3P93A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
403
structure length
384
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-MANNONATE DEHYDRATASE FROM CHROMOHALOBACTER SALEXIGENS complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 144
structure length 384
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3p93A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3p93A01
5FJTA 4HCDA 3SN1A 1WUEA 4IT1A 3DG3A 3TJIA 3MSYA 3JZUA 2PP1A 3N6JA 4H83A 1TZZA 2P3ZA 2PSNA 3IJLA 4YWSA 1E9IA 2ZC8A 2GGEA 4DXKA 3HPFA 3OW1A 2OX4A 3VFCA 2AL1A 4GIRA 3SBFA 2HXUA 3PK7A 4MGGA 3MY9A 3MWCA 3CAWA 4M0XA 5IDZA 3R25A 2PPGA 2PP0A 4KT2A 1EC9A 3SN4A 4HNLA 5J04A 3BSMA 3H70A 2PU0A 3V3WA 3DESA 2OFJA 3FYYA 3P93A 2GGHA 1NU5A 2OQYA 3T9PA 1JCTA 3FVDA 3P3BA 3U9IA 2OZ8A 3THUA 3RGTA 3ES8A 4KEMA 4K2SA 3R11A 4H2HA 5BOEA 4A35A 4IZGA 3S5SA 3N6HA 4IP5A 4E6MA 1R6WA 4GYPC 3H8AA 4J3ZA 4E8GA 3RITA 1KCZA 3GD6A 2QJMA 2PTWA 2CHRA 2AL2A 1MRAA 3QLDA 3ES7A 1L8PA 2PTYA 2PS2A 3RO6A 5FJPA 3MZNA 3TQPA 3ZLFA 3GO2A 4ENLA 1KKOA 1XPYA 5BOFA 5ENLA 2GDQA 4FP1A 4E4FA 3TTEA 1MDRA 4H1ZA 3RCYA 4MKSA 3UXKA 3VA8A 3RR1A 2QGYA 1SJAA 4IP4A 3TWAA 2OG9A 2NQLA 4JN7A 2QVHA 3OP2A 2PCEA 1ELSA 4ZCWA 4GGBA 3T6CA 3NFUA 3NZGA 1PDYA 3V5FA 3DFHA 3IJQA 3SSZA 3JW7A 3UJRA 2ONEA 3GY1A 3UCCA 1PDZA 3MKCA 3VC6A 2OVLA 3NO1A 1W6TA 2POZA 4EWJA 2MUCA 4GGHA 4KWSA 3I6EA 3JVAA 2HNEA 1EC8A 3CB3A 2P0IA 2PGWA 2OPJA 3UCDA 3ZLHA 4DX3A 5FJUA 3Q45A 1BQGA 2OKTA 1YEYA 1SJDA 3U4FA 1TKKA 3DERA 4GFIA 3DGBA 2O56A 4GYPA 1DTNA 3VCCA 3TWBA 1BKHA 3R0UA 4K8GA 1EBGA 2FYMA 1MDLA 3QTPA 2GGIA 3BJSA 4A6GA 3QPEA 2PMQA 4GISA 3QN3A 2FKPA 4KPLA 4X2PA 3V4BA 4DYEA 3KUMA 3CXOA 1NELA 3DIPA 3PFRA 1MUCA 3TCSA 3UJSA 2AKZA 4HYRA 3SQSA 2DW7A 2QDDA 3H7VA 2OO6A 4J1OA 3ZVHA 3N4FA 4F4RA 3CYJA 3UJEA 1IYXA 4HCHA 3ENLA 3Q4DA 3V5CA 3EKGA 1R0MA 4ROPA 2OQHA 3I4KA 3ZVIA 2P88A 4DWDA 3RRAA 1RVKA 4FI4A 3UGVA 2GGJA 2QJJA 6ENLA 2XGZA 3DEQA 3T4WA 3GC2A 3T8QA 2PTXA 2P8BA 1TE6A 2PODA 1EBHA 3EEZA 2AL2B 5EU9A 3TJ4A 2GGGA 2GSHA 3OTRA 2XH0A 2OZTA 4DHGA 1XS2A 3ZLGA 2HZGA 1SJCA 3B97A 4G7FA 4HPNA 2XSXA 2XH2A 1ONEA 1KD0A 7ENLA 3OZMA 2QDEA 4HN8A 3OZYA 1FHVA 2QQ6A 3IK4A 4IHCA 3D46A 1WUFA 4Z17A 2MNRA 3MUCA 4GMEA 3VC5A 2PU1A 3N4EA 3H12A 1JDFA 2I5QA 2AKMA 3CK5A 4H19A 2PP3A 4ZA0A 4HCLA 4Z1YA 3DFYA 3FXGA 2GL5A 1JPMA 4MMWA 3DDMA 3VCNA 2P8CA 4G8TA 1FHUA 2OLAA 2XH7A 1P48A 3FCPA 3IJIA 4IL2A 3UJFA 4DN1A 1F9CA 1MNSA 2RDXA 3R1ZA 3SN0A 3OPSA 3K1GA 2DW6A 4E5TA 4JHMA 3BOXA 5FJOA 1EC7A 3TOYA 3MQTA 2QJNA 4E4UA 4JN8A 4M6UA 2PA6A 3FV9A 3UXLA 4IL0A 3I6TA 3S47A 3VDGA 4A3RA 4HNCA 3TW9A 3PWGA 3NXLA 1JPDX 1KKRA 3CT2A 3DG6A 2OZ3A 1SJBA 4K1WA 3P0WA 1P43A 3R0KA 2XH4A 1OEPA 3UJ2A 3STPA 2PTZA 3DG7A 3PWIA 2ZADA 5FJRA 3D47A 3FJ4A 1ECQA 3R10A 2PGEA 3SJNA 2HXTA 3QKEA 3ZVHB
chains in the Genus database with same CATH superfamily
3MUAA 1VEOA 3ANYA 5JBFA 4LVDA 1J01A 1UZ1A 1IEIA 1XCWA 4M24A 5BXSA 4XZ9A 3CUGA 1XLGA 3H6OA 2FIQA 2D20A 4LUSA 1H7OA 3W7CA 2VX5A 3KE0A 3QH2A 4O28A 3A64A 3FAXA 5C7VA 1ICSA 3AAMA 4HK5A 2GQ8A 2ON3A 3SBFA 3BAKA 5A8QA 3KFTA 1XGEA 1HJSA 3MY9A 3BAJA 4UC5A 4AZCA 1F3TA 4L6HA 1Q6LA 3TROA 4REQB 1UG6A 3I7SA 3IUHA 5HNRA 3UPWA 4EX4A 3Q2DA 5AHMA 3BZJA 4MB4A 3UT0A 3WQ8A 5IBXC 4IGSA 4GH1A 4R7OA 2V63A 2G3MA 1E0VA 3DGZA 1R5YA 3FYYA 1IXQA 1Q85A 1VFUA 4C91A 1KM0A 2OQYA 4XVEA 4A4AA 3NSMA 4PMNA 2QW5A 3ATYA 5CXPA 3CV7A 4ZOEA 2YL5A 2VEKA 4C6KA 1KN0A 2W91A 3NZ1A 2UBPC 5FL1A 4I3GA 2BCPA 2H9AA 2RGMA 5C9UA 2IPJA 3LSBA 3CZ8A 4IZGA 4C6JA 2HK0A 4WD0A 2XGBA 3VOHA 5GPRA 1DXFA 4FX7A 3ZYZA 2YYUA 2AL2A 1OIFA 1PZ1A 4WOZA 4XO7A 1FEBA 1VH7A 4LXFA 1P7TA 4JTSA 1LG1A 4NJGA 3LCHA 1SO6A 2AQOA 3FXYA 2WVVA 3CM4A 4GH3A 5HBFA 4YCPA 1PZ0A 1RY8A 4E4FA 1S2AA 3G18A 1DE6A 3OLIA 3PZGA 4GNKB 2A3CA 4XVDA 2UY3A 1TR1A 1D2KA 3U2EA 3N12A 2OEJA 3MI6A 3T0TA 2Z1XA 3ZZ1A 4OVXA 2YCKX 3IIZA 3GY1A 3VIHA 3UCCA 1MEHA 4MTVA 2D2GA 2XVGA 3OYXA 2GPTA 1QOPA 1PYFA 1Y8BA 2XZ7A 3TNBA 5U1OA 2E3TA 3RNMA 1XLIA 5C6MA 2X09A 4YTRA 2VGFA 4W89A 1L6GA 1BVWA 1VP5A 2BXZA 3WD4A 1ZALA 2WP5A 1Z44A 3M4HA 1EX5A 2INZA 1SW7A 2PWEA 5CG7A 4ZFMA 3Q45A 1TYGA 1JOAA 4KBXA 4A05A 1AQHA 4E3TA 1Q2RA 3KW3A 3TR9A 3GC4A 1UUQA 3PM6A 4AD1A 3VZXA 2BXVA 3Q37A 3HA1A 1JR1A 3QLLA 3BGJA 1WP6A 4J5NA 1OABA 5A6MA 4EVZA 9XIMA 3CGTA 1ZENA 3M64A 1UYQA 1DWJM 3WQDA 4UFHA 3QN3A 4XKMA 4X2PA 2CLKA 1XFBA 3FVMA 2WSYA 2VUNA 2QZRA 5C7HA 3TFCA 4MLJA 5REQB 4KMQA 4N6FA 1BYDA 3WY1A 3A4XA 3WLKX 3QY7A 3WLLA 2FGLA 5GJMA 3W1NA 1FH8A 2Y8UA 1T99A 2E9BA 3HQOA 3V35A 5ABEA 1XGDA 1M53A 3SRHA 3I4KA 3PAOA 4LNYA 2WMIB 4LCQA 4PMXA 4GKLA 4QIUA 5CGQA 1X8CA 4DYKA 3C56A 1ZNNA 1XSJA 3QF0A 3T0CA 4KCWA 6CGTA 3DEQA 4JD4A 4DF0A 2A21A 2BDQA 2FVKA 1B54A 3URQA 1QR7A 3W7RA 3LI0A 4Q8MA 4JTCA 5C71A 3S4TA 2WKJA 3GXIA 4JYEA 4RKAA 1J10A 4MADA 3T0DA 2GGGA 5CPMA 1TJPA 1XWYA 3SR6B 1E1EA 2E67A 2OODA 5I5RA 3HGOA 4ACYA 3RF9A 3UA4A 4E8CA 1GZJA 3NDZA 2OX1A 4UQCA 4QCFA 2QCCA 1UIPA 3T8LA 1CB7B 2EKGA 2UY2A 1YADA 4GINA 4PSRA 3AHVA 4PMZA 5DMLA 3W7KA 6TIMA 1KCLA 2DY3A 1Q65A 2BNJA 1UD2A 4LAZA 4TTUA 4C6BA 4L4PA 2ZCGA 5A69A 2DZWA 3CAVA 2JBMA 3SFWA 2WC4A 4HZ8A 3AZSA 3FKKA 3ZOAA 4IOTA 2XGIA 1FWJC 1AL8A 1XUUA 1FH7A 1IF2A 4U2YA 1OCQA 1V59A 2WVSA 3RXZA 3KOXA 2NVAA 1N8IA 4LIIA 3ARVA 3P8JA 3VE9A 2FHBA 2WHMA 5DANA 4Q4SA 1TTPA 3D5HA 1G0CA 4M8UA 3CLWA 3IAQA 4AU0A 2YDRA 4JTGA 3KOYA 3NTYA 5AY7A 1RR2A 2J75A 1VYRA 2D2HA 1GETA 1JYVA 3UR8A 1UP3A 1GRFA 2YA0A 2PLMA 1KRBC 3KBMA 4NAFA 3LHZA 1E9ZB 3ANVA 2WBKA 5BRBA 3KLJA 1YPFA 1F73A 1XRTA 3IGHX 4J35A 1MO0A 3LY0A 5CZTA 4IMGA 1I60A 4GXPA 1TYTA 3SGUA 4JDRA 4WIWA 4Q22A 3BH4A 3TJIA 5IDIA 3XISA 1GVFA 1QI3A 4W7WA 1WBJA 4Z08A 3E2SA 2A7NA 3KZPA 1EF2A 2JGYA 2X0HA 3TSMA 4DUVA 4BQ3A 3VM5A 3F4NA 2GGEA 1UWTA 4O57A 1B31A 1RM6B 4GXWA 3UW6A 2O7SA 4JHOA 2V68A 4RNHA 4BF5A 4DO4A 4YVPA 1GWJA 2J6VA 2D73A 4HPJA 1VDVA 4CD7A 3QPZA 1XSIA 4HJFA 1UC5A 1E0WA 3U48A 5J04A 3OZPA 3WJSA 2TRSA 4HSHA 3BCJA 4YMZA 1HW6A 1A47A 2DSUA 5CKSA 3NQ6A 2W27A 2QCLA 5D33A 3LLDA 3GH5A 1KM1A 3QR3A 3V7PA 1UR0A 3N34A 1OFAA 2CETA 3HV9A 4ACZB 3WJYA 2YKKA 1P1MA 4KEMA 3GD3A 3MSDA 4JOMA 5AC7A 1FO4A 4KFPA 4RZ6A 2J7FA 4UZSA 2V5BA 4DF1A 1XG4A 1I2RA 2ZZ3A 4OKDA 4GNVA 5XINA 3KZSA 1JGIA 3RITA 4Z2IA 1L0PA 4QSHA 3GW0A 1OJTA 1L9WA 2FTWA 3TW7A 4EM4A 3BICA 4LYPA 3LCWA 2OXNA 3CZKA 2NVDA 3C2VA 4H00A 5CG0A 5FJPA 3FAWA 1HG3A 2ACSA 2CNCA 3MWAA 4HOWA 6REQA 1G7UA 4QJ1A 1TPDA 4MWAA 3GZ3A 5XIMA 3AZRA 1ZPTA 4B3KA 1RBAA 3OGVA 3WG6A 1YDVA 3C86A 5A8NA 1GQJA 4H50A 2WB5A 3CPRA 1H3GA 1WZMA 1O95A 4ZCWA 2YR1A 3F7JA 1CGYA 3ZJ8A 2RJGA 4RW3A 1PDYA 5MF5A 3NVTA 1FH9A 3DFHA 3WQ5A 3CS2A 3SQMA 5AYZA 1Z69A 1V0NA 1LQAA 1YE4A 3VC6A 2PC4A 2WPGA 2Z27A 3TDFA 1IQ8A 1EDQA 1VFSA 1I2NA 1RSCA 1LF1A 3BMWA 1NARA 4XK2A 4MAZA 4YVVA 3U7BA 2JF7A 1OCNA 3T0AA 3OBEA 4AZHA 2ZX9A 1R38A 1GYNA 3QW4B 4F9DA 3WELA 2OQLA 1KGXA 1A5NC 4P8VA 3PPGA 1GVIA 1V7YA 1AH3A 2W61A 3GVGA 4QLJA 4W88A 3ZLHA 3WMLA 1ICQA 4K36A 4LUSB 4QEHA 3HO8A 3GWQA 3M0LA 5G1MA 4D6DA 1W8SA 1JF6A 1LL4A 4R9XA 4DNHA 3DBNA 1RP8A 2BWGA 5A3HA 1UBPC 3DERA 3LXDA 6TAAA 1LROA 3VU2A 1G9HA 5G1TA 3E12A 4O17A 3DGBA 1GVOA 4D2JA 4IMFA 5HJXA 4L9XA 1AQ0A 2WSQA 4AZCB 3THCA 4W4QA 2QMKA 2R24A 1VLIA 2Y63A 4DQWA 5FAJA 1XF0A 2A5HA 1KC7A 4NJHA 1QXLA 3B8WA 5FD0A 1YKWA 2YVFA 5KTLA 1XP3A 4O10A 3VNYA 4IPPA 1R87A 4XD3A 3WFLA 4XUGA 4W5UA 3HMCA 2OWWA 1JYXA 1Q3NA 2YAUA 1PJ9A 1JPIA 1ISXA 3KAOA 4ZQRA 4LU0A 1QWGA 1ZGDA 3FEQA 1M7JA 4PE8A 3WQ4A 4UMCA 1M6IA 2D0FA 2J78A 2H9AB 2W55A 1LM1A 3UZZA 3UXIA 3PZVA 2QULA 4FXJA 4NKCA 1XPGA 1FWDC 4TXEA 2ZX7A 3TYAA 3GC2A 3MSRA 1BTCA 4C7FA 1WO2A 2WLYA 3AYTA 2PODA 4KEVA 5DCBA 3WLIA 3QMSA 3BLFA 2AL2B 5HAOA 2VCAA 1OC7A 4QLLA 1P7TB 2DZUA 1YDNA 1GOXA 1QCWA 1Y7VA 1KRCC 4JNMA 4ZSUA 2RUSA 4AHOA 1LTDA 1W5QA 1TVLA 2DZBA 2OEKA 1RCOB 2E25A 1WV2A 4GPNA 1AJ0A 1QPNA 3N9SA 5E6ZA 3L4WA 1US3A 4ZO9A 3OZMA 2QDEA 3TLLA 4HB7A 1QNPA 3SR7A 2GJRA 3RJXA 6XIMA 2GJLA 1ZCOA 2CEQA 2VX4A 4NASA 4CQCA 3WF2A 3LSCA 3KRSA 3R6IA 5ABTA 5I3IA 2D22A 3BQ5A 4DYJA 3CK5A 1Q4WA 3B8TA 3L4ZA 4YWIA 1R30A 2VZUA 1SR0A 3ZS4A 1EJ7L 3WH5A 1Q6EA 3UYCA 3N1AA 4DUXA 1IIGA 3UVAA 3LBCA 4DLFA 1P6CA 2HROA 6XIAA 4TX6A 3PB0A 3T1GA 3ZSSA 1D3GA 3PZIA 2XIIA 3S9IA 1W91A 4FMVA 2WMJA 2DGAA 5K4ZA 1Z9AA 3R1ZA 5H8UA 2UV8G 2IQTA 3K1GA 3FJLA 3FK4A 1FDZA 2YFNA 3TOYA 3FJ6A 4M6UA 3VD7A 1WOAA 1HZYA 5AC8A 5HQEA 2X50A 4R34A 1TE1A 1PSCA 4W87A 4Q8PA 3LHWA 2CPUA 2VFFA 4WRHA 3G8EA 1R3TA 3B0PA 4KWUA 5I07A 1EX1A 3G6MA 1OEPA 3CBWA 5AYIA 3S9YA 3PWIA 3KL5A 3W7MA 3QKEA 4HA1A 3AFBA 3VKDA 3G1YA 3EDFA 1M68A 2YBUA 3POCA 1ADSA 3W81A 3WD3A 4P7LA 3BSHA 4ZSTA 4RPQA 2VCCA 3RX3A 4INFA 4CNNA 1X6LA 4L4OA 3HZ3A 2Z2BA 3GTXA 3RU6A 3EOSA 2NQJA 4TOQA 4WZHA 1KR1A 2WCGA 2HXUA 1T7LA 4MGGA 1J0YA 1UWUA 5IDZA 4HBKA 5TR3A 3GAKA 3SQLA 5CZKA 1FFVC 3ERPA 1WXYA 4F3HA 4PTDA 3S8HA 1XX1A 1U30A 2ZFAA 4HSNA 3GVWA 5HJLA 2GGHA 2NWRA 1NDZA 3MMTA 1DIOA 4QROA 2NUWA 4AEEA 1U33A 3DK4A 1R3WA 3VX0A 2Q02A 1ZTVA 5G5GB 3S2MA 1O5KA 3PPHA 4KIRA 4BI7A 3W87A 1HJWA 3LHVA 4H9ZA 1ML1A 5KEZA 3NPWA 3BC9A 1KGWA 4J9JA 3O16A 1MQQA 1R6WA 1LG2A 4AY1A 1NWUA 1BD0A 1XYZA 3CTLA 3GNDA 1V77A 2YCLA 4K3ZA 3WNOA 2WYSA 4Y9NA 1SMDA 2B81A 3AMGA 4TVWA 1J0IA 2CHRA 4F2UA 1IGWA 3QLDA 2PDJA 4K68A 8XIAA 2PTYA 3UY7A 4RV3A 4E3VA 2QCDA 5A2AA 2EQ8A 4G6CA 1PS9A 2NLIA 4RDYA 3N2XA 5C54A 4F2TA 3W6YA 1A5CA 1ZBKA 1XPYA 4RLIA 5A6AA 5AHNA 5JUVA 3WEZA 3T40A 2Y1HA 1C29A 2CBJA 1CXIA 1NOFA 4PMDA 3VIOA 3DHPA 3C3NA 3MTWA 5HOSA 3NQAA 3KDOA 4NAFB 3UWQA 1XICA 5A6BA 4C5ZA 2P53A 4Z0JA 1XLAA 5EMYA 3B9OA 3EZ4A 2YBTA 1PVNA 2E5AA 3KWXA 1H1YA 1SUXA 4GVFA 5J8LA 2GQAA 5AFDA 1QI2A 3LDVA 1XDLA 1G5AA 1JZ8A 5C0QA 3WF1A 3WLNA 4GGHA 2PDKA 3LN3A 4L1XA 2E77A 1FWCC 1H5YA 3DFQA 4EIVA 1V7AA 1RAKA 3LX9A 1JVNA 2BGQA 5HATA 4PC8A 1K77A 1KBBA 3VI2A 5CBJA 4QM1A 1QHOA 1TTJA 2EGZA 3H4KA 1FCQA 3LNPA 1QAPA 2PWFA 4BURA 1KBKA 5A6TC 1YEYA 3B8UA 4WXZA 4XZHA 3WUFA 4KETA 1BYAA 1JZ2A 3VKBA 1E43A 2QJIA 2PRHA 3HGRA 1FEAA 1IXOA 5I00A 2WNWA 3IWPA 5DCEA 4M82A 1LOQA 2WMFA 3I10A 4W86A 2ISVA 1MYRA 5A1AA 1K9TA 1MDLA 2Z29A 4NZCA 4H4UA 3A4AA 4E2BA 2E9LA 2RDUA 3A5FA 2B7QA 3B3DA 3QV9A 5M1TA 4MVAA 3EPOA 2C14A 3LM3A 1KCKA 4BFAA 4K8HA 3TCSA 1BHGA 1WPCA 4C6QA 2I5IA 1CX9A 1XIJA 1D7KA 3NOEA 4O53A 2VEFA 4HNVA 2I7GA 1NWTA 3NO5A 2BS9A 3CL8A 1GK8A 3AWOA 3TA6A 2J8FA 5EMJA 4BK9A 4H6RA 1VKFA 1R85A 4UQEA 9RUBA 4OE7A 1ZJAA 4AB4A 5I3DA 1FDYA 4UUIA 3FA3A 2J8GA 3Q6JA 3CZGA 4ZO7A 1YNPA 3FX4A 3IV8A 2YYTA 4AD3A 4Z2KA 2SFPA 2OJPA 2JQXA 3INPA 4JQAA 3IUDA 2XINA 4W8LA 5AYYA 4TIMA 4HNNA 4PR4A 3UR7A 5FKYA 1ZRQA 6REQB 3AU6A 4MWAB 5H1WA 1KXQA 2Z6JA 4GI9A 4JY9A 1X38A 4TR9A 1MO9A 4MWAC 4MNKA 1POJA 2I5GA 4AAJA 2X16A 4I7VA 4O1CA 3OZYA 5DCDA 2C1GA 1RK6A 3C2OA 4RDVA 3EWUA 5I0DA 1CBGA 3D46A 4MNJA 4P8XA 4CD6A 4C6OA 1XIHA 1WXJA 3UWVA 2ZDSA 2ZUSA 3O6CA 1V6YA 5G1YA 3UF9A 2PDHA 4B92A 1TWWA 4H19A 5BROA 1OM0A 3E5BA 2HBXA 3EDJA 2GL5A 4Z2HA 4YTUA 4X60A 2WJEA 4MMWA 5AZ1A 2PC8A 4HK6A 2WSRA 1XQKA 1RD5A 1PZ3A 4YTTA 3L5LA 1GZ1A 1O6IA 4R85A 5ABFA 3R5EA 2VT0A 4IIEA 1M04A 3GHRA 4NYUA 4IMDA 4FOKA 3IJIA 1FWSA 1S5NA 3UETA 5LHEA 1M5WA 4HPXA 3E74A 4GJJA 3KTXA 3MO4A 4TMBA 2XSAA 1QNSA 3TOPA 3W02A 5FJOA 1EGZA 4WF7A 2DUXA 1XDMA 3NVYB 4S3GA 1HX0A 5FI8A 3QM3A 1BTMA 3UXLA 2EQ7A 1H7NA 2ZVIA 2Y70A 3AIVA 1CB2A 4ML4A 3KM8A 3N17A 1B3ZA 4UCGA 8CGTA 1WZLA 1DP0A 4Q8WA 1RV8A 1WKEA 4WQ6A 4H4VA 1JYNA 2UY5A 4LPCA 3WN6A 3AMLA 4C6CA 5RUBA 2VI0A 3PUEA 1WAWA 1LWIA 4AVOA 1F5ZA 2W9MA 2YVJA 1XYCA 2J7BA 1HKJA 2H8ZA 3AYVA 4O4WA 3CUJA 1ECQA 3VIMA 1JZ4A 2X1TA 1MUWA 1IEQA 2X1UA 1NFPA 4AZ6A 1AD1A 2A79A 3SN1A 4ADWA 3UGRA 3JZUA 3VNLA 5U4NA 3N6JA 1HT6A 1XHGA 3W53A 1Q45A 3BW4A 2EAWA 4YWSA 1A5SA 1S1RA 4QBXA 3TU9A 4WDUA 1TPH1 5DMYA 4PCNA 3NDOA 1DBTA 2Y89A 1FWAC 1HP4A 5A5WA 2AL1A 5PTDA 4CNOA 4H8UA 3QHMA 1F7BA 4DRSA 4DBWA 1EJUC 2WXDM 4BHYA 3N9KA 1IWBA 3AIWA 4DZHA 4KERA 2HBVA 3NYZA 3W1QA 1IZCA 2P1FA 4H7CA 4GFSA 1OC5A 2GR0A 2AGTA 4KESA 4RJEA 4GI6A 1C7TA 4PMVA 3QR0A 4G1KA 4M80A 3O07A 1E1FA 5IHSA 4FF5A 1V6XA 3NPXA 2TYSA 4I9AA 2QCNA 4JTRA 4RDZA 1V93A 4UOQA 2YW3A 4RV8A 2W62A 5CGTA 3S5SA 1SFLA 4GCXA 4WDTA 3N29A 2CBIA 4G56A 1UR3M 2J62A 1WXZA 4AW7A 2J7DA 3GD6A 1RD6A 1DJIA 3GTNA 5A8PA 3G1RA 3R13A 3EA2A 3LBOA 3BV4A 3W25A 1VR6A 1TJ2A 2Z00A 4ERAA 3VD5A 2TPRA 4L4LA 1EPVA 1O68A 1MDRA 3S2LA 4RX0A 1E6SM 3UXKA 1E55A 1QBBA 2PD9A 4JN6A 3W7JA 1HL8A 4ERGA 3V5OA 4HGXA 2Z1KA 1IGSA 2BVWA 3T6CA 4AHQA 1NFBA 5CQ1A 2Q6ZA 4XAZA 5DFAA 1GONA 1PDZA 1M7XA 3L4XA 1MRQA 3RM9A 4UXDA 5CAHA 2QNEA 3EWWA 3K8MA 1X6UA 3B4UA 3KP0A 3CU2A 3R8HA 3P2VA 4WY0A 1O94A 4LCRA 4TV6A 1R3RA 3W7IA 4F0MA 1ZB5A 1ZSXA 2J13A 2PLCA 1AG1O 3SB0A 2VGBA 2ANUA 3CJPA 3E0VA 2X8CA 1BF6A 1LLOA 4XD5A 4WK9A 4ORIA 3L2MA 4YNGA 2BFGA 3QTGA 4W93A 3N19B 2F7FA 5FESA 3I3DA 2J6XA 1TELA 1GTHA 4QS5A 1WDDA 1H60A 4PSPA 1LLWA 3PANA 1K4HA 2ZUVA 2XM1A 1E4NA 3STEA 4GUJA 4BA0A 2W54A 3M0YA 4RZ4A 4NRRA 5JBDA 4X61A 3QTPA 4JKKA 3PS7A 1TTIA 1SO5A 2NQ5A 2FH8A 3KS5A 1GOWA 4LYKA 3LB8A 3TUUA 2HPMA 3P6LA 4NL1A 3W1UA 1JAEA 3CXOA 1E6XM 1XIIA 1NPXA 3NQEA 1IZJA 4RNFA 1F4AA 5D9PA 3LB0A 3HGJA 4ZZ9A 3N4FA 5T26A 4IQJA 2P5NA 1ZJBA 1HQTA 5E0FA 3UA3A 4XZWA 3RLUA 4MG4A 2JK2A 1JPKA 1VS1A 2G41A 5FL0A 2CWNA 4US6A 4FI4A 4KCTA 4B5TA 3NO3A 1TV3A 1W1VA 3LA4A 2OT0A 2YCLB 3CHEA 1XRFA 1NAL1 1GSNA 3R8RA 1GTEA 3CT7A 4AEOA 3KLKA 4DJFD 2ALDA 1V0MA 1TO3A 4MDOA 2QCDB 4CN6A 1XLMA 4O1AA 5LNUA 4ICCX 3CL7A 4LOCA 2FZMA 2KAUC 4OV4A 1S3HA 1W1TA 3DHFA 1PL9A 2PFHA 3OOQA 4RPPA 3LLXA 1FWIC 3BG5A 3WBXA 3VOIA 1DJZA 1UOKA 5AOUA 4NJIA 2CZEA 1VCFA 1XBYA 4LAOA 7CGTA 1N7KA 1NDVA 4YIWA 3L5OA 1JFXA 1RQBA 8XIMA 2WOVA 2BASA 4FHAA 1GEUA 3BLDA 5DMMA 1Q6RA 3TYUA 4Z1YA 3C2RA 1OIMA 1SPQA 1BSLA 3OQ8A 1JPMA 3HG5A 3CWOX 1CI1A 4MAVA 1YTEA 4FPSA 4M1RA 3RM4A 1BG4A 1S5TA 3VCNA 1ZHAA 4NT0A 5LHFA 2H90A 3ITYA 2YL6A 3NZPA 1YTKA 4UTMA 1ZZMA 1FWBC 2JFEX 4OOZA 4DAFA 4C6FA 2XHYA 1OD8A 2VFIA 4E0CA 3DUGA 2V3EA 2GH5A 3G0SA 3AQUA 3T09A 3MZ2A 3ARYA 4UQBA 4JN8A 4O18A 3QSTA 1H2JA 3GX9A 4YS1A 4FA3A 4JFTA 2V3GA 4Z2JA 5JIWA 3KLLA 2WC3A 1BWLA 4L6DA 5C5YA 4D6CA 3LPOA 2Y85A 2VDGA 1H7XA 1TWSA 4QDWA 3DYOA 1TWZA 4NEVA 4WSHA 1E5NA 1CZ1A 3HG3A 3I6RA 5KZMA 3DG7A 4G2DA 3B06A 3ABOA 3UBPC 4FZIA 2FZDA 2JEPA 3O6AA 3DG3A 3VGDA 3NZRA 5FF0A 1MZRA 4B16A 3H54A 4HMDA 2WPFA 5ECUA 5LA0A 3VGEA 3U8GA 3W3OA 1BPLB 3SUWA 2XVPA 1TV7A 2HE5A 3QGVA 3KWSA 3VFCA 2X1SA 4GNJA 3NRZB 3BPWA 4AC1X 1TV2A 1OFRA 3TK7A 4KF1A 3W2KA 3IS4A 2NQ9A 1EYWA 3HQ1A 4PUDA 1S39A 3PHAA 2FVMA 4HNLA 2V2CA 3AXHA 1X7IA 3UR5A 3P80A 3W29A 3DZ1A 5D03A 4XQ6A 5I2UA 4Q33A 1PBGA 4JPGA 3EX3A 2YW4A 2YX0A 4ALDA 3C6CA 3A3HA 3KHDA 4H8HA 1C92A 5CCZA 2G97A 4IMCA 3E2VA 3NQBA 4BV6A 3T07A 3SIZA 4EAMA 2QJHA 2ZIDA 2J9YA 1HVQA 1F05A 1PX4A 2PI6A 2OB3A 3VABA 3W38A 3DGHA 5DX7A 1GJWA 4NZ5A 3H7UA 5JCIA 2OWXA 5D37A 3G5EA 1KCZA 3T2OA 2E6FA 1FCUA 3S5YA 4NVTA 2VFDA 3CHVA 2QJMA 5ABFB 4S1FA 5BW6A 1TPVA 1U2YA 4OIFA 2W6RA 3VIKA 3W6LA 2I9UA 3B8DA 1U22A 1EP3A 2VD9A 1VYSX 4O11A 3WDRA 1V02E 1EO7A 3TFXA 2F8QA 4CNPA 4W8BA 5BXRA 4UTUA 1UMYA 3SCWA 3WCZA 3QZAA 4O8AA 2HS6A 3BURA 1ITXA 1GVYA 2CIPA 4IP4A 3PTDA 1WDPA 1XLFA 1NQKA 2QUTA 4UTFA 3RAOA 4AEFA 4PFHA 1CXKA 4GX9A 1DKWA 5ER0A 3LCFA 1R3QA 1W0MA 2NV9A 4A2RA 2E1DA 1EJXC 4IF2A 2QDGA 1GJPA 4WX2A 1OYAA 4PB5A 3I4EA 1FCVA 1IEVA 1VEMA 3PN8A 4D6EA 5CPTA 5H8PA 1OSEA 4GCAA 2BV9A 2HNHA 4UOZA 4KWSA 4XZBA 4DB7A 2BY2A 3NL6A 3CNYA 1CLXA 3NQ7A 3MC5A 4JTFA 4PMRA 3WNLA 4GE8A 3CC1A 1VCVA 3SADA 5A8OA 3WMCA 2RHGA 1B4KA 3A7RA 1IXPA 3PTQA 1XYBA 4UB9A 3M43A 4Z1CA 4Q8TA 3GAYA 2IKGA 5GNYA 1RPXA 3NEHA 2G3JA 4EQXA 4PMOA 1V6WA 3RHGA 1ZBVA 1UJPA 3C8FA 4OTKA 1VJIA 3BW2A 3PBMA 2PMQA 2C0AA 4H3DA 3UCQA 1N61C 3UESA 3O0FA 3I7QA 2YJQA 3SCUA 2X2GA 2ATMA 4QAIA 1XSKA 3UEQA 1KRMA 2WMHA 2ZZ2A 1JNEA 4H6QA 1CEOA 2G4FA 4CD8A 4Q8QA 4FNRA 5DT7A 4UTTC 3QYSA 4Y7EA 2Y5EA 1X2HA 1JEZA 2YB1A 4XAPA 3ME3A 4C6NA 1O5XA 1B5TA 3V5CA 3E1F1 1R0MA 3RNDA 2Q01A 2GR2A 3CMFA 2DJLA 4TO8A 5BXPA 3VGFA 2A7PA 3VE7A 4EQSA 1OT1A 2WKGA 3E6EA 1D8CA 3AMDA 3GR4A 3U6WA 4PB4A 1T40A 5M2FX 1PB0A 5FA5A 1Q2SA 4NX5A 3BSGA 1E0XA 1LJYA 3W2MA 2YLAA 3AROA 2FDMA 2DSZA 2XH0A 3MUZ1 1HGYA 1LWJA 4R27A 3CIXA 1D7FA 4QITA 3U0HA 2ACQA 1GORA 1YBQB 5HXMA 1JUBA 1ENUA 3M5YA 2V0TA 1EP2A 1Y5XA 4B5XA 3K46A 3UZXA 2AAAA 2WZHA 1LBFA 3U3HA 3WX7A 3OB8A 2D1ZA 1NHRA 4Z1AA 1V4YA 2VTFA 2I1OA 3VGHA 2QPUA 3PPCA 2YA2A 2BMBA 2DZTA 4KCVA 4A8NA 3L4VA 1OZQA 1E0UA 5D9MA 3NQFA 3ABXA 2BY1A 1E5JA 4N9EA 4WY0B 1E4IA 3BLPX 4YXGA 1E4MM 1M9HA 5LNRA 2CLFA 5F2MA 2DVUA 3BLIA 4GY0A 4HZ7A 1LUCA 2FHFA 4QEEA 1FTXA 4RDWA 2DZSA 4C6LA 4OUIA 3L5MA 2OSYA 4LH8A 3R8GA 1HXJA 4LYQA 3MB9A 5AKQA 4I8DA 1V97A 2V5CA 2PA6A 3DK9A 5JCLA 3NPUA 3N04A 1VFHA 2WMGA 4E2DA 1FWFC 3SCTA 3H2MA 3P8IA 1AH0A 3S47A 5U25A 4WDXA 3VDGA 1PKNA 4HIBA 4C90A 5AYXA 2BC0A 1XV8A 3NXLA 1QI5A 3K1DA 1S7MA 2WVUA 1E73M 3O6YX 5CGMA 2HISA 4IJRA 3NL3A 4UTKA 1DJGA 1AA1B 3SAZA 2ZADA 4DF2A 2TPSA 3MHGA 4J2MA 2PZNA 1E9YB 3WUEA 1U5JA 4HCDA 3VD9A 2IUZA 2YCIX 3CWHA 3SECA 1ODZA 2P3ZA 5D04C 2ZZ7A 4AZGA 3DGRA 3WLSA 3B03A 4NG3A 3UFYA 5DXXA 4I6KA 1I8JA 1I4NA 2QXWA 1K6WA 1HTIA 1A5MC 4AIBA 3W26A 1JXKA 2WMKA 1JZ5A 1ISZA 1NEYA 4GIRA 1JD7A 3SQPA 3M9YA 3CUHA 5KMYA 5DBTA 4DZAA 3PTMA 4AD2A 5J5RA 1GVRA 1O4UA 4AD5A 3W28A 2EQDA 4QDPA 1UD4A 2ALRA 3KL3A 4IQDA 1M1BA 1GKPA 4B4FA 4ATLA 3EDEA 1Y5WA 1PKYA 2ODOA 3VD4A 3EX6A 1V3JA 4DJED 4LYRA 3MA8A 3PNZA 1R47A 4Q4QA 3LTSA 4PUEA 3SURA 2GVGA 4DAIA 3P82A 3T78A 3WYZA 2PRMA 4DO5A 5KITA 2GLKA 3C4UA 4KRUA 3M0XA 4L5ZA 2WLZA 1VHNA 3EBVA 1KWGA 3N2OA 1A0DA 3CO8A 4XIAA 4JNYA 4E6MA 4GYPC 5BZAA 1YPXA 3GR7A 3LYEA 4RK8A 1GZGA 4PCSA 3TZFA 1I9CB 4MOZA 3DXIA 5LIYX 3GSMA 2R82A 1B57A 3LM7A 2PS2A 4UFMA 1SVDA 2ZUWA 3SDOA 5JMUA 3HQNA 4ENLA 1JGMA 1AVAA 2A6LA 4I5XA 2C3ZA 4IIGA 2YIHA 3RR1A 1JUEA 3R07C 1SJAA 2OG9A 5FS7A 2A4AA 2D3NA 3RX2A 3TTYA 1UR8A 1KBLA 3FW6A 5AVHA 3V18A 4DJDC 4CQ8A 3RLGA 1DJQA 1XJBA 2QPXA 1XH0A 3TSBA 3APGA 4GYFA 3NZGA 2DH3A 4GIEA 3V5FA 5XIAA 1E40A 3M47A 1XIDA 4UR9A 1MOKA 2W79A 1KXTA 3H2OA 3LMZA 1YRRA 2Z28A 1W3KA 3CQIA 4FALA 4D72A 5K4XA 4KWWA 5LYRA 4AG0A 1SU5A 2VRKA 2MUCA 2HQAA 2YB4A 1W9DM 4AISA 3VKJA 2BHUA 1EA0A 3U57A 3PZ9A 3KCJA 1PPIA 3UCDA 4UQAA 4IMAA 1VBGA 1FUYA 3RJYA 2JEQA 3NNTA 3U4FA 3S83A 2GK1A 1E15A 3UG5A 2X1IA 3V16A 3ZR5A 2J24A 1FWGC 1KM3A 4JFSA 3MMWA 5A95A 2ZUNA 3WNPA 2E1WA 4D9PA 4EK7A 4Q8OA 1H6VA 1RBLA 2VEIA 3BJSA 1JQVA 4NY2A 3YPIA 3A6OA 5IHRA 2GDUA 3LV5A 3MVTA 3DJJA 2HTMA 1BGGA 2D2JA 3M0VA 3BXWA 2QT3A 4KKXA 1SZFA 1H09A 3S5NA 3WJWA 2D23A 1MQRA 3VCRA 2VR4A 3G1XA 3SGGA 1VBRA 3H7VA 1V5XA 3VPLA 1Q6FA 3CYJA 3UJEA 3C52A 1IYXA 5BRQA 3ZIZA 1A0EA 4HCHA 4CGTA 2VDIA 3WF3A 4XSLA 1OK6A 4EMJA 1NY1A 1C8VA 4DO6A 2GQ9A 5CPLA 8TIMA 4RL3A 3W1AA 4EWND 4S3BA 2BVTA 2DP3A 3MBFA 3W1RA 3F2CA 1Q7MA 1HKKA 3B9EA 1TE6A 3HW2A 1EBHA 2ACRA 1F76A 4O54A 3A4JA 3USBA 3N3MA 4HHHA 3W7PA 4NQ1A 3EXRA 3KXQA 3PWAA 1I1WA 3PC0A 2BOFX 1FBAA 3K30A 4GHRA 3PULA 5D09A 4HA4A 1NH6A 3T4CA 3B97A 3GRIA 4G7FA 1K9FA 5LA1A 2C3CA 1VBHA 1XG3A 4YCOA 1RP9A 1JEHA 2Z26A 4NF7A 4XG1A 5I09A 4B90A 3PBWA 5HQMA 3BAXA 4NNAA 3MUCA 1W2VA 2EXOA 2DZAA 5CPQA 2CYGA 4S3FA 4JQ4A 1W1YA 2I5QA 4Y9PA 2J3NA 4CNUA 2WQPA 5A6KA 3IIXA 1WKDA 2YCEA 3M07A 5JCNA 2EJAA 2BOEX 3PUOA 3E2RA 5I03A 4FX8A 2Y88A 2P8CA 3H21A 4V2XA 4N6EA 4G8TA 1PWLA 1UA7A 2VFGA 4JTKA 4O52A 2XH7A 2Z1BA 4IJCA 4CQBA 4Q7BA 3HPSA 1GV4A 3MP5A 1LRQA 4BR1A 3UQNA 4ZB2A 3IC9A 3OPSA 4KPRA 3EOEA 3BOXA 1XCFA 5F1VA 3LENA 5FEXA 5I3FA 4DY1A 1B3YA 5F1UA 3LXCA 4O50A 1TB3A 1YQZA 3JU2A 5LIXX 2XVNA 1V79A 2Y0FA 2X99A 3F5JA 5IM51 3LXBA 4TX8A 3QZ6A 3OG2A 4WKAA 5E6YA 3G1DA 1J5TA 3HG4A 4LEFA 1IZKA 5CSYA 4ZE5A 3PWGA 5BU9A 4QTGA 3DG6A 1LBLA 3BQ6A 3L67A 1ONFA 5C2GA 4BQ4A 3STPA 4HYWA 5F4WA 5G2WA 2ZA2A 5K9XA 1OQFA 1T6MA 3CAQA 1KFWA 3UU0A 5K9DA 1HVXA 1BWCA 1LOLA 1PE1A 5EY5A 3MYOA 3LBMA 4DJDD 2NZLA 3IJLA 4CQAA 3WIJA 3EX1A 1J12A 3OG3A 1AZ1A 2QV5A 3M7WA 4DUWA 3CV6A 1WE5A 3AC0A 3QVQA 1K02A 1KLZA 2X2YA 2TAAA 2BC1A 4C5YA 1BLIA 3LPFA 1R7OA 3RG6A 5EFFA 3ARSA 2VWTA 1A3WA 1I75A 2OMAA 2Y8KA 2IKHA 1KCXA 1J96A 2RFGA 4PEEA 2RH9A 3VOFA 3WENA 1AL7A 3SN4A 1SO4A 1WYGA 1VF8A 4MLRA 2IPWA 3T7VA 2D24A 4ZVJA 2X30A 3B9DA 5M5DA 1N5XA 3CZJA 3P93A 5LGXA 4PYSA 3UZJA 4JY8A 4OBTA 1R2TA 3TH6A 4QE1A 3T9PA 3MYPA 2A0NA 2I16A 4OJYA 2RABA 2BHZA 5FS6A 1UPPA 3W83A 4Y2WA 5CZJA 2XUCA 3SRFA 1F2JA 5M3WA 1GESA 2OZ8A 1JCLA 4D8AA 2OWCA 4IP7A 2EKCA 1Q6OA 1K9DA 1J0KA 3AIQA 4A35A 1XHCA 2JE8A 3PJTA 4JIHA 1PAMA 1UP2A 2ZYFA 1EH9A 4EM3A 5AC4A 1BXBA 3L4YA 1F8IA 4H8VA 2OYMA 4LT9A 1GQKA 4MY1A 3BL3A 4UTWA 2G5WA 1XYMA 3ES7A 1NM9A 1O1HA 3MHUA 4L6OA 4KWVA 2ASHA 4U31A 2R8WA 3BLOA 3GU1A 1VJZA 4IG2A 5GNZA 2POTA 1WA3A 2OO0A 2PGFA 2F6XA 1UP0A 4ZQCA 3AISA 3EUB3 4DIAA 5TQLA 1OF8A 2V30A 5A6JA 1TWIA 4X2RA 5CLWA 3SY5A 3GFYA 3E3HA 1C93A 3BG3A 4JN7A 4KFNA 1LT7A 1FX6A 1WBHA 3IRDA 5D4YA 5BWAA 4AH7A 3K4DA 3M7SA 4HHPA 2VFHA 1A53A 2ADAA 1V6TA 3NO1A 3TTSA 3AHYA 1JRBA 4J28A 1UWSA 3DN5A 4Q7NA 3UPBA 3CGCA 1X2GA 4Y6GA 5BNKA 1PX8A 3FY1A 5K7JA 4ZB0A 4MFEA 1ZU8A 1PCKA 1N62C 2PRLA 2FVLA 3CUZA 2Q3RA 1M03A 2WOQA 4WJEA 3VNDA 1GYMA 5BCAA 3B04A 3R2GA 4I7UA 4R7JA 2QCEA 1UJQA 3VDBA 4LV4A 3L4TA 1AODA 3MSGA 3U2ZA 1R9ZA 5FJUA 2G0WA 1N5WC 2Y61A 1KO0A 4C60A 4ERIA 2VQUA 1PTDA 2X05A 2CLIA 1EGMA 1SJDA 3VAVA 5DF0A 3O06A 3VKAA 3PSVA 3P5ZA 3TN6A 3F03K 1A5BA 3NL2A 1VD6A 1KM6A 3ITOA 4GJIA 1XRSA 3DAQA 3TC6A 3TWBA 3L68A 4DUOA 4PUJA 2PDPA 4Q4PA 2GGIA 4J3SA 2VVNA 3FNDA 3BCDA 1K4QA 4LVGA 4IUGA 5E70A 4AFYA 2FKPA 4OECA 5J5DA 3QYQA 4BZYA 1V3LA 3BLEA 2GVJA 1AJZA 2EG6A 4AXNA 1AFSA 2PLJA 2VRQA 1OCJA 3A3WA 1R9XA 1THFD 4H4TA 1V8EA 2DW7A 4B91A 2D3LA 4GZ7A 3MS8A 3WLPA 4ZR8A 4QISA 3ZVHA 3ZMRA 5FMHA 3AXXA 3DHUA 4NZJA 2EEXA 2PDUA 3KVMA 4CCCA 2ZRVA 2FQIA 4B9YA 2I9EA 4J57A 3I68A 2OGJA 2QPSA 1GUVA 2YLLA 2RDTA 3CYVA 2P10A 2ZXDA 1PKMA 1AJ2A 2BTMA 3R58A 3EYPA 1W3JA 6ENLA 1MMFA 1Q6QA 5CZ0A 1BSIA 2CDUA 3LMYA 1CWYA 3EEZA 3QV8A 4W7UA 1Z7AA 5AB3A 2BXYA 5IOBA 3D0CA 2WW5A 3IRSA 1P0KA 2GSHA 2R14A 1AD4A 1GQNA 1WZAA 1DJWA 3NVWB 3CHCA 2VDHA 3PZUA 3VMPA 1FKXA 2V3BA 4GA8A 3B9JB 4KS0A 3CZEA 4KRTA 3WQCA 1AZ2A 4AIEA 2TMDA 2WVTA 2ZZ6A 2GJXA 3UWYA 4APNA 4MZ1A 5EKYA 1J4EA 1TV5A 3W4RA 4EQWA 1CT5A 1STZA 3TVAA 1KQYA 2VM8A 2QQ6A 3WLTA 4PUKA 2QAPA 2EPMX 3TYZA 3WD1A 1Q6GA 1S5WA 3CUFA 2G96A 3TN4A 2R91A 3M0IA 2DPEA 3B0YA 1JDFA 3E02A 3BGAA 1GW1A 1JF5A 5LIUX 2VC6A 4HNUA 2Y6ZA 3SRDA 4H9MA 3BAYA 3CQJA 4PUUA 1W3LA 4ZA0A 1F3PA 1PIGA 1JAKA 1EBDA 5FAGA 3GR8A 3SGZA 2QAEA 3FFSA 4AUBA 3GNRA 3QOMA 1B0IA 4WHBA 1PKLA 2X1RA 3CIVA 1Q7ZA 3QC3A 2GK1B 1HKVA 3HFTA 5DO8A 2Y5JA 2V81A 1K8XA 2OU4A 2VQTA 2XIJA 1LPFA 5AHFA 5HMDA 1MZHA 3QY6A 4JFWA 4IL0A 4FIRA 2WPBA 3S1GA 3UWWA 1EXPA 1TR9A 2BLEA 2QIIA 2V6OA 2OZ3A 4HJWA 3TIMA 5TF0A 4LBRA 4M3PA 4BF7A 2ZRWA 1EZ2A 2W5FA 2W0HA 1BWVA 1OFBA 4LANA 4Q6XA 3NSXA 5HQLA 5AHLA 3WDPP 2Q3OA 4S3AA 1XLCA 2NPXA 1Z41A 3P14A 4A29A 2IW0A 1SM9A 4U10A 1W1IE 1XW8A 1CIUA 2IPFA 2NT1A 4JTQA 4ZOHB 1ISYA 2ZC8A 4HZ6A 3OBAA 5CZSA 1I1XA 3G1FA 2GOUA 4WY0F 3EDKA 1RHCA 4PCFA 4F8XA 3LNMA 4MJZA 3WDHA 5EA9A 1H0GA 2ZTKA 3B0XA 3VNKA 3TJXA 1MVYA 1JCJA 2PPGA 4XZMX 1W3IA 1CGVA 1OGGA 1QI4A 2ESCA 3ALGA 4LQ1A 5GJPA 2Z7KA 4ZQOA 4US5D 1OB0A 1TPWA 1YTDA 2P3EA 4GQRA 1X97A 3KEHA 2J79A 4NX0A 1G67A 1OX4A 2PF0A 3N2BA 3AIBA 2VEGA 3P3BA 1EEPA 1JULA 3GHTA 4F0LA 2ZC1A 2OKOA 1TRDA 4P8UA 4HN4A 1TRIA 4POCA 1YNYA 3LUTA 4MYXA 4DZIA 1VPYA 3VIFA 1FRBA 2OR2A 3G22A 3MU7A 2OLHA 1DHPA 3W37A 2JKAA 4NILA 3B4YA 4WKHA 1CGXA 4M52A 3H8AA 4U4MA 3V75A 5T9CE 4U33A 4YHEA 3UNDA 3T44A 3JRKA 2RGLA 3EX4A 1G4SA 1SZNA 3WNNA 2VP8A 2C19A 3AXIA 4DXVA 5CSSA 2GJPA 2JKEA 4PTVA 1XIMA 1XKJA 3R4IA 2J7HA 4N9CA 5I3KA 3NM3A 3A21A 1Q1WA 5CC7A 3CHDA 4FP1A 4P2VA 3BANA 4H1ZA 1KA9F 4OUEA 1IT7A 4Q4KA 3TMQA 1E3XA 2GVLA 2QVHA 4ADUA 4N7QA 2NVKX 3I65A 3UPMA 2PDQA 2GUBA 1GRBA 2WJDA 3PTKA 1GG1A 1QDSA 4QE5A 1VFFA 3RUBL 1J8VA 3NDYA 2XFRA 4GX8A 4E8DA 3BAWA 3EF6A 3ECQA 2MANA 3GB6A 4JYFA 2R1KA 5CPOA 1ESWA 5CPNA 1FECA 3TEVA 4UQDA 3CV2A 5H8MA 1FFUC 3E49A 5I3JA 1W54A 4OBRA 3MT1A 3BDKA 2DVTA 2AQWA 1FP8A 2EG7A 3F2BA 5MKGA 3CV1A 2ZRUA 1E6RA 1E56A 1F74A 2Y24A 1OG6A 4XKYA 1TKKA 1IT8A 3BJFA 4R33A 1PYMA 2Y62A 3S46A 2JF6A 4V33A 2V3FA 3KBNA 1FWWA 3S5ZA 4M19A 4RXGA 4LTSA 3A9BA 1XIBA 2LLEA 3SCNA 2F84A 5BYWA 4X9YA 1VZWA 3ITGA 3QJAA 2RJHA 4GISA 5GRTA 4FX9A 4M81A 4M56A 4NXKA 3AMKA 4FLOA 4TTGA 2E5DA 1QW9A 4K37A 1H2IA 4MNLA 1GRTA 4L9ZA 4IX2A 4JCLA 3TTQA 4HHLA 4PZVA 1EWDA 3EB2A 4CD4A 3SJ3A 1GW9A 3BJTA 1S5VA 2F2KA 3GYEA 5LNWA 3MJYA 2DUAA 3W2UA 3Q4DA 4ROQA 3SUUA 4Q8UA 3ZVIA 1RA5A 3GBEA 1JCMP 4LBUA 1H0IA 3ZT5A 1BXNA 1EP1A 3DFNA 5FF7A 4ZE4A 1JUKA 2VFEA 1GVQA 1QPRA 3PJWA 3W1MA 1LRNA 3EKLA 2PTXA 2ZZ1A 4A2SA 4GO8A 2P8BA 5EMKA 3IGXA 2XIOA 3VNZA 4CVWA 3IANA 4XO6A 1R46A 3PUGA 4RZ5A 3KVKA 3SSJA 3QV7A 2PWHA 4UTWC 3A23A 4MJ4A 3LZ3A 1MFVA 4XZLX 3ITVA 3IJDA 4IG2B 3H4GA 1EQCA 3MJMA 3W22A 1QMLA 1AQFA 1RUSA 1XS2A 3GXMA 3G1VA 2AQVA 3KOWA 2E5BA 4IX0A 2QEZA 2KZHA 3C0JA 1KD0A 3I7RA 1EWEA 2AMGA 1DJYA 1XC6A 3HB9A 2CESA 3AXMA 2ZRYA 2C3DA 4UMAA 1F3EA 3STGA 2VWSA 3Q67A 3L0NA 1E6NA 4XISA 4F79A 1XLKA 3N4EA 2FPVA 3H12A 3N9RA 1C9DA 4FXSA 3SCRA 1IV8A 2DQWA 2WSKA 4CEUC 3UWZA 4GYJA 3CUIA 3OGRA 1AW2A 3ARPA 1DIEA 3E0IA 3UZYA 3EB4A 1H1ZA 1EO5A 1I2OA 2ZZBA 4AXKA 2YXXA 4EMIA 3MV01 3E0LA 5DY3A 2GQWA 2OOGA 4XBJA 3ZR6A 3IVTA 3W7LA 4LUTB 1XBVA 3MUXA 3LHYA 4QR6A 5C70A 3AMCA 3HJZA 3S2JA 4QHRA 4EPDC 2G95A 4A3QA 2QJNA 4L56A 1HFBA 3CPUA 3PZNA 1LBMA 1K7EA 1W9XA 5CBIA 3KRZA 3CT2A 4H9VA 1JI2A 2P50A 3USZA 3P0WA 3TW6A 3PUDA 1KLYA 1XYLA 3M5VA 4I7WA 5FJRA 4AD0A 3DOPA 4C6DA 4J56A 3XIMA 3ZVHB 3EMCA 2VKZG 3VMNA 4OWGA 5CSRA 1WUEA 4IT1A 4DWSC 1QNQA 2GZXA 4IIHA 2PP1A 4QG8A 4N4PA 1EJRC 3MV11 3CGEA 1HGWA 3WK3A 2FTYA 4IGHA 2DSVA 1QI0A 4DXKA 3G6LA 1FWRA 1V02A 2WJZA 3T08A 4FS9A 3BO9A 1EGVA 1MW3A 4ICNA 4QDMA 2YXGA 3SIMA 1OG0A 3ARRA 4AF0A 4AWTA 3NIYA 1GPFA 2VO5A 3BGGA 1CYGA 4K7VA 1Q4NX 1L6WA 4KT2A 4NP7A 1B3XA 2EBNA 2EPOA 4P7QA 4YPJA 4Q3MA 4QRNA 2X8HA 3VVGA 4S39A 4QGCA 4Y90A 1ONRA 2GJXB 3GRSA 3MI2A 2NUYA 1EJTC 2C0HA 1DXLA 4DM2A 4UTIA 4JIPA 4M51A 4H04A 1NOWA 3FEMA 1X98A 5DY2A 3RGTA 3ES8A 3HGSA 4G1NA 2WOIA 1R86A 2CC0A 4GZIA 3VOGA 4N0RA 5BOEA 3BV7A 3W7DA 2QLYA 4JQ2A 4QLKA 1Q13A 4ES4A 2PLKA 1KWKA 1Z32X 4K7YA 3CGDA 4UOJA 4XAFA 4AD4A 3OBKA 3Q65A 3WF0A 4DJFA 4C7GA 1DTUA 2WZTA 3CXBA 3M6DA 5E5CA 3KS6A 3WK2A 1SZEA 3NGFA 3K5XA 1MRAA 2F6KA 1C8XA 3AWNA 3EOOA 3T05A 3DFTA 3GXTA 1C8YA 1DVJA 4ZQPA 1KFCA 3RU8X 4HD5A 4JNZA 3GO2A 4Q32A 4GABA 2FH6A 1QW8A 3AOFA 4MKSA 1ZK7A 1K4GA 3AS0A 3DH9A 2DU2A 2YSWA 1C7SA 5T91A 4EXBA 3VUPA 2BZNA 3PBVA 3B0UX 4Z1BA 3ABSA 5DQPA 3PZMA 5D2WA 2PWVA 1MWOA 1TV8A 1AMYA 2O9OA 1JCXA 5DLCA 1YLVA 4O15A 2OVLA 4D8ZA 4GI8A 4CLMA 1RALA 4WVXA 3WK1A 2JALA 4PRWA 1MXSA 2WVVB 1TFVA 2ABAA 4V28A 4LVAA 5FF2A 3PZTA 2ICSA 1UD3A 1L2UA 2E0PA 1CECA 2OPJA 3CUXA 3URAA 5JU6A 1P6WA 3QV6A 3M0KA 1B3OA 5CJ5A 2CKRA 2DT2A 3ZR4A 5REQA 4GOAA 1C8QA 3LU2A 2I14A 1TMHA 2PDIA 2FDSA 4XBSA 2O56A 2YGYA 3HPZA 1TZ7A 4ZXOA 1CLKA 4UNLA 1I2PA 1EBGA 4JFUA 4MKVA 2D0HA 3GZAA 4HMCA 2XVKA 1YQ2A 4IICA 4PUNA 4P5UA 4PEKA 4HQVA 1H7PA 3V0TA 5DELA 1NELA 4A3UA 1IR2A 3GIPA 2ATSA 3PSWA 3WL0A 3M0JA 4LY8A 4H2CA 2AKZA 2D0GA 1OX4B 2F38A 3SQSA 3T2QA 5F4SA 3N6QA 4M5PA 1HJQA 4Q4OA 3NWRA 1V6VA 1OT2A 1OCBA 3DX5A 3VGBA 4LAKA 4OU1A 4AC7C 4W8AA 5AC6A 1HJVA 3GXDA 3VGGA 3GW3A 3EMQA 3TQVA 1REQA 3PY2A 1SMAA 4DPPA 1UIOA 2PDXA 2Y5SA 3M46A 1JI1A 3QPYA 2DT3A 3RN6A 2X8RA 3LEPA 3WEMA 5BMWA 3BARA 4J3TA 2FFIA 2Y7GA 4TV5A 1B9BA 3EAUA 4X0VA 1W1PA 1ZBWA 3F4VA 1XLHA 2VL4A 2WV8A 1XIEA 3IVSA 1LP6A 2C79A 2Y8VA 4DWSD 4TVDA 1BVZA 4HZMA 3DC0A 4AY8A 1R9YA 3OLGA 2QUMA 2HZGA 3S2CA 4IISA 4H9YA 1Z3NA 4JTEA 1P0EA 1GQLA 3COTA 2Q8LA 2DFAA 5EL1A 4XTDA 1P1XA 1XYAA 2CLEA 1FHVA 4GK8A 4HPGA 2A3LA 1UR1A 4FF7A 4R3UA 4F2BA 4CKQA 3GTIA 2X42A 3W27A 1MSSA 2HWGA 2IXUA 5FSEC 5LNSA 1Q1RA 3FGCA 1DWIM 1Z48A 3G3DA 4Q6JA 2ZTJA 4WR3A 1I6NA 1D7YA 3OLEA 1NOUA 1ZFJA 2CITA 1NHQA 2BODX 2QV4A 3EPNA 4F0KA 2WNNA 5HANA 4H4PA 5D2YA 4M6QA 3ZM8A 3NQ2A 3THAA 2HVMA 1OY0A 4LUIA 2V5KA 3EX2A 3IVUA 2ZA3A 5B7YA 4P7OA 2OT1A 1XFCA 3A7AA 4HOXA 1QT1A 4A8IA 5MKGB 1TSIA 4NNCA 3ARWA 3NVVB 1E70M 1QFEA 4XKYB 2ISDA 3WQPA 1NTHA 1P4CA 2OTDA 1DXIA 2QUNA 5HPCA 1HUVA 2VR2A 4H9UA 4Y96A 2PD5A 5H91A 2NV2A 4H6KA 1RQEA 4GQGA 2YOCA 4FO4A 5D02A 4A3RA 2Q8XA 1QNVA 5HK4A 3GIYA 1YIXA 1ZP3A 1XLLA 4JTIA 1OINA 1NIUA 2ZWYA 2QUVA 5HUOA 1FOBA 5I23A 1TIWA 3O8AA 1KGUA 2WO5A 4MF4A 1GEHA 3QMTA 2E9MA 1W1B1 3UXDA 4JXCA 3R10A 1UA3A 3LRKA 4X63A 4E2VA 2QMJA 2BX7A 4U3AA 3TV8A 1K8YA 3LADA 3GU9A 2PZ0A 3H2FA 3CQ0A 4L1GA 3D9XA 4K7ZA 2Y4SA 3VO0A 2VENA 4ECLA 3EA3A 3FSTA 3ABRA 4NNBA 1QO2A 4TVYA 3TN3A 1D3CA 3PK7A 2PBGA 2A85A 2NW0A 4UIOA 2ZX8A 3TC3A 5KZEA 3GTHA 4NZ3A 4XBKA 4CEXC 4LV9A 4GO9A 3VOCA 5FJJA 1EC9A 1ZY9A 4G9PA 4FOJA 3LLFA 1H41A 1ZLPA 1TJ1A 1KXVA 1W8GA 1QATA 2J25A 3IJ6A 3FVDA 3SEPA 1A5AA 1W9VA 3WDQA 3GDBA 4UFJA 3MVIA 5DN1A 1HIZA 1TCMA 4GI4A 2GDVA 4UQ9A 3FHQA 1KB3A 4AY7A 4S2CA 3PFMA 2F61A 4NI3A 1JZ3A 4K2SA 3R11A 3M16A 4IPLA 3ZJ6A 3E9AA 3G1AA 3KBJA 5LSMA 1VIZA 3SUVA 2WCSA 3M0MA 3FDGA 4ORMA 3ICJA 2XWEA 1I2QA 4LRSA 3H23A 4MY9A 1B9ZA 1VJSA 3ELFA 1XLDA 1RY0A 4QNWA 4FNSA 2EQ9A 3VK5A 4F48A 1X96A 1VFMA 4Z0SA 3RO6A 1TWDA 2VZSA 3WBAA 3TC7A 3AJXA 2YFOA 4PB3A 1S2CA 4Q4RA 1Q6DA 1QASA 1H7RA 3VOJA 1FWTA 3BG9A 3STFA 1TX0A 3EWZA 3TMLA 1UR2A 3OA5A 5HWNA 4UTHA 4EQRA 2PCEA 4B5WA 1RVGA 3TONA 3RMJA 1VYPX 1K3UA 1O60A 2WWCA 3IJQA 4PMYA 3JW7A 5LXEA 3UR2A 3MKCA 3GUWA 2QS8A 3PBYA 4LB4A 2EO7A 3VINA 3ZJ7A 4L4MA 2ZZ0A 2DT1A 2FPTA 3O1NA 4JGDA 3H2NA 3B05A 3U5YA 3JVAA 5E0CA 3LHTA 2GJNA 1CXLA 2XN2A 3EANA 5JBEA 3UD6A 2FTPA 2BG5A 3SCVA 3VYLA 3II4A 4CNTA 2QR6A 2G3IA 3TP4A 3HBLA 2XPKA 3AUOA 4WXYA 3S6DA 1EYEA 3POHA 4UNKA 2PGRA 3V0SA 1CLVA 2DH2A 3P7YA 4YTSA 1LT8A 4FNPA 3O0KA 5LGZA 1GQIA 3H2EA 1J0JA 3AS1A 4FXFA 2HVOA 2CU0A 2XWDA 2ZQ0A 3N14A 3OIXA 3VNJA 3H24A 4NJKA 5HWMA 3W1PA 4AF0B 4R7WA 5JXQA 2Q8ZA 4BS0A 5JIPA 5EB8A 5HWJA 1W3NA 3VMOA 1TPFA 3BVJA 1GGOA 4EF8A 4ZOBA 1GREA 3DIPA 4GQQA 3U2OA 3O3RA 2E6YA 3FOKA 3TYEA 1ZY8A 1YXCA 4DO7A 4GC4A 4GY7A 4NUWA 3QQ0A 3KBSA 1KFLA 4Z2LA 4O0ZA 2TODA 5CEWA 5GVJA 1JQXA 3O9NA 3VZYA 3G2GA 3ID7A 2EHHA 3TTOA 2NV1A 2GGJA 1PCWA 2UWFA 3THQA 1W9UA 3FLUA 2A6NA 1NQ6A 3GK0A 3P74A 3ONBA 4XV0A 2VJXA 3NUKA 3QR1A 3C2YA 3AS3A 4DJFC 3NR0A 4NZ4A 3HF3A 5EU9A 1X6NA 3M5XA 3TYCA 4YYCA 3G1HA 5I6SA 1RK5A 4BEUA 2WP6A 4EE9A 3UG4A 4UTLA 3OYZA 1V3IA 1F8WA 3KVLA 3W7QA 2VX6A 4DJEA 4HSOA 2V5LA 3LERA 1J0HA 4RW5A 3CHFA 5TAOA 2YCJA 3LI1A 1DHKA 4KCUA 4OV9A 1RA0A 3H55A 3DKJA 1PO9A 2DUZA 2RDWA 4LS2A 2PUZA 5EBAA 3LTPA 5LIKX 3W85A 1XLBA 3MANA 4ZGYA 3ATZA 1WUFA 1OYCA 2QVNA 2WJFA 4ZMGA 5KZ6A 1U83A 2PWUA 3WJZA 1XINA 1LORA 1E6ZA 2HSAA 3PB2A 1S2UA 2Z2UA 2DIKA 2VCBA 3FDKA 1OYBA 1MQPA 3WLRA 3UXAA 2PDFA 4WJ8A 6A3HA 4XZNX 1M65A 1EKOA 3CTTA 4OZOA 2ZRZA 3W2NA 5G2IA 1VRDA 3C5QA 4LVFA 3PZQA 3WNMA 4UTTA 2OLAA 3VD3A 1J93A 2C6QA 2QCFA 4I5RA 1P48A 3K4WA 4QSFA 2H3BA 1VHCA 4PUWA 4S3DA 3NM1A 4DN1A 1W31A 1F9CA 4B15A 4JL1A 4F9JA 4JDBA 2DW6A 2X7WA 3ARUA 4GLEA 3TYBA 1ADDA 2ISWA 3L12A 4K1GA 1UD5A 1SW0A 1M41A 2YXOA 3N73A 3T42A 5KVIA 3VIPA 3TA9A 3R79A 5AHEA 2O55A 2ZICA 4UMBA 1XCXA 2X7VA 2BY0A 4TMCA 2J88A 5D32A 2GSEA 4TUFA 2O9PA 3KCOA 4Q7IA 1S2WA 1FHLA 2BBFA 2ZKMX 2XN1A 3LZ5A 4NIRA 2WWDA 1JZ6A 4QJ5B 1PTAA 2O9TA 2PGEA 4HPHA 3BLKA 5EMLA 4DBEA 5G4WA 1WKFA 1GOKA 3PAJA 2ISSA 3GLCA 1KV5A 1REQB 4MUZA 3NSNA 1P0BA 1IE7C 3PZOA 4J3XA 4LRTA 1E9IA 1Z8AA 3WJXA 2PEVA 1LZOA 1OD0A 3ITXA 4IXXA 2GUUA 4WCJA 2C16A 3B40A 1EUNA 2CXEA 1XR2A 1QJWA 4AQLA 3GXFA 3N18A 3RYSA 2I57A 3WUBA 4I9JA 4TU1A 2PE4A 4OT7A 3IV3A 1P6BA 3M41A 1C9WA 2Z4GA 5DRIA 2VC7A 4KEZA 1MXDA 1ZL1A 2HK1A 3MDWA 2PDLA 2PWDA 4L9YA 3W2LA 1SFTA 2FGZA 4GVIA 1GKQA 4GUFA 1R7AA 4NJJA 4U3CA 4RNIA 3GVRA 3G3MA 1PX3A 4QE4A 1VB9A 3WBYA 4AVNA 5EPDA 4QJ4B 3G0XA 1V6UA 4IFKA 3LQLA 3K4AA 3RLHA 5F2GA 4LX4A 4JHZA 4JEQA 2CFYA 3UG3A 3FGCB 1NP0A 4OQVA 4D6GA 2V82A 7TIMA 4JIEA 1YX1A 2WM0A 1RCQA 4WDWA 1NDAA 4XD6A 1XBZA 3UP8A 5E9AA 1GKRA 3WEOA 3B9AA 3EGJA 2PCQA 4KH2A 3ZXWA 4B3LA 2XIBA 2CLPA 2GOKA 3TQ0A 1VBUA 1VGAA 4S38A 1P0NA 5D2TA 1AMKA 4X22A 4ZOCA 4WSJA 5BOFA 4IPNB 4GVGA 4YTQA 2GDQA 2YZ5A 3TTEA 1SYTA 3IK2A 3HQPA 3VA8A 4BF9A 3GG7A 3SUTA 4GGBA 3AO0A 5A8MA 1B3VA 4IXHA 3UJRA 2HMCA 4D71A 1G94A 4WEVX 1U1JA 3HTWA 3E2QA 4O19A 2F5ZA 4F0RA 4RR4A 1AUSL 1JJKA 3GM8A 2VUYA 3L2LA 1KV8A 1J11A 1PEZA 4AWEA 5I3GA 2WK2A 2W0UA 2OGYA 1XD1A 3N25A 3HG2A 3CB3A 1IWPA 4LC6A 1OK4A 2V3DA 3BCFA 2CW6A 2P0IA 2PGWA 3W82A 1AOGA 1QNOA 2PDCA 3SRKA 4ADTA 1EXBA 2FB2A 3W73A 3V0UA 1TCDA 1OADA 1NSJA 3W1TA 4JTJA 3LPPA 1H62A 4GFIA 4OBSA 1X39A 4RE4A 1BKSA 4GYPA 1UH2A 4PCPA 3NQGA 1ISVA 1UASA 5AECA 3B8SA 2C18A 2OSWA 3EWCA 1MXGA 3AU2A 3UG8A 4LBSA 3OA3A 3URBA 1LYXA 3URHA 4NRSA 4V1XA 2ZDRA 2E68A 2J7EA 4GXMA 5CLTA 2IQ0A 1VC4A 1TPEA 2Z0IA 3P5YA 3T81A 5BRPA 3SY1A 3KUMA 2Y7EA 3OVQA 1WZKA 3VNIA 1PHQA 1ME7A 3A47A 3E38A 3OQEA 1EPXA 4QQUA 1RJRA 2QDDA 2R1PA 3HU7A 1NJJA 2PDWA 2AMXA 5HUPA 3GXPA 5AC5A 2OSXA 4U5IA 1RZMA 2VZOA 4DJDA 2X40A 1UZ4A 2E5CA 4IJBA 5D9NA 4QP0A 1MI3A 4PMJA 3EKGA 2AGKA 5BU6A 1K7FA 1RVKA 4FLQA 3OIHA 4S3CA 1FIQB 3W1LA 3QZEA 3O63A 1Z42A 4ZFCA 1E4LA 4FSAA 5C8BB 4H41A 1EHAA 3WK0A 4JX6A 2VR5A 2YL8A 1Q63A 3MDUA 4M29A 1JCNA 4OFCA 2PWGA 2PAJA 1DNCA 1OWQA 3RFAA 4JX5A 4PODA 2NXGA 3N3TA 5DMNA 2E40A 2XU2A 3GFZA 4R88A 4O0QA 1RPKA 2XH2A 1B30A 2ZX5A 5K9CA 1E6PA 1BVNP 4E4PA 3MHFA 1FXPA 3W71A 4HN8A 4O0KA 2AAMA 1CPUA 3RCMA 3TYDA 4BY3A 2INFA 1HJXA 2HV5A 5HR7A 3GNOA 2VZVA 3OHIA 4AHPA 3WQVA 1JYWA 2REQA 1F3WA 3AHZA 3W86A 2J7CA 3WL1A 5ECVA 4PTWA 3MP4A 3LGDA 1WX0A 3QW3A 1H7WA 4HHMA 4P7NA 4CQ9A 5CSUA 2E3ZA 3A3XA 3DDMA 4XB3A 3CL6A 1A5KC 1NHPA 1EFZA 1U1UA 1HJUA 1GRGA 3L65A 1B2YA 5CPSA 2GWNA 2YDAA 3BTNA 3VXGA 3WF4A 1IWAA 3C0LA 3WLJA 1KRAC 3ZT7A 3ZT6A 1EHNA 4PRRA 1XH2A 3J7HA 1T3QC 1I45A 2IS7A 1P5BA 2ZWZA 1R3SA 1UH3A 4PTNA 4BQ2A 5C9RA 1W17A 3VDHA 2HE8A 4FB7A 4UBPC 4IWWA 4MPQA 2GR1A 1DIKA 4Y8FA 3BOLA 3E0WA 3F2DA 3C2EA 1B1YA 5A2CA 2DIEA 1XQLA 3AXKA 3TN5A 1H11A 2ZBTA 3NOYA 3SCOA 3RK8A 1SJBA 4LB3A 2DEPA 1EZWA 5JRBA 4BWLA 3FJ4A 2YPIA 4RNJA 1RCXB 1GPWA 3W2JA 1XLJA 4HYVA 1PIFA 3CGBA 4Q8VA 1E51A 3Q58A 7A3HA 3PG6A 1L6SA 4B2DD 1TPUA 7XIMA 1GRAA 2VC9A 3HPFA 3SM0A 5F2LA 3MCOA 3OW1A 3PBUA 4LF1A 1DQUA 3U5UA 4EXQA 4LSBA 1EEXA 3W6MA 4GACA 3K13A 1X1ZA 2AOSA 4MKNA 2DJXA 4XUYA 3K8KA 4IUOA 2J77A 3SCQA 2FB3A 4IGNA 1XIGA 5T8GA 1XIFA 4RE3A 2NX3A 4DJEC 4MDPA 1G4EA 4JX4A 2CZFA 3VKCA 4J40A 5C2XA 3PP7A 3F4CA 4LJ3A 1G7VA 3DENA 1G69A 4CNSA 1FCBA 2J4GA 3IJ9A 4JFVA 1PZ2A 4JQ3A 4A3HA 2FHCA 2Z7GA 1PWMA 1T0OA 1NF0A 4PA8A 4IP5A 1Q6CA 3GDMA 2DZXA 4ZO6A 1OZMA 1TX2A 4E8GA 2O9RA 3B0VC 3BOFA 5D8WA 2E8ZA 4GQBA 1V0LA 1WDWA 1TA3A 2C71A 1VFLA 3VNMA 4HTBA 4B5UA 2QUUA 3MZNA 1WDQA 5FEZA 3CLMA 1UH4A 1DL3A 5ENLA 5HMFA 4LUYA 3WSUA 5E1QA 1VFOA 1T8XA 4DI8A 2NX1A 3L0GA 1B3WA 2YQUA 1H50A 3OP2A 1EOKA 4HTYA 3OVPA 1ZJHA 2DQXA 3GU2A 2O0TA 3TQKA 1UQYA 4CD5A 3PPFA 1F6YA 1VLWA 3P0XA 3VM7A 3THDA 2EPKX 1EUAA 1UUMA 4PULA 2IQDA 3VDCA 1ME8A 1W6TA 3MW7A 3EPMA 3FA4A 4O1BA 1ZMDA 1LDCA 2PTDA 1OFDA 4JBRA 2I17A 3HIJA 3HOJA 4DNMA 1DJNA 2C7FA 2HNEA 3C8NA 2EF9A 4GKTA 2C15A 2ZX6A 3LRMA 4H7VA 1SR9A 4C1KA 4A8LA 1QPKA 1TUXA 2XN0A 1VPXA 1RXOB 1UWQA 2PDMA 1ZKQA 3W1XA 3G24A 1KR0A 1F8MA 3DH7A 3QHOA 3KHJA 2FZBA 1UZDA 1C90A 1VPQA 2Q71A 4A8RA 2QGHA 1BKHA 3H53A 5AHIA 1ZXIC 4NAEA 4QG9A 4HU3A 3QGKC 1XL9A 4LA1A 2H8XA 1H4PA 3WD2A 3G8RA 1XANA 1W5PA 3AUJA 3WH6A 3WMSA 4IPJA 2FGBA 4DYEA 4H4YA 4HMEA 4GBUA 4J27A 1YXDA 3LRLA 3UJSA 1YPIA 2CERA 4H4WA 3ZJKA 1KFKA 4E2OA 5EMMA 3P60A 4IFKB 3R89A 2OCZA 1BXCA 1S46A 1CNVA 4K8EA 1JIBA 4JIRA 3U7VA 3B8VA 1UCWA 2R9RA 1W1ZA 4EPBC 1ZAJA 3SFKA 5FOOA 3HN3A 4H6EA 4U2ZA 6ALDA 1TIMA 4YHGA 2Q09A 1IHIA 3R0DA 1SQ7A 4LC8A 3MUIA 3S1XA 3CB8A 1LVLA 2ABBA 4V27A 2W3RA 1HKWA 5DXYA 3F5KA 5IFPA 3IAPA 3LPGA 4D1IA 1A3HA 2Y7FA 1AQMA 2CKSA 4KIEA 4US5A 1ZX9A 1YW1A 4UNIA 4J2PA 1OFEA 2X0YA 2BY3A 1I0BA 5LNVA 2XSXA 3C0SA 5A6LA 5K2ZA 3WZ0E 3GKFA 4OGZA 5E9XA 3OGSA 3LGGA 1KTNA 5CJMA 3GHSA 3UZWA 2WAGA 4C6EA 4AZBA 1QW7A 5JCKA 3A12A 3C3UA 4AX6A 4GMEA 4RCXA 4F0HA 1XLEA 4H4XA 2PU1A 3RLVA 1O12A 3KOZA 3WBWA 4JEJA 2ACUA 4P8WA 1J6PA 4FAMA 2AKMA 1QK2A 2QKFA 2J9ZA 1O5QA 5B80A 1KM5A 4Y9OA 1IR1A 4AZIA 1VENA 2VGIA 3G77A 2A3EA 2C91A 2WHLA 1H63A 2HPIA 4C1NA 1KM4A 4GZEA 5SWUA 3GXNA 1J9YA 3NG3A 4AIOA 4X9SA 1L2QA 1WDSA 2QCHA 3IPWA 1ITCA 1ADOA 4GIYA 1H61A 3IARA 3OLDA 3LQGA 4MYAA 3MCMA 3CEPA 3LOTA 2A3HA 4AWSA 1KFJA 5A6SA 1ZJIA 2O7QA 1OHLA 3ORWA 2BSLA 4IFRA 5BMXA 3KCLA 1X1OA 2PURA 4H9TA 4AMAA 4NSBA 4O1FA 4MY8A 2VYOA 5CC3A 1AW1A 2YVGA 3OO2A 2R9ZA 3RR4A 3DI1A 4JTAA 3AJ7A 2DIJA 3TXZA 1SSDA 2GVYA 3R0KA 4FXRA 1AK5A 4N42A 3TLQA 3UJ2A 1GG0A 2OEMA 4DI9A 1H49A 3M44A 3N11A 4O13A 2WANA 4FDCB 2E7FA 3C61A 1HKMA 4H83A 1UKTA 1D9EA 1X8FA 4PBGA 1JRPA 1ZDLA 2OZ0A 4J3VA 3DCPA 4FLSA 1ZP4A 3A7UA 3GH7A 3BZGA 1JD9A 5LA2A 1QHZA 1J6OA 1W3HA 1DQWA 4P7RA 2QAFA 3NPVA 4J7RA 3ABZA 4H4ZA 2JGQA 4AYSA 4TQTA 2H3DA 1WB0A 2ZZ4A 3MWCA 1VEPA 1R3YA 3DFSA 2VXNA 2Z2AA 3KVJA 3L0KA 4AZ5A 1M01A 2PP0A 1EIXA 3F4WA 4PN2A 3EOUA 4PBEA 5LKYA 1XBXA 3BSMA 3GQYA 3H70A 4LS1A 1GT8A 1B90A 4XWUA 2OYLA 3V3WA 4KWOA 3IJ7A 3A4WA 3W07A 1CGWA 3ALFA 3H4XA 5L9FA 1MUMA 1A4MA 4FX6M 1YDYA 3U9IA 3QFEA 3VIJA 2VURA 3KL0A 1RLDA 3QGAC 1SW3A 3W84A 5C2CA 1A49A 4O12A 2REQB 4ZENA 5TBOA 1UW9A 3V1HA 2C13A 5M17A 1E3ZA 3SCSA 2CHNA 1OBAA 1ZCCA 5H6HA 4KW2A 1DQXA 4BEQA 4BQ5A 5KSWA 1RH9A 2Z1VA 1NWSA 3MBDA 3A13A 4UTJA 1V3KA 2E28A 3R94A 2FMOA 3M6YA 5BXTA 2VC5A 3WKZA 2ISFA 4ZEPA 3TX9A 5JH1A 4MIMA 1F6KA 3IEBA 1FKWA 1HF6A 1QBAA 3APTA 2D69A 3V1PA 4CN4A 4KEUA 5D2VA 3LS9A 2ZUUA 3NGJA 2AAQA 4MSSA 1ZQ5A 1DV7A 4D6FA 3VIGA 2QJGA 4ATWA 3RCNA 3C2FA 3UWUA 1RJPA 3W0KA 3M0ZA 3TAKA 4WSKA 4C7DA 2BOGX 3BUVA 4W9TA 1HP5A 4UCFA 2YL9A 1D3HA 1UD8A 1K03A 1WNOA 1XXXA 1UZHA 1LQ0A 1E72M 4JTDA 3RO8A 1TMLA 4IFOA 1SZRA 3L23A 1E9LA 1F6PA 3IIOA 1JNDA 4V15A 1Q8AA 3KBWA 3GIQA 4XD4A 4YWOA 1EJVC 3ARXA 3U2CA 1DIDA 3W72A 4BWLC 5BOOA 5AYBA 3QFAA 2F6UA 4IIBA 4DM1A 3O6DA 4GWEA 1OC6A 2CZ5A 4C65A 3R12A 2A3AA 3NQVA 3N2TA 2CLOA 4MJ2A 5G5IA 4DBDA 4LALA 1UR4A 4HA3A 4D6JA 3HPXA 4AWUA 3ARQA 4R5EA 3FHAA 5JCMA 3EMZA 5CC6A 3AIRA 3VDAA 3EWBX 2ZUTA 3L9CA 3WBEA 2QCGA 2ZZ5A 7PTDA 1DTNA 2PB1A 1WCGA 4YU1A 1WOBA 1XGZA 4ILSA 4K8GA 3RMEA 1W9BM 1QWKA 3SZ8A 4PBFA 4S3KA 4DZ5A 1JPHA 1K9EA 1W5MA 5GJNA 3EXSA 2B7PA 4GC3A 2OLSA 4GY1A 5AZ0A 3HJEA 3D3AA 4LUJA 1OX5A 3NQDA 1ZS2A 1CXEA 4S23A 2XIQA 1HKIA 1GNXA 4XZIA 8A3HA 1LOSA 1FFRA 3TZNA 3E96A 3LG3A 3FJNA 4BCEA 3QSRA 2PDYA 3O2LA 2CCRA 3GDLA 3LTYA 1L6FA 4XIMA 1A0CA 5K3VA 2UZ9A 1YBQA 3UGVA 2JIWA 3W9ZA 3KTCA 2W63A 3IGSA 1XISA 4JIQA 1PXGA 1QPOA 3WQOA 4B5NA 3SY8A 2BB0A 4LNCA 3DC8A 4LY4A 5TD4A 5KVHA 1K7XA 4EPEC 2NSXA 2EJ1A 1TA3B 4JTUA 1AW5A 3MPGA 1KFBA 2I56A 2G3NA 4A3YA 4JCMA 2WC7A 2NXHA 2QIWA 1VQZA 3I3EA 2V3AA 2EPHA 3LCXA 5HNNA 5DEZA 4NYYA 4ZTYA 3PJUA 3N15A 4MWAD 7ENLA 2A7RA 2WPCA 4JQ1A 3FIGA 4IPIA 1YDOA 2VNCA 3RM8A 1JL8A 3NA8A 1OFOA 1QVBA 2R94A 3UNTA 1KM2A 2WHKA 2DZPA 5GQBA 1E1CA 4RXFA 3LCGA 4PUMA 3KP1A 2YBVA 4YLWA 1RQHA 2PP3A 2L5HA 4LCSA 3GVQA 3KTSA 1UWIA 3FXGA 3CWNA 3H4WA 4G7EA 3H22A 3IGUA 1XDJA 1OFPA 4HU4A 4NXSA 1FHUA 3UWEA 3FCPA 1HL9A 4PFMA 2X41A 3V36A 1B4EA 1MNSA 4OHQA 1UUOA 4MZYA 4JTHA 4E5TA 4WOQA 3BLLA 1DPMA 3DYMA 1OF6A 1MW2A 3FN9A 3QQ1A 3FS2A 4E4UA 1ZUAX 3QRHA 4PTMA 4NAEB 7REQA 3W01A 3WH9A 2XM2A 4H4QA 4K6AA 3GHUA 1W3TA 4E38A 2XJ7A 3WLQA 2NXIA 3F5LA 1N60C 3KBVA 4GRSA 3H2AA 3EOLA 1HO1A 1FWNA 1G01A 5FS9A 1LUCB 2XH4A 1F4HA 1UHVA 1BQCA 1DEDA 1U1HA 5FJTA 3IIPA 3ITLA 1JDAA 3LV6A 4QCEA 1ONWA 2PBOA 1A5LC 4B5VA 3A5VA 5I3HA 5C9WA 3GH4A 4JICA 2UY4A 1N82A 3MKKA 5B7ZA 3TNOA 1O5RA 3B9NA 4UWMA 3TXVA 2HVNA 3PG8A 1A4LA 1FHDA 1XI3A 3RPMA 3S6OA 5I7GA 4H9XA 1MW1A 1UB3A 4CQDA 3R43A 4MM1A 4PMUA 3REQA 3EAOA 4M0XA 3R25A 1XH1A 4U5KA 4S3EA 3GDTA 2CWXA 3ZQ9A 1UR9A 1N2VA 4XTIA 4D8LA 3W76A 4YVXA 3QOKA 1K70A 3DI0A 4NEWA 1OGBA 4CVUA 2W67A 3AICA 2FZ8A 3O05A 1BFNA 1JROA 2EPLX 1HL2A 4MB1A 3VKKA 3H26A 3ISIX 4DLMA 4FNUA 4ZQMA 3THUA 1XYFA 1N63C 1DYSA 1Y65A 3P62A 4H2HA 3F4DA 3SI9A 1XUZA 2XZ9A 2P0OA 4LEQA 1BRLA 4C1NB 4GG9A 1CGUA 1C3FA 2WHJA 5CAKA 2INEA 3AHXA 4DWSA 4ICMA 1E0TA 3NL5A 3L21A 3TQPA 3ZLFA 1US2A 1ALDA 2EPNA 4H4SA 5LZLA 3RCYA 1Z89A 5A8GA 3RDKA 2GYIA 2GFTA 4Z2GA 5FJIA 3M1ZA 1P0DA 4O4VA 5DRCA 4ZBCA 3LK6A 3NFUA 3W75A 1U5HA 3SSZA 1RBOB 4GJ1A 4LVBA 3S1WA 4BI5A 1FA2A 4D1JA 2NSOA 4L7ZA 3WD0A 2PDGA 4EMWA 4ATDA 1GXFA 4EWJA 4CCEA 1A5OC 1M6JA 2XFWA 3S1VA 1QTWA 1UPMB 2VHLA 9CGTA 2XSBA 2OOFA 1JXJA 1SO3A 1MNZA 3S0CA 5KINA 4JKMA 3TKFA 2E09A 4JTLA 4QFUA 3ZSTA 6PTDA 3WFAA 5JH2A 3APYA 3SCPA 3HURA 4NI8A 4M1BA 4QQ3A 5HNTA 1BQGA 3CH0A 1NHSA 1ZMCA 3A9IA 3F1QA 1UKOA 3WDIA 1DORA 4OOUA 3XINA 3FYPA 1H1NA 3GUGA 1J79A 3RPTA 1KBIA 4S2BA 1GVSA 2WZIA 4YN5A 4UZUA 4Y9MA 3WNKA 1F3XA 2WOWA 3EB3A 1FXQA 2CXGA 4MUPA 4MFDA 2ZE3A 3CZLA 3VIIA 5CJNA 4H01A 2VOTA 4KPLA 4MWAE 1N55A 2W66A 5EMUA 2WBGA 1MUCA 3BE7A 1QOQA 1UQZA 1CXHA 5FEWA 1R2SA 5HDRA 4URIA 5I77A <