3P8WA

Crystal structure analysis of r29m/e81m double mutant of human clic1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
236
structure length
236
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQMLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIMEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Crystal Structure Analysis of R29M/E81M double mutant of human CLIC1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 76
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3p8wA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3p8wA01
3QAVA 1H75A 1VF4A 3RPNA 3ZL5A 1ERWA 2RM5A 1OE7A 3L9UA 4I8BA 5IMAA 4YQUA 4PNFA 3G9BA 1F2EA 3MAKA 2MBSA 3TRXA 1U87A 3KD0A 3TJFA 2OBIA 1Y6EA 4GXZA 3UMAA 3PR8A 5IOXA 1SL0B 2EC4A 4AGSA 2LJKA 3BJ5A 17GSA 3N9JA 1IYIA 3U5RE 4JE1A 5IO2A 5AGYA 2IJYA 3GL3A 4IJIA 5KN0A 2HRAA 3DD3A 2WB9A 2VM1A 3HA9A 3KIJA 3LJRA 5HR2A 4RI7A 4ZB8A 1J9BA 4L5OA 5DJLA 1IYHA 1F3BA 3WGDA 4Q5QA 1KEBA 1XW6A 2B1KA 3L0HA 3TCOA 2K6VA 1M99A 1OKTA 5AIXA 1XOBA 1PKWA 2R5GA 5DALB 2EIOA 1SK0A 2IN3A 2H76A 1MEKA 3FR3A 1ML6A 2ON5A 1TTZA 1VRSD 2Z9SA 1XWKA 4N10A 4RI6A 1SYXA 2LQQA 3F8UA 3MDKA 1GSYA 1A0FA 2K18A 3C71A 4GSTA 3P90A 1HYUA 1N2AA 5ECMB 2YN1A 4KA0A 2XHFA 2FCHA 5JCUA 1F9MA 2LV3A 1QK8A 5B8AA 2P31A 2B6MA 4MJBA 4MCUA 3TOTA 4MF7A 4XRDA 1TRSA 2NTOA 1ST9A 2RUEA 3VFIA 1CQHA 4J2FA 5IMCA 5KEJA 6GSXA 3P2AA 3GSSA 4D73A 2N5AA 2CAQA 3Q6OA 3UVHA 3TOUA 3UVTA 4JR4A 4EUYA 1Z7RA 4Q5RA 3UAPA 1B9YC 4CDOA 1T7PB 2VL9A 4XIHA 2C3TA 4HQSA 3QR6A 5DAKA 4H86A 1MD4A 5ECRB 2PUKC 3DXBA 4XS4A 1QQ2A 2GZPA 3E3EA 2QC7A 2V6OA 3NOFA 2GGTA 1G6YA 5GSTA 1T4YA 5KN1A 5CO3A 2XC2A 3WGXA 4KE3A 5J9CA 1TI3A 2RLIA 2YJHA 3JCML 5FHIA 4MLYA 2JZSA 1KTEA 3R2QA 2UZ8A 3LSZA 2E7PA 3ERFA 4FYCA 1SJ6A 6GSSA 5CAXA 1GSEA 4D73B 3C1RA 4PQ1A 3HZ8A 2L6CA 3ZFBA 2DMMA 3KMNA 3DKSA 2AB6A 3GKKA 5G1LA 2B5XA 3EINA 6GSUA 3EMXA 6GSWA 1M0UA 1FB0A 3VI5A 2O7KA 2RIIA 3IHQA 3KXOA 1XWAA 2YJ7A 3I43A 1K3OA 4ILFA 2NPBA 3SWLA 1S3CA 2X99A 3ZMKA 4PURA 2A2RA 1T00A 4XS4B 2YV7A 4MJEA 3V1WA 4IBPA 2EIRA 4IGJA 1PQNA 4N11A 5HFKA 5HR3A 4JEDA 4TR1B 2I1UA 3LQ7A 2LEGA 1ILOA 2MYGA 2MMAA 1EV9A 1VF1A 4KW6A 4YAPA 2KOKA 4EF0A 4X1UA 3DRNA 4NHZA 1F37A 5IOWA 5CP1A 3VWWA 4MMMA 2ALBA 3F6DA 1O81A 1GLPA 3RHBA 3EVIA 4TXVA 9GSSA 2P5RA 4GWRA 2F8AA 2LJAA 3ERGA 3H4KA 4OO5A 1XIYA 4XCSA 3ED3A 1LU4A 5B6MA 4RQXA 5BMUA 3WGEA 4BA7A 4HDEA 3O76A 5J9BA 4PUAA 4ZB6A 4IQ1A 1PX7A 5ENUA 1J08A 1OAZA 3HZ4A 4ML6A 5DVBA 2AYTA 1UA5A 3QAWA 1SD9A 3C73A 4BVXA 2VD1A 1SK2A 2GDRA 2X8CA 4ISDA 1A8YA 3L9VA 3TJBA 4YAVA 1F3AA 1URMA 2MZCA 2OJLA 1KNGA 4G19A 1X5EA 1GLQA 5CRGA 1Q98A 2H70A 5IMFA 1K0MA 3EE2A 3BBYA 1XW9A 4ZBAA 2M80A 2O87A 5E59A 10GSA 2PERA 4FYBA 4J56E 3WYWA 2OE1A 1ERUA 2OE0A 2LS5A 3CSJA 2LTKA 3IOSA 3VI7A 1GNWA 1THXA 5F06A 3ERWA 4IP1A 4J57E 5COHA 3TRQA 3GKXA 1WWJA 4ECBA 1FVKA 3QAGA 5GZZB 4G2EA 3FR9A 1M7TA 2AAWA 4FYUA 2C80A 1EP7A 5H5RA 3IAM2 20GSA 5LD0A 4IS0A 1V9WA 1JFUA 1TK0B 3R3EA 1KBNA 3QFBC 2HRNA 4ZXGA 4BVXB 2X8GA 1FB6A 3LYPA 5DCHA 4EXJA 3KGKA 1WJKA 5HFIA 3QD9A 4PXOA 1V57A 1A24A 1GUKA 2VD0A 2GQMA 4OMVA 1AQVA 3DVXA 1Y25A 2CA8A 2YWNA 4AF2A 1GH2A 5HFGA 3I69A 4V2NA 4EO3A 5DBQA 3M1GA 3HHVA 3APSA 4PQIA 3Q18A 5F07A 1ERTA 3CTFA 5JCWA 5J5NA 4PTSA 4EVMA 4HJ2A 3M0FA 1Z5YE 4LA1A 1SL1B 4YH2A 2GTUA 2A4VA 2VL3A 3EC3A 1K0BA 1VF3A 2DLXA 3PPUA 1JLWA 1EEJA 1EP8A 1K0NA 3VPQA 1GULA 3IAS2 4IN0A 1PGTA 2WZ9A 5ECQB 4ZB9A 3VWXA 5INYA 1V98A 1B48A 2H0GA 4LL4B 3TKRA 2WRTA 2R6KA 5CRHA 3TUEA 1QUWA 1U88A 4BL7A 4NXIA 4K2DA 2I3YA 1X9MB 3ME8A 1SJZA 3LG6A 5A4UA 2VL2C 4KDXA 2H71A 5IO0A 2H1AA 4JRRA 1AAZA 3DEXA 5J3RA 1TOFA 4ZL8A 1UC7A 4XS1A 3GNJA 1SU9A 4X43A 3W6GA 3HD5A 3D4MA 3GYKA 5IMDA 1O8XA 1YF1A 1GNEA 1A8LA 1GSDA 4IVFA 3FZ4A 4HEA2 2HQTA 2X8HA 3J7Yb 3EYTA 4EDYA 4HU7A 1TI1A 5F05A 2B7JA 2H6ZA 4MJCA 4WR4A 4L5LA 1W89A 3ZLPA 5EL8A 1XCCA 1JZDA 1G0TA 3GV1A 3FY7A 2YNXA 3D21A 2E2GA 4TOPA 4GSSA 14GSA 4HZ2A 3P7XA 2YZHA 1WOUA 2O89A 2GSQA 2VO4A 1BEDA 1VGLA 1X9WB 2CVBA 1WPIA 4TR3A 2MMOA 4BL7B 1UN2A 1PSQA 2XBQA 3DVWA 3F3RA 1W4VA 4HZ4A 3UEMA 1R5AA 3DYRA 1PKZA 2H19A 4ZBDA 2C1YA 3ZZXA 2N5FA 2LUSA 4YQVA 4JR6A 2LRTA 2CQ9A 2IFQA 6GSVA 2G0FA 3A2VA 4KGIA 4CW9A 2XPDA 3D5JA 3RPPA 2G2QA 3Q19A 4GSNA 1A2LA 5JWRB 4K6XA 4NWYA 2R4VA 5KN2A 2VCQA 2V41A 3IK7A 2WCIA 3KTBA 1AQWA 2VL2A 4MDCA 1TRVA 2VUPA 4ML1A 1K0OA 2DJKA 4L0UA 2HZEA 3A5WA 2OBKA 1ON4A 2OADA 1G7OA 3FRCA 2B1LA 3KZQA 1DE2A 4ZL9A 2P5QA 2PN8A 1LBKA 2N5BA 4KCAA 3IPZA 1O6JA 4K7NA 3QPMA 2LNTA 3TRPA 1SKSB 2PU9C 2BJXA 4TR0A 1C72A 4O92A 3PINA 2H6YA 1H4OA 2BMXA 2DMLA 1K0DA 4KB3A 2J23A 2R3XA 2AHEA 4KSOA 1ACVA 2JU5A 1XWBA 3HJMA 5ID2B 3UJ1A 1TDIA 1EOHA 2FWGA 2YCDA 1XBSA 4ZIJA 4MF5A 3GHAA 3GX8A 2V2GA 2H73A 2LRCA 2IFQB 2TRCP 1M2BA 1GUHA 2JSYA 1FG4A 4TR1A 3A2WA 3GUSA 4IQAA 2LKUA 2ZNMA 4WETA 4DSRA 4GTUA 3APQA 4Q5NA 3O3TA 2E0QA 2CT6A 1M9BA 1SJIA 3I9V2 5H5SA 3D6IA 1Z6MA 1U6TA 3VURA 4L8EA 1ZCPA 2HZEB 4GRFA 4FO5A 2JZTA 4K9ZA 1QFNA 4EE0A 3LEFA 3LXZA 2F8FA 2ON7A 1O73A 3G7JA 4MZWA 1R7HA 2GSRA 4G0LA 3BCKA 5GAND 1HNBA 4XTSA 2VAFA 2XBIA 2B3SA 3BD2A 4QL7A 3TJKA 1JHBA 5G5EA 1QGVA 2H1BA 1JLVA 2IMFA 4OO4A 3HCZA 3C8EA 4NPBA 4ZL7A 4P3YB 5ECLB 3GX0A 3VLNA 1EGRA 3APOA 3KEBA 1ZMAA 1PX6A 5AIVA 4TXOA 1EEMA 11GSA 2PGTA 5KN3A 3RHCA 1R5PA 2PWJA 2HRKA 4KDYA 3GH9A 4TRXA 2QGVA 1PA3A 2WGRA 2JACA 2MBTA 3IE3A 1SKRB 2KLXA 3US3A 4PNGA 3W8JA 3FZ5A 4I2TA 1GL8A 2K9FA 2B5YA 2F51A 1YKCA 3EURA 1FAAA 1AXDA 2HYXA 1QMVA 5EVOA 1ZYQB 1YZXA 1GTBA 4V2LA 1YJ6A 5IQYA 2L4CA 2HFDA 4OCFA 1XVQA 1SENA 3KP9A 5J41A 4JZQA 4XHMA 1N8JA 2L57A 1LJRA 3J7Yk 2MMZA 1USBA 2VCVA 3W8SA 1BQ7A 2L5OA 4FQUA 4BWSA 3GKNA 2LQOA 2IMDA 3ZVJD 2FUG2 2FA4A 2YANA 2B7KA 3D4TA 3ZIJA 2XPEA 2NDOA 5L71A 1G7EA 4POMA 1HQOA 3MSZA 1TKDB 3F0IA 1U3IA 2NVLA 2C3NA 2QKEA 3EMPA 4TXOB 1GSQA 3TKSC 2PPTA 3ZTLA 1K3YA 2CVKA 1SL2B 1GSFA 2DC5A 2C0EA 1DUGA 1UVZA 2HRKB 3FHKA 4G0KA 2KHPA 5IPGA 3CSHA 1XWGA 4USSA 5ELGA 2HLSA 3IC4A 3UOMA 1AC1A 1Z9HA 2EIQA 2WS2A 5DJMA 2WULA 1A2JA 3TKSE 2GSSA 2HSNB 3H79A 3LXTA 1OYJA 3EU4A 3MNGA 3MWHA 3HJOA 5GAPD 1YY7A 2LJRA 2H74A 4GCIA 3F3QA 4NHWA 3H8QA 1K0AA 3ZYWA 3ZRDA 4IW9A 1TRUA 1YDKA 5C00A 1YEXA 2FY6A 3FK8A 1T3BA 5AN1A 2O8VB 5ECIB 2VCZA 1XZOA 2VLVA 1TP9A 3FR6A 4POLA 2HSYA 1PL1A 1X5CA 3DIEA 3WT2A 3TJJA 3ZITA 1M2DA 1T8EB 3FEUA 3GKMA 3FKFA 5JWQB 3F63A 1B4PA 2M72A 2H0HA 3K8NA 2AV4A 5DDLA 3FZ9A 3HVVA 4PQHA 3F4TA 1XXUA 4BVYA 2JSZA 1FHEA 1PMTA 6GSYA 1A0RP 5D96A 1DE1A 4F0CA 5IM9A 3TKSA 1HD2A 2F3MA 1YKAA 1TRWA 3UARA 3NZNA 3FZAA 1RW1A 3HVSA 2I4AA 3GH6A 2HSMA 4QL9A 3VPTA 5G5FA 4E8EA 1V40A 4HS1A 3C1SA 2RUFA 1FVJA 1PRXA 3IK9A 5D9XA 2BTOT 4K7OA 4JU5A 4V1Ap 2YV9A 1JZRA 1TK8B 4MA9A 4JBBA 2NBSA 2C3QA 2C4JA 1Z7PA 1NHYA 2L4QA 2C0DA 3ZREA 4ULXA 5G31A 1BX9A 4V1Ag 2L5LA 2YWOA 19GSA 4RQRA 4DVCA 3M8NA 5DQSA 1B4QA 4MPGA 2PVQA 3WT1A 1SYRA 3IDVA 1TU7A 1FW1A 1VF2A 1BJXA 2GT5A 2VCWA 4F0BA 1E6BA 3H1NA 5G30A 2HZFA 5ECHB 3HVXA 4LLRA 4BVYB 1BG5A 2IMIA 1G6WA 2GVPA 5CRDA 4IELA 2P0GA 2R2JA 2DSAA 1EOGA 4K1FA 2YOIA 2FWHA 3EU3A 3S9FA 22GSA 4O5RA 1EZKA 5D93A 5EY6A 1I5GA 2OACA 2HI7A 5CRWA 2HSMB 3P8WA 1WRYA 4F2IA 4MPFA 1RK4A 3M9JA 1A2MA 4MZBA 4EL1A 2GSTA 3DGQA 2MMNA 2DJ0A 2IMKA 3VK9A 3UIWA 1FOVA 2CVDA 4MJAA 1ZZYA 2H1DA 4HU9A 5DCGA 5A5KA 1JZOA 1NHOA 2I9HA 3LFLA 1GTUA 4GQCA 4DSSA 3H93A 4N0VA 4MH3A 3G7IA 2TIRA 2FWFA 4RUVA 3KM6A 3GMFA 2WFCA 2DJ2A 1PL2A 1YEPA 2VOCA 2RM6A 5LCZA 2F9SA 1NSWA 2DIYA 3CTGA 4K0GA 3I6AA 1Z6NA 6GSTA 3PH9A 5HR1A 4Z7XA 1SKWB 3QOUA 4LL1B 1JZWA 2LSTA 3BOAA 3IRAA 5IPHA 4KX4A 5A4WA 2JADA 2DBCA 1MD3A 4F03A 3UBKA 5ID2A 1ZGNA 2FHEA 1GUMA 4AJ7A 4GLTA 4MZCA 4N30A 4G9HA 4O7HA 1ZL9A 4XRAA 3HYPA 5F0GA 1CQGA 3ISOA 1OC9A 5LNKe 2O85A 5F8BA 5HR0A 12GSA 1ZYEA 1WIKA 5H5QA 3ZIVA 4WF4A 4EKZA 1WP0A 1SD8A 3U6VA 1ABAA 2K8VA 4Q5FA 3Q74A 5DQYA 4DSSB 3LWAA 4HUAA 1J0FA 1FO5A 5FWGA 3O6TA 5D8IA 1DBYA 2YWMA 1M2AA 2CAIA 5ECNB 3QMXA 1SK1A 2IMEA 3GRXA 3F4SA 2PMTA 1O85A 4ZILA 4O32A 4TKYA 1OC3A 2CZ2A 3IA1A 2YP6A 4N0ZA 5B6NA 2E2MA 5ABRA 3CRUA 3SBCA 4HOJA 3QDNA 3KCMA 4KH7A 1GP1A 3IXRA 2V1MA 5CREA 1QXHA 2KUCA 2A2SA 3LORA 3HJPA 3F4RA 2FWEA 5IIZA 4IHUA 4DSQA 4KDUA 3VWUA 2HT9A 1OC9B 1MTCA 4KUNA 1DSBA 4WF5A 2PBJA 2L59A 3ME7A 4LMVA 18GSA 4NMUA 3ZMLA 1F6MC 13GSA 1TXXA 4TW5A 4LMWA 4F9ZA 4EDZA 5FT3A 1GTIA 3DMLA 1GSSA 2H30A 3TGZA 3GTUA 1Z3EA 3D0ZA 4HI7A 4ACSA 4NV5A 3E0UA 1V58A 4MABA 3KP8A 2CZ3A 1OC8A 3IV4A 2DJ1A 4G10A 4WXTA 4K8MA 5IMZA 3UL3A 5HQPA 4XS6A 4FH8A 4TN8A 2OE3A 2H0IA 3QFAC 3F6FA 1ZOFA 1TU8A 5CNWA 1WMJA 2C0GA 8GSSA 3L78A 2DIZA 4KNDA 3VWVA 3EWLA 1XWCA 2PVOC 5D9TA 2YWIA 1MDJA 2H6XA 3HKRA 4L0WA 5JWOB 2H8LA 3HDCA 5JCGA 1HNAA 1BAYA 1XFLA 2IIYA 1S3AA 5DAKB 3M3MA 5D73A 3TKPA 4POKA 2VLUA 4OWYA 4IP6A 5D9WA 1THOA 3GTUB 1AQXA 2VIMA 4WEYA 2V6KA 4KAEA 1NM3A 4OCEA 2AUVA 3GL5A 2K8SA 5D9VA 1RQMA 2M46A 4HJMA 2KP1A 5C04A 4KF9A 4TVEA 4MP4A 3IC8A 1GSUA 5IMVA 2I81A 2R37A 7GSSA 1S3DA 2CX4A 4ID0A 1R26A 5ELAA 4ECIA 3LGCA 1E2YA 4MF6A 2HXKA 5ECSA 3TJGA 4ECCA 3QCPA 3OR5A 2JL4A 4CHSA 1X0RA 2JZRA 4PGTA 4BPYA 1OKDA 4EC0A 1XVWA 4AJ6A 2H66A 2GT6A 3LYKA 1B9XC 4WKWA 1X9SB 2VM2A 2H75A 3TDGA 1O7UA 4ECJA 4K0NA 3C7MA 4PX1A 3RBTA 3BCIA 3A2XA 2LNSA 4KSMA 3KTLA 1WE0A 2L6DA 1GTAA 4I97A 4GQFA 3F9UA 1ERVA 3E9JB 2ZCTA 5A4VA 1B8XA 2GZYA 2IL3A 2B5EA 2V32A 4DEJA 1TW9A 4K7IA 2WDUA 2VCXA 5G2ZA 2OA7A 2IWTA 2FGXA 3KH7A 2GLRA 3GA4A 4WBRD 3NIVA 3CYNA 2FLSA 3CXGA 3CRTA 1NW2A 1PN9A 5ECKB 2VCTA 4YQMA 4MH2A 4AJ8A 3RAZA 2D2ZA 4IJ3A 3CMIA 4KCEA 1K3LA 4HQZA 2LRNA 3GFKA 4G0IA 3UBLA 2DJ3A 2ZUPA 4I6XA 4E8HA 4NAXA 3HXSA 4POBA 2HE3A 2H1GA 2IPAA 2REMA 2GQLA 1T1VA 3AY8A 1EV4A 2TRXA 2H72A 1M9AA 1YF0A 1MDKA 4WR5A 3CSIA 1K0CA 3FYGA 5ECPB 1BYEA 4OFMA 5E4WA 2GS3A 4X0XA 4I2UA 1OVNA 4MK3A 1TJDA 1HNCA 1O8WA 2C0FA 3GSTA 3GURA 1X5DA 2FD3A 2H01A 1TK5B 5J4UA 4QQ7A 2C8UA 2FNOA 2OKAA 3A3TA 1GRXA 2DJJA 2YPMA 4BWQA 1PD21 3M9KA 4ZBBA 1V2AA 1R4WA 4F82A 1AW9A 2QSIA 1GWCA 3HY2A 3L4NA 3RDWA 16GSA 3KMOA 2WJUA 3CBUA 3ZFLA 3N5OA 2ES7A 1A23A 1XW5A 1YQ1A 4OFTA 3TB2A 5B8BA 2GZZA 3IBHA 1T4ZA 4FIWA 2YZUA 2GQKA 3GIXA 1AUCA 2AJQB 5CYYA 1EWXA 1I9DA 2X64A 4NV2A 3DWVA 2CV4A 1XPVA 3FW2A 5ECOB 1Q4JA 2VLTA 3G7YA 1EGOA 4IKHA 5AISA 1XOAA 1OE8A 2CX3A 3TKQA 1U3AA 4PUFC 3WD6A 5GSSA 4V2MA 3GN3A 3ZVJA 4OFNA 5EPFA 5G1KA 3L9SA 1AIUA 4GF0A 2HNLA 2KP2A 5B7CA 3PGTA 4TR4A 4WBJA 4OD7A 3D22A 3KH9A 2J9HA 3IR4A 1MDIA 2FA8A 4I5QA 2HSHA 2HRFA 3KJYA 5DALA
chains in the Genus database with same CATH superfamily
3QAVA 1H75A 1VF4A 3RPNA 3ZL5A 1ERWA 2RM5A 1OE7A 3L9UA 5J40A 4I8BA 5IMAA 4YQUA 4PNFA 3G9BA 1F2EA 3MAKA 2MBSA 3TRXA 1U87A 3KD0A 3TJFA 2OBIA 1Y6EA 4GXZA 3UMAA 3PR8A 5IOXA 1SL0B 2EC4A 4AGSA 2LJKA 3BJ5A 17GSA 3N9JA 1IYIA 1YVLA 3U5RE 4JE1A 5IO2A 5AGYA 2IJYA 3GL3A 2O36A 4IJIA 5KN0A 2HRAA 3DD3A 2WB9A 2VM1A 3HA9A 3KIJA 3LJRA 5HR2A 4RI7A 4ZB8A 1J9BA 4PI0C 4L5OA 5DJLA 1IYHA 1F3BA 3WGDA 4Q5QA 1KEBA 1XW6A 2B1KA 3L0HA 3TCOA 2K6VA 1M99A 1OKTA 5AIXA 1XOBA 1PKWA 3TU3B 2R5GA 5DALB 2EIOA 1SK0A 2IN3A 2H76A 1MEKA 3FR3A 1ML6A 2ON5A 1TTZA 1VRSD 2Z9SA 3A5IA 1XWKA 4N10A 4RI6A 1SYXA 2LQQA 3F8UA 3MDKA 2WVXA 1GSYA 1A0FA 2K18A 3C71A 1S3RA 4GSTA 3P90A 1HYUA 1N2AA 5ECMB 1ZYPA 2YN1A 4KA0A 2XHFA 2FCHA 5JCUA 1F9MA 2LV3A 1QK8A 5B8AA 2P31A 2B6MA 4MJBA 4MCUA 3TOTA 4MF7A 4XRDA 1TRSA 2NTOA 1ST9A 2RUEA 3VFIA 4PI2C 1CQHA 4J2FA 5IMCA 5KEJA 6GSXA 3P2AA 3GSSA 4D73A 2N5AA 2CAQA 4EIPA 3Q6OA 3UVHA 3TOUA 3UVTA 4JR4A 4EUYA 1Z7RA 4Q5RA 3UAPA 1B9YC 4CDOA 1T7PB 2VL9A 4XIHA 2C3TA 4HQSA 3QR6A 5DAKA 4H86A 4PHZC 1MD4A 5ECRB 2PUKC 3DXBA 4XS4A 1QQ2A 2GZPA 3E3EA 4X4JA 3CWGA 2OT3A 2QC7A 2V6OA 3NOFA 2GGTA 1G6YA 5GSTA 4CY8A 1T4YA 5KN1A 5CO3A 4GDFA 2XC2A 3WGXA 4KE3A 5J9CA 1TI3A 2RLIA 2YJHA 4A5PA 3JCML 5FHIA 4MLYA 2JZSA 1KTEA 3R2QA 2UZ8A 3LSZA 2E7PA 3ERFA 4FYCA 1SJ6A 3CHXC 6GSSA 5CAXA 1GSEA 4D73B 3C1RA 4PQ1A 3HZ8A 2L6CA 3ZFBA 2DMMA 3KMNA 3DKSA 2AB6A 3GKKA 5G1LA 2B5XA 3EINA 1BG1A 6GSUA 3EMXA 6GSWA 1M0UA 1FB0A 3VI5A 2O7KA 2RIIA 3IHQA 3KXOA 1XWAA 2YJ7A 3I43A 1K3OA 4ILFA 2NPBA 3SWLA 1S3CA 2X99A 3ZMKA 5KOWA 4PURA 2A2RA 1T00A 4XS4B 2YV7A 4MJEA 3V1WA 4IBPA 2EIRA 4IGJA 1PQNA 4N11A 5HFKA 5HR3A 4JEDA 4TR1B 2I1UA 3LQ7A 2LEGA 1ILOA 2MYGA 2MMAA 1EV9A 1VF1A 4KW6A 4YAPA 2KOKA 4EF0A 4X1UA 3DRNA 4NHZA 1F37A 5IOWA 5CP1A 3VWWA 4MMMA 2ALBA 3F6DA 1O81A 1GLPA 4W66A 3RHBA 3RFRC 3EVIA 4TXVA 9GSSA 2P5RA 4GWRA 2F8AA 2LJAA 3ERGA 3H4KA 4OO5A 1XIYA 4XCSA 3ED3A 1LU4A 5B6MA 4RQXA 5BMUA 3WGEA 4BA7A 4HDEA 3O76A 5J9BA 4PUAA 4ZB6A 4IQ1A 1PX7A 5ENUA 1J08A 1OAZA 3HZ4A 4ML6A 5DVBA 2AYTA 1UA5A 3QAWA 1SD9A 3C73A 4BVXA 2VD1A 1SK2A 2GDRA 2X8CA 4ISDA 1A8YA 3L9VA 3TJBA 2DKIA 4YAVA 1F3AA 1URMA 2MZCA 2OJLA 1KNGA 4G19A 1X5EA 1GLQA 5CRGA 1Q98A 2H70A 5IMFA 1K0MA 3EE2A 3BBYA 1XW9A 4ZBAA 2M80A 2O87A 5E59A 10GSA 3RGBC 2PERA 4FYBA 4J56E 3WYWA 2OE1A 1ERUA 2OE0A 2LS5A 3CSJA 2LTKA 3IOSA 5A5HB 3VI7A 1GNWA 1THXA 5F06A 3ERWA 4IP1A 4J57E 5COHA 3TRQA 1I1IP 3GKXA 1WWJA 4ECBA 1FVKA 3QAGA 5GZZB 4G2EA 3FR9A 1M7TA 2AAWA 4FYUA 2C80A 1EP7A 5H5RA 3IAM2 20GSA 5LD0A 4IS0A 1V9WA 1JFUA 1TK0B 3R3EA 1KBNA 3QFBC 2HRNA 4ZXGA 4BVXB 4N3ZA 2X8GA 1FB6A 3LYPA 5DCHA 4EXJA 3KGKA 1WJKA 5HFIA 3QD9A 4PXOA 1V57A 1A24A 1GUKA 2VD0A 2GQMA 4OMVA 4MNNA 1AQVA 3DVXA 1Y25A 2CA8A 2YWNA 4AF2A 1GH2A 5HFGA 3I69A 4V2NA 4EO3A 4K5SA 5DBQA 3M1GA 3HHVA 3APSA 4PQIA 3Q18A 5F07A 1ERTA 3CTFA 5JCWA 5J5NA 4PTSA 4EVMA 4HJ2A 3M0FA 4K5RA 1Z5YE 4LA1A 1SL1B 4YH2A 2GTUA 2A4VA 2VL3A 3EC3A 1K0BA 1VF3A 2DLXA 3PPUA 1JLWA 1EEJA 1EP8A 1K0NA 3VPQA 1GULA 1BF5A 3IAS2 3MYDA 4IN0A 1PGTA 2WZ9A 5ECQB 4ZB9A 3VWXA 5INYA 1V98A 1B48A 2H0GA 4LL4B 3TKRA 2WRTA 2R6KA 5CRHA 3TUEA 1QUWA 1U88A 4BL7A 4NXIA 4K2DA 2I3YA 2WVZA 1X9MB 3ME8A 1SJZA 3LG6A 5A4UA 2VL2C 4KDXA 2H71A 5IO0A 2H1AA 4JRRA 1AAZA 3DEXA 5J3RA 1TOFA 4ZL8A 1UC7A 4XS1A 3GNJA 1SU9A 4X43A 3W6GA 3HD5A 3D4MA 3GYKA 5IMDA 1O8XA 1TXUA 1YF1A 4G01A 4AKGA 1GNEA 1A8LA 1GSDA 4IVFA 3FZ4A 4BIKA 4HEA2 2HQTA 2X8HA 3J7Yb 3EYTA 4EDYA 4HU7A 1TI1A 5F05A 1SVOA 2B7JA 4Z2UA 2H6ZA 4MJCA 4WR4A 2A4HA 4L5LA 1W89A 3ZLPA 5EL8A 3FMWA 1XCCA 1JZDA 1G0TA 3GV1A 3FY7A 2YNXA 3D21A 2E2GA 4TOPA 1PFOA 4GSSA 14GSA 4YKFA 4HZ2A 3P7XA 2YZHA 1WOUA 2O89A 2GSQA 2VO4A 1BEDA 1VGLA 1X9WB 2CVBA 1WPIA 4TR3A 2MMOA 2WW0A 4BL7B 1UN2A 1PSQA 3LW9A 2XBQA 3DVWA 3F3RA 1W4VA 4HZ4A 3UEMA 1R5AA 3DYRA 1PKZA 2H19A 1SVMA 4ZBDA 2C1YA 4ZB7A 2R0PA 3ZZXA 1PN0A 2N5FA 2LUSA 4YQVA 4JR6A 2LRTA 2CQ9A 2IFQA 6GSVA 2G0FA 3A2VA 4KGIA 4CW9A 2XPDA 3D5JA 3RPPA 2G2QA 3Q19A 4GSNA 4AI6A 1A2LA 5JWRB 4K6XA 4NWYA 2R4VA 5KN2A 2VCQA 2V41A 3IK7A 2WCIA 3KTBA 1AQWA 2VL2A 4MDCA 1TRVA 2VUPA 4ML1A 1K0OA 2DJKA 4L0UA 1M3IA 2HZEA 3A5WA 3CQFA 2OBKA 1ON4A 2OADA 1G7OA 3FRCA 2B1LA 3KZQA 1DE2A 4ZL9A 2P5QA 2PN8A 1LBKA 2N5BA 4KCAA 3IPZA 1O6JA 4K7NA 3QPMA 2LNTA 3TRPA 1SKSB 2PU9C 2BJXA 4TR0A 1C72A 4O92A 3PINA 2H6YA 1H4OA 2BMXA 2DMLA 1K0DA 4KB3A 2J23A 2R3XA 2AHEA 4KSOA 1ACVA 2JU5A 1XWBA 3HJMA 5ID2B 3UJ1A 1TDIA 1EOHA 2FWGA 2YCDA 1XBSA 4ZIJA 2WW2A 4MF5A 3GHAA 3GX8A 2V2GA 2H73A 2LRCA 3EPTA 2IFQB 2TRCP 1M2BA 1GUHA 2JSYA 1FG4A 4TR1A 3A2WA 3GUSA 4IQAA 2LKUA 2ZNMA 4WETA 4DSRA 4GTUA 3APQA 4Q5NA 3O3TA 2E0QA 2CT6A 1M9BA 1SJIA 3I9V2 5H5SA 3D6IA 1Z6MA 1U6TA 3VURA 4L8EA 1ZCPA 2HZEB 4GRFA 4FO5A 2JZTA 4K9ZA 1QFNA 4EE0A 3LEFA 3LXZA 5A1NB 2F8FA 2ON7A 1O73A 3G7JA 4MZWA 1R7HA 2GSRA 4G0LA 3BCKA 5GAND 1HNBA 4XTSA 2VAFA 2DKHA 2XBIA 2B3SA 3BD2A 4QL7A 3TJKA 1JHBA 5G5EA 1QGVA 2H1BA 1JLVA 2IMFA 4OO4A 3HCZA 3C8EA 4NPBA 4ZL7A 4P3YB 5ECLB 4E68A 3GX0A 3VLNA 1EGRA 3APOA 3KEBA 1ZMAA 1PX6A 5AIVA 4TXOA 1EEMA 11GSA 2PGTA 5KN3A 4FXYP 3RHCA 1R5PA 2PWJA 2HRKA 4KDYA 3GH9A 4TRXA 2QGVA 1PA3A 2WGRA 2JACA 2MBTA 3IE3A 1SKRB 2KLXA 3US3A 4PNGA 3W8JA 3FZ5A 4I2TA 1GL8A 2K9FA 2B5YA 2F51A 1YKCA 3EURA 1FAAA 1AXDA 2HYXA 1QMVA 5EVOA 1ZYQB 1YZXA 1GTBA 4V2LA 1YJ6A 5IQYA 2L4CA 2HFDA 4OCFA 1XVQA 1SENA 3KP9A 5J41A 4JZQA 4XHMA 1N8JA 2L57A 1LJRA 3J7Yk 2MMZA 1USBA 2VCVA 3W8SA 5A5HA 1BQ7A 2L5OA 4FQUA 4BWSA 3GKNA 2LQOA 2IMDA 3ZVJD 2FUG2 2FA4A 2YANA 2B7KA 3D4TA 3ZIJA 2XPEA 2NDOA 5L71A 1G7EA 4POMA 1HQOA 3MSZA 1TKDB 3F0IA 1U3IA 2NVLA 2C3NA 2QKEA 3EMPA 4TXOB 1GSQA 3TKSC 2PPTA 3ZTLA 1K3YA 2CVKA 1SL2B 1GSFA 2DC5A 2C0EA 1DUGA 1UVZA 2HRKB 2O3EA 3FHKA 4G0KA 2KHPA 5IPGA 3CSHA 1XWGA 4USSA 5ELGA 2HLSA 3IC4A 3UOMA 1AC1A 1Z9HA 2EIQA 2WS2A 5DJMA 2WULA 1A2JA 3TKSE 2GSSA 2HSNB 3H79A 3LXTA 1OYJA 3EU4A 3MNGA 4ICYA 3MWHA 3HJOA 5GAPD 1YY7A 2LJRA 2H74A 4GCIA 2O5VA 3F3QA 4NHWA 3H8QA 4Z2TA 1K0AA 3ZYWA 3ZRDA 4IW9A 1TRUA 1YDKA 5C00A 1YEXA 2FY6A 3FK8A 1T3BA 5AN1A 2O8VB 5ECIB 2VCZA 1XZOA 2VLVA 1TP9A 3FR6A 4POLA 2HSYA 1PL1A 1X5CA 3DIEA 3WT2A 3TJJA 3ZITA 1M2DA 1T8EB 3FEUA 3GKMA 3FKFA 5BRTA 5JWQB 3F63A 1B4PA 2M72A 2H0HA 3K8NA 2AV4A 5DDLA 3FZ9A 3HVVA 4PQHA 3F4TA 1XXUA 4BVYA 2JSZA 1FHEA 1PMTA 6GSYA 4EIQA 1A0RP 5D96A 1DE1A 4F0CA 5IM9A 3TKSA 1HD2A 2F3MA 1YKAA 1TRWA 3UARA 3NZNA 2EFHA 3FZAA 1RW1A 3HVSA 2I4AA 3GH6A 2HSMA 4QL9A 3VPTA 5G5FA 4E8EA 1V40A 4HS1A 3C1SA 2RUFA 1FVJA 1PRXA 3IK9A 5D9XA 2BTOT 4K7OA 4JU5A 4V1Ap 2YV9A 1JZRA 1TK8B 4MA9A 5J4VA 4JBBA 2NBSA 2C3QA 2C4JA 1Z7PA 1NHYA 2L4QA 2WW1A 2C0DA 3ZREA 4ULXA 5G31A 1BX9A 4V1Ag 2L5LA 2YWOA 19GSA 4RQRA 4DVCA 3M8NA 5DQSA 1B4QA 4MPGA 2PVQA 3WT1A 4K2XA 1SYRA 3IDVA 1TU7A 1FW1A 1VF2A 1BJXA 2GT5A 2VCWA 4F0BA 1E6BA 3H1NA 5G30A 2HZFA 5ECHB 3HVXA 4LLRA 4BVYB 1BG5A 2IMIA 1G6WA 2GVPA 5CRDA 4IELA 2P0GA 2R2JA 2DSAA 1EOGA 4K1FA 2YOIA 2FWHA 3MIXA 3EU3A 3S9FA 22GSA 4O5RA 1YEWC 1EZKA 5D93A 5EY6A 1I5GA 2OACA 2HI7A 5CRWA 2HSMB 3P8WA 1WRYA 4F2IA 3IHGA 4MPFA 1RK4A 3M9JA 1A2MA 4MZBA 4EL1A 2GSTA 3DGQA 2MMNA 2DJ0A 2IMKA 3VK9A 1SVLA 3UIWA 1FOVA 2CVDA 4MJAA 1ZZYA 2H1DA 5DCGA 5A5KA 4HU9A 1JZOA 1NHOA 2I9HA 3LFLA 1GTUA 4GQCA 4DSSA 2WVYA 3H93A 4N0VA 4MH3A 3G7IA 2TIRA 2FWFA 4RUVA 3KM6A 3GMFA 2EFDA 2WFCA 2DJ2A 1PL2A 1YEPA 2VOCA 2RM6A 5LCZA 2F9SA 1NSWA 2DIYA 3CTGA 4K0GA 3I6AA 1Z6NA 6GSTA 3PH9A 5HR1A 4Z7XA 1SKWB 3QOUA 4LL1B 1JZWA 2LSTA 3BOAA 3IRAA 5IPHA 4KX4A 5A4WA 2JADA 2DBCA 1MD3A 4F03A 3UBKA 5ID2A 1ZGNA 2UV8G 2FHEA 1GUMA 4AJ7A 4GLTA 4MZCA 4N30A 4G9HA 4O7HA 1ZL9A 4XRAA 3HYPA 5F0GA 1CQGA 3ISOA 1OC9A 4YKGA 5LNKe 2O85A 5F8BA 5HR0A 12GSA 1ZYEA 1WIKA 5H5QA 3ZIVA 4WF4A 4EKZA 1WP0A 1SD8A 3U6VA 1ABAA 2K8VA 4Q5FA 3Q74A 5DQYA 4DSSB 3LWAA 5A1NA 4HUAA 2A2PA 1J0FA 3HMJG 1FO5A 5FWGA 3O6TA 5D8IA 1DBYA 2YWMA 1M2AA 2CAIA 5ECNB 3QMXA 1SK1A 3HVNA 2IMEA 3GRXA 3F4SA 2PMTA 1O85A 4ZILA 4O32A 4TKYA 1OC3A 2CZ2A 3IA1A 2YP6A 4N0ZA 5B6NA 2E2MA 5ABRA 3CRUA 3SBCA 4HOJA 3QDNA 3KCMA 4KH7A 1GP1A 3IXRA 2V1MA 5CREA 2WW3A 4AKIA 1QXHA 2KUCA 2A2SA 3LORA 3HJPA 3F4RA 2FWEA 5IIZA 4IHUA 4DSQA 4KDUA 3VWUA 2HT9A 2R0CA 1OC9B 1MTCA 4KUNA 1DSBA 4WF5A 2PBJA 2L59A 3ME7A 4LMVA 18GSA 4NMUA 2WVXB 3ZMLA 1F6MC 13GSA 1XG8A 1TXXA 4TW5A 4LMWA 2R0GA 4F9ZA 4EDZA 5FT3A 1GTIA 3DMLA 1GSSA 2H30A 3TGZA 3GTUA 1Z3EA 3D0ZA 4HI7A 4ACSA 4NV5A 3E0UA 1V58A 4MABA 3KP8A 2CZ3A 1OC8A 3IV4A 2DJ1A 4G10A 4WXTA 4K8MA 5IMZA 3UL3A 5HQPA 4XS6A 4FH8A 4TN8A 2OE3A 2H0IA 3QFAC 3F6FA 5J47A 1ZOFA 1TU8A 5CNWA 1N25A 1WMJA 2C0GA 8GSSA 3L78A 2DIZA 4KNDA 3VWVA 3EWLA 1XWCA 2PVOC 5D9TA 2YWIA 1MDJA 2H6XA 3HKRA 4L0WA 5JWOB 2QA1A 2H8LA 3HDCA 5JCGA 1HNAA 1BAYA 1XFLA 2IIYA 2EFCA 1S3AA 1Y1UA 5DAKB 3M3MA 5D73A 3TKPA 4POKA 2HSNA 2VLUA 1S4BP 4OWYA 4IP6A 5D9WA 1THOA 3GTUB 1AQXA 2VIMA 4WEYA 2V6KA 4KAEA 1NM3A 4OCEA 2AUVA 3GL5A 2K8SA 5D9VA 2X4AA 1RQMA 2M46A 2WZSA 4HJMA 2KP1A 5C04A 4KF9A 4TVEA 4MP4A 3IC8A 1GSUA 5IMVA 2I81A 2R37A 7GSSA 1S3DA 2CX4A 4ID0A 1R26A 5ELAA 4ECIA 3LGCA 1E2YA 4MF6A 2HXKA 5ECSA 3TJGA 4CY6A 4ECCA 3QCPA 3OR5A 5A34A 4HSCX 2JL4A 4CHSA 1X0RA 2JZRA 4O5UA 4PGTA 4BPYA 1OKDA 4EC0A 1XVWA 4AJ6A 2H66A 2GT6A 3LYKA 1B9XC 4WKWA 1X9SB 2QA2A 2VM2A 2H75A 3TDGA 1O7UA 4ECJA 4K0NA 3C7MA 4PX1A 3RBTA 3BCIA 3A2XA 2LNSA 4KSMA 3KTLA 1WE0A 2L6DA 1GTAA 4I97A 4GQFA 3F9UA 1ERVA 3E9JB 2ZCTA 5A4VA 1B8XA 2GZYA 5KOXA 2IL3A 2B5EA 2V32A 4DEJA 1TW9A 4K7IA 2WDUA 2H1LA 2VCXA 5G2ZA 2OA7A 2IWTA 2FGXA 3KH7A 2GLRA 3GA4A 4WBRD 3NIVA 3CYNA 2FLSA 3CXGA 3CRTA 1NW2A 2X49A 1PN9A 5ECKB 2VCTA 4YQMA 4MH2A 4AJ8A 3RAZA 2D2ZA 4IJ3A 3CMIA 4KCEA 1K3LA 4HQZA 2LRNA 3GFKA 4G0IA 3UBLA 2DJ3A 2ZUPA 4I6XA 4E8HA 5A34B 4NAXA 3HXSA 4POBA 5BMUB 2HE3A 4QMKA 2H1GA 2IPAA 2REMA 2GQLA 4AKXB 1T1VA 3AY8A 1EV4A 2TRXA 2H72A 1M9AA 1YF0A 1MDKA 4WR5A 3CSIA 1K0CA 3FYGA 5ECPB 1BYEA 4OFMA 5E4WA 2GS3A 4X0XA 4I2UA 1OVNA 4MK3A 1TJDA 1HNCA 1O8WA 2C0FA 3GSTA 3GURA 1X5DA 1FOHA 2H01A 2FD3A 1TK5B 2VKZG 5J4UA 4QQ7A 2C8UA 2FNOA 2OKAA 3A3TA 1GRXA 2DJJA 2YPMA 4BWQA 1PD21 3M9KA 4AKHA 4ZBBA 1V2AA 1R4WA 4Z2RA 4F82A 1AW9A 2QSIA 1GWCA 3HY2A 3L4NA 3RDWA 16GSA 5J4YA 3KMOA 2WJUA 3CBUA 3ZFLA 3N5OA 2ES7A 1A23A 1XW5A 1YQ1A 4OFTA 3TB2A 5B8BA 2GZZA 3IBHA 1T4ZA 2YZUA 4FIWA 2GQKA 3GIXA 1AUCA 2AJQB 5CYYA 1EWXA 1I9DA 2X64A 4NV2A 3DWVA 2CV4A 1XPVA 3FW2A 5ECOB 2EFEA 1Q4JA 2VLTA 3G7YA 1EGOA 4IKHA 5AISA 1XOAA 1OE8A 2CX3A 3TKQA 1U3AA 4PUFC 3WD6A 5GSSA 4V2MA 3GN3A 3ZVJA 4OFNA 5EPFA 5G1KA 3L9SA 1AIUA 4GF0A 2HNLA 2KP2A 5B7CA 1M3JA 3PGTA 4TR4A 4WBJA 4OD7A 3D22A 3KH9A 2J9HA 3IR4A 1MDIA 1ZYNA 2FA8A 4O5QA 4I5QA 2HSHA 2HRFA 3KJYA 5DALA
chains in the Genus database with same CATH topology
3QAVA 1H75A 1VF4A 3RPNA 3ZL5A 1ERWA 2RM5A 1OE7A 3L9UA 5J40A 4I8BA 5IMAA 4YQUA 4PNFA 3G9BA 1F2EA 3MAKA 2MBSA 3TRXA 1U87A 3KD0A 3TJFA 2OBIA 1Y6EA 4GXZA 3UMAA 3PR8A 5IOXA 1SL0B 2EC4A 4AGSA 2LJKA 3BJ5A 17GSA 3N9JA 1IYIA 1YVLA 3U5RE 4JE1A 5IO2A 5AGYA 2IJYA 3GL3A 4IJIA 5KN0A 2HRAA 3DD3A 2WB9A 2VM1A 3HA9A 3KIJA 3LJRA 5HR2A 4RI7A 4ZB8A 1J9BA 4L5OA 5DJLA 1IYHA 1F3BA 3WGDA 4Q5QA 1KEBA 1XW6A 2B1KA 3L0HA 3TCOA 2K6VA 1M99A 1OKTA 5AIXA 1XOBA 1PKWA 3TU3B 2R5GA 5DALB 2EIOA 1SK0A 2IN3A 2H76A 1MEKA 3FR3A 1ML6A 2ON5A 1TTZA 1VRSD 2Z9SA 3A5IA 1XWKA 4N10A 4RI6A 1SYXA 2LQQA 3F8UA 3MDKA 1GSYA 1A0FA 2K18A 3C71A 4GSTA 3P90A 1HYUA 1N2AA 5ECMB 1ZYPA 2YN1A 4KA0A 2XHFA 2FCHA 5JCUA 1F9MA 2LV3A 1QK8A 5B8AA 2P31A 2B6MA 4MJBA 4MCUA 3TOTA 4MF7A 4XRDA 1TRSA 2NTOA 1ST9A 2RUEA 3VFIA 1CQHA 4J2FA 5IMCA 5KEJA 6GSXA 3P2AA 3GSSA 4D73A 2N5AA 2CAQA 4EIPA 3Q6OA 3UVHA 3TOUA 3UVTA 4JR4A 4EUYA 1Z7RA 4Q5RA 3UAPA 1B9YC 4CDOA 1T7PB 2VL9A 4XIHA 2C3TA 4HQSA 3QR6A 5DAKA 4H86A 1MD4A 5ECRB 2PUKC 3DXBA 4XS4A 1QQ2A 2GZPA 3E3EA 4X4JA 3CWGA 2OT3A 2QC7A 2V6OA 3NOFA 2GGTA 1G6YA 5GSTA 4CY8A 1T4YA 5KN1A 5CO3A 4GDFA 2XC2A 3WGXA 4KE3A 5J9CA 1TI3A 2RLIA 2YJHA 4A5PA 3JCML 5FHIA 4MLYA 2JZSA 1KTEA 3R2QA 2UZ8A 3LSZA 2E7PA 3ERFA 4FYCA 1SJ6A 6GSSA 5CAXA 1GSEA 4D73B 3C1RA 4PQ1A 3HZ8A 2L6CA 3ZFBA 2DMMA 3KMNA 3DKSA 2AB6A 3GKKA 5G1LA 2B5XA 3EINA 1BG1A 6GSUA 3EMXA 6GSWA 1M0UA 1FB0A 3VI5A 2O7KA 2RIIA 3IHQA 3KXOA 1XWAA 2YJ7A 3I43A 1K3OA 4ILFA 2NPBA 3SWLA 1S3CA 2X99A 3ZMKA 5KOWA 4PURA 2A2RA 1T00A 4XS4B 2YV7A 4MJEA 3V1WA 4IBPA 2EIRA 4IGJA 1PQNA 4N11A 5HFKA 5HR3A 4JEDA 4TR1B 2I1UA 3LQ7A 2LEGA 1ILOA 2MYGA 2MMAA 1EV9A 1VF1A 4KW6A 4YAPA 2KOKA 4EF0A 4X1UA 3DRNA 4NHZA 1F37A 5IOWA 5CP1A 3VWWA 4MMMA 2ALBA 3F6DA 1O81A 1GLPA 4W66A 3RHBA 3EVIA 4TXVA 9GSSA 2P5RA 4GWRA 2F8AA 2LJAA 3ERGA 3H4KA 4OO5A 1XIYA 4XCSA 3ED3A 1LU4A 5B6MA 4RQXA 5BMUA 3WGEA 4BA7A 4HDEA 3O76A 5J9BA 4PUAA 4ZB6A 4IQ1A 1PX7A 5ENUA 1J08A 1OAZA 3HZ4A 4ML6A 5DVBA 2AYTA 1UA5A 3QAWA 1SD9A 3C73A 4BVXA 2VD1A 1SK2A 2GDRA 2X8CA 4ISDA 1A8YA 3L9VA 3TJBA 2DKIA 4YAVA 1F3AA 1URMA 2MZCA 2OJLA 1KNGA 4G19A 1X5EA 1GLQA 5CRGA 1Q98A 2H70A 5IMFA 1K0MA 3EE2A 3BBYA 1XW9A 4ZBAA 2M80A 2O87A 5E59A 10GSA 2PERA 4FYBA 4J56E 3WYWA 2OE1A 1ERUA 2OE0A 2LS5A 3CSJA 2LTKA 3IOSA 5A5HB 3VI7A 1GNWA 1THXA 5F06A 3ERWA 4IP1A 4J57E 5COHA 3TRQA 3GKXA 1WWJA 4ECBA 1FVKA 3QAGA 5GZZB 4G2EA 3FR9A 1M7TA 2AAWA 4FYUA 2C80A 1EP7A 5H5RA 3IAM2 20GSA 5LD0A 4IS0A 1V9WA 1JFUA 1TK0B 3R3EA 1KBNA 3QFBC 2HRNA 4ZXGA 4BVXB 4N3ZA 2X8GA 1FB6A 3LYPA 5DCHA 4EXJA 3KGKA 1WJKA 5HFIA 3QD9A 4PXOA 1V57A 1A24A 1GUKA 2VD0A 2GQMA 4OMVA 4MNNA 1AQVA 3DVXA 1Y25A 2CA8A 2YWNA 4AF2A 1GH2A 5HFGA 3I69A 4V2NA 4EO3A 4K5SA 5DBQA 3M1GA 3HHVA 3APSA 4PQIA 3Q18A 5F07A 1ERTA 3CTFA 5JCWA 5J5NA 4PTSA 4EVMA 4HJ2A 3M0FA 4K5RA 1Z5YE 4LA1A 1SL1B 4YH2A 2GTUA 2A4VA 2VL3A 3EC3A 1K0BA 1VF3A 2DLXA 3PPUA 1JLWA 1EEJA 1EP8A 1K0NA 3VPQA 1GULA 1BF5A 3IAS2 3MYDA 4IN0A 1PGTA 2WZ9A 5ECQB 4ZB9A 3VWXA 5INYA 1V98A 1B48A 2H0GA 4LL4B 3TKRA 2WRTA 2R6KA 5CRHA 3TUEA 1QUWA 1U88A 4BL7A 4NXIA 4K2DA 2I3YA 1X9MB 3ME8A 1SJZA 3LG6A 5A4UA 2VL2C 4KDXA 2H71A 5IO0A 2H1AA 4JRRA 1AAZA 3DEXA 5J3RA 1TOFA 4ZL8A 1UC7A 4XS1A 3GNJA 1SU9A 4X43A 3W6GA 3HD5A 3D4MA 3GYKA 5IMDA 1O8XA 1TXUA 1YF1A 4G01A 4AKGA 1GNEA 1A8LA 1GSDA 4IVFA 3FZ4A 4HEA2 2HQTA 2X8HA 3J7Yb 3EYTA 4EDYA 4HU7A 1TI1A 5F05A 1SVOA 2B7JA 4Z2UA 2H6ZA 4MJCA 4WR4A 2A4HA 4L5LA 1W89A 3ZLPA 5EL8A 3FMWA 1XCCA 1JZDA 1G0TA 3GV1A 3FY7A 2YNXA 3D21A 2E2GA 4TOPA 4GSSA 14GSA 4YKFA 4HZ2A 3P7XA 2YZHA 1WOUA 2O89A 2GSQA 2VO4A 1BEDA 1VGLA 1X9WB 2CVBA 1WPIA 4TR3A 2MMOA 4BL7B 1UN2A 1PSQA 3LW9A 2XBQA 3DVWA 3F3RA 1W4VA 4HZ4A 3UEMA 1R5AA 3DYRA 1PKZA 2H19A 1SVMA 4ZBDA 2C1YA 4ZB7A 2R0PA 3ZZXA 1PN0A 2N5FA 2LUSA 4YQVA 4JR6A 2LRTA 2CQ9A 2IFQA 6GSVA 2G0FA 3A2VA 4KGIA 4CW9A 2XPDA 3D5JA 3RPPA 2G2QA 3Q19A 4GSNA 4AI6A 1A2LA 5JWRB 4K6XA 4NWYA 2R4VA 5KN2A 2VCQA 2V41A 3IK7A 2WCIA 3KTBA 1AQWA 2VL2A 4MDCA 1TRVA 2VUPA 4ML1A 1K0OA 2DJKA 4L0UA 2HZEA 3A5WA 2OBKA 1ON4A 2OADA 1G7OA 3FRCA 2B1LA 3KZQA 1DE2A 4ZL9A 2P5QA 2PN8A 1LBKA 2N5BA 4KCAA 3IPZA 1O6JA 4K7NA 3QPMA 2LNTA 3TRPA 1SKSB 2PU9C 2BJXA 4TR0A 1C72A 4O92A 3PINA 2H6YA 1H4OA 2BMXA 2DMLA 1K0DA 4KB3A 2J23A 2R3XA 2AHEA 4KSOA 1ACVA 2JU5A 1XWBA 3HJMA 5ID2B 3UJ1A 1TDIA 1EOHA 2FWGA 2YCDA 1XBSA 4ZIJA 4MF5A 3GHAA 3GX8A 2V2GA 2H73A 2LRCA 3EPTA 2IFQB 2TRCP 1M2BA 1GUHA 2JSYA 1FG4A 4TR1A 3A2WA 3GUSA 4IQAA 2LKUA 2ZNMA 4WETA 4DSRA 4GTUA 3APQA 4Q5NA 3O3TA 2E0QA 2CT6A 1M9BA 1SJIA 3I9V2 5H5SA 3D6IA 1Z6MA 1U6TA 3VURA 4L8EA 1ZCPA 2HZEB 4GRFA 4FO5A 2JZTA 4K9ZA 1QFNA 4EE0A 3LEFA 3LXZA 5A1NB 2F8FA 2ON7A 1O73A 3G7JA 4MZWA 1R7HA 2GSRA 4G0LA 3BCKA 5GAND 1HNBA 4XTSA 2VAFA 2DKHA 2XBIA 2B3SA 3BD2A 4QL7A 3TJKA 1JHBA 5G5EA 1QGVA 2H1BA 1JLVA 2IMFA 4OO4A 3HCZA 3C8EA 4NPBA 4ZL7A 4P3YB 5ECLB 4E68A 3GX0A 3VLNA 1EGRA 3APOA 3KEBA 1ZMAA 1PX6A 5AIVA 4TXOA 1EEMA 11GSA 2PGTA 5KN3A 3RHCA 1R5PA 2PWJA 2HRKA 4KDYA 3GH9A 4TRXA 2QGVA 1PA3A 2WGRA 2JACA 2MBTA 3IE3A 1SKRB 2KLXA 3US3A 4PNGA 3W8JA 3FZ5A 4I2TA 1GL8A 2K9FA 2B5YA 2F51A 1YKCA 3EURA 1FAAA 1AXDA 2HYXA 1QMVA 5EVOA 1ZYQB 1YZXA 1GTBA 4V2LA 1YJ6A 5IQYA 2L4CA 2HFDA 4OCFA 1XVQA 1SENA 3KP9A 5J41A 4JZQA 4XHMA 1N8JA 2L57A 1LJRA 3J7Yk 2MMZA 1USBA 2VCVA 3W8SA 5A5HA 1BQ7A 2L5OA 4FQUA 4BWSA 3GKNA 2LQOA 2IMDA 3ZVJD 2FUG2 2FA4A 2YANA 2B7KA 3D4TA 3ZIJA 2XPEA 2NDOA 5L71A 1G7EA 4POMA 1HQOA 3MSZA 1TKDB 3F0IA 1U3IA 2NVLA 2C3NA 2QKEA 3EMPA 4TXOB 1GSQA 3TKSC 2PPTA 3ZTLA 1K3YA 2CVKA 1SL2B 1GSFA 2DC5A 2C0EA 1DUGA 1UVZA 2HRKB 3FHKA 4G0KA 2KHPA 5IPGA 3CSHA 1XWGA 4USSA 5ELGA 2HLSA 3IC4A 3UOMA 1AC1A 1Z9HA 2EIQA 2WS2A 5DJMA 2WULA 1A2JA 3TKSE 2GSSA 2HSNB 3H79A 3LXTA 1OYJA 3EU4A 3MNGA 4ICYA 3MWHA 3HJOA 5GAPD 1YY7A 2LJRA 2H74A 4GCIA 2O5VA 3F3QA 4NHWA 3H8QA 4Z2TA 1K0AA 3ZYWA 3ZRDA 4IW9A 1TRUA 1YDKA 5C00A 1YEXA 2FY6A 3FK8A 1T3BA 5AN1A 2O8VB 5ECIB 2VCZA 1XZOA 2VLVA 1TP9A 3FR6A 4POLA 2HSYA 1PL1A 1X5CA 3DIEA 3WT2A 3TJJA 3ZITA 1M2DA 1T8EB 3FEUA 3GKMA 3FKFA 5BRTA 5JWQB 3F63A 1B4PA 2M72A 2H0HA 3K8NA 2AV4A 5DDLA 3FZ9A 3HVVA 4PQHA 3F4TA 1XXUA 4BVYA 2JSZA 1FHEA 1PMTA 6GSYA 4EIQA 1A0RP 5D96A 1DE1A 4F0CA 5IM9A 3TKSA 1HD2A 2F3MA 1YKAA 1TRWA 3UARA 3NZNA 2EFHA 3FZAA 1RW1A 3HVSA 2I4AA 3GH6A 2HSMA 4QL9A 3VPTA 5G5FA 4E8EA 1V40A 4HS1A 3C1SA 2RUFA 1FVJA 1PRXA 3IK9A 5D9XA 2BTOT 4K7OA 4JU5A 4V1Ap 2YV9A 1JZRA 1TK8B 4MA9A 5J4VA 4JBBA 2NBSA 2C3QA 2C4JA 1Z7PA 1NHYA 2L4QA 2C0DA 3ZREA 4ULXA 5G31A 1BX9A 4V1Ag 2L5LA 2YWOA 19GSA 4RQRA 4DVCA 3M8NA 5DQSA 1B4QA 4MPGA 2PVQA 3WT1A 4K2XA 1SYRA 3IDVA 1TU7A 1FW1A 1VF2A 1BJXA 2GT5A 2VCWA 4F0BA 1E6BA 3H1NA 5G30A 2HZFA 5ECHB 3HVXA 4LLRA 4BVYB 1BG5A 2IMIA 1G6WA 2GVPA 5CRDA 4IELA 2P0GA 2R2JA 2DSAA 1EOGA 4K1FA 2YOIA 2FWHA 3MIXA 3EU3A 3S9FA 22GSA 4O5RA 1EZKA 5D93A 5EY6A 1I5GA 2OACA 2HI7A 5CRWA 2HSMB 3P8WA 1WRYA 4F2IA 3IHGA 4MPFA 1RK4A 3M9JA 1A2MA 4MZBA 4EL1A 2GSTA 3DGQA 2MMNA 2DJ0A 2IMKA 3VK9A 1SVLA 3UIWA 1FOVA 2CVDA 4MJAA 1ZZYA 2H1DA 5DCGA 5A5KA 4HU9A 1JZOA 1NHOA 2I9HA 3LFLA 1GTUA 4GQCA 4DSSA 3H93A 4N0VA 4MH3A 3G7IA 2TIRA 2FWFA 4RUVA 3KM6A 3GMFA 2EFDA 2WFCA 2DJ2A 1PL2A 1YEPA 2VOCA 2RM6A 5LCZA 2F9SA 1NSWA 2DIYA 3CTGA 4K0GA 3I6AA 1Z6NA 6GSTA 3PH9A 5HR1A 4Z7XA 1SKWB 3QOUA 4LL1B 1JZWA 2LSTA 3BOAA 3IRAA 5IPHA 4KX4A 5A4WA 2JADA 2DBCA 1MD3A 4F03A 3UBKA 5ID2A 1ZGNA 2UV8G 2FHEA 1GUMA 4AJ7A 4GLTA 4MZCA 4N30A 4G9HA 4O7HA 1ZL9A 4XRAA 3HYPA 5F0GA 1CQGA 3ISOA 1OC9A 4YKGA 5LNKe 2O85A 5F8BA 5HR0A 12GSA 1ZYEA 1WIKA 5H5QA 3ZIVA 4WF4A 4EKZA 1WP0A 1SD8A 3U6VA 1ABAA 2K8VA 4Q5FA 3Q74A 5DQYA 4DSSB 3LWAA 5A1NA 4HUAA 2A2PA 1J0FA 3HMJG 1FO5A 5FWGA 3O6TA 5D8IA 1DBYA 2YWMA 1M2AA 2CAIA 5ECNB 3QMXA 1SK1A 2IMEA 3GRXA 3F4SA 2PMTA 1O85A 4ZILA 4O32A 4TKYA 1OC3A 2CZ2A 3IA1A 2YP6A 4N0ZA 5B6NA 2E2MA 5ABRA 3CRUA 3SBCA 4HOJA 3QDNA 3KCMA 4KH7A 1GP1A 3IXRA 2V1MA 5CREA 4AKIA 1QXHA 2KUCA 2A2SA 3LORA 3HJPA 3F4RA 2FWEA 5IIZA 4IHUA 4DSQA 4KDUA 3VWUA 2HT9A 2R0CA 1OC9B 1MTCA 4KUNA 1DSBA 4WF5A 2PBJA 2L59A 3ME7A 4LMVA 18GSA 4NMUA 3ZMLA 1F6MC 13GSA 1TXXA 4TW5A 4LMWA 2R0GA 4F9ZA 4EDZA 5FT3A 1GTIA 3DMLA 1GSSA 2H30A 3TGZA 3GTUA 1Z3EA 3D0ZA 4HI7A 4ACSA 4NV5A 3E0UA 1V58A 4MABA 3KP8A 2CZ3A 1OC8A 3IV4A 2DJ1A 4G10A 4WXTA 4K8MA 5IMZA 3UL3A 5HQPA 4XS6A 4FH8A 4TN8A 2OE3A 2H0IA 3QFAC 3F6FA 5J47A 1ZOFA 1TU8A 5CNWA 1N25A 1WMJA 2C0GA 8GSSA 3L78A 2DIZA 4KNDA 3VWVA 3EWLA 1XWCA 2PVOC 5D9TA 2YWIA 1MDJA 2H6XA 3HKRA 4L0WA 5JWOB 2QA1A 2H8LA 3HDCA 5JCGA 1HNAA 1BAYA 1XFLA 2IIYA 2EFCA 1S3AA 1Y1UA 5DAKB 3M3MA 5D73A 3TKPA 4POKA 2HSNA 2VLUA 4OWYA 4IP6A 5D9WA 1THOA 3GTUB 1AQXA 2VIMA 4WEYA 2V6KA 4KAEA 1NM3A 4OCEA 2AUVA 3GL5A 2K8SA 5D9VA 2X4AA 1RQMA 2M46A 4HJMA 2KP1A 5C04A 4KF9A 4TVEA 4MP4A 3IC8A 1GSUA 5IMVA 2I81A 2R37A 7GSSA 1S3DA 2CX4A 4ID0A 1R26A 5ELAA 4ECIA 3LGCA 1E2YA 4MF6A 2HXKA 5ECSA 3TJGA 4CY6A 4ECCA 3QCPA 3OR5A 5A34A 2JL4A 4CHSA 1X0RA 2JZRA 4O5UA 4PGTA 4BPYA 1OKDA 4EC0A 1XVWA 4AJ6A 2H66A 2GT6A 3LYKA 1B9XC 4WKWA 1X9SB 2QA2A 2VM2A 2H75A 3TDGA 1O7UA 4ECJA 4K0NA 3C7MA 4PX1A 3RBTA 3BCIA 3A2XA 2LNSA 4KSMA 3KTLA 1WE0A 2L6DA 1GTAA 4I97A 4GQFA 3F9UA 1ERVA 3E9JB 2ZCTA 5A4VA 1B8XA 2GZYA 5KOXA 2IL3A 2B5EA 2V32A 4DEJA 1TW9A 4K7IA 2WDUA 2H1LA 2VCXA 5G2ZA 2OA7A 2IWTA 2FGXA 3KH7A 2GLRA 3GA4A 4WBRD 3NIVA 3CYNA 2FLSA 3CXGA 3CRTA 1NW2A 2X49A 1PN9A 5ECKB 2VCTA 4YQMA 4MH2A 4AJ8A 3RAZA 2D2ZA 4IJ3A 3CMIA 4KCEA 1K3LA 4HQZA 2LRNA 3GFKA 4G0IA 3UBLA 2DJ3A 2ZUPA 4I6XA 4E8HA 5A34B 4NAXA 3HXSA 4POBA 5BMUB 2HE3A 4QMKA 2H1GA 2IPAA 2REMA 2GQLA 4AKXB 1T1VA 3AY8A 1EV4A 2TRXA 2H72A 1M9AA 1YF0A 1MDKA 4WR5A 3CSIA 1K0CA 3FYGA 5ECPB 1BYEA 4OFMA 5E4WA 2GS3A 4X0XA 4I2UA 1OVNA 4MK3A 1TJDA 1HNCA 1O8WA 2C0FA 3GSTA 3GURA 1X5DA 1FOHA 2H01A 2FD3A 1TK5B 2VKZG 5J4UA 4QQ7A 2C8UA 2FNOA 2OKAA 3A3TA 1GRXA 2DJJA 2YPMA 4BWQA 1PD21 3M9KA 4AKHA 4ZBBA 1V2AA 1R4WA 4Z2RA 4F82A 1AW9A 2QSIA 1GWCA 3HY2A 3L4NA 3RDWA 16GSA 5J4YA 3KMOA 2WJUA 3CBUA 3ZFLA 3N5OA 2ES7A 1A23A 1XW5A 1YQ1A 4OFTA 3TB2A 5B8BA 2GZZA 3IBHA 1T4ZA 2YZUA 4FIWA 2GQKA 3GIXA 1AUCA 2AJQB 5CYYA 1EWXA 1I9DA 2X64A 4NV2A 3DWVA 2CV4A 1XPVA 3FW2A 5ECOB 2EFEA 1Q4JA 2VLTA 3G7YA 1EGOA 4IKHA 5AISA 1XOAA 1OE8A 2CX3A 3TKQA 1U3AA 4PUFC 3WD6A 5GSSA 4V2MA 3GN3A 3ZVJA 4OFNA 5EPFA 5G1KA 3L9SA 1AIUA 4GF0A 2HNLA 2KP2A 5B7CA 3PGTA 4TR4A 4WBJA 4OD7A 3D22A 3KH9A 2J9HA 3IR4A 1MDIA 1ZYNA 2FA8A 4O5QA 4I5QA 2HSHA 2HRFA 3KJYA 5DALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAV A;  1H75 A;  1VF4 A;  3RPN A;  3ZL5 A;  1ERW A;  2RM5 A;  1OE7 A;  3L9U A;  4I8B A;  5IMA A;  4YQU A;  4PNF A;  3G9B A;  1F2E A;  3MAK A;  2MBS A;  3TRX A;  1U87 A;  3KD0 A;  3TJF A;  2OBI A;  1Y6E A;  4GXZ A;  3UMA A;  3PR8 A;  5IOX A;  1SL0 B;  2EC4 A;  4AGS A;  2LJK A;  3BJ5 A;  17GS A;  3N9J A;  1IYI A;  3U5R E;  4JE1 A;  5IO2 A;  5AGY A;  2IJY A;  3GL3 A;  4IJI A;  5KN0 A;  2HRA A;  3DD3 A;  2WB9 A;  2VM1 A;  3HA9 A;  3KIJ A;  3LJR A;  5HR2 A;  4RI7 A;  4ZB8 A;  1J9B A;  4L5O A;  5DJL A;  1IYH A;  1F3B A;  3WGD A;  4Q5Q A;  1KEB A;  1XW6 A;  2B1K A;  3L0H A;  3TCO A;  2K6V A;  1M99 A;  1OKT A;  5AIX A;  1XOB A;  1PKW A;  2R5G A;  5DAL B;  2EIO A;  1SK0 A;  2IN3 A;  2H76 A;  1MEK A;  3FR3 A;  1ML6 A;  2ON5 A;  1TTZ A;  1VRS D;  2Z9S A;  1XWK A;  4N10 A;  4RI6 A;  1SYX A;  2LQQ A;  3F8U A;  3MDK A;  1GSY A;  1A0F A;  2K18 A;  3C71 A;  4GST A;  3P90 A;  1HYU A;  1N2A A;  5ECM B;  2YN1 A;  4KA0 A;  2XHF A;  2FCH A;  5JCU A;  1F9M A;  2LV3 A;  1QK8 A;  5B8A A;  2P31 A;  2B6M A;  4MJB A;  4MCU A;  3TOT A;  4MF7 A;  4XRD A;  1TRS A;  2NTO A;  1ST9 A;  2RUE A;  3VFI A;  1CQH A;  4J2F A;  5IMC A;  5KEJ A;  6GSX A;  3P2A A;  3GSS A;  4D73 A;  2N5A A;  2CAQ A;  3Q6O A;  3UVH A;  3TOU A;  3UVT A;  4JR4 A;  4EUY A;  1Z7R A;  4Q5R A;  3UAP A;  1B9Y C;  4CDO A;  1T7P B;  2VL9 A;  4XIH A;  2C3T A;  4HQS A;  3QR6 A;  5DAK A;  4H86 A;  1MD4 A;  5ECR B;  2PUK C;  3DXB A;  4XS4 A;  1QQ2 A;  2GZP A;  3E3E A;  2QC7 A;  2V6O A;  3NOF A;  2GGT A;  1G6Y A;  5GST A;  1T4Y A;  5KN1 A;  5CO3 A;  2XC2 A;  3WGX A;  4KE3 A;  5J9C A;  1TI3 A;  2RLI A;  2YJH A;  3JCM L;  5FHI A;  4MLY A;  2JZS A;  1KTE A;  3R2Q A;  2UZ8 A;  3LSZ A;  2E7P A;  3ERF A;  4FYC A;  1SJ6 A;  6GSS A;  5CAX A;  1GSE A;  4D73 B;  3C1R A;  4PQ1 A;  3HZ8 A;  2L6C A;  3ZFB A;  2DMM A;  3KMN A;  3DKS A;  2AB6 A;  3GKK A;  5G1L A;  2B5X A;  3EIN A;  6GSU A;  3EMX A;  6GSW A;  1M0U A;  1FB0 A;  3VI5 A;  2O7K A;  2RII A;  3IHQ A;  3KXO A;  1XWA A;  2YJ7 A;  3I43 A;  1K3O A;  4ILF A;  2NPB A;  3SWL A;  1S3C A;  2X99 A;  3ZMK A;  4PUR A;  2A2R A;  1T00 A;  4XS4 B;  2YV7 A;  4MJE A;  3V1W A;  4IBP A;  2EIR A;  4IGJ A;  1PQN A;  4N11 A;  5HFK A;  5HR3 A;  4JED A;  4TR1 B;  2I1U A;  3LQ7 A;  2LEG A;  1ILO A;  2MYG A;  2MMA A;  1EV9 A;  1VF1 A;  4KW6 A;  4YAP A;  2KOK A;  4EF0 A;  4X1U A;  3DRN A;  4NHZ A;  1F37 A;  5IOW A;  5CP1 A;  3VWW A;  4MMM A;  2ALB A;  3F6D A;  1O81 A;  1GLP A;  3RHB A;  3EVI A;  4TXV A;  9GSS A;  2P5R A;  4GWR A;  2F8A A;  2LJA A;  3ERG A;  3H4K A;  4OO5 A;  1XIY A;  4XCS A;  3ED3 A;  1LU4 A;  5B6M A;  4RQX A;  5BMU A;  3WGE A;  4BA7 A;  4HDE A;  3O76 A;  5J9B A;  4PUA A;  4ZB6 A;  4IQ1 A;  1PX7 A;  5ENU A;  1J08 A;  1OAZ A;  3HZ4 A;  4ML6 A;  5DVB A;  2AYT A;  1UA5 A;  3QAW A;  1SD9 A;  3C73 A;  4BVX A;  2VD1 A;  1SK2 A;  2GDR A;  2X8C A;  4ISD A;  1A8Y A;  3L9V A;  3TJB A;  4YAV A;  1F3A A;  1URM A;  2MZC A;  2OJL A;  1KNG A;  4G19 A;  1X5E A;  1GLQ A;  5CRG A;  1Q98 A;  2H70 A;  5IMF A;  1K0M A;  3EE2 A;  3BBY A;  1XW9 A;  4ZBA A;  2M80 A;  2O87 A;  5E59 A;  10GS A;  2PER A;  4FYB A;  4J56 E;  3WYW A;  2OE1 A;  1ERU A;  2OE0 A;  2LS5 A;  3CSJ A;  2LTK A;  3IOS A;  3VI7 A;  1GNW A;  1THX A;  5F06 A;  3ERW A;  4IP1 A;  4J57 E;  5COH A;  3TRQ A;  3GKX A;  1WWJ A;  4ECB A;  1FVK A;  3QAG A;  5GZZ B;  4G2E A;  3FR9 A;  1M7T A;  2AAW A;  4FYU A;  2C80 A;  1EP7 A;  5H5R A;  3IAM 2;  20GS A;  5LD0 A;  4IS0 A;  1V9W A;  1JFU A;  1TK0 B;  3R3E A;  1KBN A;  3QFB C;  2HRN A;  4ZXG A;  4BVX B;  2X8G A;  1FB6 A;  3LYP A;  5DCH A;  4EXJ A;  3KGK A;  1WJK A;  5HFI A;  3QD9 A;  4PXO A;  1V57 A;  1A24 A;  1GUK A;  2VD0 A;  2GQM A;  4OMV A;  1AQV A;  3DVX A;  1Y25 A;  2CA8 A;  2YWN A;  4AF2 A;  1GH2 A;  5HFG A;  3I69 A;  4V2N A;  4EO3 A;  5DBQ A;  3M1G A;  3HHV A;  3APS A;  4PQI A;  3Q18 A;  5F07 A;  1ERT A;  3CTF A;  5JCW A;  5J5N A;  4PTS A;  4EVM A;  4HJ2 A;  3M0F A;  1Z5Y E;  4LA1 A;  1SL1 B;  4YH2 A;  2GTU A;  2A4V A;  2VL3 A;  3EC3 A;  1K0B A;  1VF3 A;  2DLX A;  3PPU A;  1JLW A;  1EEJ A;  1EP8 A;  1K0N A;  3VPQ A;  1GUL A;  3IAS 2;  4IN0 A;  1PGT A;  2WZ9 A;  5ECQ B;  4ZB9 A;  3VWX A;  5INY A;  1V98 A;  1B48 A;  2H0G A;  4LL4 B;  3TKR A;  2WRT A;  2R6K A;  5CRH A;  3TUE A;  1QUW A;  1U88 A;  4BL7 A;  4NXI A;  4K2D A;  2I3Y A;  1X9M B;  3ME8 A;  1SJZ A;  3LG6 A;  5A4U A;  2VL2 C;  4KDX A;  2H71 A;  5IO0 A;  2H1A A;  4JRR A;  1AAZ A;  3DEX A;  5J3R A;  1TOF A;  4ZL8 A;  1UC7 A;  4XS1 A;  3GNJ A;  1SU9 A;  4X43 A;  3W6G A;  3HD5 A;  3D4M A;  3GYK A;  5IMD A;  1O8X A;  1YF1 A;  1GNE A;  1A8L A;  1GSD A;  4IVF A;  3FZ4 A;  4HEA 2;  2HQT A;  2X8H A;  3J7Y b;  3EYT A;  4EDY A;  4HU7 A;  1TI1 A;  5F05 A;  2B7J A;  2H6Z A;  4MJC A;  4WR4 A;  4L5L A;  1W89 A;  3ZLP A;  5EL8 A;  1XCC A;  1JZD A;  1G0T A;  3GV1 A;  3FY7 A;  2YNX A;  3D21 A;  2E2G A;  4TOP A;  4GSS A;  14GS A;  4HZ2 A;  3P7X A;  2YZH A;  1WOU A;  2O89 A;  2GSQ A;  2VO4 A;  1BED A;  1VGL A;  1X9W B;  2CVB A;  1WPI A;  4TR3 A;  2MMO A;  4BL7 B;  1UN2 A;  1PSQ A;  2XBQ A;  3DVW A;  3F3R A;  1W4V A;  4HZ4 A;  3UEM A;  1R5A A;  3DYR A;  1PKZ A;  2H19 A;  4ZBD A;  2C1Y A;  3ZZX A;  2N5F A;  2LUS A;  4YQV A;  4JR6 A;  2LRT A;  2CQ9 A;  2IFQ A;  6GSV A;  2G0F A;  3A2V A;  4KGI A;  4CW9 A;  2XPD A;  3D5J A;  3RPP A;  2G2Q A;  3Q19 A;  4GSN A;  1A2L A;  5JWR B;  4K6X A;  4NWY A;  2R4V A;  5KN2 A;  2VCQ A;  2V41 A;  3IK7 A;  2WCI A;  3KTB A;  1AQW A;  2VL2 A;  4MDC A;  1TRV A;  2VUP A;  4ML1 A;  1K0O A;  2DJK A;  4L0U A;  2HZE A;  3A5W A;  2OBK A;  1ON4 A;  2OAD A;  1G7O A;  3FRC A;  2B1L A;  3KZQ A;  1DE2 A;  4ZL9 A;  2P5Q A;  2PN8 A;  1LBK A;  2N5B A;  4KCA A;  3IPZ A;  1O6J A;  4K7N A;  3QPM A;  2LNT A;  3TRP A;  1SKS B;  2PU9 C;  2BJX A;  4TR0 A;  1C72 A;  4O92 A;  3PIN A;  2H6Y A;  1H4O A;  2BMX A;  2DML A;  1K0D A;  4KB3 A;  2J23 A;  2R3X A;  2AHE A;  4KSO A;  1ACV A;  2JU5 A;  1XWB A;  3HJM A;  5ID2 B;  3UJ1 A;  1TDI A;  1EOH A;  2FWG A;  2YCD A;  1XBS A;  4ZIJ A;  4MF5 A;  3GHA A;  3GX8 A;  2V2G A;  2H73 A;  2LRC A;  2IFQ B;  2TRC P;  1M2B A;  1GUH A;  2JSY A;  1FG4 A;  4TR1 A;  3A2W A;  3GUS A;  4IQA A;  2LKU A;  2ZNM A;  4WET A;  4DSR A;  4GTU A;  3APQ A;  4Q5N A;  3O3T A;  2E0Q A;  2CT6 A;  1M9B A;  1SJI A;  3I9V 2;  5H5S A;  3D6I A;  1Z6M A;  1U6T A;  3VUR A;  4L8E A;  1ZCP A;  2HZE B;  4GRF A;  4FO5 A;  2JZT A;  4K9Z A;  1QFN A;  4EE0 A;  3LEF A;  3LXZ A;  2F8F A;  2ON7 A;  1O73 A;  3G7J A;  4MZW A;  1R7H A;  2GSR A;  4G0L A;  3BCK A;  5GAN D;  1HNB A;  4XTS A;  2VAF A;  2XBI A;  2B3S A;  3BD2 A;  4QL7 A;  3TJK A;  1JHB A;  5G5E A;  1QGV A;  2H1B A;  1JLV A;  2IMF A;  4OO4 A;  3HCZ A;  3C8E A;  4NPB A;  4ZL7 A;  4P3Y B;  5ECL B;  3GX0 A;  3VLN A;  1EGR A;  3APO A;  3KEB A;  1ZMA A;  1PX6 A;  5AIV A;  4TXO A;  1EEM A;  11GS A;  2PGT A;  5KN3 A;  3RHC A;  1R5P A;  2PWJ A;  2HRK A;  4KDY A;  3GH9 A;  4TRX A;  2QGV A;  1PA3 A;  2WGR A;  2JAC A;  2MBT A;  3IE3 A;  1SKR B;  2KLX A;  3US3 A;  4PNG A;  3W8J A;  3FZ5 A;  4I2T A;  1GL8 A;  2K9F A;  2B5Y A;  2F51 A;  1YKC A;  3EUR A;  1FAA A;  1AXD A;  2HYX A;  1QMV A;  5EVO A;  1ZYQ B;  1YZX A;  1GTB A;  4V2L A;  1YJ6 A;  5IQY A;  2L4C A;  2HFD A;  4OCF A;  1XVQ A;  1SEN A;  3KP9 A;  5J41 A;  4JZQ A;  4XHM A;  1N8J A;  2L57 A;  1LJR A;  3J7Y k;  2MMZ A;  1USB A;  2VCV A;  3W8S A;  1BQ7 A;  2L5O A;  4FQU A;  4BWS A;  3GKN A;  2LQO A;  2IMD A;  3ZVJ D;  2FUG 2;  2FA4 A;  2YAN A;  2B7K A;  3D4T A;  3ZIJ A;  2XPE A;  2NDO A;  5L71 A;  1G7E A;  4POM A;  1HQO A;  3MSZ A;  1TKD B;  3F0I A;  1U3I A;  2NVL A;  2C3N A;  2QKE A;  3EMP A;  4TXO B;  1GSQ A;  3TKS C;  2PPT A;  3ZTL A;  1K3Y A;  2CVK A;  1SL2 B;  1GSF A;  2DC5 A;  2C0E A;  1DUG A;  1UVZ A;  2HRK B;  3FHK A;  4G0K A;  2KHP A;  5IPG A;  3CSH A;  1XWG A;  4USS A;  5ELG A;  2HLS A;  3IC4 A;  3UOM A;  1AC1 A;  1Z9H A;  2EIQ A;  2WS2 A;  5DJM A;  2WUL A;  1A2J A;  3TKS E;  2GSS A;  2HSN B;  3H79 A;  3LXT A;  1OYJ A;  3EU4 A;  3MNG A;  3MWH A;  3HJO A;  5GAP D;  1YY7 A;  2LJR A;  2H74 A;  4GCI A;  3F3Q A;  4NHW A;  3H8Q A;  1K0A A;  3ZYW A;  3ZRD A;  4IW9 A;  1TRU A;  1YDK A;  5C00 A;  1YEX A;  2FY6 A;  3FK8 A;  1T3B A;  5AN1 A;  2O8V B;  5ECI B;  2VCZ A;  1XZO A;  2VLV A;  1TP9 A;  3FR6 A;  4POL A;  2HSY A;  1PL1 A;  1X5C A;  3DIE A;  3WT2 A;  3TJJ A;  3ZIT A;  1M2D A;  1T8E B;  3FEU A;  3GKM A;  3FKF A;  5JWQ B;  3F63 A;  1B4P A;  2M72 A;  2H0H A;  3K8N A;  2AV4 A;  5DDL A;  3FZ9 A;  3HVV A;  4PQH A;  3F4T A;  1XXU A;  4BVY A;  2JSZ A;  1FHE A;  1PMT A;  6GSY A;  1A0R P;  5D96 A;  1DE1 A;  4F0C A;  5IM9 A;  3TKS A;  1HD2 A;  2F3M A;  1YKA A;  1TRW A;  3UAR A;  3NZN A;  3FZA A;  1RW1 A;  3HVS A;  2I4A A;  3GH6 A;  2HSM A;  4QL9 A;  3VPT A;  5G5F A;  4E8E A;  1V40 A;  4HS1 A;  3C1S A;  2RUF A;  1FVJ A;  1PRX A;  3IK9 A;  5D9X A;  2BTO T;  4K7O A;  4JU5 A;  4V1A p;  2YV9 A;  1JZR A;  1TK8 B;  4MA9 A;  4JBB A;  2NBS A;  2C3Q A;  2C4J A;  1Z7P A;  1NHY A;  2L4Q A;  2C0D A;  3ZRE A;  4ULX A;  5G31 A;  1BX9 A;  4V1A g;  2L5L A;  2YWO A;  19GS A;  4RQR A;  4DVC A;  3M8N A;  5DQS A;  1B4Q A;  4MPG A;  2PVQ A;  3WT1 A;  1SYR A;  3IDV A;  1TU7 A;  1FW1 A;  1VF2 A;  1BJX A;  2GT5 A;  2VCW A;  4F0B A;  1E6B A;  3H1N A;  5G30 A;  2HZF A;  5ECH B;  3HVX A;  4LLR A;  4BVY B;  1BG5 A;  2IMI A;  1G6W A;  2GVP A;  5CRD A;  4IEL A;  2P0G A;  2R2J A;  2DSA A;  1EOG A;  4K1F A;  2YOI A;  2FWH A;  3EU3 A;  3S9F A;  22GS A;  4O5R A;  1EZK A;  5D93 A;  5EY6 A;  1I5G A;  2OAC A;  2HI7 A;  5CRW A;  2HSM B;  3P8W A;  1WRY A;  4F2I A;  4MPF A;  1RK4 A;  3M9J A;  1A2M A;  4MZB A;  4EL1 A;  2GST A;  3DGQ A;  2MMN A;  2DJ0 A;  2IMK A;  3VK9 A;  3UIW A;  1FOV A;  2CVD A;  4MJA A;  1ZZY A;  2H1D A;  4HU9 A;  5DCG A;  5A5K A;  1JZO A;  1NHO A;  2I9H A;  3LFL A;  1GTU A;  4GQC A;  4DSS A;  3H93 A;  4N0V A;  4MH3 A;  3G7I A;  2TIR A;  2FWF A;  4RUV A;  3KM6 A;  3GMF A;  2WFC A;  2DJ2 A;  1PL2 A;  1YEP A;  2VOC A;  2RM6 A;  5LCZ A;  2F9S A;  1NSW A;  2DIY A;  3CTG A;  4K0G A;  3I6A A;  1Z6N A;  6GST A;  3PH9 A;  5HR1 A;  4Z7X A;  1SKW B;  3QOU A;  4LL1 B;  1JZW A;  2LST A;  3BOA A;  3IRA A;  5IPH A;  4KX4 A;  5A4W A;  2JAD A;  2DBC A;  1MD3 A;  4F03 A;  3UBK A;  5ID2 A;  1ZGN A;  2FHE A;  1GUM A;  4AJ7 A;  4GLT A;  4MZC A;  4N30 A;  4G9H A;  4O7H A;  1ZL9 A;  4XRA A;  3HYP A;  5F0G A;  1CQG A;  3ISO A;  1OC9 A;  5LNK e;  2O85 A;  5F8B A;  5HR0 A;  12GS A;  1ZYE A;  1WIK A;  5H5Q A;  3ZIV A;  4WF4 A;  4EKZ A;  1WP0 A;  1SD8 A;  3U6V A;  1ABA A;  2K8V A;  4Q5F A;  3Q74 A;  5DQY A;  4DSS B;  3LWA A;  4HUA A;  1J0F A;  1FO5 A;  5FWG A;  3O6T A;  5D8I A;  1DBY A;  2YWM A;  1M2A A;  2CAI A;  5ECN B;  3QMX A;  1SK1 A;  2IME A;  3GRX A;  3F4S A;  2PMT A;  1O85 A;  4ZIL A;  4O32 A;  4TKY A;  1OC3 A;  2CZ2 A;  3IA1 A;  2YP6 A;  4N0Z A;  5B6N A;  2E2M A;  5ABR A;  3CRU A;  3SBC A;  4HOJ A;  3QDN A;  3KCM A;  4KH7 A;  1GP1 A;  3IXR A;  2V1M A;  5CRE A;  1QXH A;  2KUC A;  2A2S A;  3LOR A;  3HJP A;  3F4R A;  2FWE A;  5IIZ A;  4IHU A;  4DSQ A;  4KDU A;  3VWU A;  2HT9 A;  1OC9 B;  1MTC A;  4KUN A;  1DSB A;  4WF5 A;  2PBJ A;  2L59 A;  3ME7 A;  4LMV A;  18GS A;  4NMU A;  3ZML A;  1F6M C;  13GS A;  1TXX A;  4TW5 A;  4LMW A;  4F9Z A;  4EDZ A;  5FT3 A;  1GTI A;  3DML A;  1GSS A;  2H30 A;  3TGZ A;  3GTU A;  1Z3E A;  3D0Z A;  4HI7 A;  4ACS A;  4NV5 A;  3E0U A;  1V58 A;  4MAB A;  3KP8 A;  2CZ3 A;  1OC8 A;  3IV4 A;  2DJ1 A;  4G10 A;  4WXT A;  4K8M A;  5IMZ A;  3UL3 A;  5HQP A;  4XS6 A;  4FH8 A;  4TN8 A;  2OE3 A;  2H0I A;  3QFA C;  3F6F A;  1ZOF A;  1TU8 A;  5CNW A;  1WMJ A;  2C0G A;  8GSS A;  3L78 A;  2DIZ A;  4KND A;  3VWV A;  3EWL A;  1XWC A;  2PVO C;  5D9T A;  2YWI A;  1MDJ A;  2H6X A;  3HKR A;  4L0W A;  5JWO B;  2H8L A;  3HDC A;  5JCG A;  1HNA A;  1BAY A;  1XFL A;  2IIY A;  1S3A A;  5DAK B;  3M3M A;  5D73 A;  3TKP A;  4POK A;  2VLU A;  4OWY A;  4IP6 A;  5D9W A;  1THO A;  3GTU B;  1AQX A;  2VIM A;  4WEY A;  2V6K A;  4KAE A;  1NM3 A;  4OCE A;  2AUV A;  3GL5 A;  2K8S A;  5D9V A;  1RQM A;  2M46 A;  4HJM A;  2KP1 A;  5C04 A;  4KF9 A;  4TVE A;  4MP4 A;  3IC8 A;  1GSU A;  5IMV A;  2I81 A;  2R37 A;  7GSS A;  1S3D A;  2CX4 A;  4ID0 A;  1R26 A;  5ELA A;  4ECI A;  3LGC A;  1E2Y A;  4MF6 A;  2HXK A;  5ECS A;  3TJG A;  4ECC A;  3QCP A;  3OR5 A;  2JL4 A;  4CHS A;  1X0R A;  2JZR A;  4PGT A;  4BPY A;  1OKD A;  4EC0 A;  1XVW A;  4AJ6 A;  2H66 A;  2GT6 A;  3LYK A;  1B9X C;  4WKW A;  1X9S B;  2VM2 A;  2H75 A;  3TDG A;  1O7U A;  4ECJ A;  4K0N A;  3C7M A;  4PX1 A;  3RBT A;  3BCI A;  3A2X A;  2LNS A;  4KSM A;  3KTL A;  1WE0 A;  2L6D A;  1GTA A;  4I97 A;  4GQF A;  3F9U A;  1ERV A;  3E9J B;  2ZCT A;  5A4V A;  1B8X A;  2GZY A;  2IL3 A;  2B5E A;  2V32 A;  4DEJ A;  1TW9 A;  4K7I A;  2WDU A;  2VCX A;  5G2Z A;  2OA7 A;  2IWT A;  2FGX A;  3KH7 A;  2GLR A;  3GA4 A;  4WBR D;  3NIV A;  3CYN A;  2FLS A;  3CXG A;  3CRT A;  1NW2 A;  1PN9 A;  5ECK B;  2VCT A;  4YQM A;  4MH2 A;  4AJ8 A;  3RAZ A;  2D2Z A;  4IJ3 A;  3CMI A;  4KCE A;  1K3L A;  4HQZ A;  2LRN A;  3GFK A;  4G0I A;  3UBL A;  2DJ3 A;  2ZUP A;  4I6X A;  4E8H A;  4NAX A;  3HXS A;  4POB A;  2HE3 A;  2H1G A;  2IPA A;  2REM A;  2GQL A;  1T1V A;  3AY8 A;  1EV4 A;  2TRX A;  2H72 A;  1M9A A;  1YF0 A;  1MDK A;  4WR5 A;  3CSI A;  1K0C A;  3FYG A;  5ECP B;  1BYE A;  4OFM A;  5E4W A;  2GS3 A;  4X0X A;  4I2U A;  1OVN A;  4MK3 A;  1TJD A;  1HNC A;  1O8W A;  2C0F A;  3GST A;  3GUR A;  1X5D A;  2FD3 A;  2H01 A;  1TK5 B;  5J4U A;  4QQ7 A;  2C8U A;  2FNO A;  2OKA A;  3A3T A;  1GRX A;  2DJJ A;  2YPM A;  4BWQ A;  1PD2 1;  3M9K A;  4ZBB A;  1V2A A;  1R4W A;  4F82 A;  1AW9 A;  2QSI A;  1GWC A;  3HY2 A;  3L4N A;  3RDW A;  16GS A;  3KMO A;  2WJU A;  3CBU A;  3ZFL A;  3N5O A;  2ES7 A;  1A23 A;  1XW5 A;  1YQ1 A;  4OFT A;  3TB2 A;  5B8B A;  2GZZ A;  3IBH A;  1T4Z A;  4FIW A;  2YZU A;  2GQK A;  3GIX A;  1AUC A;  2AJQ B;  5CYY A;  1EWX A;  1I9D A;  2X64 A;  4NV2 A;  3DWV A;  2CV4 A;  1XPV A;  3FW2 A;  5ECO B;  1Q4J A;  2VLT A;  3G7Y A;  1EGO A;  4IKH A;  5AIS A;  1XOA A;  1OE8 A;  2CX3 A;  3TKQ A;  1U3A A;  4PUF C;  3WD6 A;  5GSS A;  4V2M A;  3GN3 A;  3ZVJ A;  4OFN A;  5EPF A;  5G1K A;  3L9S A;  1AIU A;  4GF0 A;  2HNL A;  2KP2 A;  5B7C A;  3PGT A;  4TR4 A;  4WBJ A;  4OD7 A;  3D22 A;  3KH9 A;  2J9H A;  3IR4 A;  1MDI A;  2FA8 A;  4I5Q A;  2HSH A;  2HRF A;  3KJY A;  5DAL A; 
#chains in the Genus database with same CATH topology
 3QAV A;  1H75 A;  1VF4 A;  3RPN A;  3ZL5 A;  1ERW A;  2RM5 A;  1OE7 A;  3L9U A;  5J40 A;  4I8B A;  5IMA A;  4YQU A;  4PNF A;  3G9B A;  1F2E A;  3MAK A;  2MBS A;  3TRX A;  1U87 A;  3KD0 A;  3TJF A;  2OBI A;  1Y6E A;  4GXZ A;  3UMA A;  3PR8 A;  5IOX A;  1SL0 B;  2EC4 A;  4AGS A;  2LJK A;  3BJ5 A;  17GS A;  3N9J A;  1IYI A;  1YVL A;  3U5R E;  4JE1 A;  5IO2 A;  5AGY A;  2IJY A;  3GL3 A;  2O36 A;  4IJI A;  5KN0 A;  2HRA A;  3DD3 A;  2WB9 A;  2VM1 A;  3HA9 A;  3KIJ A;  3LJR A;  5HR2 A;  4RI7 A;  4ZB8 A;  1J9B A;  4PI0 C;  4L5O A;  5DJL A;  1IYH A;  1F3B A;  3WGD A;  4Q5Q A;  1KEB A;  1XW6 A;  2B1K A;  3L0H A;  3TCO A;  2K6V A;  1M99 A;  1OKT A;  5AIX A;  1XOB A;  1PKW A;  3TU3 B;  2R5G A;  5DAL B;  2EIO A;  1SK0 A;  2IN3 A;  2H76 A;  1MEK A;  3FR3 A;  1ML6 A;  2ON5 A;  1TTZ A;  1VRS D;  2Z9S A;  3A5I A;  1XWK A;  4N10 A;  4RI6 A;  1SYX A;  2LQQ A;  3F8U A;  3MDK A;  2WVX A;  1GSY A;  1A0F A;  2K18 A;  3C71 A;  1S3R A;  4GST A;  3P90 A;  1HYU A;  1N2A A;  5ECM B;  1ZYP A;  2YN1 A;  4KA0 A;  2XHF A;  2FCH A;  5JCU A;  1F9M A;  2LV3 A;  1QK8 A;  5B8A A;  2P31 A;  2B6M A;  4MJB A;  4MCU A;  3TOT A;  4MF7 A;  4XRD A;  1TRS A;  2NTO A;  1ST9 A;  2RUE A;  3VFI A;  4PI2 C;  1CQH A;  4J2F A;  5IMC A;  5KEJ A;  6GSX A;  3P2A A;  3GSS A;  4D73 A;  2N5A A;  2CAQ A;  4EIP A;  3Q6O A;  3UVH A;  3TOU A;  3UVT A;  4JR4 A;  4EUY A;  1Z7R A;  4Q5R A;  3UAP A;  1B9Y C;  4CDO A;  1T7P B;  2VL9 A;  4XIH A;  2C3T A;  4HQS A;  3QR6 A;  5DAK A;  4H86 A;  4PHZ C;  1MD4 A;  5ECR B;  2PUK C;  3DXB A;  4XS4 A;  1QQ2 A;  2GZP A;  3E3E A;  4X4J A;  3CWG A;  2OT3 A;  2QC7 A;  2V6O A;  3NOF A;  2GGT A;  1G6Y A;  5GST A;  4CY8 A;  1T4Y A;  5KN1 A;  5CO3 A;  4GDF A;  2XC2 A;  3WGX A;  4KE3 A;  5J9C A;  1TI3 A;  2RLI A;  2YJH A;  4A5P A;  3JCM L;  5FHI A;  4MLY A;  2JZS A;  1KTE A;  3R2Q A;  2UZ8 A;  3LSZ A;  2E7P A;  3ERF A;  4FYC A;  1SJ6 A;  3CHX C;  6GSS A;  5CAX A;  1GSE A;  4D73 B;  3C1R A;  4PQ1 A;  3HZ8 A;  2L6C A;  3ZFB A;  2DMM A;  3KMN A;  3DKS A;  2AB6 A;  3GKK A;  5G1L A;  2B5X A;  3EIN A;  1BG1 A;  6GSU A;  3EMX A;  6GSW A;  1M0U A;  1FB0 A;  3VI5 A;  2O7K A;  2RII A;  3IHQ A;  3KXO A;  1XWA A;  2YJ7 A;  3I43 A;  1K3O A;  4ILF A;  2NPB A;  3SWL A;  1S3C A;  2X99 A;  3ZMK A;  5KOW A;  4PUR A;  2A2R A;  1T00 A;  4XS4 B;  2YV7 A;  4MJE A;  3V1W A;  4IBP A;  2EIR A;  4IGJ A;  1PQN A;  4N11 A;  5HFK A;  5HR3 A;  4JED A;  4TR1 B;  2I1U A;  3LQ7 A;  2LEG A;  1ILO A;  2MYG A;  2MMA A;  1EV9 A;  1VF1 A;  4KW6 A;  4YAP A;  2KOK A;  4EF0 A;  4X1U A;  3DRN A;  4NHZ A;  1F37 A;  5IOW A;  5CP1 A;  3VWW A;  4MMM A;  2ALB A;  3F6D A;  1O81 A;  1GLP A;  4W66 A;  3RHB A;  3RFR C;  3EVI A;  4TXV A;  9GSS A;  2P5R A;  4GWR A;  2F8A A;  2LJA A;  3ERG A;  3H4K A;  4OO5 A;  1XIY A;  4XCS A;  3ED3 A;  1LU4 A;  5B6M A;  4RQX A;  5BMU A;  3WGE A;  4BA7 A;  4HDE A;  3O76 A;  5J9B A;  4PUA A;  4ZB6 A;  4IQ1 A;  1PX7 A;  5ENU A;  1J08 A;  1OAZ A;  3HZ4 A;  4ML6 A;  5DVB A;  2AYT A;  1UA5 A;  3QAW A;  1SD9 A;  3C73 A;  4BVX A;  2VD1 A;  1SK2 A;  2GDR A;  2X8C A;  4ISD A;  1A8Y A;  3L9V A;  3TJB A;  2DKI A;  4YAV A;  1F3A A;  1URM A;  2MZC A;  2OJL A;  1KNG A;  4G19 A;  1X5E A;  1GLQ A;  5CRG A;  1Q98 A;  2H70 A;  5IMF A;  1K0M A;  3EE2 A;  3BBY A;  1XW9 A;  4ZBA A;  2M80 A;  2O87 A;  5E59 A;  10GS A;  3RGB C;  2PER A;  4FYB A;  4J56 E;  3WYW A;  2OE1 A;  1ERU A;  2OE0 A;  2LS5 A;  3CSJ A;  2LTK A;  3IOS A;  5A5H B;  3VI7 A;  1GNW A;  1THX A;  5F06 A;  3ERW A;  4IP1 A;  4J57 E;  5COH A;  3TRQ A;  1I1I P;  3GKX A;  1WWJ A;  4ECB A;  1FVK A;  3QAG A;  5GZZ B;  4G2E A;  3FR9 A;  1M7T A;  2AAW A;  4FYU A;  2C80 A;  1EP7 A;  5H5R A;  3IAM 2;  20GS A;  5LD0 A;  4IS0 A;  1V9W A;  1JFU A;  1TK0 B;  3R3E A;  1KBN A;  3QFB C;  2HRN A;  4ZXG A;  4BVX B;  4N3Z A;  2X8G A;  1FB6 A;  3LYP A;  5DCH A;  4EXJ A;  3KGK A;  1WJK A;  5HFI A;  3QD9 A;  4PXO A;  1V57 A;  1A24 A;  1GUK A;  2VD0 A;  2GQM A;  4OMV A;  4MNN A;  1AQV A;  3DVX A;  1Y25 A;  2CA8 A;  2YWN A;  4AF2 A;  1GH2 A;  5HFG A;  3I69 A;  4V2N A;  4EO3 A;  4K5S A;  5DBQ A;  3M1G A;  3HHV A;  3APS A;  4PQI A;  3Q18 A;  5F07 A;  1ERT A;  3CTF A;  5JCW A;  5J5N A;  4PTS A;  4EVM A;  4HJ2 A;  3M0F A;  4K5R A;  1Z5Y E;  4LA1 A;  1SL1 B;  4YH2 A;  2GTU A;  2A4V A;  2VL3 A;  3EC3 A;  1K0B A;  1VF3 A;  2DLX A;  3PPU A;  1JLW A;  1EEJ A;  1EP8 A;  1K0N A;  3VPQ A;  1GUL A;  1BF5 A;  3IAS 2;  3MYD A;  4IN0 A;  1PGT A;  2WZ9 A;  5ECQ B;  4ZB9 A;  3VWX A;  5INY A;  1V98 A;  1B48 A;  2H0G A;  4LL4 B;  3TKR A;  2WRT A;  2R6K A;  5CRH A;  3TUE A;  1QUW A;  1U88 A;  4BL7 A;  4NXI A;  4K2D A;  2I3Y A;  2WVZ A;  1X9M B;  3ME8 A;  1SJZ A;  3LG6 A;  5A4U A;  2VL2 C;  4KDX A;  2H71 A;  5IO0 A;  2H1A A;  4JRR A;  1AAZ A;  3DEX A;  5J3R A;  1TOF A;  4ZL8 A;  1UC7 A;  4XS1 A;  3GNJ A;  1SU9 A;  4X43 A;  3W6G A;  3HD5 A;  3D4M A;  3GYK A;  5IMD A;  1O8X A;  1TXU A;  1YF1 A;  4G01 A;  4AKG A;  1GNE A;  1A8L A;  1GSD A;  4IVF A;  3FZ4 A;  4BIK A;  4HEA 2;  2HQT A;  2X8H A;  3J7Y b;  3EYT A;  4EDY A;  4HU7 A;  1TI1 A;  5F05 A;  1SVO A;  2B7J A;  4Z2U A;  2H6Z A;  4MJC A;  4WR4 A;  2A4H A;  4L5L A;  1W89 A;  3ZLP A;  5EL8 A;  3FMW A;  1XCC A;  1JZD A;  1G0T A;  3GV1 A;  3FY7 A;  2YNX A;  3D21 A;  2E2G A;  4TOP A;  1PFO A;  4GSS A;  14GS A;  4YKF A;  4HZ2 A;  3P7X A;  2YZH A;  1WOU A;  2O89 A;  2GSQ A;  2VO4 A;  1BED A;  1VGL A;  1X9W B;  2CVB A;  1WPI A;  4TR3 A;  2MMO A;  2WW0 A;  4BL7 B;  1UN2 A;  1PSQ A;  3LW9 A;  2XBQ A;  3DVW A;  3F3R A;  1W4V A;  4HZ4 A;  3UEM A;  1R5A A;  3DYR A;  1PKZ A;  2H19 A;  1SVM A;  4ZBD A;  2C1Y A;  4ZB7 A;  2R0P A;  3ZZX A;  1PN0 A;  2N5F A;  2LUS A;  4YQV A;  4JR6 A;  2LRT A;  2CQ9 A;  2IFQ A;  6GSV A;  2G0F A;  3A2V A;  4KGI A;  4CW9 A;  2XPD A;  3D5J A;  3RPP A;  2G2Q A;  3Q19 A;  4GSN A;  4AI6 A;  1A2L A;  5JWR B;  4K6X A;  4NWY A;  2R4V A;  5KN2 A;  2VCQ A;  2V41 A;  3IK7 A;  2WCI A;  3KTB A;  1AQW A;  2VL2 A;  4MDC A;  1TRV A;  2VUP A;  4ML1 A;  1K0O A;  2DJK A;  4L0U A;  1M3I A;  2HZE A;  3A5W A;  3CQF A;  2OBK A;  1ON4 A;  2OAD A;  1G7O A;  3FRC A;  2B1L A;  3KZQ A;  1DE2 A;  4ZL9 A;  2P5Q A;  2PN8 A;  1LBK A;  2N5B A;  4KCA A;  3IPZ A;  1O6J A;  4K7N A;  3QPM A;  2LNT A;  3TRP A;  1SKS B;  2PU9 C;  2BJX A;  4TR0 A;  1C72 A;  4O92 A;  3PIN A;  2H6Y A;  1H4O A;  2BMX A;  2DML A;  1K0D A;  4KB3 A;  2J23 A;  2R3X A;  2AHE A;  4KSO A;  1ACV A;  2JU5 A;  1XWB A;  3HJM A;  5ID2 B;  3UJ1 A;  1TDI A;  1EOH A;  2FWG A;  2YCD A;  1XBS A;  4ZIJ A;  2WW2 A;  4MF5 A;  3GHA A;  3GX8 A;  2V2G A;  2H73 A;  2LRC A;  3EPT A;  2IFQ B;  2TRC P;  1M2B A;  1GUH A;  2JSY A;  1FG4 A;  4TR1 A;  3A2W A;  3GUS A;  4IQA A;  2LKU A;  2ZNM A;  4WET A;  4DSR A;  4GTU A;  3APQ A;  4Q5N A;  3O3T A;  2E0Q A;  2CT6 A;  1M9B A;  1SJI A;  3I9V 2;  5H5S A;  3D6I A;  1Z6M A;  1U6T A;  3VUR A;  4L8E A;  1ZCP A;  2HZE B;  4GRF A;  4FO5 A;  2JZT A;  4K9Z A;  1QFN A;  4EE0 A;  3LEF A;  3LXZ A;  5A1N B;  2F8F A;  2ON7 A;  1O73 A;  3G7J A;  4MZW A;  1R7H A;  2GSR A;  4G0L A;  3BCK A;  5GAN D;  1HNB A;  4XTS A;  2VAF A;  2DKH A;  2XBI A;  2B3S A;  3BD2 A;  4QL7 A;  3TJK A;  1JHB A;  5G5E A;  1QGV A;  2H1B A;  1JLV A;  2IMF A;  4OO4 A;  3HCZ A;  3C8E A;  4NPB A;  4ZL7 A;  4P3Y B;  5ECL B;  4E68 A;  3GX0 A;  3VLN A;  1EGR A;  3APO A;  3KEB A;  1ZMA A;  1PX6 A;  5AIV A;  4TXO A;  1EEM A;  11GS A;  2PGT A;  5KN3 A;  4FXY P;  3RHC A;  1R5P A;  2PWJ A;  2HRK A;  4KDY A;  3GH9 A;  4TRX A;  2QGV A;  1PA3 A;  2WGR A;  2JAC A;  2MBT A;  3IE3 A;  1SKR B;  2KLX A;  3US3 A;  4PNG A;  3W8J A;  3FZ5 A;  4I2T A;  1GL8 A;  2K9F A;  2B5Y A;  2F51 A;  1YKC A;  3EUR A;  1FAA A;  1AXD A;  2HYX A;  1QMV A;  5EVO A;  1ZYQ B;  1YZX A;  1GTB A;  4V2L A;  1YJ6 A;  5IQY A;  2L4C A;  2HFD A;  4OCF A;  1XVQ A;  1SEN A;  3KP9 A;  5J41 A;  4JZQ A;  4XHM A;  1N8J A;  2L57 A;  1LJR A;  3J7Y k;  2MMZ A;  1USB A;  2VCV A;  3W8S A;  5A5H A;  1BQ7 A;  2L5O A;  4FQU A;  4BWS A;  3GKN A;  2LQO A;  2IMD A;  3ZVJ D;  2FUG 2;  2FA4 A;  2YAN A;  2B7K A;  3D4T A;  3ZIJ A;  2XPE A;  2NDO A;  5L71 A;  1G7E A;  4POM A;  1HQO A;  3MSZ A;  1TKD B;  3F0I A;  1U3I A;  2NVL A;  2C3N A;  2QKE A;  3EMP A;  4TXO B;  1GSQ A;  3TKS C;  2PPT A;  3ZTL A;  1K3Y A;  2CVK A;  1SL2 B;  1GSF A;  2DC5 A;  2C0E A;  1DUG A;  1UVZ A;  2HRK B;  2O3E A;  3FHK A;  4G0K A;  2KHP A;  5IPG A;  3CSH A;  1XWG A;  4USS A;  5ELG A;  2HLS A;  3IC4 A;  3UOM A;  1AC1 A;  1Z9H A;  2EIQ A;  2WS2 A;  5DJM A;  2WUL A;  1A2J A;  3TKS E;  2GSS A;  2HSN B;  3H79 A;  3LXT A;  1OYJ A;  3EU4 A;  3MNG A;  4ICY A;  3MWH A;  3HJO A;  5GAP D;  1YY7 A;  2LJR A;  2H74 A;  4GCI A;  2O5V A;  3F3Q A;  4NHW A;  3H8Q A;  4Z2T A;  1K0A A;  3ZYW A;  3ZRD A;  4IW9 A;  1TRU A;  1YDK A;  5C00 A;  1YEX A;  2FY6 A;  3FK8 A;  1T3B A;  5AN1 A;  2O8V B;  5ECI B;  2VCZ A;  1XZO A;  2VLV A;  1TP9 A;  3FR6 A;  4POL A;  2HSY A;  1PL1 A;  1X5C A;  3DIE A;  3WT2 A;  3TJJ A;  3ZIT A;  1M2D A;  1T8E B;  3FEU A;  3GKM A;  3FKF A;  5BRT A;  5JWQ B;  3F63 A;  1B4P A;  2M72 A;  2H0H A;  3K8N A;  2AV4 A;  5DDL A;  3FZ9 A;  3HVV A;  4PQH A;  3F4T A;  1XXU A;  4BVY A;  2JSZ A;  1FHE A;  1PMT A;  6GSY A;  4EIQ A;  1A0R P;  5D96 A;  1DE1 A;  4F0C A;  5IM9 A;  3TKS A;  1HD2 A;  2F3M A;  1YKA A;  1TRW A;  3UAR A;  3NZN A;  2EFH A;  3FZA A;  1RW1 A;  3HVS A;  2I4A A;  3GH6 A;  2HSM A;  4QL9 A;  3VPT A;  5G5F A;  4E8E A;  1V40 A;  4HS1 A;  3C1S A;  2RUF A;  1FVJ A;  1PRX A;  3IK9 A;  5D9X A;  2BTO T;  4K7O A;  4JU5 A;  4V1A p;  2YV9 A;  1JZR A;  1TK8 B;  4MA9 A;  5J4V A;  4JBB A;  2NBS A;  2C3Q A;  2C4J A;  1Z7P A;  1NHY A;  2L4Q A;  2WW1 A;  2C0D A;  3ZRE A;  4ULX A;  5G31 A;  1BX9 A;  4V1A g;  2L5L A;  2YWO A;  19GS A;  4RQR A;  4DVC A;  3M8N A;  5DQS A;  1B4Q A;  4MPG A;  2PVQ A;  3WT1 A;  4K2X A;  1SYR A;  3IDV A;  1TU7 A;  1FW1 A;  1VF2 A;  1BJX A;  2GT5 A;  2VCW A;  4F0B A;  1E6B A;  3H1N A;  5G30 A;  2HZF A;  5ECH B;  3HVX A;  4LLR A;  4BVY B;  1BG5 A;  2IMI A;  1G6W A;  2GVP A;  5CRD A;  4IEL A;  2P0G A;  2R2J A;  2DSA A;  1EOG A;  4K1F A;  2YOI A;  2FWH A;  3MIX A;  3EU3 A;  3S9F A;  22GS A;  4O5R A;  1YEW C;  1EZK A;  5D93 A;  5EY6 A;  1I5G A;  2OAC A;  2HI7 A;  5CRW A;  2HSM B;  3P8W A;  1WRY A;  4F2I A;  3IHG A;  4MPF A;  1RK4 A;  3M9J A;  1A2M A;  4MZB A;  4EL1 A;  2GST A;  3DGQ A;  2MMN A;  2DJ0 A;  2IMK A;  3VK9 A;  1SVL A;  3UIW A;  1FOV A;  2CVD A;  4MJA A;  1ZZY A;  2H1D A;  5DCG A;  5A5K A;  4HU9 A;  1JZO A;  1NHO A;  2I9H A;  3LFL A;  1GTU A;  4GQC A;  4DSS A;  2WVY A;  3H93 A;  4N0V A;  4MH3 A;  3G7I A;  2TIR A;  2FWF A;  4RUV A;  3KM6 A;  3GMF A;  2EFD A;  2WFC A;  2DJ2 A;  1PL2 A;  1YEP A;  2VOC A;  2RM6 A;  5LCZ A;  2F9S A;  1NSW A;  2DIY A;  3CTG A;  4K0G A;  3I6A A;  1Z6N A;  6GST A;  3PH9 A;  5HR1 A;  4Z7X A;  1SKW B;  3QOU A;  4LL1 B;  1JZW A;  2LST A;  3BOA A;  3IRA A;  5IPH A;  4KX4 A;  5A4W A;  2JAD A;  2DBC A;  1MD3 A;  4F03 A;  3UBK A;  5ID2 A;  1ZGN A;  2UV8 G;  2FHE A;  1GUM A;  4AJ7 A;  4GLT A;  4MZC A;  4N30 A;  4G9H A;  4O7H A;  1ZL9 A;  4XRA A;  3HYP A;  5F0G A;  1CQG A;  3ISO A;  1OC9 A;  4YKG A;  5LNK e;  2O85 A;  5F8B A;  5HR0 A;  12GS A;  1ZYE A;  1WIK A;  5H5Q A;  3ZIV A;  4WF4 A;  4EKZ A;  1WP0 A;  1SD8 A;  3U6V A;  1ABA A;  2K8V A;  4Q5F A;  3Q74 A;  5DQY A;  4DSS B;  3LWA A;  5A1N A;  4HUA A;  2A2P A;  1J0F A;  3HMJ G;  1FO5 A;  5FWG A;  3O6T A;  5D8I A;  1DBY A;  2YWM A;  1M2A A;  2CAI A;  5ECN B;  3QMX A;  1SK1 A;  3HVN A;  2IME A;  3GRX A;  3F4S A;  2PMT A;  1O85 A;  4ZIL A;  4O32 A;  4TKY A;  1OC3 A;  2CZ2 A;  3IA1 A;  2YP6 A;  4N0Z A;  5B6N A;  2E2M A;  5ABR A;  3CRU A;  3SBC A;  4HOJ A;  3QDN A;  3KCM A;  4KH7 A;  1GP1 A;  3IXR A;  2V1M A;  5CRE A;  2WW3 A;  4AKI A;  1QXH A;  2KUC A;  2A2S A;  3LOR A;  3HJP A;  3F4R A;  2FWE A;  5IIZ A;  4IHU A;  4DSQ A;  4KDU A;  3VWU A;  2HT9 A;  2R0C A;  1OC9 B;  1MTC A;  4KUN A;  1DSB A;  4WF5 A;  2PBJ A;  2L59 A;  3ME7 A;  4LMV A;  18GS A;  4NMU A;  2WVX B;  3ZML A;  1F6M C;  13GS A;  1XG8 A;  1TXX A;  4TW5 A;  4LMW A;  2R0G A;  4F9Z A;  4EDZ A;  5FT3 A;  1GTI A;  3DML A;  1GSS A;  2H30 A;  3TGZ A;  3GTU A;  1Z3E A;  3D0Z A;  4HI7 A;  4ACS A;  4NV5 A;  3E0U A;  1V58 A;  4MAB A;  3KP8 A;  2CZ3 A;  1OC8 A;  3IV4 A;  2DJ1 A;  4G10 A;  4WXT A;  4K8M A;  5IMZ A;  3UL3 A;  5HQP A;  4XS6 A;  4FH8 A;  4TN8 A;  2OE3 A;  2H0I A;  3QFA C;  3F6F A;  5J47 A;  1ZOF A;  1TU8 A;  5CNW A;  1N25 A;  1WMJ A;  2C0G A;  8GSS A;  3L78 A;  2DIZ A;  4KND A;  3VWV A;  3EWL A;  1XWC A;  2PVO C;  5D9T A;  2YWI A;  1MDJ A;  2H6X A;  3HKR A;  4L0W A;  5JWO B;  2QA1 A;  2H8L A;  3HDC A;  5JCG A;  1HNA A;  1BAY A;  1XFL A;  2IIY A;  2EFC A;  1S3A A;  1Y1U A;  5DAK B;  3M3M A;  5D73 A;  3TKP A;  4POK A;  2HSN A;  2VLU A;  1S4B P;  4OWY A;  4IP6 A;  5D9W A;  1THO A;  3GTU B;  1AQX A;  2VIM A;  4WEY A;  2V6K A;  4KAE A;  1NM3 A;  4OCE A;  2AUV A;  3GL5 A;  2K8S A;  5D9V A;  2X4A A;  1RQM A;  2M46 A;  2WZS A;  4HJM A;  2KP1 A;  5C04 A;  4KF9 A;  4TVE A;  4MP4 A;  3IC8 A;  1GSU A;  5IMV A;  2I81 A;  2R37 A;  7GSS A;  1S3D A;  2CX4 A;  4ID0 A;  1R26 A;  5ELA A;  4ECI A;  3LGC A;  1E2Y A;  4MF6 A;  2HXK A;  5ECS A;  3TJG A;  4CY6 A;  4ECC A;  3QCP A;  3OR5 A;  5A34 A;  4HSC X;  2JL4 A;  4CHS A;  1X0R A;  2JZR A;  4O5U A;  4PGT A;  4BPY A;  1OKD A;  4EC0 A;  1XVW A;  4AJ6 A;  2H66 A;  2GT6 A;  3LYK A;  1B9X C;  4WKW A;  1X9S B;  2QA2 A;  2VM2 A;  2H75 A;  3TDG A;  1O7U A;  4ECJ A;  4K0N A;  3C7M A;  4PX1 A;  3RBT A;  3BCI A;  3A2X A;  2LNS A;  4KSM A;  3KTL A;  1WE0 A;  2L6D A;  1GTA A;  4I97 A;  4GQF A;  3F9U A;  1ERV A;  3E9J B;  2ZCT A;  5A4V A;  1B8X A;  2GZY A;  5KOX A;  2IL3 A;  2B5E A;  2V32 A;  4DEJ A;  1TW9 A;  4K7I A;  2WDU A;  2H1L A;  2VCX A;  5G2Z A;  2OA7 A;  2IWT A;  2FGX A;  3KH7 A;  2GLR A;  3GA4 A;  4WBR D;  3NIV A;  3CYN A;  2FLS A;  3CXG A;  3CRT A;  1NW2 A;  2X49 A;  1PN9 A;  5ECK B;  2VCT A;  4YQM A;  4MH2 A;  4AJ8 A;  3RAZ A;  2D2Z A;  4IJ3 A;  3CMI A;  4KCE A;  1K3L A;  4HQZ A;  2LRN A;  3GFK A;  4G0I A;  3UBL A;  2DJ3 A;  2ZUP A;  4I6X A;  4E8H A;  5A34 B;  4NAX A;  3HXS A;  4POB A;  5BMU B;  2HE3 A;  4QMK A;  2H1G A;  2IPA A;  2REM A;  2GQL A;  4AKX B;  1T1V A;  3AY8 A;  1EV4 A;  2TRX A;  2H72 A;  1M9A A;  1YF0 A;  1MDK A;  4WR5 A;  3CSI A;  1K0C A;  3FYG A;  5ECP B;  1BYE A;  4OFM A;  5E4W A;  2GS3 A;  4X0X A;  4I2U A;  1OVN A;  4MK3 A;  1TJD A;  1HNC A;  1O8W A;  2C0F A;  3GST A;  3GUR A;  1X5D A;  1FOH A;  2H01 A;  2FD3 A;  1TK5 B;  2VKZ G;  5J4U A;  4QQ7 A;  2C8U A;  2FNO A;  2OKA A;  3A3T A;  1GRX A;  2DJJ A;  2YPM A;  4BWQ A;  1PD2 1;  3M9K A;  4AKH A;  4ZBB A;  1V2A A;  1R4W A;  4Z2R A;  4F82 A;  1AW9 A;  2QSI A;  1GWC A;  3HY2 A;  3L4N A;  3RDW A;  16GS A;  5J4Y A;  3KMO A;  2WJU A;  3CBU A;  3ZFL A;  3N5O A;  2ES7 A;  1A23 A;  1XW5 A;  1YQ1 A;  4OFT A;  3TB2 A;  5B8B A;  2GZZ A;  3IBH A;  1T4Z A;  2YZU A;  4FIW A;  2GQK A;  3GIX A;  1AUC A;  2AJQ B;  5CYY A;  1EWX A;  1I9D A;  2X64 A;  4NV2 A;  3DWV A;  2CV4 A;  1XPV A;  3FW2 A;  5ECO B;  2EFE A;  1Q4J A;  2VLT A;  3G7Y A;  1EGO A;  4IKH A;  5AIS A;  1XOA A;  1OE8 A;  2CX3 A;  3TKQ A;  1U3A A;  4PUF C;  3WD6 A;  5GSS A;  4V2M A;  3GN3 A;  3ZVJ A;  4OFN A;  5EPF A;  5G1K A;  3L9S A;  1AIU A;  4GF0 A;  2HNL A;  2KP2 A;  5B7C A;  1M3J A;  3PGT A;  4TR4 A;  4WBJ A;  4OD7 A;  3D22 A;  3KH9 A;  2J9H A;  3IR4 A;  1MDI A;  1ZYN A;  2FA8 A;  4O5Q A;  4I5Q A;  2HSH A;  2HRF A;  3KJY A;  5DAL A; 
#chains in the Genus database with same CATH homology
 3QAV A;  1H75 A;  1VF4 A;  3RPN A;  3ZL5 A;  1ERW A;  2RM5 A;  1OE7 A;  3L9U A;  5J40 A;  4I8B A;  5IMA A;  4YQU A;  4PNF A;  3G9B A;  1F2E A;  3MAK A;  2MBS A;  3TRX A;  1U87 A;  3KD0 A;  3TJF A;  2OBI A;  1Y6E A;  4GXZ A;  3UMA A;  3PR8 A;  5IOX A;  1SL0 B;  2EC4 A;  4AGS A;  2LJK A;  3BJ5 A;  17GS A;  3N9J A;  1IYI A;  1YVL A;  3U5R E;  4JE1 A;  5IO2 A;  5AGY A;  2IJY A;  3GL3 A;  4IJI A;  5KN0 A;  2HRA A;  3DD3 A;  2WB9 A;  2VM1 A;  3HA9 A;  3KIJ A;  3LJR A;  5HR2 A;  4RI7 A;  4ZB8 A;  1J9B A;  4L5O A;  5DJL A;  1IYH A;  1F3B A;  3WGD A;  4Q5Q A;  1KEB A;  1XW6 A;  2B1K A;  3L0H A;  3TCO A;  2K6V A;  1M99 A;  1OKT A;  5AIX A;  1XOB A;  1PKW A;  3TU3 B;  2R5G A;  5DAL B;  2EIO A;  1SK0 A;  2IN3 A;  2H76 A;  1MEK A;  3FR3 A;  1ML6 A;  2ON5 A;  1TTZ A;  1VRS D;  2Z9S A;  3A5I A;  1XWK A;  4N10 A;  4RI6 A;  1SYX A;  2LQQ A;  3F8U A;  3MDK A;  1GSY A;  1A0F A;  2K18 A;  3C71 A;  4GST A;  3P90 A;  1HYU A;  1N2A A;  5ECM B;  1ZYP A;  2YN1 A;  4KA0 A;  2XHF A;  2FCH A;  5JCU A;  1F9M A;  2LV3 A;  1QK8 A;  5B8A A;  2P31 A;  2B6M A;  4MJB A;  4MCU A;  3TOT A;  4MF7 A;  4XRD A;  1TRS A;  2NTO A;  1ST9 A;  2RUE A;  3VFI A;  1CQH A;  4J2F A;  5IMC A;  5KEJ A;  6GSX A;  3P2A A;  3GSS A;  4D73 A;  2N5A A;  2CAQ A;  4EIP A;  3Q6O A;  3UVH A;  3TOU A;  3UVT A;  4JR4 A;  4EUY A;  1Z7R A;  4Q5R A;  3UAP A;  1B9Y C;  4CDO A;  1T7P B;  2VL9 A;  4XIH A;  2C3T A;  4HQS A;  3QR6 A;  5DAK A;  4H86 A;  1MD4 A;  5ECR B;  2PUK C;  3DXB A;  4XS4 A;  1QQ2 A;  2GZP A;  3E3E A;  4X4J A;  3CWG A;  2OT3 A;  2QC7 A;  2V6O A;  3NOF A;  2GGT A;  1G6Y A;  5GST A;  4CY8 A;  1T4Y A;  5KN1 A;  5CO3 A;  4GDF A;  2XC2 A;  3WGX A;  4KE3 A;  5J9C A;  1TI3 A;  2RLI A;  2YJH A;  4A5P A;  3JCM L;  5FHI A;  4MLY A;  2JZS A;  1KTE A;  3R2Q A;  2UZ8 A;  3LSZ A;  2E7P A;  3ERF A;  4FYC A;  1SJ6 A;  6GSS A;  5CAX A;  1GSE A;  4D73 B;  3C1R A;  4PQ1 A;  3HZ8 A;  2L6C A;  3ZFB A;  2DMM A;  3KMN A;  3DKS A;  2AB6 A;  3GKK A;  5G1L A;  2B5X A;  3EIN A;  1BG1 A;  6GSU A;  3EMX A;  6GSW A;  1M0U A;  1FB0 A;  3VI5 A;  2O7K A;  2RII A;  3IHQ A;  3KXO A;  1XWA A;  2YJ7 A;  3I43 A;  1K3O A;  4ILF A;  2NPB A;  3SWL A;  1S3C A;  2X99 A;  3ZMK A;  5KOW A;  4PUR A;  2A2R A;  1T00 A;  4XS4 B;  2YV7 A;  4MJE A;  3V1W A;  4IBP A;  2EIR A;  4IGJ A;  1PQN A;  4N11 A;  5HFK A;  5HR3 A;  4JED A;  4TR1 B;  2I1U A;  3LQ7 A;  2LEG A;  1ILO A;  2MYG A;  2MMA A;  1EV9 A;  1VF1 A;  4KW6 A;  4YAP A;  2KOK A;  4EF0 A;  4X1U A;  3DRN A;  4NHZ A;  1F37 A;  5IOW A;  5CP1 A;  3VWW A;  4MMM A;  2ALB A;  3F6D A;  1O81 A;  1GLP A;  4W66 A;  3RHB A;  3EVI A;  4TXV A;  9GSS A;  2P5R A;  4GWR A;  2F8A A;  2LJA A;  3ERG A;  3H4K A;  4OO5 A;  1XIY A;  4XCS A;  3ED3 A;  1LU4 A;  5B6M A;  4RQX A;  5BMU A;  3WGE A;  4BA7 A;  4HDE A;  3O76 A;  5J9B A;  4PUA A;  4ZB6 A;  4IQ1 A;  1PX7 A;  5ENU A;  1J08 A;  1OAZ A;  3HZ4 A;  4ML6 A;  5DVB A;  2AYT A;  1UA5 A;  3QAW A;  1SD9 A;  3C73 A;  4BVX A;  2VD1 A;  1SK2 A;  2GDR A;  2X8C A;  4ISD A;  1A8Y A;  3L9V A;  3TJB A;  2DKI A;  4YAV A;  1F3A A;  1URM A;  2MZC A;  2OJL A;  1KNG A;  4G19 A;  1X5E A;  1GLQ A;  5CRG A;  1Q98 A;  2H70 A;  5IMF A;  1K0M A;  3EE2 A;  3BBY A;  1XW9 A;  4ZBA A;  2M80 A;  2O87 A;  5E59 A;  10GS A;  2PER A;  4FYB A;  4J56 E;  3WYW A;  2OE1 A;  1ERU A;  2OE0 A;  2LS5 A;  3CSJ A;  2LTK A;  3IOS A;  5A5H B;  3VI7 A;  1GNW A;  1THX A;  5F06 A;  3ERW A;  4IP1 A;  4J57 E;  5COH A;  3TRQ A;  3GKX A;  1WWJ A;  4ECB A;  1FVK A;  3QAG A;  5GZZ B;  4G2E A;  3FR9 A;  1M7T A;  2AAW A;  4FYU A;  2C80 A;  1EP7 A;  5H5R A;  3IAM 2;  20GS A;  5LD0 A;  4IS0 A;  1V9W A;  1JFU A;  1TK0 B;  3R3E A;  1KBN A;  3QFB C;  2HRN A;  4ZXG A;  4BVX B;  4N3Z A;  2X8G A;  1FB6 A;  3LYP A;  5DCH A;  4EXJ A;  3KGK A;  1WJK A;  5HFI A;  3QD9 A;  4PXO A;  1V57 A;  1A24 A;  1GUK A;  2VD0 A;  2GQM A;  4OMV A;  4MNN A;  1AQV A;  3DVX A;  1Y25 A;  2CA8 A;  2YWN A;  4AF2 A;  1GH2 A;  5HFG A;  3I69 A;  4V2N A;  4EO3 A;  4K5S A;  5DBQ A;  3M1G A;  3HHV A;  3APS A;  4PQI A;  3Q18 A;  5F07 A;  1ERT A;  3CTF A;  5JCW A;  5J5N A;  4PTS A;  4EVM A;  4HJ2 A;  3M0F A;  4K5R A;  1Z5Y E;  4LA1 A;  1SL1 B;  4YH2 A;  2GTU A;  2A4V A;  2VL3 A;  3EC3 A;  1K0B A;  1VF3 A;  2DLX A;  3PPU A;  1JLW A;  1EEJ A;  1EP8 A;  1K0N A;  3VPQ A;  1GUL A;  1BF5 A;  3IAS 2;  3MYD A;  4IN0 A;  1PGT A;  2WZ9 A;  5ECQ B;  4ZB9 A;  3VWX A;  5INY A;  1V98 A;  1B48 A;  2H0G A;  4LL4 B;  3TKR A;  2WRT A;  2R6K A;  5CRH A;  3TUE A;  1QUW A;  1U88 A;  4BL7 A;  4NXI A;  4K2D A;  2I3Y A;  1X9M B;  3ME8 A;  1SJZ A;  3LG6 A;  5A4U A;  2VL2 C;  4KDX A;  2H71 A;  5IO0 A;  2H1A A;  4JRR A;  1AAZ A;  3DEX A;  5J3R A;  1TOF A;  4ZL8 A;  1UC7 A;  4XS1 A;  3GNJ A;  1SU9 A;  4X43 A;  3W6G A;  3HD5 A;  3D4M A;  3GYK A;  5IMD A;  1O8X A;  1TXU A;  1YF1 A;  4G01 A;  4AKG A;  1GNE A;  1A8L A;  1GSD A;  4IVF A;  3FZ4 A;  4HEA 2;  2HQT A;  2X8H A;  3J7Y b;  3EYT A;  4EDY A;  4HU7 A;  1TI1 A;  5F05 A;  1SVO A;  2B7J A;  4Z2U A;  2H6Z A;  4MJC A;  4WR4 A;  2A4H A;  4L5L A;  1W89 A;  3ZLP A;  5EL8 A;  3FMW A;  1XCC A;  1JZD A;  1G0T A;  3GV1 A;  3FY7 A;  2YNX A;  3D21 A;  2E2G A;  4TOP A;  4GSS A;  14GS A;  4YKF A;  4HZ2 A;  3P7X A;  2YZH A;  1WOU A;  2O89 A;  2GSQ A;  2VO4 A;  1BED A;  1VGL A;  1X9W B;  2CVB A;  1WPI A;  4TR3 A;  2MMO A;  4BL7 B;  1UN2 A;  1PSQ A;  3LW9 A;  2XBQ A;  3DVW A;  3F3R A;  1W4V A;  4HZ4 A;  3UEM A;  1R5A A;  3DYR A;  1PKZ A;  2H19 A;  1SVM A;  4ZBD A;  2C1Y A;  4ZB7 A;  2R0P A;  3ZZX A;  1PN0 A;  2N5F A;  2LUS A;  4YQV A;  4JR6 A;  2LRT A;  2CQ9 A;  2IFQ A;  6GSV A;  2G0F A;  3A2V A;  4KGI A;  4CW9 A;  2XPD A;  3D5J A;  3RPP A;  2G2Q A;  3Q19 A;  4GSN A;  4AI6 A;  1A2L A;  5JWR B;  4K6X A;  4NWY A;  2R4V A;  5KN2 A;  2VCQ A;  2V41 A;  3IK7 A;  2WCI A;  3KTB A;  1AQW A;  2VL2 A;  4MDC A;  1TRV A;  2VUP A;  4ML1 A;  1K0O A;  2DJK A;  4L0U A;  2HZE A;  3A5W A;  2OBK A;  1ON4 A;  2OAD A;  1G7O A;  3FRC A;  2B1L A;  3KZQ A;  1DE2 A;  4ZL9 A;  2P5Q A;  2PN8 A;  1LBK A;  2N5B A;  4KCA A;  3IPZ A;  1O6J A;  4K7N A;  3QPM A;  2LNT A;  3TRP A;  1SKS B;  2PU9 C;  2BJX A;  4TR0 A;  1C72 A;  4O92 A;  3PIN A;  2H6Y A;  1H4O A;  2BMX A;  2DML A;  1K0D A;  4KB3 A;  2J23 A;  2R3X A;  2AHE A;  4KSO A;  1ACV A;  2JU5 A;  1XWB A;  3HJM A;  5ID2 B;  3UJ1 A;  1TDI A;  1EOH A;  2FWG A;  2YCD A;  1XBS A;  4ZIJ A;  4MF5 A;  3GHA A;  3GX8 A;  2V2G A;  2H73 A;  2LRC A;  3EPT A;  2IFQ B;  2TRC P;  1M2B A;  1GUH A;  2JSY A;  1FG4 A;  4TR1 A;  3A2W A;  3GUS A;  4IQA A;  2LKU A;  2ZNM A;  4WET A;  4DSR A;  4GTU A;  3APQ A;  4Q5N A;  3O3T A;  2E0Q A;  2CT6 A;  1M9B A;  1SJI A;  3I9V 2;  5H5S A;  3D6I A;  1Z6M A;  1U6T A;  3VUR A;  4L8E A;  1ZCP A;  2HZE B;  4GRF A;  4FO5 A;  2JZT A;  4K9Z A;  1QFN A;  4EE0 A;  3LEF A;  3LXZ A;  5A1N B;  2F8F A;  2ON7 A;  1O73 A;  3G7J A;  4MZW A;  1R7H A;  2GSR A;  4G0L A;  3BCK A;  5GAN D;  1HNB A;  4XTS A;  2VAF A;  2DKH A;  2XBI A;  2B3S A;  3BD2 A;  4QL7 A;  3TJK A;  1JHB A;  5G5E A;  1QGV A;  2H1B A;  1JLV A;  2IMF A;  4OO4 A;  3HCZ A;  3C8E A;  4NPB A;  4ZL7 A;  4P3Y B;  5ECL B;  4E68 A;  3GX0 A;  3VLN A;  1EGR A;  3APO A;  3KEB A;  1ZMA A;  1PX6 A;  5AIV A;  4TXO A;  1EEM A;  11GS A;  2PGT A;  5KN3 A;  3RHC A;  1R5P A;  2PWJ A;  2HRK A;  4KDY A;  3GH9 A;  4TRX A;  2QGV A;  1PA3 A;  2WGR A;  2JAC A;  2MBT A;  3IE3 A;  1SKR B;  2KLX A;  3US3 A;  4PNG A;  3W8J A;  3FZ5 A;  4I2T A;  1GL8 A;  2K9F A;  2B5Y A;  2F51 A;  1YKC A;  3EUR A;  1FAA A;  1AXD A;  2HYX A;  1QMV A;  5EVO A;  1ZYQ B;  1YZX A;  1GTB A;  4V2L A;  1YJ6 A;  5IQY A;  2L4C A;  2HFD A;  4OCF A;  1XVQ A;  1SEN A;  3KP9 A;  5J41 A;  4JZQ A;  4XHM A;  1N8J A;  2L57 A;  1LJR A;  3J7Y k;  2MMZ A;  1USB A;  2VCV A;  3W8S A;  5A5H A;  1BQ7 A;  2L5O A;  4FQU A;  4BWS A;  3GKN A;  2LQO A;  2IMD A;  3ZVJ D;  2FUG 2;  2FA4 A;  2YAN A;  2B7K A;  3D4T A;  3ZIJ A;  2XPE A;  2NDO A;  5L71 A;  1G7E A;  4POM A;  1HQO A;  3MSZ A;  1TKD B;  3F0I A;  1U3I A;  2NVL A;  2C3N A;  2QKE A;  3EMP A;  4TXO B;  1GSQ A;  3TKS C;  2PPT A;  3ZTL A;  1K3Y A;  2CVK A;  1SL2 B;  1GSF A;  2DC5 A;  2C0E A;  1DUG A;  1UVZ A;  2HRK B;  3FHK A;  4G0K A;  2KHP A;  5IPG A;  3CSH A;  1XWG A;  4USS A;  5ELG A;  2HLS A;  3IC4 A;  3UOM A;  1AC1 A;  1Z9H A;  2EIQ A;  2WS2 A;  5DJM A;  2WUL A;  1A2J A;  3TKS E;  2GSS A;  2HSN B;  3H79 A;  3LXT A;  1OYJ A;  3EU4 A;  3MNG A;  4ICY A;  3MWH A;  3HJO A;  5GAP D;  1YY7 A;  2LJR A;  2H74 A;  4GCI A;  2O5V A;  3F3Q A;  4NHW A;  3H8Q A;  4Z2T A;  1K0A A;  3ZYW A;  3ZRD A;  4IW9 A;  1TRU A;  1YDK A;  5C00 A;  1YEX A;  2FY6 A;  3FK8 A;  1T3B A;  5AN1 A;  2O8V B;  5ECI B;  2VCZ A;  1XZO A;  2VLV A;  1TP9 A;  3FR6 A;  4POL A;  2HSY A;  1PL1 A;  1X5C A;  3DIE A;  3WT2 A;  3TJJ A;  3ZIT A;  1M2D A;  1T8E B;  3FEU A;  3GKM A;  3FKF A;  5BRT A;  5JWQ B;  3F63 A;  1B4P A;  2M72 A;  2H0H A;  3K8N A;  2AV4 A;  5DDL A;  3FZ9 A;  3HVV A;  4PQH A;  3F4T A;  1XXU A;  4BVY A;  2JSZ A;  1FHE A;  1PMT A;  6GSY A;  4EIQ A;  1A0R P;  5D96 A;  1DE1 A;  4F0C A;  5IM9 A;  3TKS A;  1HD2 A;  2F3M A;  1YKA A;  1TRW A;  3UAR A;  3NZN A;  2EFH A;  3FZA A;  1RW1 A;  3HVS A;  2I4A A;  3GH6 A;  2HSM A;  4QL9 A;  3VPT A;  5G5F A;  4E8E A;  1V40 A;  4HS1 A;  3C1S A;  2RUF A;  1FVJ A;  1PRX A;  3IK9 A;  5D9X A;  2BTO T;  4K7O A;  4JU5 A;  4V1A p;  2YV9 A;  1JZR A;  1TK8 B;  4MA9 A;  5J4V A;  4JBB A;  2NBS A;  2C3Q A;  2C4J A;  1Z7P A;  1NHY A;  2L4Q A;  2C0D A;  3ZRE A;  4ULX A;  5G31 A;  1BX9 A;  4V1A g;  2L5L A;  2YWO A;  19GS A;  4RQR A;  4DVC A;  3M8N A;  5DQS A;  1B4Q A;  4MPG A;  2PVQ A;  3WT1 A;  4K2X A;  1SYR A;  3IDV A;  1TU7 A;  1FW1 A;  1VF2 A;  1BJX A;  2GT5 A;  2VCW A;  4F0B A;  1E6B A;  3H1N A;  5G30 A;  2HZF A;  5ECH B;  3HVX A;  4LLR A;  4BVY B;  1BG5 A;  2IMI A;  1G6W A;  2GVP A;  5CRD A;  4IEL A;  2P0G A;  2R2J A;  2DSA A;  1EOG A;  4K1F A;  2YOI A;  2FWH A;  3MIX A;  3EU3 A;  3S9F A;  22GS A;  4O5R A;  1EZK A;  5D93 A;  5EY6 A;  1I5G A;  2OAC A;  2HI7 A;  5CRW A;  2HSM B;  3P8W A;  1WRY A;  4F2I A;  3IHG A;  4MPF A;  1RK4 A;  3M9J A;  1A2M A;  4MZB A;  4EL1 A;  2GST A;  3DGQ A;  2MMN A;  2DJ0 A;  2IMK A;  3VK9 A;  1SVL A;  3UIW A;  1FOV A;  2CVD A;  4MJA A;  1ZZY A;  2H1D A;  5DCG A;  5A5K A;  4HU9 A;  1JZO A;  1NHO A;  2I9H A;  3LFL A;  1GTU A;  4GQC A;  4DSS A;  3H93 A;  4N0V A;  4MH3 A;  3G7I A;  2TIR A;  2FWF A;  4RUV A;  3KM6 A;  3GMF A;  2EFD A;  2WFC A;  2DJ2 A;  1PL2 A;  1YEP A;  2VOC A;  2RM6 A;  5LCZ A;  2F9S A;  1NSW A;  2DIY A;  3CTG A;  4K0G A;  3I6A A;  1Z6N A;  6GST A;  3PH9 A;  5HR1 A;  4Z7X A;  1SKW B;  3QOU A;  4LL1 B;  1JZW A;  2LST A;  3BOA A;  3IRA A;  5IPH A;  4KX4 A;  5A4W A;  2JAD A;  2DBC A;  1MD3 A;  4F03 A;  3UBK A;  5ID2 A;  1ZGN A;  2UV8 G;  2FHE A;  1GUM A;  4AJ7 A;  4GLT A;  4MZC A;  4N30 A;  4G9H A;  4O7H A;  1ZL9 A;  4XRA A;  3HYP A;  5F0G A;  1CQG A;  3ISO A;  1OC9 A;  4YKG A;  5LNK e;  2O85 A;  5F8B A;  5HR0 A;  12GS A;  1ZYE A;  1WIK A;  5H5Q A;  3ZIV A;  4WF4 A;  4EKZ A;  1WP0 A;  1SD8 A;  3U6V A;  1ABA A;  2K8V A;  4Q5F A;  3Q74 A;  5DQY A;  4DSS B;  3LWA A;  5A1N A;  4HUA A;  2A2P A;  1J0F A;  3HMJ G;  1FO5 A;  5FWG A;  3O6T A;  5D8I A;  1DBY A;  2YWM A;  1M2A A;  2CAI A;  5ECN B;  3QMX A;  1SK1 A;  2IME A;  3GRX A;  3F4S A;  2PMT A;  1O85 A;  4ZIL A;  4O32 A;  4TKY A;  1OC3 A;  2CZ2 A;  3IA1 A;  2YP6 A;  4N0Z A;  5B6N A;  2E2M A;  5ABR A;  3CRU A;  3SBC A;  4HOJ A;  3QDN A;  3KCM A;  4KH7 A;  1GP1 A;  3IXR A;  2V1M A;  5CRE A;  4AKI A;  1QXH A;  2KUC A;  2A2S A;  3LOR A;  3HJP A;  3F4R A;  2FWE A;  5IIZ A;  4IHU A;  4DSQ A;  4KDU A;  3VWU A;  2HT9 A;  2R0C A;  1OC9 B;  1MTC A;  4KUN A;  1DSB A;  4WF5 A;  2PBJ A;  2L59 A;  3ME7 A;  4LMV A;  18GS A;  4NMU A;  3ZML A;  1F6M C;  13GS A;  1TXX A;  4TW5 A;  4LMW A;  2R0G A;  4F9Z A;  4EDZ A;  5FT3 A;  1GTI A;  3DML A;  1GSS A;  2H30 A;  3TGZ A;  3GTU A;  1Z3E A;  3D0Z A;  4HI7 A;  4ACS A;  4NV5 A;  3E0U A;  1V58 A;  4MAB A;  3KP8 A;  2CZ3 A;  1OC8 A;  3IV4 A;  2DJ1 A;  4G10 A;  4WXT A;  4K8M A;  5IMZ A;  3UL3 A;  5HQP A;  4XS6 A;  4FH8 A;  4TN8 A;  2OE3 A;  2H0I A;  3QFA C;  3F6F A;  5J47 A;  1ZOF A;  1TU8 A;  5CNW A;  1N25 A;  1WMJ A;  2C0G A;  8GSS A;  3L78 A;  2DIZ A;  4KND A;  3VWV A;  3EWL A;  1XWC A;  2PVO C;  5D9T A;  2YWI A;  1MDJ A;  2H6X A;  3HKR A;  4L0W A;  5JWO B;  2QA1 A;  2H8L A;  3HDC A;  5JCG A;  1HNA A;  1BAY A;  1XFL A;  2IIY A;  2EFC A;  1S3A A;  1Y1U A;  5DAK B;  3M3M A;  5D73 A;  3TKP A;  4POK A;  2HSN A;  2VLU A;  4OWY A;  4IP6 A;  5D9W A;  1THO A;  3GTU B;  1AQX A;  2VIM A;  4WEY A;  2V6K A;  4KAE A;  1NM3 A;  4OCE A;  2AUV A;  3GL5 A;  2K8S A;  5D9V A;  2X4A A;  1RQM A;  2M46 A;  4HJM A;  2KP1 A;  5C04 A;  4KF9 A;  4TVE A;  4MP4 A;  3IC8 A;  1GSU A;  5IMV A;  2I81 A;  2R37 A;  7GSS A;  1S3D A;  2CX4 A;  4ID0 A;  1R26 A;  5ELA A;  4ECI A;  3LGC A;  1E2Y A;  4MF6 A;  2HXK A;  5ECS A;  3TJG A;  4CY6 A;  4ECC A;  3QCP A;  3OR5 A;  5A34 A;  2JL4 A;  4CHS A;  1X0R A;  2JZR A;  4O5U A;  4PGT A;  4BPY A;  1OKD A;  4EC0 A;  1XVW A;  4AJ6 A;  2H66 A;  2GT6 A;  3LYK A;  1B9X C;  4WKW A;  1X9S B;  2QA2 A;  2VM2 A;  2H75 A;  3TDG A;  1O7U A;  4ECJ A;  4K0N A;  3C7M A;  4PX1 A;  3RBT A;  3BCI A;  3A2X A;  2LNS A;  4KSM A;  3KTL A;  1WE0 A;  2L6D A;  1GTA A;  4I97 A;  4GQF A;  3F9U A;  1ERV A;  3E9J B;  2ZCT A;  5A4V A;  1B8X A;  2GZY A;  5KOX A;  2IL3 A;  2B5E A;  2V32 A;  4DEJ A;  1TW9 A;  4K7I A;  2WDU A;  2H1L A;  2VCX A;  5G2Z A;  2OA7 A;  2IWT A;  2FGX A;  3KH7 A;  2GLR A;  3GA4 A;  4WBR D;  3NIV A;  3CYN A;  2FLS A;  3CXG A;  3CRT A;  1NW2 A;  2X49 A;  1PN9 A;  5ECK B;  2VCT A;  4YQM A;  4MH2 A;  4AJ8 A;  3RAZ A;  2D2Z A;  4IJ3 A;  3CMI A;  4KCE A;  1K3L A;  4HQZ A;  2LRN A;  3GFK A;  4G0I A;  3UBL A;  2DJ3 A;  2ZUP A;  4I6X A;  4E8H A;  5A34 B;  4NAX A;  3HXS A;  4POB A;  5BMU B;  2HE3 A;  4QMK A;  2H1G A;  2IPA A;  2REM A;  2GQL A;  4AKX B;  1T1V A;  3AY8 A;  1EV4 A;  2TRX A;  2H72 A;  1M9A A;  1YF0 A;  1MDK A;  4WR5 A;  3CSI A;  1K0C A;  3FYG A;  5ECP B;  1BYE A;  4OFM A;  5E4W A;  2GS3 A;  4X0X A;  4I2U A;  1OVN A;  4MK3 A;  1TJD A;  1HNC A;  1O8W A;  2C0F A;  3GST A;  3GUR A;  1X5D A;  1FOH A;  2H01 A;  2FD3 A;  1TK5 B;  2VKZ G;  5J4U A;  4QQ7 A;  2C8U A;  2FNO A;  2OKA A;  3A3T A;  1GRX A;  2DJJ A;  2YPM A;  4BWQ A;  1PD2 1;  3M9K A;  4AKH A;  4ZBB A;  1V2A A;  1R4W A;  4Z2R A;  4F82 A;  1AW9 A;  2QSI A;  1GWC A;  3HY2 A;  3L4N A;  3RDW A;  16GS A;  5J4Y A;  3KMO A;  2WJU A;  3CBU A;  3ZFL A;  3N5O A;  2ES7 A;  1A23 A;  1XW5 A;  1YQ1 A;  4OFT A;  3TB2 A;  5B8B A;  2GZZ A;  3IBH A;  1T4Z A;  2YZU A;  4FIW A;  2GQK A;  3GIX A;  1AUC A;  2AJQ B;  5CYY A;  1EWX A;  1I9D A;  2X64 A;  4NV2 A;  3DWV A;  2CV4 A;  1XPV A;  3FW2 A;  5ECO B;  2EFE A;  1Q4J A;  2VLT A;  3G7Y A;  1EGO A;  4IKH A;  5AIS A;  1XOA A;  1OE8 A;  2CX3 A;  3TKQ A;  1U3A A;  4PUF C;  3WD6 A;  5GSS A;  4V2M A;  3GN3 A;  3ZVJ A;  4OFN A;  5EPF A;  5G1K A;  3L9S A;  1AIU A;  4GF0 A;  2HNL A;  2KP2 A;  5B7C A;  3PGT A;  4TR4 A;  4WBJ A;  4OD7 A;  3D22 A;  3KH9 A;  2J9H A;  3IR4 A;  1MDI A;  1ZYN A;  2FA8 A;  4O5Q A;  4I5Q A;  2HSH A;  2HRF A;  3KJY A;  5DAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...