3P93A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
403
structure length
384
Chain Sequence
b'LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-MANNONATE DEHYDRATASE FROM CHROMOHALOBACTER SALEXIGENS complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 144
structure length 384
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3p93A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3p93A01
3K1GA 1WUEA 3EEZA 3R10A 3SN4A 3NZGA 3UJEA 3TQPA 3UJSA 2OPJA 1SJAA 4DXKA 4IP4A 3V4BA 2AKZA 2XH0A 3IK4A 2QGYA 1WUFA 2OX4A 3PK7A 3DG3A 1FHVA 3RITA 4FI4A 2GDQA 2XH7A 3D47A 1KKOA 4E4FA 1P43A 3OP2A 3H8AA 3D46A 3DFHA 4E4UA 3P0WA 2P8BA 3DDMA 3CT2A 4IZGA 3ZVIA 3SSZA 3UCDA 4K8GA 3S47A 3NXLA 1SJCA 1BQGA 4J1OA 1SJBA 2DW6A 2NQLA 1PDZA 4HPNA 2QVHA 3MKCA 3ZLHA 1NU5A 3N6HA 1ECQA 4E5TA 6ENLA 2MUCA 4ROPA 4GGHA 3TOYA 2PTXA 3UJRA 3P93A 3ZLGA 1L8PA 1EC7A 3VDGA 3CXOA 2OVLA 1JPDX 3DG7A 3NFUA 3DIPA 3B97A 1JCTA 3UCCA 3OPSA 3OZMA 4IL0A 3H7VA 3UGVA 4EWJA 4MKSA 3VC6A 1MDRA 2AL2B 2PCEA 3MUCA 1R6WA 4KWSA 3I6EA 2P3ZA 3QPEA 1JPMA 3KUMA 2PP3A 3GC2A 3SJNA 3SQSA 4G8TA 3DFYA 3ENLA 3Q45A 2XH2A 2PTYA 3UJ2A 2P0IA 1W6TA 3T4WA 3IJQA 3R25A 2HXUA 4G7FA 3BSMA 2CHRA 4E6MA 2GSHA 3T9PA 3OTRA 2AKMA 4J3ZA 4HNLA 3DG6A 2PP0A 3CAWA 3QLDA 4A35A 2PGEA 1JDFA 2HZGA 1EC9A 1YEYA 3JW7A 5EU9A 4JN7A 4JN8A 3BJSA 3H70A 7ENLA 4DX3A 2OLAA 2GGGA 4MMWA 3RCYA 3QN3A 3P3BA 3TW9A 2GGHA 4IHCA 3PWIA 4GMEA 1XPYA 2PTWA 4M6UA 4Z1YA 3MQTA 4H2HA 3CK5A 3STPA 2QQ6A 2QJMA 5FJRA 4Z17A 2DW7A 5FJPA 3TTEA 3QTPA 4DN1A 4K2SA 4FP1A 2AL2A 1DTNA 4E8GA 2OFJA 3DGBA 2QJJA 3N4FA 3JZUA 4GIRA 3DESA 3ZLFA 4DHGA 4X2PA 4H1ZA 3JVAA 1PDYA 1BKHA 3DERA 3UJFA 3FVDA 2PGWA 3TWAA 2ONEA 3SN1A 3MY9A 2OZ8A 5BOFA 3RRAA 3TWBA 4M0XA 5FJTA 2OG9A 3SBFA 2PU1A 2ZC8A 3MZNA 1MUCA 3VA8A 4A6GA 4DYEA 1MNSA 3FJ4A 3RO6A 1FHUA 3VFCA 3N6JA 2QDEA 3PFRA 3FV9A 3NO1A 4HCLA 1RVKA 3FCPA 2O56A 4HCDA 2GGEA 2HNEA 3CB3A 3GD6A 4GYPA 5FJUA 3RGTA 4HYRA 4MGGA 1MRAA 3RR1A 2P8CA 2ZADA 1OEPA 3THUA 1SJDA 2PPGA 3R0KA 3TJIA 1TZZA 2GGIA 4IL2A 1KCZA 3R1ZA 3I4KA 3TJ4A 3UXKA 3ZVHB 2PTZA 1ELSA 2OZTA 3OW1A 3MSYA 1E9IA 3V5CA 2XH4A 4GFIA 2PMQA 3FYYA 1NELA 4ZCWA 3T6CA 3CYJA 3TCSA 3I6TA 3MWCA 1F9CA 4ENLA 2FKPA 1IYXA 1EBGA 4ZA0A 5ENLA 3GO2A 2QJNA 2AL1A 4GISA 1XS2A 2OO6A 3EKGA 3HPFA 3IJLA 3DEQA 3ES7A 4F4RA 3PWGA 4JHMA 3UXLA 3SN0A 3V3WA 4A3RA 2PSNA 3ES8A 2FYMA 1MDLA 2PS2A 3OZYA 2P88A 3FXGA 4IP5A 2OKTA 2PU0A 4H83A 3U4FA 3VC5A 3BOXA 4IT1A 4GGBA 4H19A 2RDXA 5IDZA 4KPLA 4DWDA 4KT2A 4HCHA 3GY1A 3S5SA 2MNRA 2POZA 3IJIA 3N4EA 2HXTA 2I5QA 2QDDA 3QKEA 4K1WA 3ZVHA 4YWSA 4HN8A 3V5FA 4GYPC 4HNCA 2PODA 2PP1A 1P48A 2PA6A 2OZ3A 2GGJA 5FJOA 2OQYA 1KD0A 2OQHA 3R0UA 1EC8A 3U9IA 3VCNA 5BOEA 1TKKA 2XSXA 2XGZA 3H12A 1R0MA 3R11A 4KEMA 3Q4DA 5J04A 1TE6A 1KKRA 3T8QA 1EBHA 3VCCA 2GL5A 1ONEA
chains in the Genus database with same CATH superfamily
3HBLA 4NZCA 1V8EA 2OX1A 4O57A 4FAMA 3CQJA 2QCDB 4O0KA 1FXPA 3G8EA 2Q3RA 2A0NA 1G4EA 1XP3A 2ZVRA 4UNKA 1W9BM 5CC7A 3N2MA 2DH2A 5D37A 5TAOA 3D47A 3GAYA 3O15A 4JEQA 1MQRA 3OBEA 4RV8A 4INFA 3TTYA 4YN5A 2G97A 2NX1A 2ZZ4A 1BQGA 3UXIA 4DWSC 4NNAA 3G1SA 4J1OA 2PDBA 3CIVA 2UY3A 3QM3A 1MO9A 1RSCA 1SFSA 4XISA 3F4VA 3EANA 3GR7A 3N17A 4Z1BA 2YDQA 4HMEA 3H4GA 3UD6A 3PBMA 4CUCA 3IACA 1EC7A 4PN2A 3F5LA 1U1UA 2WANA 1DTUA 3H54A 4S3DA 1JPDX 1L8NA 5CSSA 5A6BA 4F9JA 4JCMA 2GR3A 1O68A 1WOBA 2ZIDA 4G1NA 2UY2A 4H4IA 4GX8A 4W89A 5G1YA 3OVPA 1S3TC 3WBYA 4EWJA 4QJ1A 1J2WA 1O1ZA 4LFYA 1SW7A 3RYSA 1OHLA 2CXEA 4JTIA 4GVGA 1R6WA 4PUJA 4Q7IA 1VPXA 3VZZA 3VIJA 1JPMA 2QNEA 3SM0A 4PUEA 4O16A 2PTYA 2W0UA 2P0IA 1MXSA 5CG7A 1KFJA 3M0MA 4GC3A 3QW3A 1J93A 3BCFA 1F6PA 3OC4A 4S23A 3CZLA 1P5BA 1FWIC 1JCLA 2QCCA 4ACYA 1JROA 4S3JA 4RUBA 4DO7A 3OTRA 3HG2A 4WX2A 4ATDA 2QEZA 2VFEA 4LCSA 4NZ4A 1GETA 4DBEA 1KBKA 2QGHA 4JICA 2GYIA 5H8UA 1ISYA 2DVUA 3KOFA 4AD3A 1WO2A 1NFBA 4AWTA 3ZS4A 1A5OC 5MHBA 1S1PA 4IQEA 4ZQPA 2BY0A 2E9MA 4HNUA 2R1NA 3GG1A 4MAVA 1Z6KA 3DYMA 1BF6A 1Y0EA 4XG1A 4L61A 4MFEA 4AWUA 4E0CA 1W5MA 9XIAA 1ZFJA 1C9WA 3G18A 1HKKA 1JR1A 3MSRA 4HHPA 2D73A 1OC5A 2HPIA 4CQ9A 4N9EA 3DGBA 1Q6FA 4O0QA 4GNJA 5CSRA 5AYIA 3DH9A 2YW3A 3VD7A 3KBVA 4PMNA 5HDRA 5BW6A 3ZLFA 2JKEA 4Q7NA 1E0XA 1XLHA 3GFYA 1TPC1 2Z2AA 4GX9A 3JVAA 4NHVA 1UR2A 4PCTA 3UJFA 2GQ8A 2DEPA 2WBAA 5IOBA 2YOCA 4XK2A 1MZHA 2W61A 1UWUA 4NX5A 7REQB 5JCNA 4FK9A 4ZO9A 4KH2A 1K02A 3FJNA 1TPDA 2PU1A 3CO8A 1CZ1A 1GT8A 3WSUA 4RE0A 4S2CA 2W67A 1CGTA 3RO6A 2OR2A 3VDAA 3VABA 1KW1A 2AAQA 5DCEA 4QHRA 3V16A 2YL6A 2OYKA 4E2BA 2W79A 3TFCA 2O56A 3UY8A 1W1B1 3UERA 5FEWA 2D2HA 2PDPA 3AIEA 2W66A 3C52A 4RV3A 2EKCA 3GYCA 3V5OA 1K4QA 2P8CA 1E1FA 5DN1A 4EQWA 3ITGA 3EB4A 3N2CA 3EPOA 3R13A 3DK8A 4IL2A 3L23A 1WZMA 3HN3A 1KV5A 3HZ3A 7CGTA 1ELSA 2OZTA 4GQBA 1JQXA 1E0VA 2G50A 2ZDRA 2KX9A 2Y8UA 1TWDA 1XYLA 3V5CA 1IXNA 3GD4A 3OBKA 3LRKA 3BE7A 1E0TA 2R94A 4TOQA 3UCQA 4M24A 1R3TA 4UTTC 4TVUA 4D2JA 1TV7A 2PZNA 1D2KA 3URAA 4IUGA 1JDAA 4YVPA 4UTUA 3P6LA 1Q6LA 2D69A 1GQJA 1XLMA 3AM9A 3ORWA 4PCNA 4GNKB 3SCRA 4CU8A 4Y6GA 4H6RA 5C2CA 3C0QA 3IIOA 4JTGA 5HOSA 1XLGA 5HINA 3L68A 1VJSA 4UZUA 2Y1HA 4CCDA 4UMAA 3DENA 1F3PA 5AC5A 2OKTA 3HFYA 2YCLB 4DXXA 4GBUA 3WLMA 1Q3NA 5C70A 1PZ2A 4H19A 6ALDA 3HG5A 2QYGA 2WMGA 3WJSA 4IQJA 1DXLA 1R9YA 3KL5A 1O4UA 4H9YA 1Q7MA 2VEGA 3M44A 1W8GA 1X1NA 4PUMA 1H7NA 2YR1A 3EPNA 5T9BG 2ZZ1A 4CCCA 2V0TA 1HGWA 3SSJA 3IAPA 3R8GA 3ME3A 4ACZB 3V5FA 4FMVA 2PA6A 1A47A 1I2RA 1SR0A 3CQKA 1TWIA 1NHRA 5C54A 3A6OA 3BH4A 2DT3A 1MW1A 1MW3A 2I56A 2OQHA 5BOEA 4E2VA 3CGEA 2XFYA 1QNQA 4HZMA 1H09A 3OZOA 1LF1A 2DGAA 4K7VA 1XL9A 5A8QA 2P3EA 1EBHA 2NV9A 3SO7A 2GL5A 3CWOX 3K1GA 1EDTA 1H7RA 1P6WA 1IE7C 3MMWA 1E4LA 1SJAA 4DXKA 2VEMA 2FZ8A 2WNNA 3RLUA 4M80A 1O7AA 3N14A 2XIBA 3L9CA 1F3XA 4JZ5A 1YRRA 4FI4A 5CKSA 1E9YB 2HE8A 1ME9A 3QHNA 1F8WA 1BD0A 1XGDA 4FX6M 2NUYA 2QAEA 1ZX9A 2DPEA 3W76A 1D7KA 4GR1A 4M3PA 4JTJA 3QQ1A 3HOJA 3SSZA 2YDRA 3TROA 2ISFA 3NVYB 1JDDA 2D3LA 1OG0A 2QVHA 4QS5A 4IMAA 1CDGA 3EX6A 1GV4A 4R7JA 4W84A 3SCTA 1ADSA 5A8GA 4L4MA 3BG3A 2X1IA 3DFTA 1JNEA 3TNBA 3HMCA 1E71M 1XUUA 4AU0A 3A22A 5EGRA 4BZYA 3NQMA 3NPWA 1YPFA 1V0MA 1UWTA 3EA3A 1JCTA 4HVXA 4HGXA 1M6JA 4HIBA 3GHRA 1TMHA 3SRKA 1QO2A 2YDSA 2PF8A 4PSRA 2VX4A 3GLCA 3O63A 4IIDA 1EWDA 5EFFA 4Q32A 1UH3A 1RV8A 5K4ZA 3NURA 4KWSA 3BV4A 5BXSA 4ZQMA 3CIWA 4O10A 4UTWC 2ATSA 2QCDA 1KBLA 3L2IA 2ZZ3A 1C9DA 4G8TA 4JHZA 4K7YA 4UZSA 2J25A 3AYVA 1N5WC 4LV4A 1W2PA 1FWSA 3ZO9A 4XWUA 1E6XM 5CPQA 3RU8X 2ZRUA 4O4VA 3NQGA 1Z44A 4JHOA 4YMZA 4QJ4B 5RUBA 5E6YA 1Q66A 1TWZA 4G7FA 1TIWA 1PWMA 3ICJA 1FWFC 1VH7A 3DECA 5D02A 3PR2A 3TLQA 3T81A 1QPNA 3O6DA 1NWSA 4UTFA 1B54A 5K4XA 1KR1A 4IJBA 1WDQA 3DG6A 1K9TA 1RCXB 1W32A 2WSKA 2NQHA 3LY0A 3VIHA 4DLMA 2VD8A 4TR9A 3P61A 4KMQA 1YEYA 3JW7A 5FEZA 3UA4A 3MMTA 4RPQA 1AK5A 1LBMA 3NJ3A 1LQ0A 1FDYA 2Z24A 3AYRA 3WUGA 1XIBA 4QLJA 4YNGA 4BQ2A 4QEHA 4FXJA 2BY3A 2ZTKA 1ZP4A 2H8ZA 2CLEA 5I0DA 5K3VA 3W00A 1AL7A 3VD5A 1P6CA 5E9AA 1NAL1 4NILA 2QQ6A 3APTA 3MHFA 3K13A 4C6OA 1SZRA 4Z08A 2OO0A 4J7RA 4PCPA 4Z42C 4CVWA 5HR7A 3URQA 4DUVA 1UC5A 1I2PA 2YFOA 2OB3A 4QLKA 4GQRA 4A29A 4E8GA 3AIRA 3KW3A 1VR6A 3DESA 1Q85A 2X09A 3B4UA 3WLJA 7TIMA 2GR0A 1QHZA 2BFGA 1NQ6A 2QF8A 3I3EA 1TTPA 4L1XA 4WDUA 4Q8QA 1S2TA 3A3WA 3PTMA 2HTMA 3BMWA 5HJXA 4JS3A 4LF2A 2O92A 4HYVA 3SFWA 3WH9A 5D8WA 3U7BA 4D71A 2PWGA 1EXPA 2PB1A 2EPHA 4D8AA 5I00A 4IPLA 4JIIX 4M52A 4LBSA 4GVIA 3TK7A 4DWSB 1KFLA 3BANA 1MNSA 2BGNE 5ABTA 2ZYFA 3SQPA 1THFD 3HTWA 3N6JA 3VOIA 3LSCA 1U5JA 1DWAM 3MT1A 3FV9A 3B0XA 4GI8A 5DCDA 2YVGA 1GVIA 1RA5A 2PLCA 1J79A 1UUOA 4Y8EA 1SFLA 4HQVA 4NY2A 4BF9A 4ZXOA 3THUA 1ZGDA 3PSVA 1ZJAA 5D2XA 1GWJA 4PRRA 1FWCC 4JAWA 1RBLA 1M04A 2YXGA 4QG8A 5JQ9A 2Z1SA 3ZVHB 3VDBA 3S1WA 5F2GA 1U22A 4UQEA 3QMSA 3WFZA 1FDZA 1XW8A 2CC0A 3BV7A 3CEPA 4PUWA 5EKYA 1H6VA 2CBVA 1EHNA 3U57A 1V7YA 5A2BA 1RQBA 2QCGA 5I3GA 3MWCA 1BZLA 3FS2A 5F4XA 3VOGA 3VKJA 2DUXA 3KP0A 3SCPA 4M1RA 3GZAA 4L9YA 5LA1A 1DE6A 4LAOA 3MCNA 3DHUA 3VPLA 2J9YA 3L5MA 4Q4KA 4XO7A 4MADA 4PUUA 2UV8G 2GZXA 3IJLA 1JCYA 3DZ1A 2CWXA 2QJHA 4F4RA 3GH7A 3R43A 2YVFA 4XIAA 4A3RA 3OLIA 1PKMA 2HS6A 4ERIA 4F3HA 1HJUA 3C4UA 2CITA 1OCNA 1RR2A 4K8DA 3NYDA 3USZA 4YTSA 4KIRA 5EA9A 3U8GA 1WOAA 4J3SA 3MDWA 1K8ZA 1YDYA 3TIMA 3FKRA 2J7HA 1S46A 1SM9A 4AEOA 1JZ3A 2L5HA 3LNPA 3R94A 1UC4A 3NSMA 1DQUA 2GH5A 3L5LA 5AHNA 3CTLA 3FAXA 2QT3A 1V02A 2O4QA 2IPFA 2C7FA 2IUZA 2DZPA 4LYQA 4QJ5B 3TYAA 3II4A 2Q71A 1EUNA 4R85A 3WMLA 4EPBC 3UZWA 3W26A 1KBIA 1SYTA 3EUB3 1Z89A 4DF2A 4KRUA 1VAHA 2JEQA 4OV9A 2V2HA 1PB0A 2I9UA 1HKJA 1LPFA 1UROA 3WDRA 1A0DA 2X0YA 3KP1A 4OBSA 1HGYA 3UJSA 2PWHA 2OPJA 2Q6ZA 3PANA 3W7HA 3T09A 3MCMA 2AKZA 4Q8OA 2CZVA 4EM4A 1TQXA 4KWOA 4PB3A 4Q22A 3W2UA 3S3GA 3QQWA 2A6NA 1HL9A 2A79A 3NQFA 3IK2A 1XHGA 3WDIA 3GR4A 2YCLA 4TTGA 2ALRA 3HQOA 1PBGA 1Z9AA 4W5UA 2QIWA 3E2RA 4J40A 3N19B 3BLEA 3A7RA 1H7OA 2CBIA 4LUIA 1M68A 4XBSA 1PKNA 1IEQA 4B5XA 3H22A 4XZNX 1O5QA 1PDZA 1QPOA 2O7QA 5LNVA 3N9RA 3B0UX 4PB5A 1JF6A 5DXYA 4ACZA 1EJUC 3W22A 4PRTA 2Q02A 4O4WA 1KTNA 1RALA 1TQJA 1QATA 1C7TA 3GVRA 5CGQA 1AMKA 2OGJA 3UR8A 1UJPA 1K9FA 3K4AA 4FR1A 2GQ3A 3NFUA 1GONA 2ZE0A 1GEHA 3NEVA 4K37A 2HQAA 2ZXDA 2EHHA 5FF4A 1AH0A 3OZMA 3V0UA 3TC6A 2VT0A 1DKWA 1S38A 3WBAA 3U2ZA 1E6SM 2WOQA 1MDRA 2ZZ5A 4CNPA 3UYIA 3W1AA 1OD0A 3WLKX 2J7DA 3W1NA 3SJNA 3A13A 1AJ0A 1EJWC 4C1LA 3MUAA 4MTVA 2PRMA 4ERGA 3GNXA 1I6NA 1LL7A 4XZMX 4EAMA 2JGYA 3PFMA 3R25A 1R38A 1UP3A 4Z1AA 2Z0IA 1TX0A 2VX5A 1N2VA 5J8LA 4TX9A 4DBDA 1N62C 3N2XA 4X0VA 3GRSA 5HR6A 5JH1A 3BSGA 1SSDA 4ES4A 3LLFA 5EMLA 4E6MA 2GSHA 2VFIA 2BASA 4WQ6A 1W5NA 4EPKA 1L6YA 1O66A 2WMKA 4WK9A 1EP1A 3ALGA 4MNMA 1FBAA 2P5NA 3TYCA 3G1FA 3V35A 6XIAA 5I3HA 5FMHA 3MO7A 3IIPA 3ETRB 2OU4A 2G41A 4ZENA 2BDQA 3ZSTA 2W4XA 4R88A 1A4MA 2YLAA 2E5AA 1J96A 1HFBA 2DUAA 3B05A 2A7PA 2VP8A 1KM1A 3Q37A 1QO5A 4WJEA 1XD1A 1L0PA 3CU2A 3A9BA 5IBXC 3R07C 4W4QA 3TTSA 2YB1A 1OFAA 2E40A 3QTPA 4KW2A 1ZZMA 2A8XA 3VNDA 1GG0A 3K30A 3WNMA 4WDTA 4XZHA 1R9ZA 3B8TA 1GORA 4GIRA 4RE2A 1PX8A 1ZY9A 1J0KA 4FNTA 4JYDA 2PLMA 1VPYA 3KAOA 5G4HC 2XN0A 4HOZA 4YTQA 2PGWA 3G5EA 2J6XA 1UZDA 1ODZA 4L80A 4MKNA 1WV2A 2FFCA 4KRTA 4TO8A 1KV8A 3BMXA 1GQIA 2ACRA 3GDMA 1EJVC 4HNNA 3LGGA 3KZPA 1VFUA 2RHGA 2XFWA 4S3BA 5EMMA 4DYEA 4LBUA 4NL1A 2NQ9A 1MXGA 5JBEA 3PPGA 3NO1A 2Y88A 3MKKA 4EKJA 4JL2A 4QG9A 4XAPA 5DFAA 1TYGA 1J0JA 1TV2A 3CB3A 2F8QA 3G0XA 4HYRA 3W37A 2JALA 3E2VA 3MSDA 4O8AA 4O1EA 1XCFA 4QM1A 1PTDA 2DP3A 1W1PA 3TJ4A 4JFSA 4GIAA 3M6DA 3GS6A 2VQUA 3BCJA 1GCYA 1GTHA 1P0NA 3U5UA 3TQ0A 1QJWA 3ANYA 2Z27A 4JIRA 3TP4A 1WAWA 4V2XA 2HK1A 3GHTA 4BF7A 4DYKA 4XD6A 5M17A 4Q8NA 1YQ2A 4RR4A 3G1HA 3GDLA 3B9AA 3RRXA 3CZKA 3C0JA 4ZQRA 3SB0A 4B92A 1JZ4A 4GUJA 1EHAA 2WVVA 3IIXA 4JIQA 3K4WA 3RILA 4B5NA 3MUXA 3ABSA 5D9NA 4DNMA 3ES7A 3O0KA 3O3RA 1A5CA 2XJ7A 3EWDA 3V3WA 1XANA 4DWSA 1GUVA 2ZQ0A 1ZSXA 3WN6A 1QW9A 1FX6A 1H1YA 3IGHX 2GVLA 1Q63A 4GE8A 4IT1A 3AQUA 1N82A 3H2CA 3PZIA 4AUBA 4LY4A 2GQ9A 1EA9C 4P5UA 3T55A 1JCNA 2Q09A 3STFA 4FNSA 2Z6IA 4KT2A 3I4EA 1XBYA 3GBEA 4LWWA 1V7AA 4RDYA 2JIEA 1ZAHA 1R8LA 1E9ZB 3IGSA 4DI8A 5D03A 3W7RA 4S3KA 2EPNA 2WHLA 1E3ZA 2GLKA 1QOQA 2PZ0A 1WZKA 4LU0A 3TH6A 5BXRA 2AAAA 3ZVHA 4UR8A 2VCBA 2YKKA 3QC3A 4WGHA 1CNVA 4AZIA 4O18A 3MU7A 1IZJA 1UZHA 1IGSA 3WLPA 4P7QA 5I3KA 3PY2A 3LXDA 3QR1A 1E70M 2INFA 3KWSA 3AYSA 2QPSA 2R14A 4KCWA 2NVDA 3S2MA 3GDKA 2Z1WA 1BLIA 4GCXA 1WDPA 1G9HA 4D6EA 5J04A 1R2TA 2B7NA 3M1ZA 3WL1A 3GHUA 2XG9A 3VE7A 5KINA 3AJXA 3H6OA 2XVNA 2C18A 4C6DA 2VURA 1W5OA 2E09A 2W55A 5F4SA 2VC5A 2QHAA 3RITA 3N2BA 1K3UA 3CUGA 3QFWA 3XINA 3E02A 5K9XA 2J3NA 1IT8A 4OGZA 2D20A 5B7ZA 6XIMA 3FY1A 3C2EA 1K7XA 2I14A 4AY8A 1ICPA 3M7SA 3P84A 2Y61A 3LRLA 4AD5A 3GXNA 2QPXA 3EX3A 1E6ZA 4B4HA 1OGGA 4OECA 3UEQA 4WSJA 7PTDA 1UH4A 3N2TA 3LOTA 1UKQA 3TOYA 1V6XA 3GTXA 3NVDA 3ECQA 1TV3A 3NL3A 1JZ7A 2G3IA 1V5XA 5JIWA 3G1VA 1FH8A 2OMAA 2XVLA 3UGRA 5LNUA 1T40A 1S5NA 5A6SA 1A5KC 2SFPA 1NDWA 4MZ8A 4C1NA 1HVQA 2QDHA 4TMCA 2VELA 3W1MA 4LC8A 4JY8A 4GHRA 4BV6A 4RNFA 2XZ7A 2PCEA 4AIEA 1O5XA 4L6DA 4C6EA 4AZBA 4H2CA 1Z3NA 5C7VA 5KTLA 4GIEA 3DI0A 5HPOA 4QRNA 4G56A 1GXFA 3FGCB 2WKLA 1TO3A 1PUDA 4O28A 3ITYA 4DB7A 4QROA 3F4CA 2CKSA 2WOVA 4JQ3A 1MXDA 4GI9A 3EMQA 2C0AA 3ARUA 1GZGA 5E0CA 4OFCA 4JBRA 2Z7GA 4JIEA 1JYNA 2VTFA 3NPXA 1WXZA 4F2TA 1MYRA 1PO9A 4IFKA 3C0LA 3NRZB 1CXKA 4UNLA 5TQLA 4IMDA 3YPIA 1N55A 4PB4A 5C9WA 3GXDA 4ICCX 2XGBA 1VEPA 3DX5A 3PTKA 2PGEA 3GE7A 2AQOA 1UWRA 2ICSA 3BJSA 3LHYA 4P7NA 3W86A 4EVZA 3WF4A 1WXJA 2FH8A 2INEA 2OLAA 4H4SA 3QW4B 3SUUA 4C7GA 1EGMA 2GGHA 1QWKA 2OEKA 2CEQA 1VZWA 9CGTA 2I17A 4LGXA 3CK5A 1R46A 3AMLA 1EWEA 2QJMA 3CH9A 3B8IA 3ABRA 5FJIA 5DQPA 2FMNA 1FCQA 3NYZA 3DC0A 3LD5A 4LH8A 4XZWA 3JZUA 4GUHA 2C3ZA 4JNYA 1A3WA 4U3AA 3II1A 3RK8A 3ZZ1A 1BYBA 4IX2A 3VNLA 3NIYA 3LX9A 5CPLA 1JULA 2DQXA 1OWQA 3T05A 3DJGX 5JBFA 1JVNA 1DWIM 1XIEA 4QXIA 4R7OA 1MUWA 1RPXA 2E5BA 2XTKA 3R8HA 5E9XA 4HPGA 4LVAA 5C8BB 3KLLA 1QPQA 3OVGA 6A3HA 4WXYA 2CCRA 3HPXA 2DSVA 1ZUAX 3FNDA 3O16A 3NVTA 3BLOA 3OU8A 3VYLA 2C91A 1XLJA 4NUWA 1RJPA 1BSLA 4HP5A 5I03A 2A21A 4XZIA 4GYFA 3LHTA 1XG3A 4NZ3A 5F1VA 4S3FA 4W7VA 3HW2A 4XO6A 2GGEA 1Y5VA 3SRFA 3S9YA 3RR1A 3C0SA 3VGDA 3PUEA 4HJWA 4JXCA 1EGVA 1IZCA 2W27A 3M64A 4HMNA 4IIGA 1NOWA 3ZT5A 3AI0A 3W7LA 1PHQA 3EX1A 1TMLA 2OOGA 1DOSA 2OCZA 1GOIA 2JBMA 3D6NA 4DLFA 5FS7A 1DP0A 2FVKA 2VZSA 5AHEA 3IS4A 3KOYA 1VEOA 4HA4A 3PJTA 3W7OA 1KM2A 3BDKA 4Y2WA 2QF7A 4O1AA 1HO1A 2V5KA 4AX7A 2O9OA 2A3BA 5ENLA 3EYPA 2IKGA 5FF2A 1KBBA 1HXJA 1KXQA 2WLZA 2AL1A 2EQ7A 3E49A 1GYLA 3L4ZA 3M47A 4Z2HA 1CXHA 3ZXWA 1HKVA 5JU6A 3DEQA 3UZXA 4RLIA 4IG2B 3PZUA 3CHEA 3G1AA 4K68A 2PS2A 4MVAA 4ZGYA 1IEVA 3FXGA 3APGA 1BXBA 3QY8A 3KS5A 3EOUA 4MJ2A 4AB4A 2I16A 5BRBA 2OKOA 1EL3A 1J0YA 3LGEA 4H9ZA 3FSTA 2YZRA 2ODOA 2CLHA 3WY1A 5E93A 2ZX7A 3IJIA 1CLXA 3WD3A 3LN3A 3HGSA 3LV6A 3QKEA 1GZ1A 4P7OA 3FHQA 1JFHA 3A7AA 3UZ5A 3A4AA 2AGTA 5CAHA 1IQ8A 2Z6JA 1JXJA 1SR9A 2PODA 4JKMA 5EMKA 1R87A 1US2A 4MWAD 5FF3A 1LJYA 1DJWA 4XD4A 5AVNA 2XSXA 3ZR5A 5C9XA 1GKPA 1EP3A 2V5CA 3EX2A 5FL0A 3IV3A 1TE6A 1Q6DA 3B06A 3V36A 1KCXA 3CGTA 2E8ZA 3GTNA 3SI9A 1XLCA 1OX5A 1V6YA 3GB6A 2VXNA 4ZOCA 1XYFA 5L6UA 1ZAIA 1JF5A 3B40A 4IQDA 1UWIA 4NT0A 3IRSA 4E2OA 1WUFA 3N18A 1E40A 1FHVA 3CLMA 3VO0A 1RLCL 2Y85A 2TMDA 3LM3A 5DO8A 3AIQA 1XRTA 5DMLA 3NWRA 4B2DA 2CLOA 4LAKA 2YBUA 4QDMA 3DFSA 3WH7A 1MO0A 1UYQA 1H61A 4DJED 3TVAA 3MTWA 3ZVIA 3S5NA 3T0TA 5JRBA 4C1KA 3F5JA 4WZHA 3N9KA 1JZ6A 1REQB 4XB3A 3H7RA 3DGRA 4MY9A 1EEPA 5H2ZA 2ABAA 3EWWA 4PTMA 3WKZA 4ROPA 5A6JA 2BGSA 2R9RA 2PTXA 4HHMA 2WPGA 3P93A 3I6RA 3ZT6A 1L8PA 5GRTA 1UOZA 3A3XA 1UZ4A 3PP7A 2TRSA 1TREA 3ATYA 3VNIA 1KFKA 4FLOA 3R2GA 4QDWA 4PEKA 3L7RA 3I7SA 1YXDA 1TR9A 2A3HA 3F4NA 3N25A 4LUSB 4XZ9A 2WSYA 3M7WA 3EXRA 2R1MA 4D1JA 3WDJA 2G3MA 1VCVA 1JIBA 5EBUA 1GNXA 2HSAA 3QPEA 3L67A 4JGDA 2WSRA 3WF3A 3W7QA 3WEOA 2PP3A 2EG7A 4KFNA 3R12A 1F3WA 3VD3A 1Q4WA 4I9AA 4OUIA 3DGZA 2TPSA 4GWEA 3WNPA 2XIJA 3M0LA 2MANA 2V8ZA 1T99A 4RDWA 3ZMRA 2IKHA 4UTIA 3BJFA 5LHEA 5IM51 3V1HA 1FQ0A 2HXUA 4K38A 1DJQA 4YVVA 1IXPA 3TJLA 5H1WA 4FR6A 2YCEA 1MEHA 3GG0A 3FVMA 2QAPA 4I6KA 3T0DA 4M7SA 1M7OA 3T9PA 1JGMA 1OFBA 2O7SA 1DIKA 1TTQA 3VGFA 4N4PA 5KVHA 5G5HB 3AALA 1VRXA 2W3ZA 5EU9A 3QY7A 3OVQA 3B9NA 3BW2A 5FS8A 2H9AA 1AZ2A 5ER0A 1DXIA 5FSDC 2EPMX 1ZLPA 3RCYA 3AS2A 4S38A 3VVGA 1QASA 3N6QA 4CNTA 3LPFA 1ZCOA 4IXHA 4DUXA 4DJDD 4CCZA 5BNKA 1XDMA 1VIZA 2WJFA 1DWFM 5FJRA 2DW7A 3G1DA 3F03K 3GKFA 1KM4A 1OCJA 4ADSA 1TPWA 4EE9A 3QBUA 3N4FA 5CLTA 4ZBCA 2Z1BA 1YE4A 2ZFAA 1IT0A 4BI5A 4PTDA 4N9BA 1DIDA 5C5YA 3M16A 3IARA 3NSXA 2VGGA 3LA4A 3NDYA 4QS6A 3AIVA 3VGHA 4F40A 1H60A 3NUKA 2WJZA 3FVDA 4H7ZA 2GPTA 3KBMA 1C91A 4WUIA 1JQVA 3TV8A 2BTMA 2B7PA 2Z4GA 1DWHM 2XGIA 4WY0F 3TW6A 1FDJA 2OG9A 2FTWA 4GVFA 4C6NA 3O0FA 5M2FX 3W7CA 4A8LA 3LG3A 4NJKA 3OGVA 2Y7EA 1CT5A 3FJ4A 5IHRA 2GWGA 5D2YA 4CLMA 1KFEA 4ZB2A 4U31A 3KL0A 4C6KA 3CV7A 3QR3A 4BI7A 3LDVA 4JTRA 3KVLA 5JVLA 3N34A 4GY0A 1DXFA 4HCDA 3W4RA 3WLOA 2FZ9A 3T2PA 2X30A 4I7WA 4BFAA 3GD6A 4Z1DA 3L12A 4MGGA 3L4VA 4A3YA 3GKAA 4RKAA 3WLSA 3SGUA 1YDVA 1CXFA 1ZRQA 1KCLA 1H2IA 1TRIA 1RCOB 3CL6A 4GI4A 4ASTA 4W9TA 2VX6A 2FPYA 1CYGA 3RMEA 1O5RA 5BXPA 4XZBA 1IR1A 2PTZA 2F38A 5E6ZA 2DQWA 3E38A 5JCMA 2VUNA 8XIAA 3T6CA 4V33A 4CEUC 1GJWA 3WBWA 1UR9A 2FKPA 5FS6A 2A3AA 1IF2A 3FHAA 3TLLA 3PAOA 3HO8A 5DANA 3PWAA 3ONBA 4F48A 1GRAA 2NT0A 1QFEA 1UA3A 3QZEA 3TQVA 1EO7A 2VGBA 4Z2IA 3QPYA 1VFOA 4V15A 3VX1A 2Z2UA 4L4OA 3KE0A 4J27A 1JEHA 3OZYA 1DIEA 1ZU8A 4JFTA 1SZEA 3L8KA 4WGXA 1H11A 2NLIA 3BOXA 3GVVA 4G7EB 4LT9A 5E0FA 4E4PA 1GERA 1I8JA 4GLEA 2J8TA 5CC3A 3C8NA 3FIGA 4AHPA 1ZXIC 5HMDA 1X1OA 2DSKA 1O94A 4DRSA 5REQB 3FJ6A 3V75A 4KFOA 1OVDA 3W2NA 3GU2A 3ARRA 1NFGA 5LIKX 4C7DA 4DZ5A 3UP8A 4W7WA 1BAGA 3OA5A 3WZ0E 4DO5A 4NXKA 3PVFA 1NTHA 4Q6XA 3C2FA 4PUKA 1VEMA 1VPQA 2XSAA 4Q6JA 1R85A 1Q6EA 5LSMA 1GPFA 1KGWA 1DNCA 1MZRA 3VCNA 1SW0A 1OD8A 3UWYA 1Q6CA 3OZPA 2FH6A 3PB0A 3K8MA 3W7DA 1ITXA 5HNTA 1DJXA 1QNSA 3Q4DA 5A8OA 1W5QA 1L6FA 3CMGA 4W93A 2P53A 3DU0A 3OIHA 4HD5A 1VLIA 3CPGA 2ISSA 3GAKA 3DCPA 1YKWA 5F7UA 4HNVA 4IP4A 3B9EA 4X61A 3PK7A 1M3UA 1ZALA 2WZTA 3R58A 1W1IE 3URNA 1X7FA 4RE3A 5GJNA 3DAQA 1GVQA 5AECA 3EF6A 3NQBA 4L9ZA 3KXQA 1DYSA 2OQLA 2V67A 1XSKA 3HQNA 3PM6A 4K8GA 5G2IA 2V9DA 4EQXA 1GQLA 1YXYA 3PZVA 1TV5A 1F5ZA 2HISA 3GTHA 4KEUA 5CPOA 4DO6A 2ZZBA 5GJMA 7XIMA 4ROQA 5IBXA 3DBNA 3MKCA 3S83A 5FI8A 3CZEA 3CPRA 3TYUA 4KGLA 3EBVA 2EBNA 1V3HA 3H2OA 5AY7A 4A8NA 4JYEA 4AF0B 4HHLA 4RL3A 3ZLGA 3USBA 3R79A 4TVYA 3TW7A 4GUFA 2D2GA 1B3ZA 2Y6ZA 4ZVJA 3MJYA 3PUGA 3L0KA 1P1MA 4HTBA 3VI2A 3EXSA 5IFPA 2QULA 1RLDA 2C3DA 3UGVA 3DOPA 4GPNA 2EEXA 1GPWA 3LRMA 3LCLA 8CGTA 1GSNA 5E09A 3SW6A 2QDGA 1GQKA 4IF2A 3WNNA 5TBOA 1OC6A 4W8LA 1UASA 1YTDA 1WBJA 1TWSA 5D9MA 3WJZA 3E0IA 2HDJA 2J79A 3IAQA 3HGOA 3TYZA 4FA3A 2NWRA 3W1PA 1XI3A 4Y9OA 5IXEA 3AHVA 4FHAA 2R91A 4IP7A 4PODA 3LI0A 2GWNA 3ZIZA 3H4WA 4MKVA 3S5ZA 3D0CA 1K7EA 1W37A 3SQLA 3GW0A 2I5GA 3S6TA 1YPIA 3CWHA 4J3ZA 1JGIA 3S9ZA 1JPHA 1REQA 1ONWA 1NHSA 2HZGA 1RQEA 4JN7A 5XIMA 1YBQB 4GY1A 3XIMA 1OIFA 4LPCA 2J75A 2NSXA 2VRJA 4FALA 2ISWA 4IHCA 3PWIA 4K39A 2E0PA 2ZCGA 4GMEA 1K77A 2FVLA 1W0MA 4Z1YA 2J78A 4AZ6A 3WD4A 1KFBA 1QUMA 1ADDA 3TN3A 1TFVA 1B0IA 1SUXA 4LUSA 3IUHA 2A4AA 2DZSA 1AZ1A 4DN1A 1ZP3A 5I5RA 2OT1A 3AIWA 1E6RA 3JZEA 2OFJA 3K8LA 3TXZA 4B3LA 4CN6A 5L9FA 4AISA 4TQTA 2OJPA 3C2RA 3S42A 1RBAA 1S3HA 4US5D 4H4XA 2E1DA 3RDKA 3PPFA 4WY0A 3T0CA 4LOCA 2BCPA 4J2PA 1JUBA 4R34A 4HT3A 3KOWA 1TMQA 4RXGA 3PZGA 5JH2A 4A2RA 4MSSA 1E0UA 5BOFA 3EOSA 5FJTA 1FWTA 1A5AA 2Q3OA 5DY2A 1M7XA 1YQZA 1XKJA 5EMYA 3LM7A 3NPVA 4HPHA 1FHUA 4R33A 1VC4A 2G0WA 4ML4A 3GDRA 5HMEA 3D5HA 3S5OA 4RK8A 2BS9A 3SJ3A 1K70A 3IGUA 2OOFA 4H7CA 1PZ0A 3UQNA 3RJXA 1XIHA 4OJYA 4C6IA 1LRQA 5CC6A 2BGQA 5FJUA 1EF2A 3BAKA 3VKAA 2E6FA 1UP2A 4U5KA 1YX1A 3BL3A 4UR7A 2E68A 4FF5A 4FOUA 4UQ9A 1RXOB 4FPSA 3VIKA 1LUCB 4JQ1A 1PKYA 3SCNA 5BROA 1X39A 3SY1A 1HJQA 4GNVA 1LOSA 3C3NA 3AAMA 3E1F1 3BARA 4W8BA 4MDOA 4U4MA 2J7GA 2B7OA 2QCMA 3CS2A 1JZ8A 1Z48A 1T0OA 2ACQA 5AC7A 3EDJA 3T42A 1CGUA 1PAMA 1I9CB 2W91A 5C2XA 1RH9A 1IYXA 3B3DA 1SW3A 4ZA0A 1W1YA 3H24A 3S1GA 3W29A 5FKYA 2ATMA 1VKFA 1ICQA 4WOZA 4K8HA 1NDAA 3LYEA 4GJIA 2J66A 4NJGA 5K9DA 3WH6A 1R3SA 4X22A 1UQZA 4FLRA 3NDZA 2ZKMX 4FZIA 1W9VA 4RZ6A 4B5WA 4HMDA 4MYXA 2ZUTA 2HBXA 1X8CA 3KFTA 4AD4A 3QOMA 3L4YA 4S3EA 2PDFA 3ZT7A 3LB8A 1BG9A 2PWEA 1T8QA 3N4AA 1DJHA 2ZDSA 1PV8A 2E5CA 3EDKA 4GO8A 4B9ZA 4GXMA 3TTOA 4TVWA 3GSMA 3GY1A 3LCIA 1Z8AA 3RR4A 2EQ6A 2POZA 5U7SA 2QAFA 3TMLA 1C29A 5LIYX 5LXEA 1KCKA 4LVDA 2J9ZA 5ECVA 3UZZA 1TJPA 2PDHA 5FSEC 4CD4A 3GBDA 3F5KA 3KLJA 3B0PA 2DJLA 3U2CA 1E15A 2FZMA 2PP1A 1P48A 4W88A 3DI1A 2OZ3A 4GQ0A 6PTDA 1NARA 4JOMA 5CC5A 3NA8A 3WQ6A 3I3BA 3W7GA 4L6OA 3DYPA 4DYJA 3GU1A 1VDVA 4WJ8A 1W5PA 2NVKX 4TV6A 4XSMA 3BXWA 4XUYA 2BY1A 2AAMA 3AS1A 3QFBA 3DHFA 4YLWA 5H6HA 3TXVA 1E72M 4MPKA 3QR0A 3R5EA 3AS0A 3NGJA 2PD5A 3G0UA 3MKVA 5I2UA 2WPEA 2EG8A 1MNZA 3UVIA 4E8DA 1FEAA 1XYCA 4L1GA 2XIIA 3W3OA 1T41A 5HNUA 1DJGA 3DK9A 3WK2A 5I7GA 1UH2A 1BVNP 1VQTA 4W8AA 3EDEA 4RNHA 2HVMA 3OJGA 4W7UA 3ZJ7A 3DDMA 2RDWA 5REQA 3DFOA 1OT2A 3SUTA 2R82A 3WH8A 2QMKA 4U2YA 3LLXA 4L5ZA 5CZKA 5DXXA 4MAZA 1JYWA 3HRDC 1K1DA 1FFUC 3EXTA 2DW6A 4QE5A 5A8MA 1QI3A 1PXGA 1Q13A 3IEBA 5A2CA 3NDOA 3PJWA 3LNMA 3C56A 3LCWA 3UYCA 5ABHA 1QR7A 5KZMA 4C6QA 1YTKA 3POHA 1XYMA 1HZYA 1ISZA 1ONRA 1OZQA 3WJWA 3DG7A 2Y0FA 3FOKA 1PZ1A 1ECEA 2XSBA 3I7QA 5CZSA 4CNSA 4O1FA 1G69A 1B5TA 3ZFHA 5LHFA 4CQBA 1XH0A 1A49A 5FCZA 1SO5A 3LHUA 2REQB 3L5AA 4H7VA 1EZWA 1V77A 3C8FA 3WUFA 1J11A 1HJVA 3I6EA 1XDLA 4AWEA 2I5IA 1OIMA 4ZEPA 3UZJA 2JIWA 3MPGA 1JD9A 3GD3A 4UOZA 3WF0A 2Y2WA 4Y9PA 5HK4A 1HN1A 2NVAA 2BC0A 2E7FA 5CZJA 1H1NA 3S6OA 3IJQA 3SRDA 1O95A 2A3EA 1BPLB 1XIGA 1XLLA 4W5ZA 3MI2A 2V6AA 3ITXA 2O9TA 2V5LA 3G77A 4MB4A 3H55A 3OLDA 4WVXA 4TVCA 2BXVA 4H9VA 4M6VA 2WHMA 3ARVA 3S5YA 2X7WA 1OCQA 3I3DA 1WDSA 5EB8A 3RFAA 3T08A 2WB5A 1JDFA 1OFEA 1JI1A 1W3LA 3LBCA 1HUVA 1FFQA 1U5VA 2DZVA 7ENLA 3A12A 4WR3A 4N02A 1Q8JA 3A7UA 1RZMA 2ZRYA 3ZYZA 2C79A 1TG7A 4CCEA 1W9DM 2J47A 1IIHA 4H4RA 3SY5A 1XLFA 3WNOA 1LT8A 3PG6A 1QT1A 1OG6A 1DQWA 4M5PA 4Q4MA 3VDHA 3AIUA 2A2IA 1FUYA 1W54A 2Y8KA 4H3DA 4YTTA 1W1TA 1OYAA 1E1EA 1TZ9A 3B4YA 4UFKA 2Z28A 2A7NA 1WNOA 2HVOA 1ZS2A 3ZSSA 4US5A 1FWRA 2CFFA 3PZTA 1XC6A 4L1WA 4V28A 3A4WA 4E38A 2VVSA 3BURA 3CPUA 1AG1O 1TJ0A 4X2PA 5JXQA 4GZ7A 2GOKA 1PIIA 2FHCA 1Q1RA 3WH5A 3WQWA 3NQ7A 1UCWA 3OG2A 4H8VA 5EBAA 1WYGA 1VBJA 2PDCA 1SZGA 3TWAA 3TU9A 2Z2BA 2AOSA 3GNOA 4B3KA 5AKQA 1MW2A 1V0LA 4PMYA 1Q5MA 1C8VA 4GRTA 2GJXA 3VA8A 4A6GA 4R9OA 3IJDA 1O60A 3CWNA 4JTQA 1KM6A 4OQVA 4YIWA 1Q2RA 4UXDA 2OEJA 5M03A 1XJBA 3SIMA 2J27A 4KPRA 1YBQA 4LALA 3CUFA 1FWWA 4YYFA 5M1TA 1QU4A 2HNEA 4AD2A 4B3ZA 3NQ6A 4CNUA 2XISA 1RM6B 4JQ2A 3O2LA 4LS1A 3T1GA 1Z41A 9XIMA 2ZTJA 1KQZA 2YZ5A 1KRAC 5MF5A 4D6HA 2PPGA 2ZA2A 4AZ5A 5CJ5A 1GREA 1JFXA 5KZEA 4Q7BA 5C9ZA 1LWHA 3LHWA 3VK5A 1JZ5A 5E70A 5CPNA 1U1JA 3UXKA 4O52A 3QFEA 3LPOA 4ICMA 1J0IA 2X99A 1CCWB 4Q4RA 4ZO6A 1ONXA 3EA1A 2X8GA 1V02E 3CYJA 1AW1A 2BVDA 4LUTB 1OINA 4PTVA 3KL3A 4GYJA 3OQEA 1EPXA 1VCFA 2D0GA 5B80A 3VKCA 1CXEA 1T3QC 5AHFA 5DX7A 3CHFA 4QGCA 3ARYA 5FAGA 2OO6A 1FVPA 3AHXA 2E25A 4I3GA 5EFDA 4EIVA 3DC8A 1RP8A 3PWGA 3AXKA 3BGGA 1TSIA 4ZODA 4HA1A 1EJSC 4UIOA 1VFLA 1XLEA 2ZOXA 2P88A 4XV0A 1A3XA 1PTAA 2WBGA 2IKIA 3CHDA 3AMGA 3T78A 1Q7QA 3MYOA 4P7LA 4U28A 5AYYA 4PMJA 4BURA 2E3ZA 1XD0A 1W1ZA 3WIJA 5FD0A 4B5UA 4Z2GA 4IX0A 4C6PA 4D8ZA 1LUCA 3WQVA 1Z7AA 3IANA 4KKXA 1LOLA 1FCVA 3BCDA 3F2DA 4I9TA 1RJRA 3VOFA 5D2VA 3N73A 2HVNA 3AUJA 1UR4A 3B8DA 4IUOA 1CX9A 4AZGA 4DNHA 4GYPC 4HNCA 2VZVA 3P81A 1LYXA 1YIXA 3STEA 2OEMA 3WLRA 1XKYA 4GKTA 1B30A 3CZGA 2QV4A 4QNEA 1PSCA 1HTIA 1PYMA 1XM3A 2OWCA 4IH3A 1ALDA 3GXFA 5AHLA 4C5YA 2YLLA 1RCQA 2F2KA 1V3KA 3SAZA 1LROA 4O8RA 5D4YA 1A0EA 2YAUA 1PCKA 2F7FA 3EEZA 1V08A 1GOXA 1DQXA 3AXHA 1CGWA 3IVUA 4M6QA 4PE8A 1NP2A 2DT2A 3PPHA 4WXZA 3DG3A 4Y7EA 1Q6GA 3W1UA 1TJ1A 4Q8PA 1N8WA 3WMCA 5K9CA 4E4FA 2X8RA 3NL5A 3OP2A 4DY1A 2VOTA 4X9SA 2GVGA 1HKMA 2XN1A 3ANVA 2WPCA 1GZJA 4LYPA 1LLOA 2X41A 1SO4A 1L9WA 3GTFA 1MEWA 3TC7A 4HSOA 1XV8A 1GRHA 3BICA 2C16A 3U4AA 3HG3A 4OE7A 1WPCA 2V3BA 4UBPC 3NZQA 4Y96A 2QV5A 3SCSA 1NDYA 5I07A 4KWVA 4JIHA 1DL3A 2MUCA 3EOEA 1XBVA 4GGHA 3ARZA 4PTNA 3UJRA 4RPPA 3TNOA 4G1KA 4Q4OA 3NOEA 1UD8A 3UNTA 1KC7A 1C92A 3RU6A 3GIPA 2DSWA 2I1OA 4IL0A 5AYXA 4Q8VA 3V18A 1BSIA 4N6EA 3PJUA 4GJJA 1XICA 1TVLA 2PRHA 3E5BA 1YHTA 1AQHA 3DKJA 3TZFA 3RM4A 3AO0A 3MA8A 4AMCA 3EOOA 1LM1A 1JCMP 1FY6A 1OBAA 3QGKC 4EX4A 5ABFA 4O12A 1LCOA 3HQ1A 1KXVA 4L9XA 5CGTA 3RCMA 2YQUA 2Q8LA 2G5WA 7A3HA 2VFDA 2OXNA 4DUWA 3B9DA 4D6CA 4WD0A 1QHPA 1LP6A 2NX9A 2QZRA 3STCA 3FFSA 2RDUA 3SECA 1H0IA 1W3NA 2WCAA 3SCOA 1AD1A 2W3RA 1E73M 1VBUA 3MWAA 1H7XA 3BGAA 2ZX8A 1S5VA 4NAFB 3O7UA 2YGYA 1EC9A 3T7VA 4K3ZA 4PZVA 3PBWA 3APYA 5GNYA 2G3FA 3P8IA 4MHBA 1Q45A 4CVUA 3I7RA 3AXIA 4TX6A 4MF4A 5BMXA 2OWWA 3MI6A 4FEZA 1TRDA 1MWOA 1QDSA 3LXAA 4L6HA 1FP9A 1KGXA 4FLSA 1IV8A 2VUYA 3GH4A 1A5LC 4LNCA 4QE1A 3TTQA 1P7TA 4AC1X 3EAUA 3JRKA 4MJ4A 4YS1A 5HULA 4DF0A 5IFTA 1SSGA 3RX3A 1YDOA 1EKOA 1D8WA 2E6AA 3MI3A 3EMZA 4JD4A 3GVQA 1SMDA 3FEQA 1B1YA 2WKGA 3U3HA 4GRSA 2VM8A 3MHUA 2GVJA 4H00A 5I3JA 3GDBA 1E5JA 3WLHA 3NXFA 3L66A 3S2JA 2O9RA 5PTDA 5CBIA 2XVGA 1XXXA 2Y8VA 1B31A 1U1HA 2ON3A 3VTRA 4E3TA 4EOUA 2FFIA 3MUIA 4M0XA 3JU2A 1H7PA 2DT1A 4F2BA 4ZTXA 3GNRA 2AMGA 3PZ9A 3CJPA 4QG6A 1L6GA 3GXIA 4JTDA 3TA6A 2D22A 2QCFA 4PULA 1MSSA 1RK5A 3FCPA 3NL2A 3UXDA 1KTCA 1XCWA 1A5UA 5HQLA 3THCA 1JI2A 4MG4A 5CJNA 2Y89A 2YA2A 4KCUA 2V3GA 3RPTA 1XH1A 3RIKA 4OOUA 3SCUA 1A4LA 3KVMA 1XYAA 3OW1A 3MSYA 3N29A 1J5TA 2EXOA 4AEFA 1S1RA 1MRQA 4OV4A 4UFHA 3H7UA 2PMQA 4ADUA 3RHGA 5BMWA 3WQ5A 3RAOA 4S1FA 1NH6A 1F7BA 4LEFA 3ONCA 4JTLA 3WFLA 3I6TA 3EX4A 2YL5A 3HB9A 3R8RA 4NKCA 3ZWSA 3GO2A 3AZRA 3P0XA 1UR0A 1ISWA 3VNJA 2JFEX 4TU1A 1NF0A 3W85A 2VEKA 1GW1A 3AFBA 4PBFA 4KS0A 3PNZA 4LAUA 1XIDA 2O9PA 3JR2A 3HV8A 8RUCA 3OLEA 1S5TA 3KVJA 2W92A 4Z0SA 3AHTA 4RZBA 4WSKA 2PSNA 5DBUA 1A5NC 2PDJA 4B15A 4BR1A 4C6CA 3LERA 4H83A 4J3VA 1K6WA 3CLWA 3ZM8A 3FJLA 4GZEA 3KCOA 1QRQA 1TVPA 4W87A 1XX1A 3H2FA 1DORA 4F66A 3I10A 4DAIA 3KWXA 4EPDC 5D38A 3LB0A 4GBDA 2HXTA 4WSHA 1NDVA 4WCJA 1KM5A 5I79A 3RLGA 1QVBA 4JTFA 1TCDA 1WDWA 4B91A 3FA3A 3W2LA 1J5SA 4JFVA 2Y5SA 1FWJC 3AS3A 1D7FA 2X0HA 2D23A 2X42A 3N3MA 3CTTA 4BKNA 4WJXA 2F6KA 5LA0A 3CMJA 4LUTA 3QOKA 4J3WA 3UXAA 2GR2A 4NRRA 4N2YA 1TKKA 3GYEA 2GJNA 4ZO8A 1NQKA 1D7YA 2G95A 2PDKA 1UD5A 4LA1A 3QH2A 3BAYA 5C71A 4HU3A 1F07A 2NUWA 4MFDA 1ONEA 2WHKA 4NF7A 2NX3A 4HBKA 1ZKQA 1GOMA 3L4UA 4DVOA 2V6OA 3E2SA 5HMFA 2ZICA 2VEFA 2Z25A 3IK4A 2QGYA 4KWUA 3L4TA 2GK1B 1HL2A 2YL9A 4GCAA 1YW1A 2H90A 2FPVA 2GDQA 3W7NA 4AX6A 1MEIA 2B81A 3N9SA 1MW0A 5CSYA 4LVBA 3MBDA 3H8AA 2HRWA 3K1DA 1J10A 5EMJA 4B9YA 3NXLA 3PF3A 3UG3A 2YPIA 3FLUA 3UR7A 3KRZA 4CD7A 3V0SA 2NQLA 3UZYA 5CPMA 1X98A 1DJZA 3ZLHA 3NQ8A 3TN5A 1NJJA 1K8XA 1OABA 4QP0A 1WE5A 4D6DA 1ZJIA 4JY9A 2CHOA 1JYXA 5KMYA 2V3EA 4DJFD 1BQCA 4D6JA 1HQTA 5A95A 7TAAA 1E9LA 4YCOA 1WX0A 1GW9A 2IS7A 1FEBA 4Q4QA 3RX4A 2KZHA 1BGGA 1V03A 4N9CA 1IXOA 4GXPA 4CN1A 1UUQA 4EMWA 2ZZ6A 1A3HA 1VYSX 1CW2A 4RDZA 1OF6A 2PDMA 1SO3A 1XLKA 4H4VA 3W2MA 2BC1A 5M3WA 1YNPA 2INZA 2DIEA 1HKWA 2H8XA 5I24A 3VINA 2YW4A 4AYGA 2PDWA 4FIQA 2CHNA 3V7PA 3M46A 4POCA 1XIIA 3CGBA 2DZXA 1R3RA 4C6MA 1XH2A 1UP0A 2X7VA 2C15A 4PCFA 1V93A 3EOLA 3L65A 3HIJA 3WENA 3WUEA 3WJXA 1UMLA 1LRNA 4E2DA 1BYAA 2GDVA 2GDUA 3QY6A 3RM9A 4ERAA 1AFSA 3UU0A 3SGGA 3QLLA 1A80A 5EY5A 5H91A 2CZ5A 3MDUA 1H0GA 4ADWA 1OX4B 1EJRC 3B0YA 2ZVIA 4NXSA 4WKFA 1R3YA 3NEHA 1NWUA 1F6KA 5I6SA 1GJPA 2VKZG 1US3A 1CECA 5GNZA 1WB0A 2IQDA 3MVIA 5G5IA 4GUGA 4O19A 2ADAA 3W6MA 2NSOA 2OSWA 3BO9A 1QNRA 3S1UA 2GGGA 2WC7A 4FOJA 5LNWA 4PL2A 3S4TA 1NOUA 1H41A 2WZMA 3LCXA 1UR8A 4AG0A 2PTDA 1V4YA 4M6UA 3O07A 1IEIA 2WNQA 1FCUA 1H4PA 3PTQA 2GJPA 5HJYA 1O5KA 1IEXA 2DH3A 4PUNA 2VO5A 4JTTA 2TPRA 3BOFA 1L2QA 2VX7A 1SFJA 2ISDA 7REQA 3BOLA 2IXUA 4IIBA 5CAKA 2EG6A 2CLMA 4JNMA 2WAGA 3LENA 1OQFA 2W54A 3QXBA 1LTDA 4UMBA 3H21A 3B03A 3H53A 5JMUA 3TKFA 4JX5A 3QTGA 2VR5A 4TVDA 4O14A 3CGDA 3LTPA 4BF5A 2WP6A 2FVMA 3DFNA 1OB0A 4IMGA 4D9PA 4NASA 1EBDA 1U33A 3VXGA 4H01A 4FNUA 1VQZA 4DWSD 3RRAA 4IIEA 3TWBA 2LLEA 1OFRA 4AHOA 1XBXA 1V97A 4JR5A 2VGFA 3ARWA 4K8EA 1RQHA 3A21A 2C1GA 3DFQA 5HANA 2ACUA 1X6NA 2VDHA 1EJTC 4EXBA 1KXTA 1TTIA 2NXGA 3LBOA 5C2GA 2GOUA 4NAFA 2PBOA 4PRWA 4ADTA 3VNZA 3W6LA 3K5XA 1STZA 4R53A 1JAEA 3KDNA 1I1WA 4PCSA 1UD3A 2WYSA 3WELA 5LNRA 2IW0A 4EXAA 4NAEB 1TZZA 1XQLA 5D9PA 1J6PA 1GGOA 2POTA 1B4KA 4FX8A 1EO5A 1WQ5A 4A3HA 1W1VA 3BTNA 4XAGA 4C6FA 2BY2A 3GNNA 1OCBA 4QX4A 4GFIA 1UKOA 2H6RA 2ZUVA 3WL0A 1NELA 4FX9A 1BF2A 4HPJA 4WIWA 3BLLA 3TCSA 3IJ7A 3RO8A 4YPJA 1GOWA 1J4EA 3WMSA 4XVEA 1UD2A 2XWDA 2VENA 3KDOA 4O0ZA 4NZFA 4GQQA 1EB3A 1GYMA 1TPB1 3UG4A 1B3OA 3W7PA 4AAJA 5EL1A 3UY7A 1WKDA 2YVJA 1G0CA 4FB7A 3S8HA 3FX4A 4RZ4A 4JTCA 3OYXA 3EA2A 1JXKA 2CW6A 1QK0A 1SO6A 5CG0A 4J35A 1OY0A 2ZE3A 4QBXA 4A4AA 4HOWA 4AY1A 1LL6A 4P8WA 4IICA 4XVDA 1ZJHA 4NG3A 3PZQA 3U4FA 1Z32X 4GK8A 3EWUA 3AROA 4IPNB 2ZWYA 5F1UA 3QQ0A 4F0MA 3CC1A 1V0KA 4RDVA 2EKGA 4KPLA 1KLZA 3AISA 1NIUA 3CQ0A 5I06A 1YLVA 5HATA 1LORA 2ZRXA 3LZ5A 3B8WA 3AMDA 2MNRA 2PUZA 4DI9A 4F2UA 3S1VA 3N4EA 1WP6A 4JX6A 1QNVA 3H2AA 1UR1A 1B4EA 1R5YA 2QDDA 4J3UA 4ZL1A 2OZ0A 1VGAA 2JKAA 1NP0A 1XRFA 4XBJA 3TCEA 4BHYA 4I9JA 1XIFA 4UTLA 6TIMA 3UG8A 2WK2A 1LG2A 3E5PA 4S2BA 4PYSA 1LQ2A 2OLHA 5CPTA 2FGBA 4KERA 1JDCA 2YBTA 3UG5A 1QBAA 2W0HA 1JRCA 4BY3A 2GUUA 1BTCA 3LTYA 3P60A 1OZMA 1YYAA 2WLYA 2V3AA 3HJZA 1GOQA 2VEPA 2QXWA 3IRDA 2NUXA 3WEMA 4P2VA 2XH0A 5AHIA 4TMBA 5KITA 2VC9A 3MV01 2OODA 1KFCA 3KEHA 5A6KA 5HQEA 3IPWA 2VC6A 3AN1A 4IJRA 5CBJA 3LBMA 1POJA 3TUUA 3GZ3A 2XFFA 2BNJA 3POCA 3WLLA 4ZZ9A 4DJFA 3AJ7A 1KWKA 2X8HA 1ENUA 4QSHA 3VNMA 2ZXBA 1PZ3A 1VBRA 2VVNA 3PAJA 3ZJ8A 1HX0A 2A6LA 2WQPA 3BAXA 2BZNA 3E3HA 2PC8A 1OYCA 2VR2A 3VDGA 3W7KA 3H26A 1XGEA 1PE1A 5I02A 3MCOA 1KO0A 2NPXA 3QSTA 4LANA 4F8XA 4MDPA 4LB3A 3LMZA 1H50A 1X7IA 1PIGA 4LJ3A 1EIBA 4TUFA 3R6IA 1GJUA 1YE6A 2XDFA 1CWYA 1QWGA 3HV9A 3BPWA 5FJJA 3H23A 4L4PA 4PC8A 2RAGA 1QI0A 4C6LA 3DFYA 2O55A 1OFPA 3Q45A 5DEZA 2XH2A 2YFNA 1VENA 3KCJA 1S5MA 3FA5A 1GRTA 4PL1A 4RZ5A 1YXCA 1VBHA 2DU2A 1DHPA 4LQ1A 1Q7ZA 2FPTA 1KWGA 1CTNA 2CZDA 2OT0A 3VNYA 1VD6A 1XC4A 2WC3A 3TMQA 4PBGA 1WA3A 5ABEA 2FIQA 3MHGA 1B2YA 1Q1WA 3ARXA 2V5JA 3NO5A 5BOOA 1N8IA 3BC9A 4U33A 4A21A 4B90A 3W70A 3NQAA 4AZ7A 4KCTA 4WDXA 3PTDA 4DX3A 2ALDA 2CIPA 2NQ5A 3TW9A 2F61A 1I2QA 4IPJA 4LUJA 1OK4A 1AD4A 1WCGA 1G01A 1XBZA 3F4WA 5EMUA 3IVTA 3NQ2A 3R7MA 4OTKA 4ZQNA 2A3CA 2EQDA 1TPEA 3RUBL 3WNKA 1XG4A 3W82A 1OFQA 1P1XA 3FDKA 4NP7A 1ZNNA 5MKGB 1AJZA 4S3AA 4LY8A 4NJHA 4MUPA 1TYPA 4APNA 1SB3B 1NEYA 2F2HA 1BKHA 4O13A 4FF7A 3ZWTA 2IPWA 5F2MA 2UY5A 2E6YA 5B7YA 3LK6A 4AD0A 3QHOA 4AIUA 3Q6JA 4K6AA 3T2OA 3SN1A 2VQTA 5A6TC 3MY9A 3E0FA 2BVYA 3LCGA 5I3DA 2E8YA 3MBFA 1UJQA 3U7VA 3P80A 2HROA 1UIPA 1OX4A 2ZUMA 3W6YA 1H63A 5AOUA 3WLNA 1UWAA 3VFCA 4IMEA 1V3JA 2QJIA 5KVIA 4HOXA 1MUMA 3PFRA 4HCLA 3QSRA 5D09A 1TUXA 4KESA 4I7VA 4LV9A 4GYPA 3WQEA 5JCIA 3RGTA 5AN7A 1WZAA 1N5XA 2XZ9A 1XPGA 1RAKA 3M0JA 4ZR8A 2CLLA 3QGAC 4D1IA 3OA3A 1OEPA 1E4NA 2OLSA 4IXXA 4LUYA 3W7MA 3B8VA 5LZLA 3THQA 4EACA 2FDSA 1PL9A 3KBNA 4FO4A 4MWAE 1FWGC 2VGIA 4I5UA 8XIMA 1E9IA 2PGRA 1KRMA 3BG9A 4LX4A 1OYBA 2E6DA 2J6VA 3C6CA 1UB3A 3ARSA 5A5WA 4ENLA 3NQEA 3AC0A 1VJIA 4M51A 3L4XA 4H6QA 4LB4A 4MB3A 1SFTA 4JEJA 3F7JA 3LHZA 1I45A 4ZXLA 4NEWA 4HNOA 4V1YA 4UCFA 1GQNA 2CWNA 3W25A 1N61C 2XHYA 4XSLA 1TR1A 4QJ3B 5CJMA 4XAZA 2FHBA 5LIXX 2WC4A 1B57A 3AU6A 3NM1A 4B2DD 3P67A 5GVJA 2FYMA 1CLVA 3CGCA 3GR8A 3S6DA 2RJHA 1PIFA 1AW5A 1R2RA 4YYCA 3CUIA 1XHCA 2Y5EA 2FTYA 1LQAA 4FOKA 2RUSA 1EP2A 5BWAA 5A94A 3M41A 1EZ2A 1PCWA 2E5DA 1MFUA 3CB8A 1NPXA 3GDTA 1EIXA 4XX6A 3FW6A 4OOZA 2TAAA 4NAEA 1TYTA 3W83A 1Y7VA 1ISVA 1YPXA 1LWJA 1RY8A 4X0NA 1EOMA 3WLQA 2EPLX 3ZR4A 4KEVA 1OFDA 4LAMA 1H7WA 1NM9A 4CD5A 1V6UA 4TV5A 2WP5A 4C5ZA 1KBJA 5F2IA 3KOXA 3R89A 3MP3A 2O0TA 2TSYA 2VDIA 3SUVA 1JRBA 5FJOA 4C90A 5FF7A 5I3FA 3ZJKA 5HUPA 3U2EA 2PI6A 2XGZA 3MB9A 3PJXA 2XIQA 2PDNA 4LIIA 4E8CA 3TYDA 1EDGA 3W27A 1T6MA 3PZMA 9RUBA 1KKRA 4PMVA 3T8QA 2AQVA 4P8XA 2NWSA 3NZGA 3ABXA 3TAOA 4L4LA 4M56A 4S3CA 2C3CA 6TAAA 2YX0A 4ICNA 3QHMA 3T44A 2V2CA 1EQCA 3F2CA 3BW4A 4PUDA 3G22A 3D9XA 3GX9A 3ZQ9A 4GABA 3M5VA 5JBDA 4DUOA 1R3WA 3PBVA 1QCWA 1OFOA 4H8HA 4FS9A 4V27A 4H9XA 4WLCA 4Y9AA 2J8GA 3S47A 1AJ2A 4RCXA 3AOFA 2DV0A 4UTTA 4H9TA 4LCRA 2FZBA 3SY8A 1QNOA 3EB2A 2JE8A 2DDXA 2FMOA 3M5ZA 3R0DA 1C3FA 1UIOA 4C65A 1U30A 3WF2A 1W3JA 1OADA 5T26A 1LDCA 1R7AA 3G0SA 3VX0A 4KCVA 3VM7A 4GVHA 1MI3A 2B7QA 3GWQA 4R27A 5G4EA 3WBEA 2Y7FA 3B97A 3RX2A 1F4HA 2GUBA 4PEEA 2HE5A 4I8DA 3VDCA 3P74A 2YDAA 4FXSA 2XIMA 4K7ZA 4FXRA 2YA0A 1ZBVA 4QISA 2QJGA 4H9MA 2ZRVA 3MUCA 1YTEA 1FOBA 3K2GA 5E1QA 5TIMA 3RPDA 4KGJA 4QEEA 4F0SA 3KBWA 3NNTA 3CAQA 3A5VA 3LLDA 1AA1B 2HJPA 3DHDA 1AH3A 2FJKA 1W3HA 3AICA 1B90A 4NNCA 2ZRWA 4NJIA 5AYBA 3EPMA 1IR2A 2GFTA 3CO4A 3VOHA 1WYIA 3M5XA 1BXCA 1D3GA 3C61A 2BP1A 2CLIA 3BSMA 1RUSA 1BGAA 1GVYA 4WF7A 4AFYA 2ESCA 1DXEA 2PC4A 1LVLA 2ZUSA 5LIWX 2FB2A 4PFMA 5HA7A 2VZTA 2C14A 1CPUA 2WMIB 5LGXA 2IKJA 4A35A 2C13A 3GC5A 1EF3A 4DZHA 1HG3A 2AGKA 1LL4A 3WYZA 1B3XA 3G3DA 3BLDA 1Q4NX 3STGA 1ONFA 1BHGA 3QN3A 4GI6A 2GSJA 2JF7A 2XM2A 3H4XA 1F8MA 4CQCA 5A1AA 1EJXC 3CMFA 4MM1A 2JQXA 2ZUUA 4FNRA 3QC0A 4JFWA 4M81A 3O1NA 1OF8A 1V3IA 1X38A 3ARPA 3ISIX 3AXXA 5HNRA 1SVDA 2GSEA 1OGBA 4UOJA 4NZ5A 3F4DA 3SFKA 1I1XA 1J18A 4V1XA 1IWPA 1FWHC 3E12A 3QPZA 5D33A 1ZCCA 2FZNA 2VWTA 1LWIA 1SMAA 1CXIA 3PBGA 1UG6A 2Q8XA 2VRKA 1NOFA 4ZQOA 3C2OA 2P1FA 4GH3A 3M43A 4REQB 1X2GA 3W1LA 4ZOHB 1GTEA 3OBAA 5CEWA 4NU7A 2PDGA 1MUCA 1XR2A 1CENA 2CBUA 1A0CA 1HP4A 2QDEA 1FHDA 1FKXA 3CZJA 3KHDA 2F5ZA 4QAWA 4RW3A 3SEPA 2J4GA 4F79A 2G3JA 3UETA 3WK1A 2PFHA 3EWXA 3WLIA 2PWUA 4GD0A 1X6LA 3BZJA 3W7IA 3AIBA 4UTWA 4CEXC 3BGJA 3MZ2A 3NQCA 3UVAA 3LCFA 2FDMA 3KVKA 1XFBA 4IGHA 3NVVB 3M9YA 3B8SA 5GNXA 5G5GB 1Q8AA 3AZTA 1G4PA 2WPBA 3KCLA 1JJKA 3QMTA 1BWCA 3N15A 3M0KA 1ZMDA 3AZSA 1W91A 3OEXA 1O12A 1CEOA 3VKDA 1G1YA 2R1PA 3EWYA 5MKGA 4JYFA 5I3IA 2F6UA 5H8PA 4L64A 1HVXA 3NZRA 1I0DA 4JNZA 2A85A 4EXQA 8A3HA 4QCFA 3IIZA 4XIMA 3LXCA 1VJZA 3M0IA 4GOAA 4UFJA 4HNTA 3U0HA 1UOKA 3PZOA 4CD6A 1BWVA 2CESA 4GYKA 5DT5A 1H62A 1QI5A 2DUZA 2X0SA 3J7HA 2ZRZA 3WD0A 4Y8FA 1BWKA 3SN0A 1IWBA 1GK8A 1R2SA 2V3DA 3E0LA 1MDLA 4AMAA 4PMUA 2DVTA 4ZSUA 4BS0A 6CGTA 3BAJA 4DBSA 4AHQA 2X1UA 5JCKA 3FN9A 3OGRA 1LG1A 4GC4A 4I5RA 4D6GA 1GVFA 3TR9A 4DBUA 4LS2A 1ZAJA 3VGGA 3L5OA 3TJXA 2WVVB 1BTMA 4HSNA 3HG4A 3LZ3A 3M4HA 5G1TA 4H4UA 4XD3A 2WV8A 4JL1A 2HBVA 1YDNA 1D8CA 3PS7A 1S5WA 4Z2JA 4UQBA 2VFFA 1AQMA 2ZZ0A 3RMJA 1KRBC 2QMJA 4NSBA 2R9ZA 3WQCA 4RJEA 5CQ1A 3O06A 4YWSA 3CASA 4ZOBA 3CUXA 3I65A 4UFLA 2JF6A 3KLKA 1A5SA 1EEXA 1E1CB 2WSQA 1WKYA 5EBKA 1TPVA 1AOGA 4PBEA 3TDFA 1UKSA 3UWUA 3GXMA 3R11A 4L65A 3DKLA 4CU7A 1FH7A 3P82A 3MO4A 4RNJA 4DEFA 4NI8A 3K8KA 1M01A 3MMDA 3PB2A 5C9RA 4GY7A 2P10A 3R10A 5TR3A 1WBHA 3GM8A 3URHA 3VZYA 3TQPA 2V69A 4LW7A 4URIA 4H4TA 1RJQA 1NDZA 4JDYA 4X3ZA 3Q2DA 2NQJA 3MP4A 4YJ5A 3RXZA 5FESA 3N04A 4Z2LA 3PG9A 4CD8A 4YVXA 2XYLA 3S2NA 3H2NA 2VEIA 2OSXA 2YXXA 2I9EA 2UY4A 5BYWA 4AXNA 5DRIA 4I7UA 4FSAA 2WM0A 1C90A 3GXPA 1W56A 1XLBA 2Z29A 4RNIA 4JCLA 3UCDA 3SGZA 2R24A 4AXKA 2WXDM 1ZBWA 4X63A 3IVSA 1NWTA 1CLKA 3VILA 1E6QM 3H4KA 2A7RA 1SU5A 4I9MA 1NU5A 3N6HA 1BVWA 4EQSA 4HJFA 3I68A 1PEZA 1KTBA 3GW3A 5XIAA 3QF0A 1ZTVA 1TA3B 4IISA 4EMJA 5TF0A 1C8YA 2ZUWA 3CXOA 5EYWA 3FG2P 1Z42A 1BVZA 3FGCA 2Y4SA 2NXIA 4Q33A 3OPSA 3ALFA 2QCNA 4AWSA 2FQIA 3H7VA 1VYRA 1Y65A 3GQYA 3TOPA 2AL2B 1J01A 4TX8A 4WHBA 1EH9A 1OJXA 1D3HA 1QPRA 3OOQA 4M82A 1J12A 5GQBA 4AZCB 4QIUA 1G6CA 4QSFA 1AODA 3WK0A 1E4MM 4Y9MA 2QUVA 1J0HA 5G1MA 3A5FA 5BU6A 5FAJA 4DM1A 4MB1A 5BRQA 2W62A 4NNBA 2YSWA 3MYPA 3F2BA 4C1NB 3TZNA 3A23A 1QMLA 3IIVA 4LC6A 5AC8A 3OODA 2D0FA 5AC4A 3BJTA 5FS9A 1WDRA 2CHRA 2ZXQA 1XQKA 5I09A 4US6A 4GKLA 2AKMA 5M5DA 5CSUA 1ZBCA 1F6YA 3T07A 3S46A 2PCQA 5U1OA 1V3MA 2WJEA 4LF1A 1SPQA 2Z1XA 3WQPA 4IOTA 2RJGA 1TV8A 2ACSA 4EPEC 4HN4A 4YWOA 3OG3A 5HWJA 4Y90A 4O15A 2X1SA 2XU2A 3NZ1A 3URBA 3ITOA 2QVNA 2PTWA 3MMUA 3IC9A 4IFKB 2J7FA 4GG9A 2BMBA 4ECLA 4Z17A 3DK4A 1EYWA 4WOQA 5D8ZA 4OHQA 3LUTA 5LIUX 3ARQA 3N2OA 2EAWA 4CN4A 5G2WA 3FA4A 2O4MA 2QJJA 5DF0A 3TFXA 1LLZA 2BHUA 2W63A 4ZB5A 3WDQA 3E74A 3NTYA 2ISVA 4RW5A 4ATWA 3VGBA 2P50A 2FLIA 2ZA1A 4H41A 4MWAC 2GR1A 3VCRA 1G5AA 2D1ZA 1CB7B 3EWZA 1F05A 2GJRA 1U83A 3WK3A 2YYUA 2XVKA 3ABQA 1GEQA 4PGLA 2DZWA 3VIPA 4MUZA 3A9IA 3CHVA 2FHFA 4H6KA 4XKMA 4OBRA 4NYUA 2R8WA 3M0VA 1ZHAA 4K1GA 2HMCA 5E5CA 1TJRA 4W86A 3DHPA 1H51A 3LTSA 2B0MA 2WMIA 3W9ZA 1HL8A 3C2VA 3NPUA 3N11A 1ZQ5A 2WO5A 3CAKA 1F74A 6REQB 1R47A 3HU7A 1K9DA 3RF9A 3EDFA 4IWWA 4O1DA 2WJDA 1MRAA 3HF3A 4D6IA 1UPMB 5A6MA 3TJIA 2IMRA 3SZ8A 4C6JA 5BRPA 2GGIA 5KZDA 3M0YA 4J9JA 4DJEC 1KCZA 3R1ZA 3WUBA 3H2MA 2ZX6A 4EM3A 3E9AA 2BB0A 1QHOA 3CZ8A 5ECUA 4IG2A 1GKQA 1W9UA 3JS3A 4M6PA 4PMOA 5KEZA 4DZAA 1QOXA 3T8LA 2E77A 5U4NA 2QJNA 1BFNA 2VR4A 3GIQA 5CZTA 4AZHA 3CL7A 3S2LA 3UESA 3MVTA 1TZ7A 3BLPX 1VHCA 1KNWA 4REQA 1ZJBA 4GA8A 5BWFA 4XTIA 1M1BA 3NAVA 3CV6A 3QV6A 4XAFA 2GUYA 2J7CA 2V3FA 4NZ1A 1FP8A 4CKQA 4JHMA 1T96A 4EMIA 1NSJA 4KFPA 1F61A 2QIIA 1TV4A 3W81A 1XLIA 4QDPA 2QCHA 2UZ9A 3FSUA 4AVNA 1XRSA 4JTKA 1ZENA 2D2JA 4NI3A 3LCHA 1V0NA 3W07A 1K4GA 1LRTA 3P14A 1EXBA 1DIOA 4H8UA 3VGEA 5H8MA 1BXNA 4HCHA 2CERA 1G4SA 3BK0A 2PBGA 1AL8A 3G1YA 3QFAA 5I23A 1A50A 3NGFA 2V30A 4PMRA 1ML1A 3DN5A 5DBTA 3O05A 4Z1CA 4OT7A 3PNUA 3EDDA 4A2SA 3BQ6A 1FWDC 2EJAA 4WRHA 4N9DA 2WWCA 2QKFA 5J5DA 5DLCA 2RFGA 1GHRA 3PBUA 4DBWA 3H12A 1GVRA 1R0MA 3FDGA 2HNHA 1G67A 3BUVA 3UR2A 3ITCA 3DXIA 5AFDA 2IPGA 4DJDC 2VZOA 2VDGA 2VNCA 3HA1A 2E9BA 2CKRA 3UJEA 2BXZA 1DV7A 3LV5A 4LNYA 2DZAA 3V4BA 1CB2A 2QCLA 4GXWA 2WMFA 4GQGA 4HKPA 1W9XA 4MLJA 1N7KA 2B4GA 3L21A 3NL6A 3N1AA 3HJEA 1XISA 3DBPA 1A5BA 2OWXA 1ZBKA 3HURA 4ZE4A 3SDOA 1HKIA 1E55A 2V2DA 4EWND 3DFHA 3P0WA 3PUDA 3QEZA 3ID7A 5I78A 3CT2A 3GFXA 4ZFMA 1MQPA 3UPMA 3VD4A 1VFHA 4DIAA 3IJ9A 2DZTA 4Q4SA 5HWMA 4JDBA 4WKAA 1UKPA 1ECQA 5T9CE 4KRZA 6ENLA 3GVGA 3DGHA 4B16A 1RY0A 3BLKA 3EZ4A 5FIPA 3GG7A 5DCBA 2GRTA 3TSMA 3WBXA 4FIRA 4IM4A 2J7EA 2P0OA 1ADOA 2OVLA 3MJMA 4EANA 2ZXAA 3OYZA 4X60A 3UFYA 3DIPA 1UA7A 1E1CA 4LSBA 1AUSL 3UCCA 3CUJA 2PRLA 2WBKA 1N8FA 1EA0A 4JX4A 5BXTA 3W88A 4KWWA 4NQ1A 3TONA 2CFYA 2R1LA 1LBFA 1W8SA 2YCJA 2V68A 1WZLA 4ZB0A 1J8VA 2FGZA 3KUMA 4JQ9A 3GC2A 4TIMA 1DBTA 2DORA 1V6WA 3AYTA 3CQIA 5C6MA 2QR6A 3ENLA 1XDJA 4ALDA 3M0HA 3ATZA 4PTXA 3T4WA 3W75A 3WCZA 2DIJA 3ZOAA 2J8FA 4LS0A 4XTDA 2ZZ7A 1XF0A 1AH4A 3QZ6A 5CLWA 2EJ1A 1NF7A 1X97A 1L6SA 3SCWA 2VFGA 4C60A 4X9YA 3BLFA 4HNLA 5AB3A 4GZIA 3IJ6A 2WW5A 4MJZA 4YTRA 2CLFA 2HV5A 3WLTA 1HF6A 4J3XA 1RBOB 1RD5A 4IJCA 1VFSA 3CT7A 2BBFA 2WM1A 1FWAC 2UWFA 1TA3A 1GVEA 3P3BA 3SIZA 2C0HA 2GJLA 3M0XA 3T0AA 2YA1A 2B31A 1GHSA 5XINA 3S0CA 3HQPA 4IPIA 1T8XA 3CM4A 4O50A 4H2HA 3HM7A 4TXEA 3GK0A 2FTPA 3VNKA 1VCGA 1TUFA 1EDQA 5FJPA 3U2OA 5DRCA 3TTEA 2C19A 2Y24A 2WSPA 4ORMA 3WEZA 1D3CA 2AL2A 3EB3A 2H9AB 4J56A 1FTXA 3KM8A 3OVRA 5FL1A 4JTEA 2G37A 4AZCA 2X50A 3XISA 4HU0A 1Q65A 3HGRA 4AEEA 1VFTA 1PDYA 3DERA 4AY7A 4L7ZA 4DPPA 3RCNA 4MNKA 2DZUA 1XSJA 3U6WA 4KF1A 2QCEA 4H4YA 3AHYA 3W1TA 3PN8A 2CZFA 4MZYA 5AHMA 2VOMA 3U5YA 2RH9A 1NVMA 5DMMA 3ABOA 3CHCA 5TD4A 3LPGA 3QKZA 2X8CA 4I5XA 3NQDA 4F0HA 4D72A 2JK6A 1AVAA 1OC7A 5U25A 2JEPA 3DH7A 5CPSA 3ABZA 1GRBA 2Z7KA 5FEXA 3QYQA 2WNZA 1NY1A 4ZSTA 3RPMA 1UMYA 4C91A 3WQGA 3WX7A 2VHLA 3WD2A 2VRQA 4QNWA 4BK9A 3QJAA 1S39A 4DAFA 5KZ6A 4H9UA 2VJXA 3PC0A 3T4CA 5IDIA 4WKHA 1ME8A 3P2VA 4QCEA 3WDHA 3GNPA 1S2CA 5TNVA 5A69A 2JGQA 1KLYA 2XH4A 3GC4A 4G2DA 1W17A 3WG6A 1A5MC 3FYYA 3SCVA 2H3DA 1EBGA 1RD6A 2RGLA 2BV9A 3CNYA 3M5YA 2CLPA 4HK5A 2GQAA 4G7EA 1I2NA 4MPQA 3GTIA 4JPGA 4MJMA 4JKLA 5FA5A 3CQHA 4N7QA 3SUWA 2GVEA 3FAWA 4RE4A 3UXLA 2IQTA 4XZLX 4AIOA 4M8UA 2NV2A 3ES8A 4A8IA 4JIPA 3W01A 3ARTA 3UA3A 3PUOA 3OHIA 6REQA 5GJPA 1F3TA 3UT0A 3L4WA 3IWPA 1XINA 4A05A 4EF9A 1TE1A 2XN2A 2ZA3A 3W0KA 5LXXA 3IGXA 4Z2KA 2PWFA 4UB9A 4QE4A 4EQRA 3O6YX 1W3IA 3GNDA 2BVTA 4UQAA 3AMKA 2I5QA 1XIMA 2C6QA 2OYMA 2VL4A 2BOGX 1H49A 2WMHA 5A2AA 3FYPA 2A3LA 2NV1A 3W84A 5CGMA 1HNYA 1TELA 1K8CA 3NO3A 2G8ZA 4U5IA 4XQ6A 3AXMA 1QTWA 2EPKX 1KD0A 1TJ2A 3R0UA 1XLDA 4XKYB 4MWAB 5F4WA 3VOCA 2Z26A 1W31A 3KTSA 4MIMA 5AZ0A 1M6IA 2ZC1A 1HJSA 1ESWA 2ZZ2A 4HU4A 2J9XA 4UUIA 3GUWA 1CGVA 1Q2SA 2DJXA 1QAPA 3P5YA 3TX9A 2HS8A 4BWLC 1N63C 4FXFA 3IUIA 3TQKA 3TSBA 4DPQA 5D2TA 1WDDA 3G2GA 3INPA 1GVOA 1HJXA 2VYOA 1GKRA 1POKA 2XH7A 1QW8A 1KM3A 2X1RA 3B9JB 1KKOA 4P7RA 2UBPC 1JYVA 4AF0A 3EMCA 1MQQA 3PBYA 2P8BA 2WNWA 4IZGA 5K2ZA 4G6CA 1SJCA 2G96A 2RDTA 1S2AA 5C55A 1IT7A 1UZ1A 4AH7A 2QUUA 1RK6A 5I77A 4E5TA 3G6MA 4OU1A 2Z1KA 3A4JA 4JTUA 1V51A 5HMSA 4HZ7A 1DE5A 5HQMA 4LYKA 3KHJA 1NHQA 2ZUNA 4YCPA 5FEPA 3D3FA 4GACA 4DF1A 1XCXA 5G2HA 5D32A 1VIWA 3QV8A 1QI2A 1W1A1 4BQ5A 3SR6B 5J5RA 5E0KA 1YNYA 3SURA 3W2JA 3BZGA 4NEVA 2VMFA 4KETA 3Q65A 1OX6A 3M6YA 2C71A 4LVGA 1X2HA 2RGMA 4J3TA 1NHPA 3P7YA 3WQFA 5C7HA 4PA8A 2WKJA 1RVGA 3BAIA 4LVFA 3VD9A 2VWSA 1W6TA 1UWSA 3TA9A 1MFVA 1HJWA 2E4TA 2BXYA 1OK6A 5AVHA 3L0GA 4LRTA 1TPFA 3UBPC 4DZIA 4U10A 4QLLA 1G7UA 4AC7C 3VMPA 2G4FA 1W2VA 2EO7A 1S2UA 1ZB5A 3W38A 3W53A 3VUPA 2X2GA 4YU1A 4B5TA 4YHGA 2NT1A 1FWBC 1P4CA 3W1RA 2YJQA 1PTGA 2W5FA 2E28A 2XFRA 2XIOA 3AWNA 1M9HA 3GUGA 3QMRA 3BLIA 4JN8A 4LXFA 4QAIA 2BWGA 3GG8A 5T8GA 4XAYA 3VM5A 2PGFA 4GINA 3P8JA 5HUOA 3VIFA 4HZ8A 3OGSA 4AIBA 3VUSA 1XPYA 2E67A 2X05A 3VMOA 4CQDA 4LEQA 1JG9A 1I4NA 3JUGA 3C3UA 2P76A 1XGZA 2D24A 5HXMA 1UKTA 4K2SA 1K4HA</