1B4QA 1ZGNA 2HE3A 3OR5A 4EO3A 2EFHA 14GSA 4X0XA 4TW5A 1E6BA 1X5DA 3RHCA 3LYKA 3KTLA 5LNKe 2WB9A 1URMA 1OYJA 2A4HA 1RW1A 3F6FA 1PKZA 3TJFA 4XS6A 4K7NA 5F07A 1PX6A 2X8HA 1F3BA 3EWLA 4GRFA 1ZOFA 3LXTA 1GSQA 3TRXA 3L4NA 4KDUA 2F3MA 5IMVA 2X49A 4E8HA 2KP1A 3GA4A 4JR4A 3MNGA 3N5OA 5D73A 1QMVA 5ECMB 3RPNA 4QL7A 4V2LA 2CVDA 2K8SA 3FRCA 2HSMA 4MF7A 3QDNA 1F37A 5G30A 3MWHA 4K6XA 3TKQA 2L4QA 4PUFC 3FMWA 3C1SA 4HQSA 3F63A 2F8AA 2DBCA 1MEKA 5ENUA 3KXOA 4GQFA 4ZL7A 4NMUA 2H72A 4USSA 4OFMA 3CQFA 3HVXA 3PPUA 2WVXA 5IMFA 3UJ1A 2VM2A 2C0GA 5ECNB 4POBA 5DAKA 4Z2TA 3TDGA 4XRDA 2FCHA 3DMLA 4AKIA 3RDWA 3I9V2 4FYUA 3CXGA 3HMJG 6GSVA 2PPTA 2IWTA 5HR2A 1GUKA 5AISA 2RM5A 2HRKB 10GSA 2IMFA 2VL2A 1X9WB 2PBJA 2JZTA 3ZREA 4XCSA 3EINA 1K3OA 2FWFA 2LUSA 4IS0A 2H66A 5HFKA 4L0WA 3A5IA 4NWYA 4XRAA 4LMWA 1A23A 5J40A 2LRNA 1XG8A 2EFDA 4MPFA 5DDLA 3KGKA 5KOWA 3IC8A 2L59A 1K0MA 2A2SA 2VUPA 4BIKA 1DSBA 4PNFA 3KD0A 2AB6A 3VI7A 1GRXA 4TR1A 3QAWA 4J57E 2L6CA 3WT2A 1FOVA 3EU4A 1M99A 4A5PA 4HU9A 4MP4A 5JCWA 3LG6A 3H1NA 3UIWA 2HSYA 3J7Yk 2RM6A 3TKSA 1YZXA 1ZCPA 1AIUA 3KTBA 4G0KA 2GQLA 1K0DA 4FYCA 3ZMKA 5COHA 2EFCA 2IFQA 1HNAA 2CAIA 1ML6A 3O3TA 1USBA 4DSSA 5ID2B 5JWQB 5IO2A 1Y6EA 3PH9A 4BA7A 1IYIA 3L9VA 1O73A 4O32A 17GSA 1NW2A 3TOTA 5KOXA 1M9BA 2EIQA 4KGIA 3FZAA 4PI2C 1GLQA 2L57A 5FT3A 4HJ2A 2HRNA 3QMXA 2FWEA 6GSXA 1V40A 1TRVA 4YQMA 1A2MA 1OC8A 3O76A 3LSZA 4MJEA 1VGLA 2UZ8A 1B9XC 3GH9A 3BCIA 4K8MA 3CSHA 1TDIA 1GUMA 1N8JA 1TK5B 3PR8A 2KLXA 2DJKA 2PMTA 2P5RA 2I81A 1G6WA 2VM1A 3DWVA 3SWLA 2LRCA 1O7UA 3HHVA 3GX8A 4KCEA 2O7KA 1XWCA 4GDFA 2HSNA 2HI7A 4MNNA 1S3AA 1O81A 2XC2A 4IGJA 3FKFA 2ALBA 3GTUA 2LSTA 1S3DA 2GQKA 1GSFA 2H0IA 4ECBA 4PTSA 2WFCA 3EC3A 4KDXA 1H75A 3GKKA 3GV1A 4W66A 1FW1A 22GSA 5HFGA 2OE3A 5IIZA 4K1FA 5B8BA 1FOHA 2E0QA 4ZBDA 1X5EA 4F03A 4MK3A 1F6MC 1T1VA 2VIMA 1WRYA 1ZYQB 4J56E 19GSA 4KDYA 2H6ZA 2QA2A 3GRXA 3ZL5A 3EURA 2RUEA 5DJLA 3TB2A 1SKWB 2HSMB 3HDCA 2LKUA 2QKEA 3J7Yb 4L8EA 5J4UA 1NHOA 2CAQA 3L9UA 2DSAA 1WMJA 1BG5A 2X4AA 3M9JA 4J2FA 1UVZA 1MDJA 4KNDA 1AAZA 2DMMA 1EEJA 3E9JB 1TJDA 5JCUA 2WVXB 3GHAA 4N0VA 3GH6A 4MJBA 4MJCA 1KNGA 3IV4A 1SVLA 2VLTA 4GSSA 3TCOA 5DCHA 4IJIA 1TW9A 1I1IP 1OC9A 4WR5A 2KOKA 2O5VA 2VL2C 4OFNA 1T00A 2GZPA 1SK2A 3R2QA 5A5HB 3IE3A 5DCGA 1T7PB 3NOFA 1XW5A 1OKDA 3H8QA 4CY8A 3ZYWA 1HYUA 5ELGA 1EOGA 3BJ5A 3A2XA 1ERWA 1XWBA 3FHKA 2HZEB 4YH2A 2FD3A 3KJYA 3O6TA 3D22A 2IMKA 4ZB9A 4NV2A 1SJZA 2G2QA 3MYDA 3VWWA 4TR1B 3NIVA 2B1LA 3WYWA 5CYYA 1XPVA 1KBNA 4MZWA 2BJXA 2HRFA 3P2AA 4MZCA 5CRGA 5G5FA 3GNJA 3CWGA 2P31A 4FYBA 2YCDA 4DSQA 4MDCA 3GIXA 3TKSC 4HI7A 4RUVA 4KA0A 3W6GA 1PMTA 4WBRD 2C3TA 2AHEA 5G1LA 5JWOB 1RQMA 5BMUA 2OJLA 5IMZA 3L0HA 2IFQB 3DKSA 2B7JA 4DSSB 5HFIA 1PQNA 1TK8B 4F0CA 1GULA 1QUWA 2B5XA 5CAXA 2LRTA 6GSTA 5ECIB 4BL7A 1Y25A 1WJKA 4IJ3A 1ZL9A 1XW9A 4HU7A 3Q18A 4PQHA 4WR4A 3F4RA 2NTOA 1O6JA 2H0GA 4HS1A 1X9MB 1X0RA 3FW2A 4GCIA 2IMIA 2X8GA 1Q4JA 4OCEA 16GSA 3EMXA 1H4OA 3TJBA 1M2AA 2YWNA 3G7IA 2F51A 2K6VA 1MDKA 4MF5A 2A2PA 3DGQA 3DIEA 2WRTA 2M80A 2HSNB 1TXUA 2GT6A 1U3IA 1M7TA 3GTUB 4FXYP 4FQUA 5GZZB 4ID0A 2OA7A 2FUG2 2VOCA 4G2EA 4ZB8A 5B8AA 4O5UA 4ECJA 3C8EA 4IELA
chains in the Genus database with same CATH topology
1ABAA 3N9JA 1UN2A 1V57A 4Z7XA 2WS2A 2IMDA 2DJ2A 5A4VA 1QFNA 3UBLA 1QK8A 3P7XA 3F4TA 3M3MA 3P90A 2OADA 1YVLA 4TN8A 4Z2RA 4EXJA 3RAZA 2IIYA 1BAYA 13GSA 4TR4A 1JLVA 3KZQA 2H1LA 4K7OA 4V1Ap 4ZXGA 3SBCA 2R0PA 1X9SB 4MLYA 1THXA 1THOA 5A4WA 3BBYA 4K0NA 5D9XA 2UV8G 2V32A 4OFTA 4ECIA 5J47A 4MJAA 1Z3EA 3HA9A 5F8BA 1O8WA 5ECLB 1ZYPA 1DE1A 1R5PA 1TXXA 5H5RA 1BF5A 4EIPA 2CX3A 1U3AA 5ECKB 3LORA 1AXDA 4YQUA 4WF5A 1SVMA 4IW9A 2REMA 2JL4A 1SL0B 4ECCA 3PGTA 1OC9B 4YKFA 4XTSA 2V41A 4KSMA 2PERA 1E2YA 5HR3A 3Q74A 5IOXA 5E4WA 2OBKA 1RK4A 2RLIA 3VLNA 4G10A 5ELAA 5HQPA 5IOWA 4ZL8A 1YEXA 1EP7A 1YKAA 3CSJA 1SYXA 3F3RA 2V6OA 3GX0A 4ZILA 1G7OA 5KN0A 1AQXA 2OT3A 2PN8A 1Z7RA 2GSTA 4NHZA 4GSTA 2LNSA 4BPYA 3EMPA 2H73A 2ON5A 2FA4A 4AJ6A 3VPQA 1XOBA 3GL5A 5IM9A 4N3ZA 3LXZA 5D9TA 1FAAA 4EE0A 2K9FA 4V2MA 2VCTA 5J9BA 1ILOA 1GNWA 4WETA 3UOMA 1XIYA 1HD2A 3QPMA 4ZBBA 3VWVA 20GSA 2DIZA 1VF1A 4AGSA 2GSSA 2DJJA 1FVKA 2H19A 4TR0A 5IO0A 1OC3A 1XXUA 2HRAA 2QA1A 4JE1A 3KP8A 1AW9A 3FY7A 5KN1A 3UL3A 4BL7B 4CW9A 3ERWA 4O5QA 3KH7A 2XHFA 1TI3A 1IYHA 2DLXA 1F9MA 3DEXA 9GSSA 4NHWA 2G0FA 5HR0A 4FO5A 2VL9A 1TP9A 3IHQA 2IN3A 4RQRA 1LBKA 4EDYA 3IK7A 5DALA 4OO4A 1XFLA 1YJ6A 2TIRA 3C1RA 1BG1A 3ZIVA 1PL2A 4BWQA 2LTKA 3TKSE 1WWJA 4OCFA 2LQQA 3FYGA 2P0GA 4HEA2 1N2AA 4GQCA 5AIVA 7GSSA 5CO3A 4LMVA 4BVXA 3TUEA 3TGZA 1WP0A 1K0OA 2H1BA 1ZZYA 2AAWA 2HYXA 3HXSA 3VURA 2HSHA 3CRTA 5F05A 2PWJA 2LEGA 4QL9A 2YWIA 2WULA 3GMFA 5J4VA 3HVSA 4IP1A 4AKGA 3D21A 4NPBA 3TOUA 3IBHA 4PNGA 5A4UA 2GZZA 2MMNA 3U5RE 2TRCP 3CYNA 2V2GA 1GSYA 1GWCA 4IP6A 3F9UA 1FB0A 2CZ2A 1PN9A 2CA8A 1UC7A 2VD1A 3GKMA 2MMOA 4I5QA 4IVFA 4PQ1A 3KMNA 2B1KA 1G0TA 4BVYA 3LJRA 5GSTA 2L6DA 1SK0A 3HZ8A 2VAFA 4F82A 4K9ZA 1JFUA 3LQ7A 4XS1A 2N5FA 3DD3A 2IPAA 3I69A 3ISOA 1SK1A 3FZ9A 3R3EA 3C7MA 1XBSA 1NM3A 2JZSA 4KAEA 1TRUA 5D93A 4EIQA 4O92A 5ECHB 2WCIA 1FB6A 4N0ZA 4PGTA 1M2BA 4WF4A 4YAPA 4O7HA 2GGTA 5EY6A 4WEYA 2KHPA 1U87A 4I2TA 2R3XA 2M72A 2O87A 4I2UA 3IHGA 3WGXA 1GSDA 3WGEA 1EV9A 1TU7A 1LJRA 5FWGA 3DYRA 1XVWA 3F3QA 2C80A 5G2ZA 1EOHA 2NDOA 1YF0A 2LQOA 3FEUA 5J41A 2FNOA 2JSZA 4MABA 1A8LA 4AKHA 4Q5FA 4L5OA 4IBPA 3KIJA 5ECSA 3IXRA 1SL2B 1YKCA 4MF6A 1ST9A 2H01A 2DMLA 1PRXA 2AUVA 3F8UA 4XIHA 3FR3A 3KCMA 3KP9A 1TK0B 4ZL9A 1ACVA 3Q19A 1Z5YE 1I5GA 2YZUA 3I6AA 3DVXA 2N5BA 4AF2A 4GF0A 1FG4A 1J0FA 1TRWA 2GTUA 5DAKB 1KEBA 1XVQA 2FWGA 1MD4A 4IHUA 3LW9A 3GN3A 3M8NA 1DUGA 2GLRA 3D6IA 5IMAA 3GKXA 3MDKA 2C3QA 2YP6A 4PQIA 3ME8A 1QGVA 5A1NA 2HZFA 1J08A 3IPZA 3UMAA 5JCGA 2GZYA 2YNXA 1VF2A 3UARA 5G1KA 3KEBA 3LFLA 1WE0A 2RUFA 4JRRA 3ZFBA 1SD8A 4HQZA 3VWXA 2R37A 2QGVA 2VCZA 1GTUA 1TU8A 3VWUA 4TOPA 3F6DA 2B3SA 1PL1A 3U6VA 4LL4B 4NXIA 1TRSA 1WIKA 3HY2A 1K3LA 3D0ZA 3FZ4A 4TXVA 3CBUA 3VFIA 2B5EA 3I43A 3C73A 1T3BA 2YWOA 4KUNA 5AN1A 3TJJA 3BCKA 4HDEA 5IPGA 2B6MA 5CRDA 5DBQA 2B5YA 4MH2A 1F3AA 4YKGA 1GUHA 2H30A 2IJYA 5EL8A 2PU9C 2E2GA 2MMZA 1YF1A 2HQTA 3TRQA 1AQVA 3NZNA 1MTCA 2VCWA 1FO5A 3HKRA 1Z7PA 3US3A 2NVLA 3ZIJA 5GAPD 4FH8A 1DE2A 4KSOA 4YAVA 2KUCA 1WPIA 4TRXA 4BVYB 2X8CA 3IA1A 1YDKA 3E3EA 2MMAA 4ML1A 3ERGA 4KE3A 1QXHA 1G7EA 2H1GA 2HFDA 1SD9A 2EIRA 1JZWA 4F9ZA 4Z2UA 4JR6A 4GLTA 3HJOA 3EPTA 2F9SA 5IMDA 1T8EB 2YOIA 3GFKA 3FZ5A 3FK8A 3ME7A 5J3RA 1B48A 4WXTA 5ECQB 3F0IA 5CNWA 4F0BA 2IMEA 3GYKA 2C4JA 2PGTA 2EC4A 4KX4A 1K0BA 1N25A 2R5GA 1PKWA 1XWKA 1SENA 4G0LA 1PN0A 3TJKA 3IAS2 2GDRA 6GSWA 2YWMA 5C04A 4ML6A 2JZRA 4CHSA 1ERUA 3APOA 3FR6A 2LS5A 2DJ1A 5F0GA 6GSYA 1Q98A 2GVPA 5ECOB 2MZCA 1ZMAA 3VPTA 1AC1A 2YZHA 4PUAA 1GH2A 3APQA 2DC5A 2XPDA 4ACSA 4ZB7A 1XZOA 2DKHA 4QQ7A 2AYTA 5H5SA 1HNCA 2ZUPA 3ZRDA 2I3YA 2PVOC 2VLVA 1OE8A 3DVWA 4K5SA 4LL1B 4I97A 1GTBA 2BTOT 4HJMA 1TKDB 4QMKA 5D8IA 3WD6A 2WDUA 3CTGA 3GL3A 2C0EA 4E68A 2EIOA 5KN3A 4KF9A 4OD7A 1PX7A 3L78A 4ICYA 1C72A 2PUKC 6GSUA 3IC4A 1NSWA 1XOAA 1CQGA 3A2WA 1GTAA 1SJIA 3ZTLA 3ZITA 3IR4A 5CRHA 2VO4A 1GSUA 4NAXA 2V1MA 5A1NB 1SKSB 2XBIA 1JZRA 4ULXA 4MH3A 2C8UA 1ZYEA 2XBQA 4POMA 3M1GA 1VF3A 2O8VB 2WJUA 1SKRB 4FIWA 2Z9SA 3UBKA 1G6YA 1LU4A 4WBJA 4EUYA 5DQSA 1S3CA 1AQWA 2L5LA 3KH9A 2FLSA 5EPFA 3HVVA 2VLUA 1A8YA 4K5RA 3HCZA 2X99A 3MSZA 1FHEA 1TTZA 5H5QA 3TJGA 4X4JA 3A5WA 4PXOA 2XPEA 3LGCA 3Q6OA 4L0UA 3QOUA 4ZBAA 2HT9A 3DRNA 4P3YB 4TKYA 2K18A 1B9YC 1PA3A 5BMUB 5FHIA 4GSNA 5D9WA 1A2LA 4TR3A 2L4CA 2C1YA 4DSRA 2M46A 1OKTA 2YV7A 3IK9A 4AKXB 1J9BA 1T4YA 4KCAA 4LA1A 2GQMA 4KH7A 2JADA 4V2NA 1X5CA 2C0DA 5A5HA 3VK9A 4Q5QA 3UAPA 4HZ2A 3TU3B 2I1UA 1XWGA 11GSA 5J4YA 2DJ0A 5IQYA 2OBIA 2OE0A 3TRPA 1K0NA 4MCUA 4G0IA 18GSA 2HZEA 2WZ9A 1AUCA 3A2VA 4RQXA 2GT5A 4G9HA 2YJ7A 2NBSA 2PVQA 1EEMA 5GAND 2H1AA 2LV3A 5IMCA 2CVKA 2ES7A 1GNEA 3H93A 3K8NA 1V98A 2E7PA 4CDOA 2MYGA 2A4VA 1JHBA 4TVEA 6GSSA 5ABRA 3M9KA 5CRWA 3FR9A 3UEMA 2L5OA 5DVBA 2EFEA 2N5AA 2CVBA 2J9HA 3EVIA 2OKAA 4I6XA 3PINA 2QC7A 1R7HA 2CX4A 2YN1A 4POLA 3MAKA 3HJPA 2MBSA 1PSQA 4D73A 2YJHA 5GSSA 4AJ8A 3ED3A 4K2DA 1K0AA 3HYPA 2H76A 5KN2A 1U88A 1M9AA 4OO5A 3ZLPA 12GSA 4KW6A 5HR1A 1PGTA 1O8XA 1EZKA 4AJ7A 1Z6MA 2GS3A 1BEDA 3P8WA 4PURA 3AY8A 1EP8A 1T4ZA 4G01A 3ZVJA 2MBTA 3WGDA 4K7IA 2DIYA 3IAM2 2LJKA 5JWRB 3JCML 5CP1A 2LJRA 3W8JA 3D5JA 1O85A 4AI6A 4Q5NA 2BMXA 3ZFLA 3LWAA 2DJ3A 2LNTA 1BQ7A 4OWYA 3RPPA 3ZMLA 1JZOA 5CREA 1MDIA 1DBYA 4TXOA 2C3NA 1W4VA 2HNLA 1SL1B 2GSRA 3G7YA 5B7CA 2HXKA 3LYPA 1V58A 2J23A 4L5LA 3HZ4A 2I4AA 4N30A 1JLWA 4XS4A 3QD9A 2VL3A 1V2AA 5F06A 5LCZA 4GTUA 3QR6A 4EC0A 3GSTA 5G31A 1TI1A 2CT6A 3EYTA 3G7JA 3GSSA 3CRUA 8GSSA 1XWAA 1B8XA 2H6YA 3E0UA 3RHBA 2VCXA 1SJ6A 5A34A 3QFBC 2R4VA 4MPGA 1GP1A 2IL3A 2VKZG 3HJMA 2AJQB 2R2JA 5BRTA 5AIXA 1K3YA 1GSSA 1MD3A 1TOFA 4EL1A 3GUSA 5E59A 1JZDA 4IN0A 1EGRA 1YEPA 2RIIA 1R4WA 4BWSA 4K0GA 5IPHA 1VRSD 4KB3A 2FHEA 3EE2A 1KTEA 1Z9HA 1ERVA 4PX1A 4NV5A 1XW6A 1U6TA 2YPMA 1I9DA 1V9WA 2H8LA 2I9HA 3UVTA 5C00A 4JU5A 3V1WA 2VD0A 5AGYA 1A24A 1BJXA 3VI5A 5DALB 3WT1A 3UVHA 1A2JA 2E2MA 2FA8A 4MMMA 2CQ9A 4Q5RA 1GL8A 4HOJA 1CQHA 2FGXA 1EV4A 5D9VA 3DXBA 2QSIA 5B6MA 4JZQA 4EDZA 4BVXB 4OMVA 2CZ3A 3ZZXA 2ZNMA 4DVCA 4MZBA 4IQAA 4DEJA 2O85A 4X1UA 1F2EA 2CV4A 2P5QA 2VCQA 3BD2A 2HLSA 1OVNA 3F4SA 4MA9A 3ERFA 4X43A 3TKPA 1GLPA 3GURA 2C0FA 2F8FA 4GWRA 1YQ1A 4N10A 3KMOA 2V6KA 1GTIA 4WKWA 1ERTA 2NPBA 4ZIJA 2GSQA 4EVMA 4YQVA 3KM6A 3IDVA 1VF4A 5G5EA 3CTFA 3IOSA 4ILFA 4V1Ag 1Y1UA 2HRKA 1FVJA 1BX9A 2R0GA 2O89A 1SU9A 1OAZA 1W89A 2ON7A 2X64A 4D73B 4K2XA 4EF0A 4H86A 4HUAA 4O5RA 5ECPB 3IRAA 4I8BA 2OACA 3APSA 1SVOA 3HD5A 5ECRB 5KEJA 2H70A 3G9BA 4ZB6A 1YY7A 3D4MA 1EGOA 2D2ZA 2H74A 1A0FA 3EU3A 2H1DA 1NHYA 2VCVA 5J9CA 5DQYA 1K0CA 1XCCA 2A2RA 4JBBA 5B6NA 4LLRA 2OE1A 4F2IA 2AV4A 4RI7A 3H79A 4ISDA 2DKIA 2FWHA 1HQOA 3QAGA 1GSEA 1WOUA 3QFAC 2FY6A 5EVOA 4HZ4A 3RBTA 3LEFA 3L9SA 3C71A 5A5KA 5INYA 2K8VA 5L71A 1UA5A 4XHMA 2JU5A 4GXZA 2TRXA 2H71A 3MIXA 1OE7A 1R5AA 5ID2A 2YV9A 4N11A 3ZVJD 4E8EA 3QCPA 4TXOB 3H4KA 3TKRA 3QAVA 3CSIA 1SYRA 2WGRA 4IKHA 2B7KA 2H75A 2LJAA 1A0RP 4G19A 3CMIA 1HNBA 1B4PA 3D4TA 4XS4B 2H6XA 1Z6NA 3S9FA 1BYEA 1M0UA 1ZYNA 4JEDA 1M2DA 2YANA 4RI6A 1ON4A 1R26A 1EWXA 4CY6A 2H0HA 3A3TA 2KP2A 2R6KA 1PD21 5J5NA 4POKA 3M0FA 5DJMA 2JSYA 5D96A 3W8SA 3GKNA 4IQ1A 2ZCTA 1QQ2A 3BOAA 5LD0A 4EKZA 5A34B 2R0CA 2JACA 1B4QA 1ZGNA 2HE3A 3OR5A 4EO3A 2EFHA 14GSA 4X0XA 4TW5A 1E6BA 1X5DA 3RHCA 3LYKA 3KTLA 5LNKe 2WB9A 1URMA 1OYJA 2A4HA 1RW1A 3F6FA 1PKZA 3TJFA 4XS6A 4K7NA 5F07A 1PX6A 2X8HA 1F3BA 3EWLA 4GRFA 1ZOFA 3LXTA 1GSQA 3TRXA 3L4NA 4KDUA 2F3MA 5IMVA 2X49A 4E8HA 2KP1A 3GA4A 4JR4A 3MNGA 3N5OA 5D73A 1QMVA 5ECMB 3RPNA 4QL7A 4V2LA 2CVDA 2K8SA 3FRCA 2HSMA 4MF7A 3QDNA 1F37A 5G30A 3MWHA 4K6XA 3TKQA 2L4QA 4PUFC 3FMWA 3C1SA 4HQSA 3F63A 2F8AA 2DBCA 1MEKA 5ENUA 3KXOA 4GQFA 4ZL7A 4NMUA 2H72A 4USSA 4OFMA 3HVXA 3PPUA 5IMFA 3UJ1A 2VM2A 2C0GA 5ECNB 4POBA 5DAKA 4Z2TA 3TDGA 4XRDA 2FCHA 3DMLA 4AKIA 3RDWA 3I9V2 4FYUA 3CXGA 3HMJG 6GSVA 2PPTA 2IWTA 5HR2A 1GUKA 5AISA 2RM5A 2HRKB 10GSA 2IMFA 2VL2A 1X9WB 2PBJA 2JZTA 3ZREA 4XCSA 3EINA 1K3OA 2FWFA 2LUSA 4IS0A 2H66A 5HFKA 4L0WA 3A5IA 4NWYA 4XRAA 4LMWA 1A23A 5J40A 2LRNA 2EFDA 4MPFA 5DDLA 3KGKA 5KOWA 3IC8A 2L59A 1K0MA 2A2SA 2VUPA 1DSBA 4PNFA 3KD0A 2AB6A 3VI7A 1GRXA 4TR1A 3QAWA 4J57E 2L6CA 3WT2A 1FOVA 3EU4A 1M99A 4A5PA 4HU9A 4MP4A 5JCWA 3LG6A 3H1NA 3UIWA 2HSYA 3J7Yk 2RM6A 3TKSA 1YZXA 1ZCPA 1AIUA 3KTBA 4G0KA 2GQLA 1K0DA 4FYCA 3ZMKA 5COHA 2EFCA 2IFQA 1HNAA 2CAIA 1ML6A 3O3TA 1USBA 4DSSA 5ID2B 5JWQB 5IO2A 1Y6EA 3PH9A 4BA7A 1IYIA 3L9VA 1O73A 4O32A 17GSA 1NW2A 3TOTA 5KOXA 1M9BA 2EIQA 4KGIA 3FZAA 1GLQA 2L57A 5FT3A 4HJ2A 2HRNA 3QMXA 2FWEA 6GSXA 1V40A 1TRVA 4YQMA 1A2MA 1OC8A 3O76A 3LSZA 4MJEA 1VGLA 2UZ8A 1B9XC 3GH9A 3BCIA 4K8MA 3CSHA 1TDIA 1GUMA 1N8JA 1TK5B 3PR8A 2KLXA 2DJKA 2PMTA 2P5RA 2I81A 1G6WA 2VM1A 3DWVA 3SWLA 2LRCA 1O7UA 3HHVA 3GX8A 4KCEA 2O7KA 1XWCA 4GDFA 2HSNA 2HI7A 4MNNA 1S3AA 1O81A 2XC2A 4IGJA 3FKFA 2ALBA 3GTUA 2LSTA 1S3DA 2GQKA 1GSFA 2H0IA 4ECBA 4PTSA 2WFCA 3EC3A 4KDXA 1H75A 3GKKA 3GV1A 4W66A 1FW1A 22GSA 5HFGA 2OE3A 5IIZA 4K1FA 5B8BA 1FOHA 2E0QA 4ZBDA 1X5EA 4F03A 4MK3A 1F6MC 1T1VA 2VIMA 1WRYA 1ZYQB 4J56E 19GSA 4KDYA 2H6ZA 2QA2A 3GRXA 3ZL5A 3EURA 2RUEA 5DJLA 3TB2A 1SKWB 2HSMB 3HDCA 2LKUA 2QKEA 3J7Yb 4L8EA 5J4UA 1NHOA 2CAQA 3L9UA 2DSAA 1WMJA 1BG5A 2X4AA 3M9JA 4J2FA 1UVZA 1MDJA 4KNDA 1AAZA 2DMMA 1EEJA 3E9JB 1TJDA 5JCUA 3GHAA 4N0VA 3GH6A 4MJBA 4MJCA 1KNGA 3IV4A 1SVLA 2VLTA 4GSSA 3TCOA 5DCHA 4IJIA 1TW9A 1OC9A 4WR5A 2KOKA 2O5VA 2VL2C 4OFNA 1T00A 2GZPA 1SK2A 3R2QA 5A5HB 3IE3A 5DCGA 1T7PB 3NOFA 1XW5A 1OKDA 3H8QA 4CY8A 3ZYWA 1HYUA 5ELGA 1EOGA 3BJ5A 3A2XA 1ERWA 1XWBA 3FHKA 2HZEB 4YH2A 2FD3A 3KJYA 3O6TA 3D22A 2IMKA 4ZB9A 4NV2A 1SJZA 2G2QA 3MYDA 3VWWA 4TR1B 3NIVA 2B1LA 3WYWA 5CYYA 1XPVA 1KBNA 4MZWA 2BJXA 2HRFA 3P2AA 4MZCA 5CRGA 5G5FA 3GNJA 3CWGA 2P31A 4FYBA 2YCDA 4DSQA 4MDCA 3GIXA 3TKSC 4HI7A 4RUVA 4KA0A 3W6GA 1PMTA 4WBRD 2C3TA 2AHEA 5G1LA 5JWOB 1RQMA 5BMUA 2OJLA 5IMZA 3L0HA 2IFQB 3DKSA 2B7JA 4DSSB 5HFIA 1PQNA 1TK8B 4F0CA 1GULA 1QUWA 2B5XA 5CAXA 2LRTA 6GSTA 5ECIB 4BL7A 1Y25A 1WJKA 4IJ3A 1ZL9A 1XW9A 4HU7A 3Q18A 4PQHA 4WR4A 3F4RA 2NTOA 1O6JA 2H0GA 4HS1A 1X9MB 1X0RA 3FW2A 4GCIA 2IMIA 2X8GA 1Q4JA 4OCEA 16GSA 3EMXA 1H4OA 3TJBA 1M2AA 2YWNA 3G7IA 2F51A 2K6VA 1MDKA 4MF5A 2A2PA 3DGQA 3DIEA 2WRTA 2M80A 2HSNB 1TXUA 2GT6A 1U3IA 1M7TA 3GTUB 4FQUA 5GZZB 4ID0A 2OA7A 2FUG2 2VOCA 4G2EA 4ZB8A 5B8AA 4O5UA 4ECJA 3C8EA 4IELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ABA A;  3N9J A;  1UN2 A;  1V57 A;  4Z7X A;  2WS2 A;  2IMD A;  2DJ2 A;  5A4V A;  1QFN A;  3UBL A;  1QK8 A;  3P7X A;  3F4T A;  3M3M A;  3P90 A;  2OAD A;  4TN8 A;  4EXJ A;  3RAZ A;  2IIY A;  1BAY A;  13GS A;  4TR4 A;  1JLV A;  3KZQ A;  4K7O A;  4V1A p;  4ZXG A;  3SBC A;  1X9S B;  4MLY A;  1THX A;  1THO A;  5A4W A;  3BBY A;  4K0N A;  5D9X A;  2V32 A;  4OFT A;  4ECI A;  4MJA A;  1Z3E A;  3HA9 A;  5F8B A;  1O8W A;  5ECL B;  1DE1 A;  1R5P A;  1TXX A;  5H5R A;  2CX3 A;  1U3A A;  5ECK B;  3LOR A;  1AXD A;  4YQU A;  4WF5 A;  4IW9 A;  2REM A;  2JL4 A;  1SL0 B;  4ECC A;  3PGT A;  1OC9 B;  4XTS A;  2V41 A;  4KSM A;  2PER A;  1E2Y A;  5HR3 A;  3Q74 A;  5IOX A;  5E4W A;  2OBK A;  1RK4 A;  2RLI A;  3VLN A;  4G10 A;  5ELA A;  5HQP A;  5IOW A;  4ZL8 A;  1YEX A;  1EP7 A;  1YKA A;  3CSJ A;  1SYX A;  3F3R A;  2V6O A;  3GX0 A;  4ZIL A;  1G7O A;  5KN0 A;  1AQX A;  2PN8 A;  1Z7R A;  2GST A;  4NHZ A;  4GST A;  2LNS A;  4BPY A;  3EMP A;  2H73 A;  2ON5 A;  2FA4 A;  4AJ6 A;  3VPQ A;  1XOB A;  3GL5 A;  5IM9 A;  5D9T A;  3LXZ A;  1FAA A;  4EE0 A;  2K9F A;  4V2M A;  2VCT A;  5J9B A;  1ILO A;  1GNW A;  4WET A;  3UOM A;  1XIY A;  1HD2 A;  3QPM A;  4ZBB A;  3VWV A;  20GS A;  2DIZ A;  1VF1 A;  4AGS A;  2GSS A;  2DJJ A;  1FVK A;  2H19 A;  4TR0 A;  5IO0 A;  1OC3 A;  1XXU A;  2HRA A;  4JE1 A;  3KP8 A;  1AW9 A;  3FY7 A;  5KN1 A;  3UL3 A;  4BL7 B;  4CW9 A;  3ERW A;  3KH7 A;  2XHF A;  1TI3 A;  1IYH A;  2DLX A;  1F9M A;  3DEX A;  9GSS A;  4NHW A;  2G0F A;  5HR0 A;  4FO5 A;  2VL9 A;  1TP9 A;  3IHQ A;  2IN3 A;  4RQR A;  1LBK A;  4EDY A;  3IK7 A;  5DAL A;  4OO4 A;  1XFL A;  1YJ6 A;  2TIR A;  3C1R A;  3ZIV A;  1PL2 A;  4BWQ A;  2LTK A;  3TKS E;  1WWJ A;  4OCF A;  2LQQ A;  3FYG A;  2P0G A;  4HEA 2;  1N2A A;  4GQC A;  5AIV A;  7GSS A;  5CO3 A;  4LMV A;  4BVX A;  3TUE A;  3TGZ A;  1WP0 A;  1K0O A;  2H1B A;  1ZZY A;  2AAW A;  2HYX A;  3HXS A;  3VUR A;  2HSH A;  3CRT A;  5F05 A;  2PWJ A;  2LEG A;  4QL9 A;  2YWI A;  2WUL A;  3GMF A;  3HVS A;  4IP1 A;  3D21 A;  4NPB A;  3TOU A;  3IBH A;  4PNG A;  5A4U A;  2GZZ A;  2MMN A;  3U5R E;  2TRC P;  3CYN A;  2V2G A;  1GSY A;  1GWC A;  4IP6 A;  3F9U A;  1FB0 A;  2CZ2 A;  1PN9 A;  2CA8 A;  1UC7 A;  2VD1 A;  3GKM A;  2MMO A;  4I5Q A;  4IVF A;  4PQ1 A;  3KMN A;  2B1K A;  1G0T A;  4BVY A;  3LJR A;  5GST A;  2L6D A;  1SK0 A;  3HZ8 A;  2VAF A;  4F82 A;  4K9Z A;  1JFU A;  3LQ7 A;  4XS1 A;  2N5F A;  3DD3 A;  2IPA A;  3I69 A;  3ISO A;  1SK1 A;  3FZ9 A;  3R3E A;  3C7M A;  1XBS A;  1NM3 A;  2JZS A;  4KAE A;  1TRU A;  5D93 A;  4O92 A;  5ECH B;  2WCI A;  1FB6 A;  4N0Z A;  4PGT A;  1M2B A;  4WF4 A;  4YAP A;  4O7H A;  2GGT A;  5EY6 A;  4WEY A;  2KHP A;  1U87 A;  4I2T A;  2R3X A;  2M72 A;  2O87 A;  4I2U A;  3WGX A;  1GSD A;  3WGE A;  1EV9 A;  1TU7 A;  1LJR A;  5FWG A;  3DYR A;  1XVW A;  3F3Q A;  2C80 A;  5G2Z A;  1EOH A;  2NDO A;  1YF0 A;  2LQO A;  3FEU A;  5J41 A;  2FNO A;  2JSZ A;  4MAB A;  1A8L A;  4Q5F A;  4L5O A;  4IBP A;  3KIJ A;  5ECS A;  3IXR A;  1SL2 B;  1YKC A;  4MF6 A;  1ST9 A;  2H01 A;  2DML A;  1PRX A;  2AUV A;  3F8U A;  4XIH A;  3FR3 A;  3KCM A;  3KP9 A;  1TK0 B;  4ZL9 A;  1ACV A;  3Q19 A;  1Z5Y E;  1I5G A;  2YZU A;  3I6A A;  3DVX A;  2N5B A;  4AF2 A;  4GF0 A;  1FG4 A;  1J0F A;  1TRW A;  2GTU A;  5DAK B;  1KEB A;  1XVQ A;  2FWG A;  1MD4 A;  4IHU A;  3GN3 A;  3M8N A;  1DUG A;  2GLR A;  3D6I A;  5IMA A;  3GKX A;  3MDK A;  2C3Q A;  2YP6 A;  4PQI A;  3ME8 A;  1QGV A;  2HZF A;  3IPZ A;  1J08 A;  3UMA A;  5JCG A;  2GZY A;  2YNX A;  1VF2 A;  3UAR A;  5G1K A;  3KEB A;  3LFL A;  1WE0 A;  2RUF A;  4JRR A;  3ZFB A;  1SD8 A;  4HQZ A;  3VWX A;  2R37 A;  2QGV A;  2VCZ A;  1GTU A;  1TU8 A;  3VWU A;  4TOP A;  3F6D A;  2B3S A;  1PL1 A;  3U6V A;  4LL4 B;  4NXI A;  1TRS A;  1WIK A;  3HY2 A;  1K3L A;  3D0Z A;  3FZ4 A;  4TXV A;  3CBU A;  3VFI A;  2B5E A;  3I43 A;  3C73 A;  1T3B A;  2YWO A;  4KUN A;  5AN1 A;  3TJJ A;  3BCK A;  4HDE A;  5IPG A;  2B6M A;  5CRD A;  5DBQ A;  2B5Y A;  4MH2 A;  1F3A A;  1GUH A;  2H30 A;  2IJY A;  5EL8 A;  2PU9 C;  2E2G A;  2MMZ A;  1YF1 A;  2HQT A;  3TRQ A;  1AQV A;  3NZN A;  1MTC A;  2VCW A;  1FO5 A;  3HKR A;  1Z7P A;  3US3 A;  2NVL A;  3ZIJ A;  5GAP D;  4FH8 A;  1DE2 A;  4KSO A;  4YAV A;  2KUC A;  1WPI A;  4TRX A;  4BVY B;  2X8C A;  3IA1 A;  1YDK A;  3E3E A;  2MMA A;  4ML1 A;  3ERG A;  4KE3 A;  1QXH A;  1G7E A;  2H1G A;  2HFD A;  1SD9 A;  2EIR A;  1JZW A;  4F9Z A;  4JR6 A;  4GLT A;  3HJO A;  2F9S A;  5IMD A;  1T8E B;  2YOI A;  3GFK A;  3FZ5 A;  3FK8 A;  3ME7 A;  5J3R A;  1B48 A;  4WXT A;  5ECQ B;  3F0I A;  5CNW A;  4F0B A;  2IME A;  3GYK A;  2C4J A;  2PGT A;  2EC4 A;  4KX4 A;  1K0B A;  2R5G A;  1PKW A;  1XWK A;  1SEN A;  4G0L A;  3TJK A;  3IAS 2;  2GDR A;  6GSW A;  2YWM A;  5C04 A;  4ML6 A;  2JZR A;  4CHS A;  1ERU A;  3APO A;  3FR6 A;  2LS5 A;  2DJ1 A;  5F0G A;  6GSY A;  1Q98 A;  2GVP A;  5ECO B;  2MZC A;  1ZMA A;  3VPT A;  1AC1 A;  2YZH A;  4PUA A;  1GH2 A;  3APQ A;  2DC5 A;  2XPD A;  4ACS A;  1XZO A;  4QQ7 A;  2AYT A;  5H5S A;  1HNC A;  2ZUP A;  3ZRD A;  2I3Y A;  2PVO C;  2VLV A;  1OE8 A;  3DVW A;  4LL1 B;  4I97 A;  1GTB A;  2BTO T;  4HJM A;  1TKD B;  5D8I A;  3WD6 A;  2WDU A;  3CTG A;  3GL3 A;  2C0E A;  2EIO A;  5KN3 A;  4KF9 A;  4OD7 A;  1PX7 A;  3L78 A;  1C72 A;  2PUK C;  6GSU A;  3IC4 A;  1NSW A;  1XOA A;  1CQG A;  3A2W A;  1GTA A;  1SJI A;  3ZTL A;  3ZIT A;  3IR4 A;  5CRH A;  2VO4 A;  1GSU A;  4NAX A;  2V1M A;  1SKS B;  2XBI A;  1JZR A;  4ULX A;  4MH3 A;  2C8U A;  1ZYE A;  2XBQ A;  4POM A;  3M1G A;  1VF3 A;  2O8V B;  2WJU A;  1SKR B;  4FIW A;  2Z9S A;  3UBK A;  1G6Y A;  1LU4 A;  4WBJ A;  4EUY A;  5DQS A;  1S3C A;  1AQW A;  2L5L A;  3KH9 A;  2FLS A;  5EPF A;  3HVV A;  2VLU A;  1A8Y A;  3HCZ A;  2X99 A;  3MSZ A;  1FHE A;  1TTZ A;  5H5Q A;  3TJG A;  3A5W A;  4PXO A;  2XPE A;  3LGC A;  3Q6O A;  4L0U A;  3QOU A;  4ZBA A;  2HT9 A;  3DRN A;  4P3Y B;  4TKY A;  2K18 A;  1B9Y C;  1PA3 A;  5FHI A;  4GSN A;  5D9W A;  1A2L A;  4TR3 A;  2L4C A;  2C1Y A;  4DSR A;  2M46 A;  1OKT A;  2YV7 A;  3IK9 A;  1J9B A;  1T4Y A;  4KCA A;  4LA1 A;  2GQM A;  4KH7 A;  2JAD A;  4V2N A;  1X5C A;  2C0D A;  3VK9 A;  4Q5Q A;  3UAP A;  4HZ2 A;  2I1U A;  1XWG A;  11GS A;  2DJ0 A;  5IQY A;  2OBI A;  2OE0 A;  3TRP A;  1K0N A;  4MCU A;  4G0I A;  18GS A;  2HZE A;  2WZ9 A;  1AUC A;  3A2V A;  4RQX A;  2GT5 A;  4G9H A;  2YJ7 A;  2NBS A;  2PVQ A;  1EEM A;  5GAN D;  2H1A A;  2LV3 A;  5IMC A;  2CVK A;  2ES7 A;  1GNE A;  3H93 A;  3K8N A;  1V98 A;  2E7P A;  4CDO A;  2MYG A;  2A4V A;  1JHB A;  4TVE A;  6GSS A;  5ABR A;  3M9K A;  5CRW A;  3FR9 A;  3UEM A;  2L5O A;  5DVB A;  2N5A A;  2CVB A;  2J9H A;  3EVI A;  2OKA A;  4I6X A;  3PIN A;  2QC7 A;  1R7H A;  2CX4 A;  2YN1 A;  4POL A;  3MAK A;  3HJP A;  2MBS A;  1PSQ A;  4D73 A;  2YJH A;  5GSS A;  4AJ8 A;  3ED3 A;  4K2D A;  1K0A A;  3HYP A;  2H76 A;  5KN2 A;  1U88 A;  1M9A A;  4OO5 A;  3ZLP A;  12GS A;  4KW6 A;  5HR1 A;  1PGT A;  1O8X A;  1EZK A;  4AJ7 A;  1Z6M A;  2GS3 A;  1BED A;  3P8W A;  4PUR A;  3AY8 A;  1EP8 A;  1T4Z A;  3ZVJ A;  2MBT A;  3WGD A;  4K7I A;  2DIY A;  3IAM 2;  2LJK A;  5JWR B;  3JCM L;  5CP1 A;  2LJR A;  3W8J A;  3D5J A;  1O85 A;  4Q5N A;  2BMX A;  3ZFL A;  3LWA A;  2DJ3 A;  2LNT A;  1BQ7 A;  4OWY A;  3RPP A;  3ZML A;  1JZO A;  5CRE A;  1MDI A;  1DBY A;  4TXO A;  2C3N A;  1W4V A;  2HNL A;  1SL1 B;  2GSR A;  3G7Y A;  5B7C A;  2HXK A;  3LYP A;  1V58 A;  2J23 A;  4L5L A;  3HZ4 A;  2I4A A;  4N30 A;  1JLW A;  4XS4 A;  3QD9 A;  2VL3 A;  1V2A A;  5F06 A;  5LCZ A;  4GTU A;  3QR6 A;  4EC0 A;  3GST A;  5G31 A;  1TI1 A;  2CT6 A;  3EYT A;  3G7J A;  3GSS A;  3CRU A;  8GSS A;  1XWA A;  1B8X A;  2H6Y A;  3E0U A;  3RHB A;  2VCX A;  1SJ6 A;  3QFB C;  2R4V A;  4MPG A;  1GP1 A;  2IL3 A;  3HJM A;  2AJQ B;  2R2J A;  5AIX A;  1K3Y A;  1GSS A;  1MD3 A;  1TOF A;  4EL1 A;  3GUS A;  5E59 A;  1JZD A;  4IN0 A;  1EGR A;  1YEP A;  2RII A;  1R4W A;  4BWS A;  4K0G A;  5IPH A;  1VRS D;  4KB3 A;  2FHE A;  3EE2 A;  1KTE A;  1Z9H A;  1ERV A;  4PX1 A;  4NV5 A;  1XW6 A;  1U6T A;  2YPM A;  1I9D A;  1V9W A;  2H8L A;  2I9H A;  3UVT A;  5C00 A;  4JU5 A;  3V1W A;  2VD0 A;  5AGY A;  1A24 A;  1BJX A;  3VI5 A;  5DAL B;  3WT1 A;  3UVH A;  1A2J A;  2E2M A;  2FA8 A;  4MMM A;  2CQ9 A;  4Q5R A;  1GL8 A;  4HOJ A;  1CQH A;  2FGX A;  1EV4 A;  5D9V A;  3DXB A;  2QSI A;  5B6M A;  4JZQ A;  4EDZ A;  4BVX B;  4OMV A;  2CZ3 A;  3ZZX A;  2ZNM A;  4DVC A;  4MZB A;  4IQA A;  4DEJ A;  2O85 A;  4X1U A;  1F2E A;  2CV4 A;  2P5Q A;  2VCQ A;  3BD2 A;  2HLS A;  1OVN A;  3F4S A;  4MA9 A;  3ERF A;  4X43 A;  3TKP A;  1GLP A;  3GUR A;  2C0F A;  2F8F A;  4GWR A;  1YQ1 A;  4N10 A;  3KMO A;  2V6K A;  1GTI A;  4WKW A;  1ERT A;  2NPB A;  4ZIJ A;  2GSQ A;  4EVM A;  4YQV A;  3KM6 A;  1VF4 A;  3IDV A;  5G5E A;  3CTF A;  3IOS A;  4ILF A;  4V1A g;  2HRK A;  1FVJ A;  1BX9 A;  2O89 A;  1SU9 A;  1OAZ A;  1W89 A;  2ON7 A;  2X64 A;  4D73 B;  4EF0 A;  4H86 A;  4HUA A;  4O5R A;  5ECP B;  3IRA A;  4I8B A;  2OAC A;  3APS A;  3HD5 A;  5ECR B;  5KEJ A;  2H70 A;  3G9B A;  4ZB6 A;  1YY7 A;  3D4M A;  1EGO A;  2D2Z A;  2H74 A;  1A0F A;  3EU3 A;  2H1D A;  1NHY A;  2VCV A;  5J9C A;  5DQY A;  1K0C A;  1XCC A;  2A2R A;  4JBB A;  5B6N A;  4LLR A;  2OE1 A;  4F2I A;  2AV4 A;  4RI7 A;  3H79 A;  4ISD A;  2FWH A;  1HQO A;  3QAG A;  1GSE A;  1WOU A;  3QFA C;  2FY6 A;  5EVO A;  4HZ4 A;  3RBT A;  3LEF A;  3L9S A;  3C71 A;  5A5K A;  5INY A;  2K8V A;  5L71 A;  1UA5 A;  4XHM A;  2JU5 A;  4GXZ A;  2TRX A;  2H71 A;  1OE7 A;  1R5A A;  5ID2 A;  2YV9 A;  4N11 A;  3ZVJ D;  4E8E A;  3QCP A;  4TXO B;  3H4K A;  3TKR A;  3QAV A;  3CSI A;  1SYR A;  2WGR A;  4IKH A;  2B7K A;  2H75 A;  2LJA A;  1A0R P;  4G19 A;  3CMI A;  1HNB A;  1B4P A;  3D4T A;  4XS4 B;  2H6X A;  1Z6N A;  3S9F A;  1BYE A;  1M0U A;  4JED A;  1M2D A;  2YAN A;  4RI6 A;  1ON4 A;  1R26 A;  1EWX A;  2H0H A;  3A3T A;  2KP2 A;  2R6K A;  1PD2 1;  5J5N A;  4POK A;  3M0F A;  5DJM A;  2JSY A;  5D96 A;  3W8S A;  3GKN A;  4IQ1 A;  2ZCT A;  1QQ2 A;  3BOA A;  5LD0 A;  4EKZ A;  2JAC A;  1B4Q A;  1ZGN A;  2HE3 A;  3OR5 A;  4EO3 A;  14GS A;  4X0X A;  4TW5 A;  1E6B A;  1X5D A;  3RHC A;  3LYK A;  3KTL A;  5LNK e;  2WB9 A;  1URM A;  1OYJ A;  1RW1 A;  3F6F A;  1PKZ A;  3TJF A;  4XS6 A;  4K7N A;  5F07 A;  1PX6 A;  2X8H A;  1F3B A;  3EWL A;  4GRF A;  1ZOF A;  3LXT A;  1GSQ A;  3TRX A;  3L4N A;  4KDU A;  2F3M A;  5IMV A;  4E8H A;  2KP1 A;  3GA4 A;  4JR4 A;  3MNG A;  3N5O A;  5D73 A;  1QMV A;  5ECM B;  3RPN A;  4QL7 A;  4V2L A;  2CVD A;  2K8S A;  3FRC A;  2HSM A;  4MF7 A;  3QDN A;  1F37 A;  5G30 A;  3MWH A;  4K6X A;  3TKQ A;  2L4Q A;  4PUF C;  3C1S A;  4HQS A;  3F63 A;  2F8A A;  2DBC A;  1MEK A;  5ENU A;  3KXO A;  4GQF A;  4ZL7 A;  4NMU A;  2H72 A;  4USS A;  4OFM A;  3HVX A;  3PPU A;  5IMF A;  3UJ1 A;  2VM2 A;  2C0G A;  5ECN B;  4POB A;  5DAK A;  3TDG A;  4XRD A;  2FCH A;  3DML A;  3RDW A;  3I9V 2;  4FYU A;  3CXG A;  6GSV A;  2PPT A;  2IWT A;  5HR2 A;  1GUK A;  5AIS A;  2RM5 A;  2HRK B;  10GS A;  2IMF A;  2VL2 A;  1X9W B;  2PBJ A;  2JZT A;  3ZRE A;  4XCS A;  3EIN A;  1K3O A;  2FWF A;  2LUS A;  4IS0 A;  2H66 A;  5HFK A;  4L0W A;  4NWY A;  4XRA A;  4LMW A;  1A23 A;  2LRN A;  4MPF A;  5DDL A;  3KGK A;  3IC8 A;  2L59 A;  1K0M A;  2A2S A;  2VUP A;  1DSB A;  4PNF A;  3KD0 A;  2AB6 A;  3VI7 A;  1GRX A;  4TR1 A;  3QAW A;  4J57 E;  2L6C A;  3WT2 A;  1FOV A;  3EU4 A;  1M99 A;  4HU9 A;  4MP4 A;  5JCW A;  3LG6 A;  3H1N A;  3UIW A;  2HSY A;  3J7Y k;  2RM6 A;  3TKS A;  1YZX A;  1ZCP A;  1AIU A;  3KTB A;  4G0K A;  2GQL A;  1K0D A;  4FYC A;  3ZMK A;  5COH A;  2IFQ A;  1HNA A;  2CAI A;  1ML6 A;  3O3T A;  1USB A;  4DSS A;  5ID2 B;  5JWQ B;  5IO2 A;  1Y6E A;  3PH9 A;  4BA7 A;  1IYI A;  3L9V A;  1O73 A;  4O32 A;  17GS A;  1NW2 A;  3TOT A;  1M9B A;  2EIQ A;  4KGI A;  3FZA A;  1GLQ A;  2L57 A;  5FT3 A;  4HJ2 A;  2HRN A;  3QMX A;  2FWE A;  6GSX A;  1V40 A;  1TRV A;  4YQM A;  1A2M A;  1OC8 A;  3O76 A;  3LSZ A;  4MJE A;  1VGL A;  2UZ8 A;  1B9X C;  3GH9 A;  3BCI A;  4K8M A;  3CSH A;  1TDI A;  1GUM A;  1N8J A;  1TK5 B;  3PR8 A;  2KLX A;  2DJK A;  2PMT A;  2P5R A;  2I81 A;  1G6W A;  2VM1 A;  3DWV A;  3SWL A;  2LRC A;  1O7U A;  3HHV A;  3GX8 A;  4KCE A;  2O7K A;  1XWC A;  2HI7 A;  1S3A A;  1O81 A;  2XC2 A;  4IGJ A;  3FKF A;  2ALB A;  3GTU A;  2LST A;  1S3D A;  2GQK A;  1GSF A;  2H0I A;  4ECB A;  4PTS A;  2WFC A;  3EC3 A;  4KDX A;  1H75 A;  3GKK A;  3GV1 A;  1FW1 A;  22GS A;  5HFG A;  2OE3 A;  5IIZ A;  4K1F A;  5B8B A;  2E0Q A;  4ZBD A;  1X5E A;  4F03 A;  4MK3 A;  1F6M C;  1T1V A;  2VIM A;  1WRY A;  1ZYQ B;  4J56 E;  19GS A;  4KDY A;  2H6Z A;  3GRX A;  3ZL5 A;  3EUR A;  2RUE A;  5DJL A;  3TB2 A;  1SKW B;  2HSM B;  3HDC A;  2LKU A;  2QKE A;  3J7Y b;  4L8E A;  5J4U A;  1NHO A;  2CAQ A;  3L9U A;  2DSA A;  1WMJ A;  1BG5 A;  3M9J A;  4J2F A;  1UVZ A;  1MDJ A;  4KND A;  1AAZ A;  2DMM A;  1EEJ A;  3E9J B;  1TJD A;  5JCU A;  3GHA A;  4N0V A;  3GH6 A;  4MJB A;  4MJC A;  1KNG A;  3IV4 A;  2VLT A;  4GSS A;  3TCO A;  5DCH A;  4IJI A;  1TW9 A;  1OC9 A;  4WR5 A;  2KOK A;  2VL2 C;  4OFN A;  1T00 A;  2GZP A;  1SK2 A;  3R2Q A;  3IE3 A;  5DCG A;  1T7P B;  3NOF A;  1XW5 A;  1OKD A;  3H8Q A;  3ZYW A;  1HYU A;  5ELG A;  1EOG A;  3BJ5 A;  3A2X A;  1ERW A;  1XWB A;  3FHK A;  2HZE B;  4YH2 A;  2FD3 A;  3KJY A;  3O6T A;  3D22 A;  2IMK A;  4ZB9 A;  4NV2 A;  1SJZ A;  2G2Q A;  3VWW A;  4TR1 B;  3NIV A;  2B1L A;  3WYW A;  5CYY A;  1XPV A;  1KBN A;  4MZW A;  2BJX A;  2HRF A;  3P2A A;  4MZC A;  5CRG A;  5G5F A;  3GNJ A;  2P31 A;  4FYB A;  2YCD A;  4DSQ A;  4MDC A;  3GIX A;  3TKS C;  4HI7 A;  4RUV A;  4KA0 A;  3W6G A;  1PMT A;  4WBR D;  2C3T A;  2AHE A;  5G1L A;  5JWO B;  1RQM A;  5BMU A;  2OJL A;  5IMZ A;  3L0H A;  2IFQ B;  3DKS A;  2B7J A;  4DSS B;  5HFI A;  1PQN A;  1TK8 B;  4F0C A;  1GUL A;  1QUW A;  2B5X A;  5CAX A;  2LRT A;  6GST A;  5ECI B;  4BL7 A;  1Y25 A;  1WJK A;  4IJ3 A;  1ZL9 A;  1XW9 A;  4HU7 A;  3Q18 A;  4PQH A;  4WR4 A;  3F4R A;  2NTO A;  1O6J A;  2H0G A;  4HS1 A;  1X9M B;  1X0R A;  3FW2 A;  4GCI A;  2IMI A;  2X8G A;  1Q4J A;  4OCE A;  16GS A;  3EMX A;  1H4O A;  3TJB A;  1M2A A;  2YWN A;  3G7I A;  2F51 A;  2K6V A;  1MDK A;  4MF5 A;  3DGQ A;  3DIE A;  2WRT A;  2M80 A;  2HSN B;  2GT6 A;  1U3I A;  1M7T A;  3GTU B;  4FQU A;  5GZZ B;  4ID0 A;  2OA7 A;  2FUG 2;  2VOC A;  4G2E A;  4ZB8 A;  5B8A A;  4ECJ A;  3C8E A;  4IEL A; 
#chains in the Genus database with same CATH topology
 1ABA A;  3N9J A;  1UN2 A;  1V57 A;  4Z7X A;  2WS2 A;  2IMD A;  2DJ2 A;  5A4V A;  1QFN A;  3UBL A;  1QK8 A;  3P7X A;  3F4T A;  3M3M A;  3P90 A;  2OAD A;  1YVL A;  4TN8 A;  4Z2R A;  4EXJ A;  3RAZ A;  2IIY A;  1BAY A;  4PI0 C;  13GS A;  4TR4 A;  1JLV A;  3KZQ A;  2H1L A;  4K7O A;  4V1A p;  4ZXG A;  3SBC A;  2R0P A;  1X9S B;  4MLY A;  1THX A;  1THO A;  5A4W A;  3BBY A;  4K0N A;  5D9X A;  2UV8 G;  2V32 A;  4OFT A;  4ECI A;  5J47 A;  4MJA A;  1Z3E A;  3HA9 A;  5F8B A;  1O8W A;  5ECL B;  1ZYP A;  1DE1 A;  1R5P A;  1TXX A;  5H5R A;  1BF5 A;  4EIP A;  2CX3 A;  1U3A A;  5ECK B;  3LOR A;  1AXD A;  4YQU A;  4WF5 A;  1SVM A;  4IW9 A;  2REM A;  2JL4 A;  1SL0 B;  4ECC A;  3PGT A;  1OC9 B;  4YKF A;  4XTS A;  2V41 A;  4KSM A;  2PER A;  1E2Y A;  5HR3 A;  3Q74 A;  5IOX A;  5E4W A;  2OBK A;  1RK4 A;  2RLI A;  3VLN A;  4G10 A;  5ELA A;  5HQP A;  5IOW A;  4ZL8 A;  1YEX A;  1EP7 A;  1YKA A;  3CSJ A;  1SYX A;  3F3R A;  2V6O A;  3GX0 A;  4ZIL A;  1G7O A;  5KN0 A;  1AQX A;  2OT3 A;  2PN8 A;  1Z7R A;  2GST A;  4NHZ A;  4GST A;  2LNS A;  4BPY A;  3EMP A;  2H73 A;  2ON5 A;  2FA4 A;  4AJ6 A;  3VPQ A;  1XOB A;  3GL5 A;  5IM9 A;  2WW3 A;  4N3Z A;  3LXZ A;  5D9T A;  1FAA A;  4EE0 A;  2K9F A;  4V2M A;  2VCT A;  5J9B A;  1ILO A;  1GNW A;  4WET A;  3UOM A;  1XIY A;  1HD2 A;  3QPM A;  4ZBB A;  3VWV A;  20GS A;  2DIZ A;  1VF1 A;  4AGS A;  2GSS A;  2DJJ A;  1FVK A;  2H19 A;  4TR0 A;  5IO0 A;  1OC3 A;  1XXU A;  2HRA A;  2QA1 A;  4JE1 A;  3KP8 A;  1AW9 A;  3FY7 A;  5KN1 A;  3UL3 A;  4BL7 B;  4CW9 A;  3ERW A;  4O5Q A;  3KH7 A;  2XHF A;  1TI3 A;  1IYH A;  2DLX A;  1F9M A;  3DEX A;  9GSS A;  4NHW A;  2G0F A;  5HR0 A;  4FO5 A;  2VL9 A;  1TP9 A;  3IHQ A;  2IN3 A;  4RQR A;  1LBK A;  4EDY A;  3IK7 A;  5DAL A;  4OO4 A;  1XFL A;  1YJ6 A;  2TIR A;  3C1R A;  1BG1 A;  3ZIV A;  1PL2 A;  4BWQ A;  2LTK A;  3TKS E;  1WWJ A;  4OCF A;  2LQQ A;  3FYG A;  2P0G A;  4HEA 2;  1N2A A;  4GQC A;  5AIV A;  7GSS A;  5CO3 A;  4LMV A;  4BVX A;  3TUE A;  3TGZ A;  1WP0 A;  1K0O A;  2H1B A;  1ZZY A;  2AAW A;  2HYX A;  3HXS A;  3VUR A;  2HSH A;  3CRT A;  5F05 A;  2PWJ A;  2LEG A;  4QL9 A;  2YWI A;  2WUL A;  3GMF A;  5J4V A;  3HVS A;  4IP1 A;  4AKG A;  3D21 A;  4NPB A;  4HSC X;  3TOU A;  3IBH A;  4PNG A;  5A4U A;  2GZZ A;  2MMN A;  3U5R E;  2TRC P;  3CYN A;  2V2G A;  1GSY A;  1GWC A;  4IP6 A;  3F9U A;  1S4B P;  1FB0 A;  2CZ2 A;  1PN9 A;  2CA8 A;  1UC7 A;  2VD1 A;  3GKM A;  2MMO A;  4I5Q A;  4IVF A;  4PQ1 A;  3KMN A;  2B1K A;  1G0T A;  4BVY A;  3LJR A;  5GST A;  2L6D A;  1SK0 A;  3HZ8 A;  2VAF A;  4F82 A;  4K9Z A;  1JFU A;  3LQ7 A;  4XS1 A;  2N5F A;  3DD3 A;  2IPA A;  3I69 A;  3ISO A;  1SK1 A;  3FZ9 A;  3R3E A;  3C7M A;  1XBS A;  1YEW C;  3RGB C;  1NM3 A;  2JZS A;  4KAE A;  1TRU A;  5D93 A;  4EIQ A;  4O92 A;  5ECH B;  2WCI A;  1FB6 A;  4N0Z A;  4PGT A;  1M2B A;  4WF4 A;  4YAP A;  4O7H A;  2GGT A;  5EY6 A;  4WEY A;  2KHP A;  1U87 A;  4I2T A;  2R3X A;  2M72 A;  2O87 A;  4I2U A;  3IHG A;  3WGX A;  1GSD A;  3WGE A;  1EV9 A;  1TU7 A;  1LJR A;  5FWG A;  3DYR A;  1XVW A;  3F3Q A;  2C80 A;  5G2Z A;  1EOH A;  2NDO A;  1YF0 A;  2LQO A;  3FEU A;  5J41 A;  2FNO A;  2JSZ A;  4MAB A;  1A8L A;  4AKH A;  4Q5F A;  4L5O A;  4IBP A;  3KIJ A;  5ECS A;  3IXR A;  1SL2 B;  1YKC A;  4MF6 A;  1ST9 A;  2H01 A;  2DML A;  1PRX A;  2AUV A;  3F8U A;  4XIH A;  3FR3 A;  3KCM A;  3KP9 A;  1TK0 B;  4ZL9 A;  1ACV A;  3Q19 A;  1Z5Y E;  1I5G A;  2YZU A;  3I6A A;  3DVX A;  2N5B A;  4AF2 A;  4GF0 A;  1FG4 A;  1J0F A;  1TRW A;  2GTU A;  5DAK B;  1KEB A;  1XVQ A;  2FWG A;  1MD4 A;  4IHU A;  3LW9 A;  3GN3 A;  3M8N A;  1DUG A;  2GLR A;  3D6I A;  5IMA A;  3GKX A;  3MDK A;  2C3Q A;  2YP6 A;  4PQI A;  3ME8 A;  2WW1 A;  1QGV A;  5A1N A;  3IPZ A;  1J08 A;  2HZF A;  3UMA A;  5JCG A;  2GZY A;  2YNX A;  1VF2 A;  3UAR A;  5G1K A;  3KEB A;  3LFL A;  1WE0 A;  2RUF A;  4JRR A;  3ZFB A;  1SD8 A;  4HQZ A;  3VWX A;  2R37 A;  2QGV A;  2WVZ A;  2VCZ A;  1GTU A;  1TU8 A;  3VWU A;  4TOP A;  3F6D A;  2B3S A;  1PL1 A;  3U6V A;  4LL4 B;  4NXI A;  1TRS A;  1WIK A;  3HY2 A;  1K3L A;  3D0Z A;  3FZ4 A;  4TXV A;  3CBU A;  3VFI A;  2B5E A;  3I43 A;  3C73 A;  1T3B A;  2YWO A;  4KUN A;  5AN1 A;  3TJJ A;  3BCK A;  4HDE A;  5IPG A;  2B6M A;  5CRD A;  5DBQ A;  2B5Y A;  4MH2 A;  1F3A A;  4YKG A;  1GUH A;  2H30 A;  2IJY A;  5EL8 A;  2PU9 C;  2E2G A;  2MMZ A;  1YF1 A;  2HQT A;  3TRQ A;  1AQV A;  3NZN A;  1MTC A;  4PHZ C;  2VCW A;  1FO5 A;  3HKR A;  1Z7P A;  3US3 A;  2NVL A;  3ZIJ A;  5GAP D;  4FH8 A;  1DE2 A;  4KSO A;  4YAV A;  2KUC A;  1WPI A;  4TRX A;  4BVY B;  2X8C A;  3IA1 A;  1YDK A;  3E3E A;  2MMA A;  4ML1 A;  3ERG A;  4KE3 A;  1QXH A;  1G7E A;  2H1G A;  2HFD A;  1SD9 A;  2EIR A;  1JZW A;  4F9Z A;  4Z2U A;  4JR6 A;  4GLT A;  3HJO A;  3EPT A;  2F9S A;  5IMD A;  1T8E B;  2YOI A;  3GFK A;  3FZ5 A;  3FK8 A;  3ME7 A;  5J3R A;  1B48 A;  4WXT A;  5ECQ B;  3F0I A;  5CNW A;  4F0B A;  2IME A;  3GYK A;  2C4J A;  2PGT A;  2EC4 A;  4KX4 A;  1K0B A;  1N25 A;  2R5G A;  1PKW A;  1XWK A;  1SEN A;  4G0L A;  1PN0 A;  3TJK A;  3IAS 2;  2GDR A;  6GSW A;  2YWM A;  5C04 A;  4ML6 A;  2JZR A;  4CHS A;  1ERU A;  3APO A;  3FR6 A;  2LS5 A;  2DJ1 A;  5F0G A;  6GSY A;  1Q98 A;  2GVP A;  5ECO B;  1PFO A;  2MZC A;  1ZMA A;  3VPT A;  1AC1 A;  2YZH A;  4PUA A;  1GH2 A;  3APQ A;  2DC5 A;  2XPD A;  4ACS A;  4ZB7 A;  1XZO A;  2DKH A;  4QQ7 A;  2AYT A;  5H5S A;  1HNC A;  2ZUP A;  3ZRD A;  2I3Y A;  2PVO C;  2VLV A;  1OE8 A;  3DVW A;  4K5S A;  4LL1 B;  4I97 A;  1GTB A;  2BTO T;  4HJM A;  1TKD B;  4QMK A;  5D8I A;  3WD6 A;  2WDU A;  3CTG A;  3GL3 A;  2C0E A;  4E68 A;  2EIO A;  5KN3 A;  4KF9 A;  4OD7 A;  1PX7 A;  3L78 A;  4ICY A;  1C72 A;  2PUK C;  6GSU A;  3IC4 A;  1NSW A;  1XOA A;  1CQG A;  3A2W A;  1GTA A;  1SJI A;  3ZTL A;  3ZIT A;  3IR4 A;  5CRH A;  2VO4 A;  1GSU A;  4NAX A;  2V1M A;  5A1N B;  1SKS B;  2XBI A;  1JZR A;  4ULX A;  4MH3 A;  2C8U A;  1ZYE A;  2XBQ A;  4POM A;  3M1G A;  1VF3 A;  2O8V B;  2WJU A;  1SKR B;  4FIW A;  2Z9S A;  3UBK A;  1G6Y A;  1LU4 A;  4WBJ A;  4EUY A;  5DQS A;  1S3C A;  1AQW A;  2L5L A;  3KH9 A;  2FLS A;  5EPF A;  3HVV A;  2VLU A;  1A8Y A;  4K5R A;  3HCZ A;  2X99 A;  3MSZ A;  1FHE A;  1TTZ A;  5H5Q A;  3TJG A;  4X4J A;  3A5W A;  4PXO A;  2XPE A;  3LGC A;  3Q6O A;  4L0U A;  3QOU A;  4ZBA A;  2HT9 A;  3DRN A;  4P3Y B;  4TKY A;  2K18 A;  1B9Y C;  1PA3 A;  5BMU B;  5FHI A;  4GSN A;  5D9W A;  1A2L A;  4TR3 A;  2L4C A;  2C1Y A;  4DSR A;  2M46 A;  1OKT A;  2YV7 A;  3IK9 A;  4AKX B;  1J9B A;  1T4Y A;  4KCA A;  4LA1 A;  2GQM A;  4KH7 A;  2JAD A;  4V2N A;  1M3J A;  1X5C A;  2C0D A;  5A5H A;  3VK9 A;  4Q5Q A;  3UAP A;  4HZ2 A;  3TU3 B;  2I1U A;  1XWG A;  11GS A;  5J4Y A;  2DJ0 A;  5IQY A;  2OBI A;  2OE0 A;  3TRP A;  1K0N A;  4MCU A;  4G0I A;  18GS A;  2HZE A;  2WZ9 A;  2WW2 A;  1AUC A;  3A2V A;  4RQX A;  2GT5 A;  4G9H A;  2YJ7 A;  2NBS A;  2PVQ A;  1EEM A;  5GAN D;  2H1A A;  2LV3 A;  5IMC A;  2CVK A;  2ES7 A;  1GNE A;  3H93 A;  3K8N A;  1V98 A;  2E7P A;  4CDO A;  2MYG A;  2A4V A;  1JHB A;  4TVE A;  6GSS A;  5ABR A;  3M9K A;  5CRW A;  3FR9 A;  3UEM A;  2L5O A;  5DVB A;  2EFE A;  2N5A A;  1M3I A;  2CVB A;  2J9H A;  3EVI A;  2O3E A;  2OKA A;  4I6X A;  3PIN A;  2QC7 A;  1R7H A;  2CX4 A;  2YN1 A;  4POL A;  3MAK A;  3HJP A;  2MBS A;  1PSQ A;  4D73 A;  2YJH A;  5GSS A;  1S3R A;  4AJ8 A;  3ED3 A;  4K2D A;  1K0A A;  3HYP A;  2H76 A;  5KN2 A;  1U88 A;  1M9A A;  4OO5 A;  3ZLP A;  12GS A;  4KW6 A;  5HR1 A;  1PGT A;  1O8X A;  1EZK A;  4AJ7 A;  1Z6M A;  2GS3 A;  1BED A;  3P8W A;  4PUR A;  3AY8 A;  1EP8 A;  1T4Z A;  4G01 A;  3ZVJ A;  2MBT A;  3WGD A;  4K7I A;  2DIY A;  3IAM 2;  2LJK A;  5JWR B;  3JCM L;  5CP1 A;  2LJR A;  3W8J A;  3D5J A;  1O85 A;  4AI6 A;  4Q5N A;  2BMX A;  3RFR C;  3ZFL A;  3LWA A;  2DJ3 A;  2LNT A;  1BQ7 A;  4OWY A;  3RPP A;  3ZML A;  1JZO A;  5CRE A;  1MDI A;  1DBY A;  3HVN A;  4TXO A;  2C3N A;  1W4V A;  2HNL A;  1SL1 B;  2GSR A;  3G7Y A;  5B7C A;  2HXK A;  3LYP A;  1V58 A;  2J23 A;  4L5L A;  3HZ4 A;  2I4A A;  4N30 A;  1JLW A;  4XS4 A;  3QD9 A;  2VL3 A;  1V2A A;  5F06 A;  5LCZ A;  4GTU A;  3QR6 A;  4EC0 A;  3GST A;  5G31 A;  1TI1 A;  2CT6 A;  3EYT A;  3G7J A;  3GSS A;  3CRU A;  8GSS A;  1XWA A;  1B8X A;  2H6Y A;  3E0U A;  3RHB A;  2VCX A;  1SJ6 A;  5A34 A;  3QFB C;  2R4V A;  4MPG A;  1GP1 A;  2IL3 A;  2VKZ G;  3HJM A;  2AJQ B;  2R2J A;  5BRT A;  5AIX A;  1K3Y A;  2WVY A;  1GSS A;  1MD3 A;  1TOF A;  4EL1 A;  3GUS A;  5E59 A;  1JZD A;  4IN0 A;  1EGR A;  1YEP A;  2RII A;  1R4W A;  4BWS A;  4K0G A;  5IPH A;  1VRS D;  4KB3 A;  2FHE A;  3EE2 A;  1KTE A;  1Z9H A;  1ERV A;  4PX1 A;  4NV5 A;  1XW6 A;  1U6T A;  2YPM A;  1I9D A;  1V9W A;  2H8L A;  2I9H A;  3UVT A;  5C00 A;  4JU5 A;  3V1W A;  2VD0 A;  5AGY A;  1A24 A;  1BJX A;  3VI5 A;  5DAL B;  3WT1 A;  3UVH A;  1A2J A;  2E2M A;  2WZS A;  2FA8 A;  4MMM A;  2CQ9 A;  4Q5R A;  1GL8 A;  3CHX C;  4HOJ A;  1CQH A;  2FGX A;  1EV4 A;  5D9V A;  3DXB A;  2QSI A;  5B6M A;  4JZQ A;  4EDZ A;  4BVX B;  4OMV A;  2CZ3 A;  3ZZX A;  2ZNM A;  4DVC A;  4MZB A;  4IQA A;  4DEJ A;  2O85 A;  4X1U A;  1F2E A;  2CV4 A;  2P5Q A;  2VCQ A;  3BD2 A;  2HLS A;  1OVN A;  2O36 A;  3F4S A;  4MA9 A;  3ERF A;  4X43 A;  3TKP A;  1GLP A;  3GUR A;  2C0F A;  2F8F A;  4GWR A;  1YQ1 A;  4N10 A;  3KMO A;  2V6K A;  1GTI A;  4WKW A;  1ERT A;  2NPB A;  4ZIJ A;  2GSQ A;  4EVM A;  4YQV A;  3KM6 A;  3IDV A;  1VF4 A;  5G5E A;  3CTF A;  3IOS A;  4ILF A;  4V1A g;  1Y1U A;  2HRK A;  1FVJ A;  1BX9 A;  2R0G A;  2O89 A;  1SU9 A;  1OAZ A;  1W89 A;  2ON7 A;  2X64 A;  4D73 B;  4K2X A;  4EF0 A;  4H86 A;  4HUA A;  4O5R A;  5ECP B;  3IRA A;  4I8B A;  2OAC A;  3APS A;  1SVO A;  3HD5 A;  5ECR B;  5KEJ A;  2H70 A;  3G9B A;  4ZB6 A;  1YY7 A;  3D4M A;  1EGO A;  2D2Z A;  2H74 A;  1A0F A;  3EU3 A;  2H1D A;  1NHY A;  2VCV A;  5J9C A;  5DQY A;  1K0C A;  1XCC A;  2A2R A;  4JBB A;  5B6N A;  4LLR A;  2OE1 A;  4F2I A;  2AV4 A;  4RI7 A;  3H79 A;  4ISD A;  2DKI A;  2FWH A;  1HQO A;  3QAG A;  1GSE A;  1WOU A;  3QFA C;  2FY6 A;  5EVO A;  4HZ4 A;  3RBT A;  3LEF A;  3L9S A;  3C71 A;  5A5K A;  5INY A;  2K8V A;  5L71 A;  1UA5 A;  4XHM A;  2JU5 A;  4GXZ A;  2TRX A;  2H71 A;  3MIX A;  1OE7 A;  1R5A A;  5ID2 A;  2YV9 A;  4N11 A;  3ZVJ D;  4E8E A;  3QCP A;  4TXO B;  3H4K A;  3TKR A;  3QAV A;  3CSI A;  1SYR A;  2WGR A;  4IKH A;  2B7K A;  2H75 A;  2LJA A;  1A0R P;  4G19 A;  3CMI A;  1HNB A;  1B4P A;  3D4T A;  4XS4 B;  2H6X A;  1Z6N A;  3S9F A;  1BYE A;  1M0U A;  1ZYN A;  4JED A;  1M2D A;  2YAN A;  4RI6 A;  1ON4 A;  1R26 A;  1EWX A;  4CY6 A;  2H0H A;  3A3T A;  2WW0 A;  2KP2 A;  2R6K A;  1PD2 1;  5J5N A;  4POK A;  3M0F A;  5DJM A;  2JSY A;  5D96 A;  3W8S A;  3GKN A;  4IQ1 A;  2ZCT A;  1QQ2 A;  3BOA A;  5LD0 A;  4EKZ A;  5A34 B;  2R0C A;  2JAC A;  1B4Q A;  1ZGN A;  2HE3 A;  3OR5 A;  4EO3 A;  2EFH A;  14GS A;  4X0X A;  4TW5 A;  1E6B A;  1X5D A;  3RHC A;  3LYK A;  3KTL A;  5LNK e;  2WB9 A;  1URM A;  1OYJ A;  2A4H A;  1RW1 A;  3F6F A;  1PKZ A;  3TJF A;  4XS6 A;  4K7N A;  5F07 A;  1PX6 A;  2X8H A;  1F3B A;  3EWL A;  4GRF A;  1ZOF A;  3LXT A;  1GSQ A;  3TRX A;  3L4N A;  4KDU A;  2F3M A;  5IMV A;  2X49 A;  4E8H A;  2KP1 A;  3GA4 A;  4JR4 A;  3MNG A;  3N5O A;  5D73 A;  1QMV A;  5ECM B;  3RPN A;  4QL7 A;  4V2L A;  2CVD A;  2K8S A;  3FRC A;  2HSM A;  4MF7 A;  3QDN A;  1F37 A;  5G30 A;  3MWH A;  4K6X A;  3TKQ A;  2L4Q A;  4PUF C;  3FMW A;  3C1S A;  4HQS A;  3F63 A;  2F8A A;  2DBC A;  1MEK A;  5ENU A;  3KXO A;  4GQF A;  4ZL7 A;  4NMU A;  2H72 A;  4USS A;  4OFM A;  3CQF A;  3HVX A;  3PPU A;  2WVX A;  5IMF A;  3UJ1 A;  2VM2 A;  2C0G A;  5ECN B;  4POB A;  5DAK A;  4Z2T A;  3TDG A;  4XRD A;  2FCH A;  3DML A;  4AKI A;  3RDW A;  3I9V 2;  4FYU A;  3CXG A;  3HMJ G;  6GSV A;  2PPT A;  2IWT A;  5HR2 A;  1GUK A;  5AIS A;  2RM5 A;  2HRK B;  10GS A;  2IMF A;  2VL2 A;  1X9W B;  2PBJ A;  2JZT A;  3ZRE A;  4XCS A;  3EIN A;  1K3O A;  2FWF A;  2LUS A;  4IS0 A;  2H66 A;  5HFK A;  4L0W A;  3A5I A;  4NWY A;  4XRA A;  4LMW A;  1A23 A;  5J40 A;  2LRN A;  1XG8 A;  2EFD A;  4MPF A;  5DDL A;  3KGK A;  5KOW A;  3IC8 A;  2L59 A;  1K0M A;  2A2S A;  2VUP A;  4BIK A;  1DSB A;  4PNF A;  3KD0 A;  2AB6 A;  3VI7 A;  1GRX A;  4TR1 A;  3QAW A;  4J57 E;  2L6C A;  3WT2 A;  1FOV A;  3EU4 A;  1M99 A;  4A5P A;  4HU9 A;  4MP4 A;  5JCW A;  3LG6 A;  3H1N A;  3UIW A;  2HSY A;  3J7Y k;  2RM6 A;  3TKS A;  1YZX A;  1ZCP A;  1AIU A;  3KTB A;  4G0K A;  2GQL A;  1K0D A;  4FYC A;  3ZMK A;  5COH A;  2EFC A;  2IFQ A;  1HNA A;  2CAI A;  1ML6 A;  3O3T A;  1USB A;  4DSS A;  5ID2 B;  5JWQ B;  5IO2 A;  1Y6E A;  3PH9 A;  4BA7 A;  1IYI A;  3L9V A;  1O73 A;  4O32 A;  17GS A;  1NW2 A;  3TOT A;  5KOX A;  1M9B A;  2EIQ A;  4KGI A;  3FZA A;  4PI2 C;  1GLQ A;  2L57 A;  5FT3 A;  4HJ2 A;  2HRN A;  3QMX A;  2FWE A;  6GSX A;  1V40 A;  1TRV A;  4YQM A;  1A2M A;  1OC8 A;  3O76 A;  3LSZ A;  4MJE A;  1VGL A;  2UZ8 A;  1B9X C;  3GH9 A;  3BCI A;  4K8M A;  3CSH A;  1TDI A;  1GUM A;  1N8J A;  1TK5 B;  3PR8 A;  2KLX A;  2DJK A;  2PMT A;  2P5R A;  2I81 A;  1G6W A;  2VM1 A;  3DWV A;  3SWL A;  2LRC A;  1O7U A;  3HHV A;  3GX8 A;  4KCE A;  2O7K A;  1XWC A;  4GDF A;  2HSN A;  2HI7 A;  4MNN A;  1S3A A;  1O81 A;  2XC2 A;  4IGJ A;  3FKF A;  2ALB A;  3GTU A;  2LST A;  1S3D A;  2GQK A;  1GSF A;  2H0I A;  4ECB A;  4PTS A;  2WFC A;  3EC3 A;  4KDX A;  1H75 A;  3GKK A;  3GV1 A;  4W66 A;  1FW1 A;  22GS A;  5HFG A;  2OE3 A;  5IIZ A;  4K1F A;  5B8B A;  1FOH A;  2E0Q A;  4ZBD A;  1X5E A;  4F03 A;  4MK3 A;  1F6M C;  1T1V A;  2VIM A;  1WRY A;  1ZYQ B;  4J56 E;  19GS A;  4KDY A;  2H6Z A;  2QA2 A;  3GRX A;  3ZL5 A;  3EUR A;  2RUE A;  5DJL A;  3TB2 A;  1SKW B;  2HSM B;  3HDC A;  2LKU A;  2QKE A;  3J7Y b;  4L8E A;  5J4U A;  1NHO A;  2CAQ A;  3L9U A;  2DSA A;  1WMJ A;  1BG5 A;  2X4A A;  3M9J A;  4J2F A;  1UVZ A;  1MDJ A;  4KND A;  1AAZ A;  2DMM A;  1EEJ A;  3E9J B;  1TJD A;  5JCU A;  2WVX B;  3GHA A;  4N0V A;  3GH6 A;  4MJB A;  4MJC A;  1KNG A;  3IV4 A;  1SVL A;  2VLT A;  4GSS A;  3TCO A;  5DCH A;  4IJI A;  1TW9 A;  1I1I P;  1OC9 A;  4WR5 A;  2KOK A;  2O5V A;  2VL2 C;  4OFN A;  1T00 A;  2GZP A;  1SK2 A;  3R2Q A;  5A5H B;  3IE3 A;  5DCG A;  1T7P B;  3NOF A;  1XW5 A;  1OKD A;  3H8Q A;  4CY8 A;  3ZYW A;  1HYU A;  5ELG A;  1EOG A;  3BJ5 A;  3A2X A;  1ERW A;  1XWB A;  3FHK A;  2HZE B;  4YH2 A;  2FD3 A;  3KJY A;  3O6T A;  3D22 A;  2IMK A;  4ZB9 A;  4NV2 A;  1SJZ A;  2G2Q A;  3MYD A;  3VWW A;  4TR1 B;  3NIV A;  2B1L A;  3WYW A;  5CYY A;  1XPV A;  1KBN A;  4MZW A;  2BJX A;  2HRF A;  3P2A A;  4MZC A;  5CRG A;  5G5F A;  3GNJ A;  3CWG A;  2P31 A;  4FYB A;  2YCD A;  4DSQ A;  4MDC A;  3GIX A;  3TKS C;  4HI7 A;  4RUV A;  4KA0 A;  3W6G A;  1PMT A;  4WBR D;  2C3T A;  2AHE A;  5G1L A;  5JWO B;  1RQM A;  5BMU A;  2OJL A;  5IMZ A;  3L0H A;  2IFQ B;  3DKS A;  2B7J A;  4DSS B;  5HFI A;  1PQN A;  1TK8 B;  4F0C A;  1GUL A;  1QUW A;  2B5X A;  5CAX A;  2LRT A;  6GST A;  5ECI B;  4BL7 A;  1Y25 A;  1WJK A;  4IJ3 A;  1ZL9 A;  1XW9 A;  4HU7 A;  3Q18 A;  4PQH A;  4WR4 A;  3F4R A;  2NTO A;  1O6J A;  2H0G A;  4HS1 A;  1X9M B;  1X0R A;  3FW2 A;  4GCI A;  2IMI A;  2X8G A;  1Q4J A;  4OCE A;  16GS A;  3EMX A;  1H4O A;  3TJB A;  1M2A A;  2YWN A;  3G7I A;  2F51 A;  2K6V A;  1MDK A;  4MF5 A;  2A2P A;  3DGQ A;  3DIE A;  2WRT A;  2M80 A;  2HSN B;  1TXU A;  2GT6 A;  1U3I A;  1M7T A;  3GTU B;  4FXY P;  4FQU A;  5GZZ B;  4ID0 A;  2OA7 A;  2FUG 2;  2VOC A;  4G2E A;  4ZB8 A;  5B8A A;  4O5U A;  4ECJ A;  3C8E A;  4IEL A; 
#chains in the Genus database with same CATH homology
 1ABA A;  3N9J A;  1UN2 A;  1V57 A;  4Z7X A;  2WS2 A;  2IMD A;  2DJ2 A;  5A4V A;  1QFN A;  3UBL A;  1QK8 A;  3P7X A;  3F4T A;  3M3M A;  3P90 A;  2OAD A;  1YVL A;  4TN8 A;  4Z2R A;  4EXJ A;  3RAZ A;  2IIY A;  1BAY A;  13GS A;  4TR4 A;  1JLV A;  3KZQ A;  2H1L A;  4K7O A;  4V1A p;  4ZXG A;  3SBC A;  2R0P A;  1X9S B;  4MLY A;  1THX A;  1THO A;  5A4W A;  3BBY A;  4K0N A;  5D9X A;  2UV8 G;  2V32 A;  4OFT A;  4ECI A;  5J47 A;  4MJA A;  1Z3E A;  3HA9 A;  5F8B A;  1O8W A;  5ECL B;  1ZYP A;  1DE1 A;  1R5P A;  1TXX A;  5H5R A;  1BF5 A;  4EIP A;  2CX3 A;  1U3A A;  5ECK B;  3LOR A;  1AXD A;  4YQU A;  4WF5 A;  1SVM A;  4IW9 A;  2REM A;  2JL4 A;  1SL0 B;  4ECC A;  3PGT A;  1OC9 B;  4YKF A;  4XTS A;  2V41 A;  4KSM A;  2PER A;  1E2Y A;  5HR3 A;  3Q74 A;  5IOX A;  5E4W A;  2OBK A;  1RK4 A;  2RLI A;  3VLN A;  4G10 A;  5ELA A;  5HQP A;  5IOW A;  4ZL8 A;  1YEX A;  1EP7 A;  1YKA A;  3CSJ A;  1SYX A;  3F3R A;  2V6O A;  3GX0 A;  4ZIL A;  1G7O A;  5KN0 A;  1AQX A;  2OT3 A;  2PN8 A;  1Z7R A;  2GST A;  4NHZ A;  4GST A;  2LNS A;  4BPY A;  3EMP A;  2H73 A;  2ON5 A;  2FA4 A;  4AJ6 A;  3VPQ A;  1XOB A;  3GL5 A;  5IM9 A;  4N3Z A;  3LXZ A;  5D9T A;  1FAA A;  4EE0 A;  2K9F A;  4V2M A;  2VCT A;  5J9B A;  1ILO A;  1GNW A;  4WET A;  3UOM A;  1XIY A;  1HD2 A;  3QPM A;  4ZBB A;  3VWV A;  20GS A;  2DIZ A;  1VF1 A;  4AGS A;  2GSS A;  2DJJ A;  1FVK A;  2H19 A;  4TR0 A;  5IO0 A;  1OC3 A;  1XXU A;  2HRA A;  2QA1 A;  4JE1 A;  3KP8 A;  1AW9 A;  3FY7 A;  5KN1 A;  3UL3 A;  4BL7 B;  4CW9 A;  3ERW A;  4O5Q A;  3KH7 A;  2XHF A;  1TI3 A;  1IYH A;  2DLX A;  1F9M A;  3DEX A;  9GSS A;  4NHW A;  2G0F A;  5HR0 A;  4FO5 A;  2VL9 A;  1TP9 A;  3IHQ A;  2IN3 A;  4RQR A;  1LBK A;  4EDY A;  3IK7 A;  5DAL A;  4OO4 A;  1XFL A;  1YJ6 A;  2TIR A;  3C1R A;  1BG1 A;  3ZIV A;  1PL2 A;  4BWQ A;  2LTK A;  3TKS E;  1WWJ A;  4OCF A;  2LQQ A;  3FYG A;  2P0G A;  4HEA 2;  1N2A A;  4GQC A;  5AIV A;  7GSS A;  5CO3 A;  4LMV A;  4BVX A;  3TUE A;  3TGZ A;  1WP0 A;  1K0O A;  2H1B A;  1ZZY A;  2AAW A;  2HYX A;  3HXS A;  3VUR A;  2HSH A;  3CRT A;  5F05 A;  2PWJ A;  2LEG A;  4QL9 A;  2YWI A;  2WUL A;  3GMF A;  5J4V A;  3HVS A;  4IP1 A;  4AKG A;  3D21 A;  4NPB A;  3TOU A;  3IBH A;  4PNG A;  5A4U A;  2GZZ A;  2MMN A;  3U5R E;  2TRC P;  3CYN A;  2V2G A;  1GSY A;  1GWC A;  4IP6 A;  3F9U A;  1FB0 A;  2CZ2 A;  1PN9 A;  2CA8 A;  1UC7 A;  2VD1 A;  3GKM A;  2MMO A;  4I5Q A;  4IVF A;  4PQ1 A;  3KMN A;  2B1K A;  1G0T A;  4BVY A;  3LJR A;  5GST A;  2L6D A;  1SK0 A;  3HZ8 A;  2VAF A;  4F82 A;  4K9Z A;  1JFU A;  3LQ7 A;  4XS1 A;  2N5F A;  3DD3 A;  2IPA A;  3I69 A;  3ISO A;  1SK1 A;  3FZ9 A;  3R3E A;  3C7M A;  1XBS A;  1NM3 A;  2JZS A;  4KAE A;  1TRU A;  5D93 A;  4EIQ A;  4O92 A;  5ECH B;  2WCI A;  1FB6 A;  4N0Z A;  4PGT A;  1M2B A;  4WF4 A;  4YAP A;  4O7H A;  2GGT A;  5EY6 A;  4WEY A;  2KHP A;  1U87 A;  4I2T A;  2R3X A;  2M72 A;  2O87 A;  4I2U A;  3IHG A;  3WGX A;  1GSD A;  3WGE A;  1EV9 A;  1TU7 A;  1LJR A;  5FWG A;  3DYR A;  1XVW A;  3F3Q A;  2C80 A;  5G2Z A;  1EOH A;  2NDO A;  1YF0 A;  2LQO A;  3FEU A;  5J41 A;  2FNO A;  2JSZ A;  4MAB A;  1A8L A;  4AKH A;  4Q5F A;  4L5O A;  4IBP A;  3KIJ A;  5ECS A;  3IXR A;  1SL2 B;  1YKC A;  4MF6 A;  1ST9 A;  2H01 A;  2DML A;  1PRX A;  2AUV A;  3F8U A;  4XIH A;  3FR3 A;  3KCM A;  3KP9 A;  1TK0 B;  4ZL9 A;  1ACV A;  3Q19 A;  1Z5Y E;  1I5G A;  2YZU A;  3I6A A;  3DVX A;  2N5B A;  4AF2 A;  4GF0 A;  1FG4 A;  1J0F A;  1TRW A;  2GTU A;  5DAK B;  1KEB A;  1XVQ A;  2FWG A;  1MD4 A;  4IHU A;  3LW9 A;  3GN3 A;  3M8N A;  1DUG A;  2GLR A;  3D6I A;  5IMA A;  3GKX A;  3MDK A;  2C3Q A;  2YP6 A;  4PQI A;  3ME8 A;  1QGV A;  5A1N A;  2HZF A;  1J08 A;  3IPZ A;  3UMA A;  5JCG A;  2GZY A;  2YNX A;  1VF2 A;  3UAR A;  5G1K A;  3KEB A;  3LFL A;  1WE0 A;  2RUF A;  4JRR A;  3ZFB A;  1SD8 A;  4HQZ A;  3VWX A;  2R37 A;  2QGV A;  2VCZ A;  1GTU A;  1TU8 A;  3VWU A;  4TOP A;  3F6D A;  2B3S A;  1PL1 A;  3U6V A;  4LL4 B;  4NXI A;  1TRS A;  1WIK A;  3HY2 A;  1K3L A;  3D0Z A;  3FZ4 A;  4TXV A;  3CBU A;  3VFI A;  2B5E A;  3I43 A;  3C73 A;  1T3B A;  2YWO A;  4KUN A;  5AN1 A;  3TJJ A;  3BCK A;  4HDE A;  5IPG A;  2B6M A;  5CRD A;  5DBQ A;  2B5Y A;  4MH2 A;  1F3A A;  4YKG A;  1GUH A;  2H30 A;  2IJY A;  5EL8 A;  2PU9 C;  2E2G A;  2MMZ A;  1YF1 A;  2HQT A;  3TRQ A;  1AQV A;  3NZN A;  1MTC A;  2VCW A;  1FO5 A;  3HKR A;  1Z7P A;  3US3 A;  2NVL A;  3ZIJ A;  5GAP D;  4FH8 A;  1DE2 A;  4KSO A;  4YAV A;  2KUC A;  1WPI A;  4TRX A;  4BVY B;  2X8C A;  3IA1 A;  1YDK A;  3E3E A;  2MMA A;  4ML1 A;  3ERG A;  4KE3 A;  1QXH A;  1G7E A;  2H1G A;  2HFD A;  1SD9 A;  2EIR A;  1JZW A;  4F9Z A;  4Z2U A;  4JR6 A;  4GLT A;  3HJO A;  3EPT A;  2F9S A;  5IMD A;  1T8E B;  2YOI A;  3GFK A;  3FZ5 A;  3FK8 A;  3ME7 A;  5J3R A;  1B48 A;  4WXT A;  5ECQ B;  3F0I A;  5CNW A;  4F0B A;  2IME A;  3GYK A;  2C4J A;  2PGT A;  2EC4 A;  4KX4 A;  1K0B A;  1N25 A;  2R5G A;  1PKW A;  1XWK A;  1SEN A;  4G0L A;  1PN0 A;  3TJK A;  3IAS 2;  2GDR A;  6GSW A;  2YWM A;  5C04 A;  4ML6 A;  2JZR A;  4CHS A;  1ERU A;  3APO A;  3FR6 A;  2LS5 A;  2DJ1 A;  5F0G A;  6GSY A;  1Q98 A;  2GVP A;  5ECO B;  2MZC A;  1ZMA A;  3VPT A;  1AC1 A;  2YZH A;  4PUA A;  1GH2 A;  3APQ A;  2DC5 A;  2XPD A;  4ACS A;  4ZB7 A;  1XZO A;  2DKH A;  4QQ7 A;  2AYT A;  5H5S A;  1HNC A;  2ZUP A;  3ZRD A;  2I3Y A;  2PVO C;  2VLV A;  1OE8 A;  3DVW A;  4K5S A;  4LL1 B;  4I97 A;  1GTB A;  2BTO T;  4HJM A;  1TKD B;  4QMK A;  5D8I A;  3WD6 A;  2WDU A;  3CTG A;  3GL3 A;  2C0E A;  4E68 A;  2EIO A;  5KN3 A;  4KF9 A;  4OD7 A;  1PX7 A;  3L78 A;  4ICY A;  1C72 A;  2PUK C;  6GSU A;  3IC4 A;  1NSW A;  1XOA A;  1CQG A;  3A2W A;  1GTA A;  1SJI A;  3ZTL A;  3ZIT A;  3IR4 A;  5CRH A;  2VO4 A;  1GSU A;  4NAX A;  2V1M A;  5A1N B;  1SKS B;  2XBI A;  1JZR A;  4ULX A;  4MH3 A;  2C8U A;  1ZYE A;  2XBQ A;  4POM A;  3M1G A;  1VF3 A;  2O8V B;  2WJU A;  1SKR B;  4FIW A;  2Z9S A;  3UBK A;  1G6Y A;  1LU4 A;  4WBJ A;  4EUY A;  5DQS A;  1S3C A;  1AQW A;  2L5L A;  3KH9 A;  2FLS A;  5EPF A;  3HVV A;  2VLU A;  1A8Y A;  4K5R A;  3HCZ A;  2X99 A;  3MSZ A;  1FHE A;  1TTZ A;  5H5Q A;  3TJG A;  4X4J A;  3A5W A;  4PXO A;  2XPE A;  3LGC A;  3Q6O A;  4L0U A;  3QOU A;  4ZBA A;  2HT9 A;  3DRN A;  4P3Y B;  4TKY A;  2K18 A;  1B9Y C;  1PA3 A;  5BMU B;  5FHI A;  4GSN A;  5D9W A;  1A2L A;  4TR3 A;  2L4C A;  2C1Y A;  4DSR A;  2M46 A;  1OKT A;  2YV7 A;  3IK9 A;  4AKX B;  1J9B A;  1T4Y A;  4KCA A;  4LA1 A;  2GQM A;  4KH7 A;  2JAD A;  4V2N A;  1X5C A;  2C0D A;  5A5H A;  3VK9 A;  4Q5Q A;  3UAP A;  4HZ2 A;  3TU3 B;  2I1U A;  1XWG A;  11GS A;  5J4Y A;  2DJ0 A;  5IQY A;  2OBI A;  2OE0 A;  3TRP A;  1K0N A;  4MCU A;  4G0I A;  18GS A;  2HZE A;  2WZ9 A;  1AUC A;  3A2V A;  4RQX A;  2GT5 A;  4G9H A;  2YJ7 A;  2NBS A;  2PVQ A;  1EEM A;  5GAN D;  2H1A A;  2LV3 A;  5IMC A;  2CVK A;  2ES7 A;  1GNE A;  3H93 A;  3K8N A;  1V98 A;  2E7P A;  4CDO A;  2MYG A;  2A4V A;  1JHB A;  4TVE A;  6GSS A;  5ABR A;  3M9K A;  5CRW A;  3FR9 A;  3UEM A;  2L5O A;  5DVB A;  2EFE A;  2N5A A;  2CVB A;  2J9H A;  3EVI A;  2OKA A;  4I6X A;  3PIN A;  2QC7 A;  1R7H A;  2CX4 A;  2YN1 A;  4POL A;  3MAK A;  3HJP A;  2MBS A;  1PSQ A;  4D73 A;  2YJH A;  5GSS A;  4AJ8 A;  3ED3 A;  4K2D A;  1K0A A;  3HYP A;  2H76 A;  5KN2 A;  1U88 A;  1M9A A;  4OO5 A;  3ZLP A;  12GS A;  4KW6 A;  5HR1 A;  1PGT A;  1O8X A;  1EZK A;  4AJ7 A;  1Z6M A;  2GS3 A;  1BED A;  3P8W A;  4PUR A;  3AY8 A;  1EP8 A;  1T4Z A;  4G01 A;  3ZVJ A;  2MBT A;  3WGD A;  4K7I A;  2DIY A;  3IAM 2;  2LJK A;  5JWR B;  3JCM L;  5CP1 A;  2LJR A;  3W8J A;  3D5J A;  1O85 A;  4AI6 A;  4Q5N A;  2BMX A;  3ZFL A;  3LWA A;  2DJ3 A;  2LNT A;  1BQ7 A;  4OWY A;  3RPP A;  3ZML A;  1JZO A;  5CRE A;  1MDI A;  1DBY A;  4TXO A;  2C3N A;  1W4V A;  2HNL A;  1SL1 B;  2GSR A;  3G7Y A;  5B7C A;  2HXK A;  3LYP A;  1V58 A;  2J23 A;  4L5L A;  3HZ4 A;  2I4A A;  4N30 A;  1JLW A;  4XS4 A;  3QD9 A;  2VL3 A;  1V2A A;  5F06 A;  5LCZ A;  4GTU A;  3QR6 A;  4EC0 A;  3GST A;  5G31 A;  1TI1 A;  2CT6 A;  3EYT A;  3G7J A;  3GSS A;  3CRU A;  8GSS A;  1XWA A;  1B8X A;  2H6Y A;  3E0U A;  3RHB A;  2VCX A;  1SJ6 A;  5A34 A;  3QFB C;  2R4V A;  4MPG A;  1GP1 A;  2IL3 A;  2VKZ G;  3HJM A;  2AJQ B;  2R2J A;  5BRT A;  5AIX A;  1K3Y A;  1GSS A;  1MD3 A;  1TOF A;  4EL1 A;  3GUS A;  5E59 A;  1JZD A;  4IN0 A;  1EGR A;  1YEP A;  2RII A;  1R4W A;  4BWS A;  4K0G A;  5IPH A;  1VRS D;  4KB3 A;  2FHE A;  3EE2 A;  1KTE A;  1Z9H A;  1ERV A;  4PX1 A;  4NV5 A;  1XW6 A;  1U6T A;  2YPM A;  1I9D A;  1V9W A;  2H8L A;  2I9H A;  3UVT A;  5C00 A;  4JU5 A;  3V1W A;  2VD0 A;  5AGY A;  1A24 A;  1BJX A;  3VI5 A;  5DAL B;  3WT1 A;  3UVH A;  1A2J A;  2E2M A;  2FA8 A;  4MMM A;  2CQ9 A;  4Q5R A;  1GL8 A;  4HOJ A;  1CQH A;  2FGX A;  1EV4 A;  5D9V A;  3DXB A;  2QSI A;  5B6M A;  4JZQ A;  4EDZ A;  4BVX B;  4OMV A;  2CZ3 A;  3ZZX A;  2ZNM A;  4DVC A;  4MZB A;  4IQA A;  4DEJ A;  2O85 A;  4X1U A;  1F2E A;  2CV4 A;  2P5Q A;  2VCQ A;  3BD2 A;  2HLS A;  1OVN A;  3F4S A;  4MA9 A;  3ERF A;  4X43 A;  3TKP A;  1GLP A;  3GUR A;  2C0F A;  2F8F A;  4GWR A;  1YQ1 A;  4N10 A;  3KMO A;  2V6K A;  1GTI A;  4WKW A;  1ERT A;  2NPB A;  4ZIJ A;  2GSQ A;  4EVM A;  4YQV A;  3KM6 A;  3IDV A;  1VF4 A;  5G5E A;  3CTF A;  3IOS A;  4ILF A;  4V1A g;  1Y1U A;  2HRK A;  1FVJ A;  1BX9 A;  2R0G A;  2O89 A;  1SU9 A;  1OAZ A;  1W89 A;  2ON7 A;  2X64 A;  4D73 B;  4K2X A;  4EF0 A;  4H86 A;  4HUA A;  4O5R A;  5ECP B;  3IRA A;  4I8B A;  2OAC A;  3APS A;  1SVO A;  3HD5 A;  5ECR B;  5KEJ A;  2H70 A;  3G9B A;  4ZB6 A;  1YY7 A;  3D4M A;  1EGO A;  2D2Z A;  2H74 A;  1A0F A;  3EU3 A;  2H1D A;  1NHY A;  2VCV A;  5J9C A;  5DQY A;  1K0C A;  1XCC A;  2A2R A;  4JBB A;  5B6N A;  4LLR A;  2OE1 A;  4F2I A;  2AV4 A;  4RI7 A;  3H79 A;  4ISD A;  2DKI A;  2FWH A;  1HQO A;  3QAG A;  1GSE A;  1WOU A;  3QFA C;  2FY6 A;  5EVO A;  4HZ4 A;  3RBT A;  3LEF A;  3L9S A;  3C71 A;  5A5K A;  5INY A;  2K8V A;  5L71 A;  1UA5 A;  4XHM A;  2JU5 A;  4GXZ A;  2TRX A;  2H71 A;  3MIX A;  1OE7 A;  1R5A A;  5ID2 A;  2YV9 A;  4N11 A;  3ZVJ D;  4E8E A;  3QCP A;  4TXO B;  3H4K A;  3TKR A;  3QAV A;  3CSI A;  1SYR A;  2WGR A;  4IKH A;  2B7K A;  2H75 A;  2LJA A;  1A0R P;  4G19 A;  3CMI A;  1HNB A;  1B4P A;  3D4T A;  4XS4 B;  2H6X A;  1Z6N A;  3S9F A;  1BYE A;  1M0U A;  1ZYN A;  4JED A;  1M2D A;  2YAN A;  4RI6 A;  1ON4 A;  1R26 A;  1EWX A;  4CY6 A;  2H0H A;  3A3T A;  2KP2 A;  2R6K A;  1PD2 1;  5J5N A;  4POK A;  3M0F A;  5DJM A;  2JSY A;  5D96 A;  3W8S A;  3GKN A;  4IQ1 A;  2ZCT A;  1QQ2 A;  3BOA A;  5LD0 A;  4EKZ A;  5A34 B;  2R0C A;  2JAC A;  1B4Q A;  1ZGN A;  2HE3 A;  3OR5 A;  4EO3 A;  2EFH A;  14GS A;  4X0X A;  4TW5 A;  1E6B A;  1X5D A;  3RHC A;  3LYK A;  3KTL A;  5LNK e;  2WB9 A;  1URM A;  1OYJ A;  2A4H A;  1RW1 A;  3F6F A;  1PKZ A;  3TJF A;  4XS6 A;  4K7N A;  5F07 A;  1PX6 A;  2X8H A;  1F3B A;  3EWL A;  4GRF A;  1ZOF A;  3LXT A;  1GSQ A;  3TRX A;  3L4N A;  4KDU A;  2F3M A;  5IMV A;  2X49 A;  4E8H A;  2KP1 A;  3GA4 A;  4JR4 A;  3MNG A;  3N5O A;  5D73 A;  1QMV A;  5ECM B;  3RPN A;  4QL7 A;  4V2L A;  2CVD A;  2K8S A;  3FRC A;  2HSM A;  4MF7 A;  3QDN A;  1F37 A;  5G30 A;  3MWH A;  4K6X A;  3TKQ A;  2L4Q A;  4PUF C;  3FMW A;  3C1S A;  4HQS A;  3F63 A;  2F8A A;  2DBC A;  1MEK A;  5ENU A;  3KXO A;  4GQF A;  4ZL7 A;  4NMU A;  2H72 A;  4USS A;  4OFM A;  3HVX A;  3PPU A;  5IMF A;  3UJ1 A;  2VM2 A;  2C0G A;  5ECN B;  4POB A;  5DAK A;  4Z2T A;  3TDG A;  4XRD A;  2FCH A;  3DML A;  4AKI A;  3RDW A;  3I9V 2;  4FYU A;  3CXG A;  3HMJ G;  6GSV A;  2PPT A;  2IWT A;  5HR2 A;  1GUK A;  5AIS A;  2RM5 A;  2HRK B;  10GS A;  2IMF A;  2VL2 A;  1X9W B;  2PBJ A;  2JZT A;  3ZRE A;  4XCS A;  3EIN A;  1K3O A;  2FWF A;  2LUS A;  4IS0 A;  2H66 A;  5HFK A;  4L0W A;  3A5I A;  4NWY A;  4XRA A;  4LMW A;  1A23 A;  5J40 A;  2LRN A;  2EFD A;  4MPF A;  5DDL A;  3KGK A;  5KOW A;  3IC8 A;  2L59 A;  1K0M A;  2A2S A;  2VUP A;  1DSB A;  4PNF A;  3KD0 A;  2AB6 A;  3VI7 A;  1GRX A;  4TR1 A;  3QAW A;  4J57 E;  2L6C A;  3WT2 A;  1FOV A;  3EU4 A;  1M99 A;  4A5P A;  4HU9 A;  4MP4 A;  5JCW A;  3LG6 A;  3H1N A;  3UIW A;  2HSY A;  3J7Y k;  2RM6 A;  3TKS A;  1YZX A;  1ZCP A;  1AIU A;  3KTB A;  4G0K A;  2GQL A;  1K0D A;  4FYC A;  3ZMK A;  5COH A;  2EFC A;  2IFQ A;  1HNA A;  2CAI A;  1ML6 A;  3O3T A;  1USB A;  4DSS A;  5ID2 B;  5JWQ B;  5IO2 A;  1Y6E A;  3PH9 A;  4BA7 A;  1IYI A;  3L9V A;  1O73 A;  4O32 A;  17GS A;  1NW2 A;  3TOT A;  5KOX A;  1M9B A;  2EIQ A;  4KGI A;  3FZA A;  1GLQ A;  2L57 A;  5FT3 A;  4HJ2 A;  2HRN A;  3QMX A;  2FWE A;  6GSX A;  1V40 A;  1TRV A;  4YQM A;  1A2M A;  1OC8 A;  3O76 A;  3LSZ A;  4MJE A;  1VGL A;  2UZ8 A;  1B9X C;  3GH9 A;  3BCI A;  4K8M A;  3CSH A;  1TDI A;  1GUM A;  1N8J A;  1TK5 B;  3PR8 A;  2KLX A;  2DJK A;  2PMT A;  2P5R A;  2I81 A;  1G6W A;  2VM1 A;  3DWV A;  3SWL A;  2LRC A;  1O7U A;  3HHV A;  3GX8 A;  4KCE A;  2O7K A;  1XWC A;  4GDF A;  2HSN A;  2HI7 A;  4MNN A;  1S3A A;  1O81 A;  2XC2 A;  4IGJ A;  3FKF A;  2ALB A;  3GTU A;  2LST A;  1S3D A;  2GQK A;  1GSF A;  2H0I A;  4ECB A;  4PTS A;  2WFC A;  3EC3 A;  4KDX A;  1H75 A;  3GKK A;  3GV1 A;  4W66 A;  1FW1 A;  22GS A;  5HFG A;  2OE3 A;  5IIZ A;  4K1F A;  5B8B A;  1FOH A;  2E0Q A;  4ZBD A;  1X5E A;  4F03 A;  4MK3 A;  1F6M C;  1T1V A;  2VIM A;  1WRY A;  1ZYQ B;  4J56 E;  19GS A;  4KDY A;  2H6Z A;  2QA2 A;  3GRX A;  3ZL5 A;  3EUR A;  2RUE A;  5DJL A;  3TB2 A;  1SKW B;  2HSM B;  3HDC A;  2LKU A;  2QKE A;  3J7Y b;  4L8E A;  5J4U A;  1NHO A;  2CAQ A;  3L9U A;  2DSA A;  1WMJ A;  1BG5 A;  2X4A A;  3M9J A;  4J2F A;  1UVZ A;  1MDJ A;  4KND A;  1AAZ A;  2DMM A;  1EEJ A;  3E9J B;  1TJD A;  5JCU A;  3GHA A;  4N0V A;  3GH6 A;  4MJB A;  4MJC A;  1KNG A;  3IV4 A;  1SVL A;  2VLT A;  4GSS A;  3TCO A;  5DCH A;  4IJI A;  1TW9 A;  1OC9 A;  4WR5 A;  2KOK A;  2O5V A;  2VL2 C;  4OFN A;  1T00 A;  2GZP A;  1SK2 A;  3R2Q A;  5A5H B;  3IE3 A;  5DCG A;  1T7P B;  3NOF A;  1XW5 A;  1OKD A;  3H8Q A;  4CY8 A;  3ZYW A;  1HYU A;  5ELG A;  1EOG A;  3BJ5 A;  3A2X A;  1ERW A;  1XWB A;  3FHK A;  2HZE B;  4YH2 A;  2FD3 A;  3KJY A;  3O6T A;  3D22 A;  2IMK A;  4ZB9 A;  4NV2 A;  1SJZ A;  2G2Q A;  3MYD A;  3VWW A;  4TR1 B;  3NIV A;  2B1L A;  3WYW A;  5CYY A;  1XPV A;  1KBN A;  4MZW A;  2BJX A;  2HRF A;  3P2A A;  4MZC A;  5CRG A;  5G5F A;  3GNJ A;  3CWG A;  2P31 A;  4FYB A;  2YCD A;  4DSQ A;  4MDC A;  3GIX A;  3TKS C;  4HI7 A;  4RUV A;  4KA0 A;  3W6G A;  1PMT A;  4WBR D;  2C3T A;  2AHE A;  5G1L A;  5JWO B;  1RQM A;  5BMU A;  2OJL A;  5IMZ A;  3L0H A;  2IFQ B;  3DKS A;  2B7J A;  4DSS B;  5HFI A;  1PQN A;  1TK8 B;  4F0C A;  1GUL A;  1QUW A;  2B5X A;  5CAX A;  2LRT A;  6GST A;  5ECI B;  4BL7 A;  1Y25 A;  1WJK A;  4IJ3 A;  1ZL9 A;  1XW9 A;  4HU7 A;  3Q18 A;  4PQH A;  4WR4 A;  3F4R A;  2NTO A;  1O6J A;  2H0G A;  4HS1 A;  1X9M B;  1X0R A;  3FW2 A;  4GCI A;  2IMI A;  2X8G A;  1Q4J A;  4OCE A;  16GS A;  3EMX A;  1H4O A;  3TJB A;  1M2A A;  2YWN A;  3G7I A;  2F51 A;  2K6V A;  1MDK A;  4MF5 A;  2A2P A;  3DGQ A;  3DIE A;  2WRT A;  2M80 A;  2HSN B;  1TXU A;  2GT6 A;  1U3I A;  1M7T A;  3GTU B;  4FQU A;  5GZZ B;  4ID0 A;  2OA7 A;  2FUG 2;  2VOC A;  4G2E A;  4ZB8 A;  5B8A A;  4O5U A;  4ECJ A;  3C8E A;  4IEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...