3P93A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
403
structure length
384
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF D-MANNONATE DEHYDRATASE FROM CHROMOHALOBACTER SALEXIGENS complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 144
structure length 384
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3p93A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3p93A01
4ROPA 4M0XA 4Z17A 3JZUA 2QDEA 3FXGA 3CYJA 3D46A 3SBFA 3RRAA 3TJIA 2PTZA 3UCCA 2DW7A 2PA6A 4DX3A 3DIPA 3I4KA 2QDDA 4G8TA 1DTNA 4G7FA 1PDYA 2PP1A 3RGTA 2XH7A 3N6HA 3ZLGA 1EC7A 3H8AA 3OZMA 4KEMA 4E6MA 3OTRA 3VC5A 2I5QA 4M6UA 4HCHA 2P88A 2POZA 3UJEA 3SN0A 3ZVHA 3P0WA 3MWCA 1KKOA 3PWGA 3RITA 3STPA 4E5TA 4MGGA 1ONEA 3I6TA 3SSZA 4MKSA 3R0KA 2GGGA 3CXOA 4JN8A 1EBHA 2OPJA 4DXKA 4J3ZA 3OW1A 2PTXA 1MNSA 1ELSA 3VC6A 3VDGA 4IHCA 4GYPC 2PTWA 1KKRA 3N4EA 2OX4A 5FJOA 4HYRA 3DERA 2P3ZA 3V3WA 1XPYA 2CHRA 5FJRA 4H2HA 1R6WA 2OO6A 4DHGA 1P48A 1JCTA 2P0IA 4YWSA 2PMQA 3U9IA 3N6JA 4GFIA 5BOFA 3TQPA 4X2PA 1SJBA 4E8GA 3V5FA 3UXKA 1FHUA 2PU0A 4K1WA 1OEPA 4HNCA 2HXTA 3UGVA 7ENLA 1L8PA 3U4FA 5ENLA 3B97A 2FKPA 3HPFA 2GGHA 2AKMA 3EEZA 3VCCA 1RVKA 3VCNA 3SN1A 3SJNA 4Z1YA 3P3BA 3EKGA 1JPMA 1MDLA 3RO6A 3CB3A 3NFUA 1BQGA 2FYMA 3R0UA 5BOEA 3VA8A 2QGYA 3H7VA 2RDXA 4JHMA 4H83A 1TKKA 1ECQA 3NXLA 4KPLA 4F4RA 2AKZA 3RCYA 2OVLA 3QPEA 4K8GA 1YEYA 3TTEA 2MUCA 3DDMA 2QJJA 3FJ4A 3GC2A 4GGHA 3IJQA 3DFHA 3DG7A 3FVDA 3R11A 3TW9A 1IYXA 3NO1A 3H12A 2P8CA 2PGEA 3QN3A 3BSMA 2PCEA 5IDZA 2XGZA 3SN4A 3CT2A 4H19A 4A35A 3T6CA 4KWSA 2HNEA 2PS2A 3R1ZA 3DGBA 1WUEA 1JDFA 3UCDA 2PPGA 3R10A 3ZVIA 4IZGA 1XS2A 3P93A 1MDRA 2OZ8A 2XH2A 1NELA 1TZZA 1SJCA 3MQTA 2GSHA 2GGJA 3THUA 4FI4A 3IK4A 3I6EA 2QJMA 4EWJA 1EC8A 3K1GA 3DFYA 3ES7A 3MKCA 2QQ6A 3UJ2A 3Q45A 3SQSA 3CAWA 3DEQA 2AL1A 2PSNA 3GO2A 4ZA0A 4ZCWA 1TE6A 3IJIA 3N4FA 5FJUA 3S47A 3DG6A 3QLDA 2OZTA 3V5CA 1EBGA 4MMWA 3BJSA 3UXLA 3JVAA 2OZ3A 2HZGA 1EC9A 3CK5A 1NU5A 3TOYA 3FCPA 3OPSA 2OLAA 3QKEA 1FHVA 2O56A 2PTYA 4K2SA 2HXUA 3MUCA 4HPNA 1PDZA 2AL2A 3TWAA 2AL2B 3BOXA 4DWDA 1BKHA 3UJRA 3QTPA 3D47A 3OZYA 4ENLA 3KUMA 2QVHA 3ZLFA 4GYPA 4A3RA 3MSYA 2XH0A 5FJPA 3MZNA 3PK7A 2OQYA 3UJSA 3T9PA 3UJFA 1KCZA 3V4BA 3JW7A 2OQHA 3H70A 4HNLA 4FP1A 3TWBA 2GGIA 1MUCA 2NQLA 2ONEA 3TCSA 3T8QA 1F9CA 1P43A 2PGWA 2PP3A 3PFRA 4A6GA 4GISA 3DESA 2PODA 3TJ4A 1SJDA 2PU1A 3IJLA 6ENLA 5J04A 2OKTA 1MRAA 4IL2A 3RR1A 3R25A 4GMEA 3GY1A 1SJAA 2P8BA 3ES8A 4J1OA 1R0MA 3FV9A 2XH4A 2QJNA 4GIRA 1W6TA 5EU9A 4E4FA 4E4UA 3ENLA 4IP5A 3Q4DA 3OP2A 4H1ZA 3ZLHA 4DYEA 2ZC8A 3FYYA 4GGBA 4IP4A 4JN7A 3VFCA 2GL5A 2GGEA 5FJTA 2ZADA 1JPDX 4HCDA 4HCLA 1E9IA 3PWIA 3GD6A 2OG9A 2GDQA 2DW6A 3ZVHB 4KT2A 4HN8A 2OFJA 4IL0A 4IT1A 3S5SA 4DN1A 3MY9A 2XSXA 1WUFA 3DG3A 3T4WA 2PP0A 1KD0A 2MNRA 3NZGA
chains in the Genus database with same CATH superfamily
2C0HA 3NPXA 2F38A 3RMEA 2VZUA 3IRDA 4GUFA 3AZRA 3WQWA 3RRAA 3EAUA 2GQAA 4PGLA 5HXMA 2ZUNA 2PWHA 3W7RA 4AISA 4UFHA 5AY7A 3QHOA 2Y7GA 3QFAA 1RR2A 1JCLA 3DBNA 2GVYA 4B5XA 3W6MA 2PDJA 1BWVA 1GVIA 3NDOA 2BXYA 4FNQA 4INFA 5G2WA 2QCMA 4LV9A 3WJSA 1AH0A 3O8AA 4ATWA 3GG8A 3N17A 1TVNA 2FZNA 4DNAA 1E0WA 4MKSA 3AZSA 4Y2WA 4WXYA 4QS6A 4WKFA 2XWEA 4US6A 2XWDA 4H04A 4PUJA 4Z1CA 1JPKA 1KKRA 3A6OA 3F5LA 2OXNA 4IIFA 4ONVA 1RD5A 2ZZ2A 4PMNA 1JZ5A 2D0GA 1LWJA 2CHRA 3T2QA 2POTA 3MO7A 4O18A 3WLKX 3CUJA 4GI8A 1MW2A 3I65A 1NOUA 3E02A 3SO7A 1QFEA 4E8GA 4C6JA 1W3JA 2A7RA 1XYZA 5CPQA 3W81A 4GKLA 1LCOA 2Z27A 1TUFA 3STEA 3A12A 1BXNA 1PKLA 2BS9A 3BW3A 1IWPA 3WUEA 1UKQA 5FIPA 3UZYA 1U1HA 3QR1A 2DUXA 1BQCA 3H2OA 3MP4A 4JNYA 4PODA 3RRXA 4CUCA 1F8WA 1BG9A 4Q4SA 3APTA 1VHCA 3G77A 2QUVA 1XLDA 4GJIA 3LB8A 1T96A 1E6QM 2DH2A 5DT5A 4UNKA 1RJRA 2Y62A 3OHMB 3PNUA 3W88A 4UNIA 4GCXA 5C9ZA 2RDXA 3AWOA 2EPMX 4H83A 3KBMA 5C70A 2VZSA 2CBUA 1XH0A 4Q8VA 2E9MA 5I3KA 1UPMB 1ZUAX 3CQHA 3CQIA 1F3XA 1RSCA 4C6OA 4YJ5A 2V3EA 4J40A 2MUCA 5EMYA 2YBTA 1I0BA 1OFBA 1JUKA 4NI3A 4O12A 1RP9A 1XBZA 1XIFA 3R58A 1J0KA 4QAWA 1THFD 4P8WA 3WNOA 3PBYA 3T0AA 3GNOA 4GUJA 4OKDA 3SRKA 3W71A 1KR1A 2CU0A 2HVNA 3ID7A 1V6YA 2D2OA 3B0XA 4CCDA 3S5NA 4KWSA 1OFDA 3I7RA 2I14A 2ZRWA 4GYFA 1M65A 3D3AA 4O1DA 4Y8EA 1TJ0A 4BF7A 1B90A 1HKWA 3VK5A 1OFQA 1WQ5A 2J7HA 4ZR8A 2FDMA 2IPWA 1UWRA 1UOKA 3KP0A 3I6EA 4TIMA 2YA1A 3VNIA 3G2GA 3S2MA 1TCMA 3AS1A 2FGBA 4PMYA 4FAMA 2GUYA 1O5XA 4Z42C 1VGAA 3ITCA 3WENA 3B9JB 4WDUA 2WV8A 2XIOA 4DZIA 3VTRA 1GRGA 3LN3A 4S3GA 3GXNA 1WZMA 4WDXA 4J7RA 1EPVA 1UWUA 4HTYA 3QV9A 1SW7A 1FWHC 2ZX7A 3O6YX 1NP0A 3WK2A 1GEUA 3P5ZA 3PANA 4BHYA 3GNPA 1LRTA 4JTIA 1EC9A 3CK5A 3SR6B 3B9AA 1QOXA 1VBGA 2G3MA 1R47A 4WVXA 3SCNA 1TWSA 2NLIA 3NAVA 2G95A 3O7UA 3IJ7A 1B3VA 2PTYA 1XD1A 1XH1A 3EOSA 1JQXA 4B3ZA 2BFGA 2VEIA 4UOZA 3BDKA 4IIBA 3HMJG 1DIKA 2GUUA 2R8WA 3C0QA 3UJRA 3QTPA 4A2RA 1ONXA 1T3QC 4AZ7A 2E09A 1XLHA 4TMBA 2C3DA 4JDRA 4LUTB 2R24A 3B0VC 5CCZA 5JBEA 5CC3A 1S7MA 1JDCA 1XV8A 4CD5A 3WBYA 3SEPA 3UJSA 3TSMA 2WOIA 3T9PA 4LU0A 1IWAA 1CXEA 3KHDA 2VM8A 4DIAA 3KRSA 3FHAA 3PULA 1KRAC 2VDIA 1VLIA 1YMYA 2NVDA 2FVMA 2NT1A 3BMXA 4E2OA 3TCSA 1EF3A 4J3TA 3O63A 4YYCA 3G1XA 4D6GA 3PFRA 4GOAA 3C8FA 1UP2A 2JK6A 1KRBC 4GISA 1S2TA 2FJKA 4CD7A 5JU6A 3DBPA 3PZVA 5G4HC 4LV4A 1J6OA 2PU1A 3LHTA 1U33A 2D73A 3R25A 3PZUA 1UKTA 2O55A 4RE4A 1JZ4A 1F2JA 2GFTA 1PV8A 3DI1A 2YCLB 2P8BA 1LOSA 2QHAA 3BAWA 3FYPA 1C93A 1EBDA 1V6VA 3N12A 1REQA 3L2IA 1B9BA 2GSEA 5MHBA 1IE7C 2QV5A 3L21A 4AY8A 1OADA 2E6DA 3EPOA 1JPDX 4QLJA 2J7EA 4Y9PA 4B5TA 1WDQA 3NQEA 3LXDA 2YOCA 3WDJA 5I3GA 4AIUA 2VWSA 3N2MA 2FVKA 3H21A 2I5GA 3WKZA 4APNA 4NYYA 3RLHA 4E4PA 4J27A 1LLWA 2P50A 4BF5A 2EJAA 5I3JA 1OQFA 4ILSA 2F8QA 4D8LA 3LENA 2XFFA 2BHZA 5CGQA 4AF0B 2YCKX 4FO4A 3O07A 4ICCX 4DYJA 2CZVA 3VNJA 3ICJA 3GR8A 4MWAB 1DJYA 5CEWA 3LCGA 3SCOA 5JUVA 4KBXA 2OT0A 4EAYA 1WDSA 2RDUA 3IUHA 4IIHA 4ZEPA 2YSWA 4B4FA 3REQA 3V1PA 2VELA 1ZCCA 2INEA 4NZ1A 2CXGA 4XZIA 3U7BA 3V7PA 3N6HA 4QITA 2DORA 1N8WA 1FWWA 4QEHA 2RUSA 3GQYA 2BBFA 4JQ1A 4DB7A 4LVFA 4M6UA 2PAJA 3UJEA 5HAOA 2PDHA 4M3PA 4V1YA 2W66A 1X1NA 4RE2A 1Z89A 1XDMA 5AHLA 1CXFA 4NT0A 2WAGA 1UBSA 3I6TA 3HPXA 4GI4A 1PX4A 4ZQMA 1Q1RA 4LYKA 4PMQA 4NAFB 1A3XA 2W79A 4Y6GA 4EXBA 3TEVA 4CU6A 5LHFA 1V3HA 4GYPC 3S1UA 3WDRA 3LGEA 1Q2RA 4Y8FA 1EL3A 2OX4A 4W5UA 1ISZA 1ZJIA 1UHVA 3DK8A 4JKLA 3XINA 3L4VA 2ZRXA 5HBFA 2W92A 2YCIX 3F4NA 4KRUA 1W1YA 3GNRA 3A22A 1CB2A 3GNXA 1ENUA 3PTDA 5A6AA 4AY7A 4BZYA 4UMBA 5XINA 4ZXOA 3FY1A 1UP3A 5F2LA 1ME7A 1VCVA 4J56A 4R33A 2E77A 4GY7A 3U8GA 4DJFC 2NSXA 1KM4A 4CD6A 2JBMA 1E0XA 1YPFA 3QXBA 5ENLA 4RZ6A 3W1XA 5A1AA 1GZGA 1M41A 1QW8A 1VENA 1LG2A 2JGQA 3W1PA 3WFLA 3GW3A 4LC8A 4DWSB 3BAJA 3N13A 4MWAD 1TCDA 4MY8A 3O2LA 4A3QA 1ZP3A 4ZSTA 4EM4A 4OQVA 4JPGA 1GONA 1I2OA 3QGAC 4UZUA 3VMNA 2DJXA 2G3IA 3DUGA 4EF8A 4FSAA 1AW2A 1RM6B 4YPJA 2E6YA 1EOKA 2VEFA 4M80A 1YNYA 2GQ9A 4AHPA 4NP7A 4OOZA 2E40A 3NO1A 4BQ3A 4XD6A 2A79A 2PGEA 1Y8BA 3WL1A 1OG6A 3OB8A 2VT0A 3FGCA 3KOWA 4HNTA 3OIHA 1H60A 2A8XA 4NZJA 4RXFA 4I8YA 4XSLA 1JUBA 2VWTA 1K3UA 3SUUA 4S3AA 1LUCA 1NFGA 1BFNA 1CGVA 1YTKA 4AX7A 1AL7A 3DFPA 3LDVA 1V6XA 3GTNA 1W32A 3QPYA 3WNLA 4AVNA 2V6AA 3JRKA 3IACA 2GQ3A 5LNRA 3E9AA 1UWAA 4NXKA 5BROA 3NGFA 2BB0A 2AQOA 1O4UA 3NVZB 3FAWA 3T4CA 4KW2A 3G1VA 4GHRA 1U5VA 3STGA 1MQQA 2GJRA 5AYBA 3EA1A 4C1LA 1NHRA 4UOJA 1DQXA 1EF2A 1C9DA 1W5MA 4ZA0A 1Q8JA 3ITOA 1W1PA 3IJIA 2Y6ZA 4R9OA 3MCMA 2BC1A 2OZTA 3KZSA 2PTDA 2BTMA 3AYRA 4CQAA 1S5TA 1D3HA 1OYCA 5EMJA 4IMGA 2J7DA 4HN4A 2C1GA 4ZO7A 3WQ6A 2Z2BA 2GJNA 3MUCA 1OGSA 4HPNA 1ALDA 1UD2A 4HHLA 2EG6A 1B3ZA 1N61C 3IWPA 4FLQA 4NZ5A 3B8VA 1W9PA 2H6RA 1XISA 4RE3A 1WBJA 2D2GA 2B7NA 2Y8KA 5F4SA 1SPQA 1NFPA 3KLLA 1BYDA 2Q09A 2Y70A 4IIEA 1XLLA 3B8TA 2JK2A 5HANA 3RAOA 1F05A 1ZENA 3DFOA 1VLWA 2O4QA 2YFNA 4UTIA 3VIJA 3C2EA 3RNMA 1NY1A 4JS3A 1NOWA 1Q66A 4O1BA 4TOQA 3GW0A 3WDQA 3T8QA 1F9CA 1F7BA 2XVLA 1QU4A 1X7FA 4HGXA 2R94A 1CLVA 1GTEA 2WJZA 2R91A 4GIAA 3PHAA 1UWIA 3UFYA 3LG3A 1B1YA 3DYPA 1KM2A 2V5KA 3RR1A 1E4IA 3L7RA 3BUVA 3N1AA 3CZGA 1T41A 5AHMA 2X0YA 1DWAM 2R1KA 3OGSA 3WLNA 3MHUA 3NG3A 1JZ6A 1SJAA 4HNNA 1ZZMA 3ES8A 4GD0A 4GH3A 1BYBA 3VXGA 2FVLA 4P7NA 4L5ZA 3T55A 3PPHA 2ZRVA 3A9IA 3LOTA 4GGBA 4QHRA 3H2NA 4IP4A 4JCMA 1J0JA 3B4YA 4ADUA 2B4GA 1GYNA 2A3AA 2ZADA 4XZBA 1XCFA 4AD5A 1E1EA 1XIBA 4IG2B 1K1DA 3STFA 3NL5A 2GWGA 1K8XA 4IPLA 2E3TA 4HMEA 5CH9A 2YVGA 4IT1A 3UXIA 1GRTA 3UCQA 3AXHA 5A8OA 4UQDA 3L8KA 2RJHA 2D1ZA 3WLQA 2PDCA 5I5RA 1ZMDA 4FDCB 1FEAA 1KLZA 1PKMA 1OC7A 2FB3A 2VDGA 1VBUA 1KRCC 3HQNA 2WLZA 3LMYA 4O50A 3AHXA 2ABBA 3M5VA 4RV8A 1V03A 3VILA 3LHVA 3L66A 5BU6A 1TJ1A 1E0VA 2OT1A 2P5NA 1UH2A 3DH7A 4LTSA 1X2HA 4DBDA 1DTNA 5DXYA 4PMZA 3JU2A 1P7TA 5D2VA 1G01A 4IPNB 1TPDA 4AWUA 4DYKA 2FHFA 4IMFA 1VAHA 9XIAA 2QCFA 1B57A 4JXCA 3GFYA 3HGRA 2ISWA 1Y5VA 1N63C 4HTBA 4LUTA 1GQJA 3HJZA 4YCOA 4A8IA 4LAUA 4WSKA 1LQ0A 1UWTA 4GRSA 4OBRA 4GVGA 1R5YA 3QSTA 1BAGA 4PMUA 4UXDA 5JCNA 3CUIA 2W27A 3JUGA 1NOFA 2AQVA 3RNDA 3WJZA 1P0EA 3RJXA 3GVVA 1OINA 1FCVA 5AC7A 3DERA 4BFAA 3U0HA 2QUTA 3NM3A 4Q7IA 1TR1A 4DJEA 1EB3A 2I16A 2DZSA 3GU9A 4DHGA 4ZO6A 1H3GA 2NSOA 3W24A 1DXIA 3L0NA 1D9EA 1H5YA 4GQRA 5BWAA 1PB0A 5I2UA 3G3MA 2EQ8A 4EQWA 3GUGA 1YDVA 2W54A 1KLYA 3II4A 1X8FA 3ZJ6A 1EJUC 4OT7A 1XRTA 1OEPA 2UY5A 3KTSA 3FSUA 1UQYA 4JIHA 4TVCA 1FWAC 2J77A 1EA0A 1EP3A 4UFKA 4C7DA 4Q4MA 5IOBA 5CSUA 1HFBA 1MXGA 5I09A 3T7VA 3WZ0E 3JS3A 2W0HA 2JKAA 3VCRA 3AXXA 4FMVA 1EXPA 2DQXA 4MOZA 4H2CA 1ADOA 3CQ0A 3COTA 2EAWA 4L7ZA 1J0HA 4ZXLA 1K7EA 3CJPA 4NY2A 4P2VA 3TYCA 3CTLA 1S2UA 1QMLA 1OSEA 4H6KA 3MPGA 1DPMA 1OWQA 3SQPA 5E9AA 1PIFA 1ISVA 1XD0A 2QDHA 3M47A 3C52A 4TXEA 4TVUA 3AUOA 4AEFA 2ZZ5A 2Z00A 2PC8A 3M5ZA 4NNBA 4MB3A 2P8CA 2V8ZA 1FWNA 5FESA 2YL9A 1JGMA 2HRWA 5F1VA 5LNUA 1R9XA 3WNKA 1STZA 3G18A 2CPUA 3QQ0A 3U2EA 4DXXA 1RAKA 2WZTA 3QC3A 3IIZA 4IZGA 2DJLA 4H4YA 3OZOA 1EUAA 1VJSA 3WX7A 1XF0A 3FN9A 4Q3MA 1ECEA 1I60A 4IUGA 5M03A 3THUA 1QCWA 2DP3A 3S1GA 2RABA 3W1RA 2Q6ZA 3NA8A 3MKCA 4GYKA 2FMOA 4IFOA 1CEOA 5K4ZA 1IGWA 4LRSA 5AC8A 3VKAA 3PP7A 3GM8A 1NARA 5D2YA 1JDAA 2D24A 4ZCWA 2BDQA 5E93A 1JNDA 1TYTA 2FPTA 4PR4A 4WKAA 3TOPA 4ICMA 2AAAA 2C71A 3BCDA 3O0KA 1HP5A 1C3FA 2DZAA 5TR3A 2XPKA 4AZHA 4K7VA 2A0NA 2GOUA 2UWFA 3GH4A 5AYYA 4UTMA 5HR6A 3NQCA 5F2GA 5AZ0A 4MFDA 3EKLA 1HTIA 1CT5A 2CXEA 3KBNA 4S3KA 5DCDA 1B9ZA 2GJLA 2XUCA 1UA7A 4DXVA 1RQEA 3M0HA 3R12A 5T9CE 1XCWA 3BOXA 4DWDA 3LK6A 2X09A 1RA5A 2DUAA 3BQ5A 3VGDA 1AZ2A 2WJDA 3E2VA 4X9YA 1AODA 3G24A 3PVFA 1V7YA 2DT3A 5F7UA 3KCLA 3NQGA 1XYAA 5B7ZA 2PF8A 3E0IA 4KRZA 2PWDA 4IXXA 2CZEA 4UUIA 3VDAA 3GDLA 4AVOA 4DWSC 5EB8A 2X7VA 1O7AA 2J8GA 3GHUA 4E8CA 1YPXA 3LA4A 3SUVA 2JIEA 1NDWA 4PMXA 1FDZA 3L4WA 4JIEA 3VX0A 3M16A 1N2VA 1O94A 5J5RA 3VGEA 1M01A 2PODA 3TYEA 4B90A 4WGHA 1NF7A 4YHEA 2WMIA 2X05A 3EOUA 3GTIA 3O6DA 1GOQA 4ERAA 3W22A 2FZDA 1UZDA 1VEOA 1XRVA 1M1BA 3T0DA 3NSXA 2PWUA 4UTWC 2VFFA 3CLMA 5EBUA 1TPFA 2PDKA 3HIJA 3PAOA 3LXCA 1XXXA 1TELA 3PJXA 2QJNA 1DXFA 4HSNA 5CKSA 1PYFA 3P82A 5LXEA 4HHPA 3Q65A 1U22A 2CYGA 5B7YA 1XHGA 4PCPA 1ZSXA 3S4TA 2FPVA 2J62A 3NPWA 1ZBCA 3SURA 1Q2SA 4ZOHB 3WD1A 2BGSA 4ECLA 4LB3A 1F8IA 1W9UA 3C8NA 1VFFA 2BASA 4Q4RA 1K7FA 4D1IA 3LTSA 1NIUA 1D7KA 5LIWX 4UQAA 1NSJA 4LBRA 1L9WA 3LBOA 3WLIA 4S3BA 1K4GA 1UR9A 4IUOA 1MSSA 1FWTA 1A5KC 1S2CA 4PRRA 2HK1A 4C6KA 3NZGA 1CDGA 4HPHA 1QPRA 3W2JA 1TX2A 1W56A 1JF6A 4OOUA 4H6QA 4CCEA 1XLAA 1ZS2A 1Q85A 3MWAA 1JVNA 4EMWA 3M0ZA 4FX6M 1UD8A 3L0KA 3CZ8A 3EOLA 4O54A 3VIGA 4XKYA 4PCNA 2QJIA 4H8UA 3MVTA 1ONWA 4XBJA 4L61A 4OUIA 1R2SA 2F9RA 3WLLA 1F07A 3ZMRA 4OJYA 4AIBA 4ORIA 4EWND 3SN0A 3WIJA 1A47A 2A6LA 1OZMA 2QT3A 4LF2A 3UXDA 2FZ8A 3MYPA 4YTUA 3LXAA 1Z8AA 3NZRA 4H4SA 1FH7A 3STPA 3MSGA 3QOKA 2DPEA 4QIUA 1XLKA 1GETA 1TPVA 4IMAA 1T40A 3BSGA 3S46A 1V3LA 3OVRA 1KCKA 2HS6A 1IEWA 1FEBA 4JEJA 4KS0A 1OCNA 4IPIA 3A4XA 4JY9A 4WJEA 3GG0A 1O60A 3AU2A 4EPEC 1WZAA 2BP1A 3AMGA 1H5VA 1VPYA 3RO8A 5GJPA 2Y7DA 5CQ1A 2AAMA 3IK2A 4O0ZA 1QO5A 2C6QA 3U2ZA 3CU2A 3NYZA 1B2YA 2AMGA 3W73A 1DBTA 1QPKA 5FEZA 1J11A 1RZMA 1JI2A 3CWNA 2I1OA 4Z2GA 1WKDA 3SW6A 1TR9A 3B97A 1YTDA 1TB3A 2Y8UA 4MG4A 3ALGA 3QV6A 3VCNA 2OKOA 1VJIA 2OR2A 4Z1YA 1AK5A 2UBPC 4KGLA 1K6WA 1MDLA 2O4MA 3WQDA 1L0PA 1VFLA 3A3WA 4TV5A 2V3GA 1PX8A 1GPFA 3CPRA 1VFMA 1KV5A 1U30A 4PFHA 2J6VA 4N9EA 2AAQA 4BQ2A 3D9XA 3HRDC 4IFKB 4BEUA 4L56A 4DUXA 5FSEC 2OSXA 1TIWA 3TKFA 2Z1VA 3M0VA 1E6ZA 3SGZA 2QR6A 3M6YA 3ZWSA 5CGMA 3GAYA 2R6OA 4PCTA 2VX6A 4U3AA 1JYWA 1SW0A 3TU9A 2XZ9A 2R9ZA 2GDUA 2JF7A 1CXIA 1REQB 3OYXA 2DSKA 3GBDA 4QJ1A 5HPCA 3NQDA 5FEXA 1ZU8A 4ZOAA 3W07A 4XIMA 3CT2A 4A35A 1Q1WA 3QY6A 3RMJA 2HNEA 4D6IA 2XIIA 3LBCA 1Q63A 1BRLB 1WUEA 2FPYA 1VPQA 3VD7A 3GNNA 1KXHA 1OIFA 3GXFA 1VFHA 2OZ8A 2XH2A 1PEZA 1N55A 4AWEA 2BC0A 4RPPA 2WZMA 4XZNX 3MUY1 3V0TA 4H4ZA 3KRBA 3I3DA 4HZ7A 1OIMA 4XO7A 5DELA 2ZUUA 4R7JA 4B5WA 3UZ5A 1A5UA 2VRJA 3SQSA 2CW6A 2DVXA 2NPXA 1O68A 4QJ4B 4BJHA 4WOQA 1HL8A 3JZEA 3IS4A 3N4FA 5B80A 3MBDA 1GHSA 3M5YA 2EEXA 4C6FA 1OJXA 2XIBA 2NWSA 4Y9MA 5PTDA 2QMKA 4REQA 4WDTA 4X22A 3TC7A 1KB3A 1A49A 2WVVA 4DJDC 2JEQA 3EDEA 2CIPA 3QBUA 4F9DA 1MFVA 2E28A 2XFRA 5HINA 4D6DA 1GRBA 4O28A 2CFYA 2VVNA 4H9YA 1LQ2A 4LRTA 4ZOCA 3WF3A 1Y5WA 1EQPA 5FA5A 1NEYA 1UIPA 4Q8UA 4Y90A 3U2CA 3WYZA 1GOOA 2PDLA 3S42A 3THCA 1PIGA 2QCGA 5ABEA 4ML9A 1LQAA 3CAVA 2ZX5A 1J79A 3MSYA 1FWCC 1H2IA 1KN0A 4G56A 5D8ZA 1IEQA 3NQVA 4H8HA 1QRQA 2G37A 4MZ1A 2OQYA 1XM3A 3LX9A 3WF0A 3W1UA 3NPUA 5FL1A 3RXZA 2OQHA 2Z1XA 3DH9A 4QFUA 1DJGA 4FP1A 1MUCA 1PWMA 2PRHA 3FJNA 4C6DA 3SCTA 3LM3A 5D30A 2A3EA 2PP3A 3V5OA 3PJWA 2W63A 4Q4PA 3WMCA 4W88A 2O9TA 3M46A 3NEHA 1F4HA 4AD0A 1ZAIA 3KRZA 1OVDA 2XN2A 1S5NA 1RXOB 1HJWA 3SB0A 4NAEA 1YQZA 4O8RA 1ZGDA 2HNHA 3FV9A 4DAFA 1ZL1A 3OP2A 3C0JA 2V6OA 4DYEA 1SB3B 1FOBA 2G5WA 3NQBA 4EE9A 1Y5XA 4AB4A 1EO5A 4A3YA 2J9XA 2W9MA 3A4AA 1XDIA 1SFTA 3LI1A 4ZBCA 4UQCA 3E6EA 1FUYA 2WWDA 3GIQA 3RX4A 1HJSA 1C90A 5AB3A 2QV4A 4NEWA 5C6MA 2DIJA 3MY9A 3T05A 4DO5A 1V7AA 1SUXA 3AXKA 3MS8A 1K02A 1W3LA 1QAPA 3FGCB 4BWLC 2D3NA 1UR2A 3P74A 1RJPA 1XCXA 3IGHX 1TV3A 3B8DA 4FPSA 1SMDA 5CZKA 2INZA 1BKSA 2G97A 2NQZA 3DGRA 1XIMA 1R7AA 3CYJA 3D46A 5AHFA 2VFEA 2EPHA 3LCHA 3GC4A 3BAKA 3CV2A 1FWDC 1AA1B 3BL3A 2DW7A 4DX3A 1KTNA 1K6AA 3I4KA 1V02E 1UG6A 9RUBA 2TMDA 1ZALA 5D9OA 2GK1B 3RGTA 2GR1A 1XIGA 1IV8A 3H23A 3VC5A 1EJ7L 2BY3A 1CGTA 1XIDA 5CC7A 2WVVB 4J9JA 5C8BB 1NWSA 3GVGA 3W29A 3E2RA 1E6PA 3MWCA 1KKOA 4H8NA 3CZJA 2OODA 5K7JA 3THQA 5FJJA 1HKKA 5BCAA 4RJEA 4YIWA 2OPJA 1OG0A 3A7UA 1PTAA 1PX3A 3NL3A 4W8LA 3NSMA 1B3OA 3TP4A 1CB7B 4FXFA 3IIVA 4HYRA 2OMAA 1POJA 2RDWA 3A23A 1RP8A 1I1XA 4JR5A 2ZIDA 4H2HA 5BMWA 1OF8A 3CMFA 3VFLA 3KLJA 4KH2A 1YXDA 3WQGA 3ABRA 3UWEA 3URQA 1KBJA 3HQOA 4UFIA 1G4SA 5FS6A 5LKYA 2V38A 2YL5A 6XIAA 3TMLA 1V3JA 4PSPA 1A5NC 4K37A 3FKKA 3EMZA 3PF3A 4QQUA 1M3UA 4Y9AA 3AYSA 3U4FA 1LZOA 4AUBA 2FKPA 4L6OA 2IQDA 1U2YA 5EKYA 1EGZA 4PN2A 2OYMA 3EEZA 3UR5A 2E68A 3HZ3A 5AN7A 1B3YA 2PDQA 1G7VA 3LM7A 3R89A 2X1SA 1GOKA 1XLIA 1LF1A 1EJRC 4EQSA 3RO6A 1AQMA 1TRDA 5JCLA 3H7RA 4MDPA 3MSRA 1IZKA 5FAJA 4HD5A 4CKQA 1QXLA 5EMUA 4Y9NA 1WA3A 2AKZA 4GR1A 3CZKA 1KQZA 5EGRA 2HMCA 4H4PA 3TYZA 3GUWA 3AICA 4H7CA 1CXKA 3TAKA 4GGHA 4PUDA 1GW1A 5CGTA 3BTNA 3DC0A 4PMRA 1PBGA 9XIMA 2E6AA 3R13A 4FS9A 4JHOA 2DDXA 2D0FA 1HJXA 4CGTA 3BSMA 4JDYA 1PUDA 1H63A 1R8LA 2XGZA 4FNRA 3HG4A 4AEOA 1W5NA 4GXMA 1V79A 5I24A 4H19A 1VYPX 4IXHA 1E40A 1P6CA 1H1YA 3KS6A 1R30A 4QP0A 5FKYA 3VMOA 1Z69A 4L9ZA 2CLMA 4AZGA 4GK8A 5CSYA 2DZPA 4QTGA 3G8RA 4IQJA 4MUZA 4LYQA 2ZUSA 1TZZA 2XIQA 3MKVA 3W1QA 2WHKA 1PO9A 4HPJA 4FI4A 3ARTA 5FF3A 3IK4A 3GD3A 3OLIA 3LBMA 4L6DA 3AIQA 1FX6A 4KFPA 1JDDA 1EKOA 4BQ5A 4XB3A 1CGXA 2YA0A 4XAGA 1FWRA 3HPAA 4UTFA 1LTDA 1JYNA 4HU8A 4BR1A 2HWGA 3IANA 4UFLA 3N11A 4BCEA 1VDVA 4QNWA 2PGRA 3N6QA 3WUFA 1QBBA 3V5CA 5AECA 1VR6A 4JTRA 1ICSA 3EA3A 3FKRA 5HDRA 3GDBA 3BC9A 3PZGA 4ZQNA 2NV1A 3CGDA 3F5JA 4E3VA 4GUHA 3RX3A 4J3UA 3FX4A 3E5PA 2JKPA 2OLAA 4O52A 3QKEA 4OE7A 5C55A 3PAJA 1XYCA 5ER0A 2ZCGA 1ZLPA 1EH9A 1HT6A 3QQWA 4JNMA 4Y7EA 2ZTKA 1IIHA 4PUNA 1OHLA 3AJ7A 8XIAA 4LJ3A 4ZL1A 2OEMA 3OZYA 3W74A 1ODZA 2C1HA 1G0CA 4D6CA 1FCQA 2CESA 3WQ8A 1CXHA 4LNYA 4LYRA 4E2VA 4J3SA 4ICNA 4OUEA 1US2A 3QW3A 1JJKA 4KPRA 3FFSA 4HU0A 1XLEA 3TYDA 1K4HA 3TNOA 1H49A 2QPUA 3G1HA 4NJHA 3Q2DA 4B5SA 2ISSA 2OGYA 4AZIA 4RDYA 2JALA 4LY8A 1JZ7A 3RCNA 3TAOA 1P43A 3M0LA 2YDAA 2INFA 1TVLA 1ZNNA 5GRTA 4WY0A 1C29A 1PIIA 1UKOA 3W7LA 2VCAA 2H8XA 1FXPA 1ITUA 5HUOA 2VR2A 2FJUB 3PBGA 1G7UA 3KRUA 3GTHA 4D72A 2E8YA 2YZ5A 2AGKA 3NDYA 4GI6A 4AZCB 2P53A 3TSBA 4C6BA 3FEQA 4FXRA 1W6TA 5EU9A 4IP5A 1LJYA 1S39A 4HK5A 3DCPA 4NSBA 4YVVA 1UUOA 1PYMA 1ZY8A 1XG3A 2IPGA 3M7SA 4UQ9A 3M0YA 5IDIA 2G3NA 4QCEA 2V5LA 2BXVA 2GJXA 3UVAA 4QG6A 1QASA 4O1AA 1O5QA 3I4EA 4HN8A 5D37A 5CBIA 2HV5A 2E5DA 1W5OA 6ALDA 2QEZA 1BZLA 5FSDC 4EPDC 3EB3A 3N18A 2GDVA 4ADTA 2PFHA 1UROA 2PP0A 1XH2A 4QG9A 1XPGA 5HMSA 4FB7A 4KWUA 1F3PA 1FQ0A 4NI8A 2XFWA 3G1FA 3M9YA 4W8BA 2FTYA 1W37A 4XX6A 1EJWC 3LLDA 5HULA 1PJ9A 3WH6A 1BSIA 1BHGA 4WR3A 3WLSA 1F3EA 4HOWA 3WLPA 2Y7FA 3C2FA 3NQMA 2XH7A 1UA3A 1WNOA 3TR2A 3C0SA 1P7TB 5D9PA 1E3ZA 1UP0A 3VNMA 4S39A 4O1CA 1FTXA 3VOGA 3FNDA 1YTEA 3GFXA 2BOGX 2POZA 2YR1A 4EK7A 1GG1A 3B06A 2HSAA 3ARWA 1M6JA 3NOYA 4H4XA 4W5ZA 5KINA 1JRCA 4M81A 1W9DM 2PLMA 1TZ9A 1DL3A 3QKZA 3BOFA 3GC5A 2G96A 4GA8A 3R0KA 1X97A 1TWIA 3CXOA 3ZSTA 2ZKMX 1UR1A 4A8NA 4J3ZA 1UKSA 4TR9A 1ELSA 2VR4A 5ABFA 4TTUA 3E0FA 5DBUA 3EAOA 2D23A 2W91A 1DHPA 3VOFA 3EWDA 2YCEA 3O0FA 4ZB2A 2EHHA 3WLHA 1JZ8A 2YW3A 1GVFA 2NUXA 2WM0A 2X1UA 3SSJA 2VRQA 5DRIA 3ONCA 3PTMA 1H7OA 2KX9A 1YADA 2Y5JA 2Y2WA 1VIZA 3MA8A 1DNCA 3GD4A 2WP5A 3VIMA 2EPNA 1GEQA 2QKFA 4DWSD 5MKGB 1LRNA 2GR2A 2Q3OA 7ODCA 3QH2A 5L9FA 1UR3M 4PUKA 2QCHA 4UTLA 4AHQA 1EWDA 4F2BA 3VCCA 3OG3A 4LALA 2YVFA 4FOUA 2Z1SA 1J2WA 4S3JA 4XD3A 2Y85A 1JCNA 3EKGA 4L1XA 1J5TA 3B03A 3R0UA 3TONA 3S9IA 2QGYA 2NXHA 5FF0A 4MAZA 4MADA 1WXYA 2X8CA 3WBXA 3MUAA 4DZ5A 1PXGA 1Q6QA 5BYWA 1QWKA 2CZ5A 2GVGA 1JG9A 1KM5A 1E1FA 4XVEA 1NH6A 1B31A 4CD4A 5FOOA 1HX0A 2F84A 2PDUA 4F0HA 3CNYA 2FQIA 4O14A 5C2XA 2Y4SA 2OWXA 2WPCA 1UYQA 3UWWA 2Q3RA 4DBSA 1S2WA 4A3HA 1RQBA 3SQLA 1HO1A 1HKJA 3IUDA 4S2CA 1FFQA 2PCEA 2J78A 2VX5A 1W1B1 4H4QA 2FZ9A 3BW4A 1SO3A 2DVTA 2ZZBA 1IZJA 3LHYA 3W9ZA 4U5IA 1SSDA 3L5OA 2A1YA 3I7SA 3G3DA 2OQLA 1BYCA 1EP1A 4M19A 1IEXA 1UH4A 2F6XA 3L4XA 5T9BG 3R10A 3KDNA 3SGUA 3UW6A 4W85A 3OOQA 4U2YA 2IUZA 3KOYA 1H0GA 3MQTA 3MYOA 1ICQA 3L68A 1FH9A 4Z08A 5F2IA 5F2MA 1FWBC 3RLUA 1J5SA 3A3HA 1XHCA 3U48A 1LL6A 3N34A 4OBTA 2VGGA 4ZQPA 2D0HA 3JR2A 2YL8A 2ZFAA 1E51A 2YGYA 2YYUA 2CWNA 4IGSA 3IJ6A 4Z0SA 5FEWA 2OCZA 4HYVA 3WF4A 4L1WA 5BRQA 1FRBA 3B3DA 5AKQA 5H8UA 2FZBA 4ZOBA 2E0PA 3AYVA 3M0JA 4JNZA 3ZR6A 1D8WA 3BJSA 3L12A 5D09A 2ACUA 1CIUA 4B3LA 3RCMA 4R88A 4POCA 4ATDA 3SI9A 1A4MA 5DN1A 1ZX9A 4GJJA 1RLCL 2O92A 2ZRUA 1UUMA 3BG5A 1W9XA 2HXUA 1QOQA 3WEOA 3NVVB 4L65A 4Z2JA 1BKHA 3EMQA 2HVOA 5C9XA 3NVTA 3W2KA 1XSKA 3KUMA 2BGQA 3F4WA 5U4NA 4LVAA 3BAIA 4TX9A 1ZBWA 3KW3A 4J2PA 4CQ9A 4M56A 1MRQA 4Q7NA 3HG2A 1KWGA 2G41A 4JTLA 3EGJA 3TQ0A 2WPEA 3BE7A 5JVLA 3NPVA 1HF6A 2V81A 3H70A 3CHVA 4QM1A 1EIXA 2X41A 1VJZA 3KX6A 2ZQ0A 3TWBA 3MU7A 1UZHA 3PG8A 4IG2A 1KFWA 2NW0A 2ZXDA 1EDGA 1OX4A 4EMIA 4JCLA 3R79A 3VE7A 3H4WA 4MLJA 3GTXA 2V3AA 3P14A 3DESA 4PRTA 3MI2A 2Z2UA 1Q6CA 3H24A 1SFLA 1V51A 4CN6A 2OKTA 4CVWA 4J3XA 1DWJM 2NVKX 2Z7KA 5AOUA 2QNEA 3WD3A 2YCLA 1SZRA 3BCJA 4XZLX 3LERA 1H2JA 3SFWA 4WKHA 1R0MA 2Z1WA 4E4FA 3Q4DA 1FVPA 1DKWA 4JTAA 2CKRA 4JBRA 3R8HA 5I23A 1XBVA 2NX1A 2J9YA 3HN3A 1PS9A 1I2NA 3W02A 5FJTA 3MANA 1DQWA 3LYEA 4AZ5A 3MSDA 3P7YA 1C8VA 4EP8C 1H50A 3QTGA 4UB9A 3UWUA 5GQBA 3IIXA 1D3GA 1H11A 1NFBA 1UIOA 1XSIA 3OA5A 3M43A 3CO4A 2CBIA 5MF5A 4GZEA 3MDUA 2XJ7A 2ZXAA 4QE5A 2ZUMA 3BSHA 5HUPA 4AFYA 5EFDA 3DAQA 3MC5A 2CITA 1E56A 2Q01A 5EYWA 5GNZA 3E96A 1RVGA 4Z17A 2ZZ6A 2Y1HA 3PB2A 2A3CA 5BXPA 4J3WA 3PBUA 2J24A 3F7JA 3C3NA 3VD4A 2YDRA 2YPIA 3DJGX 2PRMA 3BQ6A 3CUZA 3W28A 1TWDA 3O6CA 2PI6A 1MQPA 1SZEA 1EC7A 1IXQA 3IVUA 4QJ5B 4UTTC 4Q8WA 3ARYA 2I17A 2HQAA 1OF6A 3VINA 3F4VA 3EYPA 4RDZA 2VJXA 2IS7A 1H4PA 3M41A 4GKTA 3H4XA 2OO0A 4C7GA 2BG5A 2OEJA 3LI0A 2R1PA 3G6MA 1S3HA 1CLKA 3K4AA 4IQEA 4PUUA 4Y96A 4ZSUA 1JULA 1VC4A 4FOJA 1VZWA 4IPJA 2W5FA 4EACA 1W1ZA 3VC6A 3VDGA 3WNMA 2XM1A 5EBAA 3SUSA 5BRBA 4EPBC 1XPYA 2EXOA 4C6CA 3NSNA 4PYSA 3HPZA 1R6WA 3DOPA 4H4VA 2BVTA 4F40A 3WUBA 1MWOA 3VU2A 4PUWA 4YL2A 2XYLA 3HW2A 3UZZA 3W6YA 4X2PA 2ZXBA 4N9CA 3UXKA 1KR0A 1WKFA 3FJLA 1K9FA 4JDBA 1HKMA 2OLSA 4HNCA 4C6PA 3UGVA 5FL0A 3WSUA 2EPLX 4V15A 4HOXA 4R9XA 1IXOA 3P8JA 4I9MA 4R5EA 4QRNA 5DMLA 3GIYA 1WPCA 1BD0A 3VGGA 2QZRA 5CJMA 2EQ6A 1AQFA 3E0WA 1LOQA 2TYSA 2Z7GA 2YXXA 4YN5A 2D3LA 3P3BA 3THAA 2Y24A 3AQUA 1EYWA 2GOKA 2HISA 4PTMA 5I3FA 4NHVA 1YBQB 4QE1A 3AROA 5E0FA 2VXNA 2OWCA 2VD9A 1GQNA 2ASHA 1TKKA 4XZ9A 3CT7A 2ZA1A 1MW0A 1XG4A 2X30A 3O15A 2I7GA 1KM1A 2VEGA 3PM6A 4K8HA 4F79A 2DZWA 1XBXA 5LNWA 3DXIA 4HZMA 3NR0A 1OFOA 1MZHA 1SO5A 4AZ6A 4ZB0A 4J5NA 5DFAA 4AD4A 1A5MC 3VIIA 3E12A 4OV4A 3HQ1A 1QNSA 4IH3A 3SRHA 4P7RA 2RDTA 3NTYA 1V02A 5D33A 4CN4A 4C6NA 1Q7QA 2H3DA 1UZ1A 1IWBA 3VOJA 2VC6A 1TFVA 3ZT6A 3WBWA 1W1IE 4AZCA 1JZ2A 3S1VA 1BRLA 1KCLA 1AOGA 1JIBA 1MDRA 4H41A 2HE5A 2FDSA 5GPRA 1NELA 2Z1BA 4FX9A 1BWKA 4ROQA 3GFZA 4HPXA 1FCUA 3RIKA 4PMOA 5LA0A 1TMQA 3VD9A 1EC8A 3ES7A 3ABXA 4MJ2A 3QR3A 2FFCA 1V0NA 1M7PA 3K8LA 1R2TA 5C54A 5HNRA 1FY6A 2CLEA 4RPQA 3QM3A 3Q37A 5D2XA 2Q71A 1UWQA 2V0TA 1R3SA 4PBEA 1TPEA 1O12A 2C0AA 1QNRA 1MW1A 3PR2A 1CYGA 4FF7A 5C0QA 1TUXA 1ZB5A 3AAMA 3G6LA 3BLKA 1LRQA 3B0UX 3T0TA 3T08A 3C2YA 5I3DA 3FCPA 3CV6A 4HMNA 5AHIA 4L6HA 3TTQA 1HZYA 3ZJ7A 1J8VA 3QV8A 4N6EA 4K7YA 3PSVA 1P4CA 4CNTA 2WQDA 3UG4A 1OYBA 1K7XA 1A3WA 5H6HA 4MWAC 5CXPA 1UR4A 3RR4A 1AH3A 2RFGA 3KBWA 1A5OC 4ENLA 3W85A 2V2DA 4D6HA 4EQRA 1QI5A 2WKJA 1QW9A 3LXBA 3PK7A 1M9HA 1MZRA 1N82A 5FMHA 2DZVA 3UBPC 2BV9A 3QR0A 1JD9A 3LRMA 1BF6A 3PUDA 1NTHA 1V77A 1G5AA 1HGWA 4MWAE 3B04A 1RCXB 1S2VA 3NVYB 1TPB1 5G2IA 1I2RA 2YCJA 3LRLA 5L6UA 1S38A 4Q32A 1H6VA 2CCRA 1W9BM 5J04A 1B5TA 1H41A 3ZZ1A 4GMEA 3GBEA 3VNKA 3WF1A 1XDLA 3K13A 1C91A 4XAPA 5E9XA 3VNYA 2QYGA 1R3WA 3AIUA 3DHDA 4J1OA 3AISA 3KS5A 2B81A 1P6BA 7XIMA 4A22A 1JF5A 4QGCA 3ZLHA 2A3HA 3L5LA 4R7OA 3UYCA 4S2BA 1PZ2A 4MLRA 2HEJA 3BGJA 5BU9A 4I5XA 1ONFA 1V5XA 4MVAA 2OB3A 2DSUA 3M6DA 4B9ZA 3VX1A 1GJPA 4O4WA 3DYOA 4G6CA 5GJNA 3MUZ1 3WFZA 1ZXIC 2BY1A 4NILA 4H9VA 3QYSA 3H2MA 3S2LA 4CCCA 1G4EA 3D5HA 1WBHA 2V30A 1YQ2A 1W3IA 2OLHA 4EOUA 2Z2AA 4X3ZA 4WJXA 3T07A 3R5EA 3PZTA 2DIKA 1GERA 3G1AA 2WHMA 4JQ4A 1KC7A 1RBAA 3W2NA 4I6KA 1E0TA 4LB4A 4EMJA 1FWSA 3UCCA 3AALA 1POKA 3CL6A 4ZQOA 2J13A 3M07A 5LSMA 2DY3A 3A24A 2BWGA 4DBUA 5A94A 4CNPA 3VGFA 1MEWA 2CEQA 4CQBA 4N4PA 4E6MA 1C8XA 3L4UA 2I5QA 3N2OA 4PL2A 1TPUA 4RZBA 5M3WA 4URIA 2V2CA 3MJMA 5A2AA 3KL3A 1RHCA 4FIRA 2BMBA 4MGGA 2AMXA 4IJCA 1K4QA 3Q94A 3VMPA 2EGZA 3E0LA 2WOVA 3TA6A 2DSWA 4LAKA 2PTXA 4RL3A 4IHCA 1R3QA 1YDOA 2VGIA 3B9DA 3QGKC 3LQGA 5FJOA 5CC5A 1N8IA 3RM8A 2X0HA 3CUFA 3UG3A 4LUSB 1U5JA 4LCSA 2E9BA 3PUOA 1UZ4A 5D04C 1XLMA 1E4NA 5J8LA 4O0QA 1VRDA 4LVBA 3WEMA 3QV7A 1Q6GA 3ABZA 1B4KA 1RY8A 4JTHA 3RU8X 1VF8A 1E5JA 4LBUA 2O7QA 1HJVA 4I90A 1SO4A 5T8GA 3VIFA 3R4IA 7ENLA 4GXWA 4S3CA 4ADWA 4WQ6A 3O9NA 4QNEA 4IJRA 1G6CA 4KFOA 2VZTA 1U1UA 2QMJA 3W1TA 4IQLA 3WCZA 3GDRA 1DEDA 3KFTA 1K9TA 2W55A 3SJNA 1DJWA 5LIUX 1TZ7A 1UASA 4M51A 2IKIA 3ARZA 1U5HA 2A5HA 3FDGA 3K30A 1LWHA 5C2CA 4NJJA 1FWFC 3W87A 1I0DA 1SMAA 1YHTA 4OECA 4XBKA 4UMCA 3ITLA 3WK0A 2J25A 1SFSA 3RPDA 4W4QA 1TPH1 3IUIA 3LNPA 4AF0A 4HPGA 1G69A 4D9PA 4AAJA 4LVDA 4M29A 3WDPP 2YBUA 3NWRA 4JTFA 3FJ4A 1QT1A 4UC5A 3K2GA 4UIOA 2PDNA 4UBPC 4JL2A 4RXGA 3ITVA 2PWEA 3WLTA 4CD8A 4LPCA 3K46A 2O7SA 3W7PA 2E67A 5A3HA 3TTOA 4Q8NA 2GLKA 4HNOA 5LA2A 1KO0A 3QEZA 2WMKA 3VUPA 1I4NA 3T1GA 5TIMA 1R9YA 2PPGA 1XS2A 3P93A 4GNVA 1ONRA 3ZJKA 2YW4A 4OZOA 4MUPA 3BG9A 4BKNA 2GSHA 1I1WA 2EPOA 4ZFMA 1DJNA 3WK1A 1TA3A 5U25A 2QW5A 3YPIA 3UJ2A 3GHTA 4WEVX 3HGOA 3PBVA 4X2RA 2PRLA 4PUEA 7TIMA 1YNQA 3AZTA 1UWSA 5CJNA 3S9ZA 3MMUA 4C6LA 3POHA 1N8FA 4N4QA 1I9CB 1EZWA 4F3HA 2WMHA 4GFSA 2CERA 1JPHA 4GYJA 1EBGA 3OQ8A 5KEZA 1NU5A 1OC6A 3VGBA 1BGAA 3RX2A 4GLEA 3ANUA 4A29A 1FWEC 2C19A 2VGBA 3AHVA 1TX0A 2ZE0A 4ZQCA 2KZHA 3UY8A 3NQ6A 5KZDA 1XC4A 3H54A 1S1RA 3NS1B 3ZWTA 3A4JA 1D3CA 1VFTA 1WDRA 5C9RA 3OLGA 4FR6A 2YLLA 2QAEA 4BI6A 4JFWA 2VNCA 4P8XA 1JROA 2O0TA 4UR7A 4GYPA 3H55A 1W91A 1TVPA 3UPMA 5LHEA 2PDBA 4I5RA 3APGA 2IMRA 5HQMA 1ZK7A 4AD2A 2BVWA 2W4XA 1FDJA 3BCFA 3ZT7A 3G5EA 3NEVA 1LWIA 1O5RA 3E5BA 2BODX 4G7EA 1KFJA 3ITYA 1BGGA 1OT2A 4GC3A 3ETRB 1OM0A 2NT0A 3GDMA 4X9SA 3PJUA 4MNLA 1DJQA 4HB7A 3DKJA 2CZFA 1FO4A 3TROA 1Q45A 2Q8LA 3CO8A 2ZUTA 4DJEC 3GLCA 2QJHA 1PHWA 2VUNA 1Z44A 4HJWA 3M4HA 4GVHA 3A3XA 3UF9A 4H4WA 1OK4A 1OABA 1VH7A 1YLVA 3FOKA 3ENLA 4RX0A 2FH6A 4H1ZA 2P76A 3W2LA 2ZC8A 1NQ6A 2G50A 3HGSA 1GHRA 8RUCA 4HHMA 3CGCA 3EEGA 1ZHAA 4FX7A 4QDWA 4HCDA 3VKCA 4GQQA 1W3HA 4H3DA 3HFYA 5G5GB 4H9ZA 3GZAA 3CH0A 1NWUA 3W1NA 4HQVA 2NX3A 1WO2A 3LV6A 2CHNA 2DSVA 4MYXA 2XVKA 3KOZA 3ZT5A 5FEPA 3RHGA 2CZDA 4ROPA 1Q6FA 1V6TA 3F5KA 3LHWA 4UNLA 2QVNA 1WDWA 1UC5A 5IHSA 1DHKA 4F2TA 4DZAA 2RKXA 3JZUA 1P0KA 5TD4A 2PWGA 4GO9A 3WQEA 1ZY9A 3TH6A 4C1KA 3UQNA 3CYVA 1LL4A 2QDDA 3CUGA 4XD4A 2PP1A 4IM4A 2B31A 4NNCA 4LS1A 5KZMA 2E4TA 4K39A 3CL7A 4RKAA 3BG3A 2XVGA 3I6RA 3N25A 2WSKA 3G22A 5HNNA 3ZVHA 5EFFA 2J9ZA 1L6SA 4JQ9A 4ERGA 4ZTYA 4C5YA 1VCFA 3W2MA 1G9HA 2GQ8A 3PWAA 4ZE5A 2QCDB 3TSDA 3UG5A 3KOFA 1VHNA 4IGNA 4DLMA 1RH9A 4FNUA 2F2HA 1YE6A 3RM4A 3G1SA 1KRMA 1DV7A 3DC8A 4Y9OA 3OJGA 5JMUA 1S1PA 2PTWA 3W7IA 3WO8A 7TAAA 4DRSA 1MO9A 1FKWA 4Z2HA 2D22A 3TV8A 2A2IA 1QNQA 3AMCA 3BVJA 1FFUC 3NDZA 5LNSA 5AYXA 3M64A 4GJ1A 3N6JA 2XINA 3SZ8A 2H9AA 1E73M 5K3VA 3LZ5A 2NZLA 4UQEA 1FECA 1XIIA 3R43A 3AMLA 1YW1A 3PUGA 3SY5A 3BURA 3OA3A 3PTQA 2WVSA 2ZDRA 4KEZA 1F61A 2BVYA 4ZO9A 3KM8A 1L8PA 4PMDA 4RDVA 1PVNA 4H01A 2Z1KA 3SQMA 2VX4A 1JYXA 5C2GA 2F6KA 4IIDA 4LOCA 5F4XA 3MMTA 4P8UA 7A3HA 4GX8A 2YB4A 2VVSA 4GQBA 3ZXWA 3NFUA 4K8DA 3AFBA 1NHQA 3ABSA 4MJMA 2BHUA 4KF1A 3RF9A 3EDKA 3HG5A 5LYRA 1W3TA 4H4UA 3GKFA 3GXIA 1LBLA 1D7FA 2X1RA 3MVIA 4CNUA 4OVXA 4PSRA 3TTEA 2XVNA 2QJJA 5I77A 1J10A 3DG7A 2HE8A 3TXZA 5HMDA 2PD9A 2X1IA 1WKEA 2PC4A 3SY1A 1EIBA 2YDQA 4IX2A 1QK0A 3BH4A 4MPQA 7REQB 3FA4A 4LX4A 1QUMA 1M04A 3ERPA 4UTWA 2FMNA 4JTDA 3S9YA 1BEUA 5CC6A 1L6GA 1X6NA 1FFRA 1UMYA 4Z2KA 2OEKA 3W26A 5EMKA 1OCBA 3ZR4A 1QK2A 2O9OA 4WGXA 5AHEA 1LBMA 4Q6JA 2Y89A 1IXPA 4QSFA 3UESA 1OCQA 2E6FA 4MNJA 3J7HA 2A3LA 4JFVA 1ZMCA 3NIYA 1N5WC 3WN6A 4F0SA 3HTWA 4V28A 4XKYB 2ZUVA 3WH5A 4O17A 3DFQA 1ZKQA 4R34A 3URNA 3P60A 5I6SA 4NZ3A 4JX4A 3G0UA 3H2AA 4WRHA 1G4TA 4ZQRA 2ATMA 2PSNA 3GO2A 4RV3A 3DJJA 1A5AA 3W7KA 2NWRA 5EBKA 2J79A 3A21A 1E9YB 4RZ5A 3B0YA 4D1JA 3EWZA 5JBDA 4XTIA 3T2PA 1F8MA 1IR1A 2OELA 1NWRA 4GZ7A 2WSRA 3S6DA 3DG6A 3AHTA 3CHEA 4QG8A 4AD1A 4I7WA 2HZGA 2DVUA 1CWYA 4J3VA 1JEZA 2GH5A 3L23A 1QI4A 4JTQA 4ORMA 3NL2A 3G8EA 1VQTA 4UTHA 4L9YA 3KE0A 1NHPA 3EKZA 4KFNA 2WHLA 1H51A 1SZFA 3PPGA 4ZMGA 1W54A 1LT7A 3TN5A 4DY1A 1H1ZA 1MO0A 2FLIA 2NVAA 3TYAA 1DWHM 2YX0A 5XIMA 3P2VA 3LTPA 4K7ZA 1E6NA 3HURA 3AWNA 5JBFA 4DUOA 3BGGA 4KETA 5FJPA 2GJPA 3EF6A 1TPC1 1K8ZA 3ZYZA 3OQEA 1M7XA 3TR9A 2CFFA 3RPTA 2PBOA 1TJRA 1Y65A 2WVUA 5FS9A 2YIHA 4MB4A 4QR6A 2Y0FA 3UVIA 5GNXA 2A3BA 4QX4A 5DQPA 1GXFA 5I7GA 3TJLA 4JTGA 4HYWA 3V75A 1J0IA 3E74A 2AQWA 4QLLA 3WEZA 4JHZA 1OFRA 2ZX9A 1DXLA 3N4AA 2WPGA 1NDVA 4F0MA 4RNJA 5JIPA 3IAQA 4KCVA 2I57A 1TV5A 3OLDA 5HNTA 2IW0A 5D38A 2JFEX 4U2ZA 4NAEB 3GVWA 3VKJA 2DGAA 4NVTA 3F4CA 2XH4A 2WP6A 4DJED 3DGZA 3TTYA 1O1HA 4Q4KA 3QFEA 3AJXA 2CETA 1KBKA 2JQXA 1Q5MA 1YDNA 1V6WA 1TA3B 1ICPA 3CC1A 2ZZ4A 2BVDA 1RK5A 4L4LA 3WK3A 2E5CA 5DXXA 4Q8QA 1KGUA 3ZVHB 2DW6A 2J8FA 4MNMA 2NV9A 2V5CA 4IWWA 4LS0A 2TODA 1Z3NA 2X7WA 5E1QA 3CAKA 2NV2A 4LF1A 2Y8VA 2NLYA 1LT8A 2A7PA 1V0KA 3N9RA 2J27A 4QE4A 3UYIA 4GX9A 4JZ5A 3SECA 4JQAA 1UR0A 2G3FA 4PEEA 3VIOA 2VTFA 3N29A 4DNMA 3F4DA 3GE7A 1VYRA 3BLFA 1FFVC 3KXQA 3ZOAA 5TF0A 1LUCB 3P81A 2GQWA 2BY2A 2QDEA 2IQ0A 1EYEA 3VIKA 1JFHA 5AFDA 3H2CA 3VOIA 3BLOA 3W7OA 4AC7C 1KFKA 2JIWA 2UZ9A 3LCXA 3A7RA 3HGJA 1GOXA 1JQVA 1XFCA 3XISA 1JRPA 4G7FA 4M7SA 1QNPA 4MKNA 5A8MA 3BZJA 3AO0A 2ZZ3A 3H8AA 4AVFA 1TV8A 1X39A 2WCGA 4Z1BA 5JIWA 5I00A 1GVSA 3UZWA 4X60A 3GG1A 3P84A 5ECUA 4LEQA 4XZHA 5MKGA 3P0WA 2J74A 4EQXA 4W7WA 5HJXA 1NP2A 4GY1A 2AOSA 4TV6A 3BLEA 1GVQA 1QBAA 4EKJA 4J28A 4GBDA 4ZVJA 1HKIA 3W25A 1XIHA 1ONEA 4IJBA 4AIEA 1SM9A 1L6WA 4GY0A 4AWTA 3DENA 1XSJA 1MNSA 3Q67A 3GB6A 1GYLA 1G67A 3URHA 1QR7A 4UWMA 5CJ5A 3LLXA 3M44A 2E1WA 3NZ1A 5J5DA 1LPFA 5D9MA 1C8QA 3V3WA 4MJZA 1XFBA 1XQKA 5IHRA 4RZ4A 5XIAA 1CPUA 2ACRA 3G0SA 1US0A 1V3MA 3V36A 3UA3A 3M0IA 3UT0A 2PDIA 1RCOB 3L0GA 1P0DA 4MY1A 3THDA 1VKFA 1SJBA 2HVMA 3V5FA 4CLMA 2WO5A 2WB5A 4O10A 2JKEA 3MHFA 3NQAA 5AYZA 4HU3A 4GPNA 1DE5A 4JTTA 4US5A 5JH2A 1QDSA 2E8ZA 1VQZA 4FA3A 1QNVA 4LEFA 1ZP4A 3GG7A 3MDWA 1H61A 3HPFA 3TIMA 1DP0A 1OJTA 5K2ZA 2J7CA 3ZSSA 4F48A 2WZIA 4YHGA 4BURA 3VD5A 3WBEA 1CI1A 3W3OA 4LQ1A 4BQ4A 1GQLA 3BV4A 4NXSA 3CS2A 1GJWA 1GG0A 3GXTA 6CGTA 3W7GA 3HU7A 4AW7A 4PB4A 3MCOA 1ITQA 5DT7A 3WH8A 1YEYA 3W01A 4GE8A 3KAOA 4MIMA 3GC2A 3QJAA 3DFHA 3FVDA 3LY0A 1F3WA 1Z48A 3CMGA 1NWTA 2WMIB 3RILA 3W4RA 4XQ6A 4ZTXA 1HKVA 1WXZA 4FLOA 4GQ0A 4RCXA 3SCPA 4H7ZA 4DM1A 4E2DA 1XICA 4D8AA 1I8JA 4O53A 3T6CA 1E6RA 3KTXA 6PTDA 3LPGA 2OX1A 3PPCA 2QIWA 4H4TA 4LNCA 1QVBA 3VKKA 4TX8A 3IGXA 3SADA 3NZQA 3DECA 4AIOA 4FXSA 4JIIX 3TQVA 1SJCA 2PCQA 3PBMA 3E3HA 1X8CA 4N42A 3VDBA 3W82A 3BANA 4O16A 1WYGA 3CWOX 3S0CA 2QQ6A 2FH8A 5CLWA 3QYQA 2PUZA 4KCWA 2AL1A 1VPXA 2WM1A 1TG7A 4AZBA 2UV8G 1E4LA 1WZLA 3WL0A 3ARSA 3GDKA 3IIPA 4N0RA 4LW7A 3W6LA 4J57A 1EPXA 4HK7A 1SSGA 3CZEA 3UNTA 3S47A 3B9EA 4LSBA 3PUEA 4HKPA 1DIDA 4JAWA 5KITA 4DAIA 1S5WA 1OC5A 3ANVA 3OPSA 4JQ2A 2F5ZA 3KEHA 3IRSA 2Y7EA 3LU2A 2OSWA 4B9YA 1Q7MA 2ON3A 1W8GA 2GVEA 1DJZA 2PLCA 4ZODA 2ODOA 2VC7A 3SGGA 1YNPA 5REQA 1TYGA 2QUMA 1N5XA 5A6KA 1ZJBA 2XZ7A 3D47A 1QHOA 4PEKA 1JCMP 4NZCA 3TUUA 4JGDA 5E6YA 4YTTA 3CIXA 1WYIA 5D03A 1EDTA 2NVCA 2YAUA 3LQLA 2YDSA 4JTUA 5I03A 1KFBA 1F6YA 4IICA 5I3HA 1Q4WA 3BMWA 2PGWA 3N9KA 4A6GA 2I9EA 3FK4A 4XD5A 1ISYA 1ML1A 4WY0B 5KZ6A 1RPXA 3WQVA 1JYVA 4RW3A 4DI8A 2P0OA 1J4EA 4O13A 4IL2A 4MB1A 3ZJ8A 4JKMA 4JL1A 4QSHA 2PZNA 3R8GA 3GHRA 4IGHA 4QQ3A 5FS8A 4P61A 2X40A 2XGIA 2CBVA 1ZPTA 4XAZA 2GZXA 3GR4A 1BYAA 3DI0A 1A0DA 3M1ZA 2V3BA 3PFMA 2Y5SA 3GIPA 4O4VA 3CGEA 1HUVA 4TVWA 4MB5A 2Q8ZA 2ZYFA 2XN1A 4QS5A 4BA0A 3XIMA 3S83A 2OWWA 3SCUA 3BZGA 2V3DA 4HSHA 1E9IA 3L4ZA 1EHNA 1V3IA 4B5NA 3WDHA 5CSRA 1GV4A 2ZZ7A 2OG9A 5IFPA 5HMFA 3QMRA 4ASTA 1V97A 4IL0A 1KGWA 1QPNA 3CIVA 4KESA 4ZGYA 1B3WA 4DN1A 1F74A 4WOZA 1ESWA 3B8IA 4PFMA 1CXLA 1UD5A 3U2OA 1V0LA 3BPWA 2WC7A 3PJTA 3TFXA 5A6LA 5K9DA 1UW9A 4A3UA 3KL5A 2NUYA 5FF2A 1OT1A 4Z0JA 3WMLA 3SR7A 1R9ZA 5ABHA 5KZEA 2ZBTA 3RLVA 3BK0A 2Q8XA 3E2QA 1PZ1A 3L4TA 1MEHA 3WELA 2FFIA 3EZ4A 3NL6A 4FALA 3CGBA 3VKBA 2X1TA 2WMFA 2HROA 1XWYA 3DHFA 3QRHA 3H22A 4WHBA 1XLFA 4CNSA 3APYA 3ATYA 4UMAA 1A4LA 1TMLA 4OGZA 3EXTA 2VR5A 2BSLA 3GXMA 3T81A 3S5ZA 3HOJA 1RK6A 2DT1A 1RD6A 4PULA 4ZOEA 3ARRA 1G94A 1H0IA 1UPPA 1MI3A 4RW5A 3SUTA 4DNHA 1XRFA 1CGWA 4JYDA 3K5XA 4LIIA 2TAAA 3ITTA 4W7VA 3E1F1 2F2KA 2GRTA 4UTKA 4JTKA 1EA9C 3LZ3A 3SIMA 1AD1A 4P8VA 4WDWA 5I79A 4GABA 5JCMA 5HWJA 3EWUA 1JZ3A 3E2SA 1VBJA 1XGDA 2H9AB 1KBIA 4XAFA 2ESCA 2BOEX 4U5KA 5DBTA 4FOKA 3TK7A 5CAKA 5LIXX 5K4XA 3UEQA 1EHAA 1GWJA 4KERA 1H7XA 1JCJA 1E43A 3SCWA 3KWSA 4PB3A 4PTVA 2GVLA 1UMLA 3RN6A 1G1YA 5CZ0A 4M7TA 4DJFD 3CPUA 1WDPA 5CBBA 3EUB3 2TPRA 1IF2A 4NRSA 1PZ0A 3H7UA 2CHOA 4MHBA 1W2PA 1UCWA 3L2LA 4ZB5A 1XUZA 3NXLA 2TRSA 4YWIA 1FWGC 1QI0A 2ZVRA 2ZXQA 3WMSA 1M7OA 4KMQA 3G1RA 2D20A 4LT9A 4CEXC 1NDYA 1QI2A 3CHCA 4WSHA 3R11A 1EJXC 3DHUA 1IYXA 3WDIA 3GAKA 3N2BA 2EF9A 5D2TA 1VB9A 4Q8PA 2IXUA 3GVQA 3NUKA 3VABA 2R14A 3TW7A 2XSAA 1VS1A 3L9CA 5HJLA 1V59A 3WNNA 1AJ0A 4AXNA 3NM1A 5E6ZA 2BY0A 4A21A 5D9NA 2OYKA 4A2SA 3R1ZA 3UCDA 1TO3A 2OZ0A 4WD0A 3KDOA 3GRTA 4OV9A 3W7NA 2ZUWA 1Q6LA 3I3EA 3A13A 2PLJA 2GGJA 3F03K 4ZE4A 2WW5A 4TQTA 1EEXA 3LPOA 1MMFA 2WANA 3K1GA 4IFKA 4TVDA 1KFLA 4UQBA 1EP2A 3NQ8A 4KEVA 1XYLA 3SAZA 3CAWA 1CZ1A 3S2NA 4XK2A 3BOLA 3DFNA 4P7LA 1PCKA 2XSBA 3ZR5A 3IV3A 5FJUA 3GDTA 5DRCA 4EXAA 4LFYA 4LA1A 2CBJA 1GTHA 4U28A 3OC4A 1RCQA 4MMWA 1Q6DA 1QW7A 2Y88A 2V69A 1AH4A 2AGTA 3A9BA 1XBYA 5HOSA 1KTCA 3OGVA 1DOSA 4Q7BA 1IQ8A 5EPDA 4B4HA 2G8ZA 4L4OA 2BGNE 3IVSA 3HQPA 3QHNA 1TJPA 1EJVC 1TWWA 2DUZA 1W0MA 3UNDA 1GUVA 1SU5A 4EIVA 4NZ4A 4Q4QA 3ONBA 4WZHA 3II1A 4GH1A 4Q33A 2Z6JA 5M17A 3KBSA 2J7BA 3FLUA 3A5FA 4A8LA 4CEUC 4V1XA 1ADSA 4DO7A 5G2HA 1RY0A 2QS8A 2ANUA 3LTYA 3O06A 3UJFA 1KCZA 4DO4A 1RLDA 2HPIA 2DIEA 3GXPA 4B15A 4YTRA 5LGZA 1RUSA 2C79A 1X96A 4HNLA 4PE8A 5IBXC 3UWYA 2GGIA 1X1ZA 2WPBA 3QPZA 1HXJA 2OYLA 2CLOA 4JN6A 3EWBX 3VUSA 3AMDA 1V3KA 4LGXA 3LB0A 2V2HA 4PUMA 4ACZB 3O1NA 5A2CA 4XISA 2FZMA 3WD2A 1VBHA 5M5DA 3TA9A 3RM9A 3M0XA 3G1DA 4JX6A 1EWEA 4RK8A 3W7QA 3BWWA 4QEEA 4UTJA 1MXSA 5D05A 3W7CA 3I10A 2PDPA 3BXWA 1P6WA 4MJ4A 3BJTA 4N9BA 3KP1A 3R2GA 4A4AA 2CLKA 3U5UA 1PSCA 5DEZA 2GSJA 1R38A 3PTKA 4JN7A 3OVQA 2ZDSA 4MKVA 3B05A 5FF4A 1HNYA 1P5BA 5BMXA 2UY3A 3PWIA 1AJZA 1CX9A 3UGRA 3MBFA 2OFJA 5A6BA 1C8YA 3C5QA 1JL8A 3NVWB 8CGTA 3PZQA 1KFEA 4KIEA 2IKGA 3UG8A 1TYPA 1TQJA 3G1YA 4GINA 3HV8A 3T4WA 1WDDA 2PDYA 3SJ3A 1Q6RA 2MNRA 8A3HA 1EOMA 4LUJA 3WQ4A 3RLGA 3HBLA 1GESA 4M0XA 1LP6A 3FXGA 2WBKA 2UY2A 2YA2A 1FP9A 1LROA 3TDFA 1AD4A 2C15A 3TYUA 5GJMA 4LAMA 3NO3A 2ICSA 1PDYA 2VC9A 2ZTJA 3W38A 1K8YA 3W7HA 5REQB 1VRXA 5A6JA 3PSWA 3MUIA 4RUBA 1NAL1 2W6RA 2P88A 4KKXA 1F4AA 1XL9A 3TC3A 3FHQA 2WYSA 3S1XA 3PWGA 4M1BA 5HATA 1DYSA 1Y0EA 4U10A 3UWVA 4QAIA 2R1NA 5LZLA 3NXFA 4HA0A 3EOOA 1AL8A 4JTCA 2VDHA 4X61A 3MMWA 4NAFA 4CQ8A 4JFUA 3VE9A 1V93A 3BAYA 2R82A 2ZWYA 2QPXA 4C60A 1Z32X 5A6TC 3GX9A 3T8LA 5AVNA 4NU7A 2YL6A 5IRPA 1LVLA 1XJBA 3WD0A 3OGRA 2BLEA 1SYTA 1GVYA 4BI5A 2DEPA 2GR0A 1R3VA 5FJRA 2OO6A 3LCIA 3DKLA 3E49A 5CPTA 3U9IA 1P0BA 1ZCOA 4GFIA 3TQPA 3LRKA 3UPWA 1T99A 1K77A 3OHIA 5D8WA 4PA8A 3AI0A 3IPWA 1GW9A 3INPA 3WJWA 1CTNA 5H8PA 4YTSA 1TV7A 3CB8A 4CNNA 1QPOA 4HT3A 3C2OA 1W17A 4UFJA 4F66A 1X1OA 4M52A 4A05A 5C9WA 2GGHA 4RDWA 1SO6A 2XVPA 4GG9A 1RVKA 4YCPA 4JIPA 4PTXA 5CPNA 3C6CA 4NNAA 3SN1A 1K03A 2Z24A 3CL8A 1H09A 4QDPA 3EBVA 1UD3A 3WJXA 1J01A 2ABAA 3ECQA 1GKQA 3H7VA 5CZTA 5JXQA 4R53A 3CEPA 3AS0A 2DQWA 3IEBA 2YLAA 3BLPX 4WX2A 4F4RA 1DQUA 3I7QA 3ARUA 4AXKA 4OWGA 2OVLA 2P10A 2BXZA 1KW1A 1C92A 1ITXA 1FDYA 3DDMA 3GKAA 4PZVA 3TW6A 1QHPA 4HK6A 3BO9A 3H2FA 2WMJA 3EX1A 3VGHA 4D71A 4FF5A 4DJDA 4W9TA 1JCYA 4KWOA 1FHLA 4M1RA 3C86A 4ADSA 1KBBA 3PZNA 1SR9A 3QZEA 1RALA 3H6OA 4ERIA 1S5MA 2PGFA 3C61A 1FIQB 5I78A 5DY3A 2YXOA 5F4WA 5CSSA 1JDFA 4O15A 3TXVA 1M03A 3QF0A 2GWNA 4E2BA 1CGUA 5BXRA 2C8NA 2WSYA 5BXSA 4GIEA 3B9OA 1WV2A 5IBXA 4W7UA 2G3JA 1VYSX 3WQ5A 2CLPA 1RJQA 4EWJA 3V0UA 5GNYA 4BEQA 3PZMA 4KCUA 2BHYA 2O9PA 3GRSA 4D2JA 2F7FA 1Q6OA 5C5YA 4W93A 1WAWA 2QGHA 3HG3A 6A3HA 1TE6A 2J3NA 4LUYA 5FAGA 4DBEA 2EBNA 1T8XA 3I3BA 1I2QA 1CW2A 5A8GA 3REQB 3KLKA 3PG9A 2DZXA 3PZ9A 3SY8A 3LHUA 1YYAA 1CCWB 1HVXA 3RDKA 1JAEA 3IC9A 5A95A 5A69A 1XYFA 2PEVA 4RLIA 1JD7A 3ZM8A 3V1HA 3P0XA 1F5ZA 3URAA 2WZEA 3TOYA 1L8NA 3WH7A 4DF2A 4CVUA 4GXPA 1VEMA 3LGDA 3GYCA 4ACZA 1C9WA 3WNPA 4C6MA 4CU8A 3V0SA 4LCQA 1DIOA 3CV1A 2ZICA 3T0CA 6TAAA 3DN5A 3S2JA 4GCAA 2HDJA 1ISWA 1OCJA 2EO7A 2NX9A 1TIMA 2E5AA 4ATLA 3CLWA 2D2HA 2NXGA 4MNKA 1ME8A 3SM0A 3N2CA 1XANA 2XHYA 2QVHA 2VFGA 3AU6A 1VFSA 3ZLFA 4OHQA 2WJFA 3AS3A 1R86A 2J7FA 4JIQA 3EX3A 1NM9A 4JX5A 4YXGA 4AX6A 4C65A 1BG4A 3S2CA 2VFIA 1KTBA 4HVXA 2C14A 1IT7A 4GZIA 3BARA 1GT8A 1S2AA 2CWXA 2NQLA 4ACYA 5SWUA 3W23A 1HW6A 1MW3A 2QDGA 1BVZA 1XIJA 3H4GA 1FA2A 4G9PA 4DO6A 4PH6A 1A5LC 2WPFA 2ISFA 5G1YA 3S8HA 1HJQA 3TJ4A 1SJDA 3WQPA 1DWFM 4L4PA 3UY7A 1UOZA 4YMZA 3OO2A 1OX6A 2FTWA 5I3IA 1GRFA 4N7QA 3VOCA 4QCFA 1X2GA 3ZO9A 3HFTA 1DORA 4OFCA 1E0UA 5A2BA 1W3NA 3C56A 1J12A 4KRTA 1VP5A 1GKPA 4NASA 2QCEA 3W53A 4OTKA 2QJGA 3SCRA 2I56A 2CLHA 3VNZA 3NQFA 3OEXA 4LAOA 3UR2A 4HCLA 1K70A 3I68A 1GNXA 1LOLA 4P5UA 3N73A 2OOGA 5HR7A 1GSNA 3SCSA 4G7EB 4PMJA 4HP5A 2DSZA 5CZJA 4W8AA 4M8UA 4O1EA 4HIBA 1XDJA 4GNKB 4UTTA 2XSXA 3V18A 4EPKA 3VIPA 3CH9A 3U57A 1PTDA 4GUGA 3T40A 1GGOA 3EB2A 3PY2A 3IGSA 1B0IA 4XZMX 3LADA 1M53A 3L67A 5TNVA 3QSRA 4I8DA 4MWAA 1T8QA 4K1GA 3W84A 4QBXA 4BS0A 3EWCA 3BV7A 1R87A 3AHYA 1Z9AA 2XISA 1J9YA 2YB1A 3P6LA 2OGJA 3ALFA 4LYPA 2PA6A 1R85A 3GRIA 1I2PA 5KMYA 2I9UA 2XFYA 3ZLGA 1E6XM 5CG0A 4M6QA 4KEMA 4LBSA 1JR1A 2EJ1A 5A8NA 2YZRA 1JCXA 3ABOA 3N04A 1A0EA 2ISVA 1JOAA 4LXFA 3C2VA 1OD8A 3KVKA 2O9RA 1EFZA 4CQCA 4TU1A 3DFTA 2G4JA 3QOMA 1D7YA 3LPPA 4O0KA 1FKXA 2YFOA 4Q4OA 1CNVA 1M68A 3PBWA 1Z41A 3SSZA 5BRPA 4DPPA 4YVXA 3OBAA 1GKRA 1PPIA 2IKHA 1DIEA 4JN8A 2RH9A 4PL1A 1EBHA 2V5DA 3R94A 3TCEA 3FVMA 3MTWA 1WCGA 3FSTA 3AIWA 4O57A 1PTGA 4DUWA 2YBVA 4JYFA 2PDFA 3DHPA 2IKJA 2C3CA 4PTDA 3TLQA 3AM9A 5D32A 4FXJA 4GVIA 2X99A 3M7WA 5G5HB 1N7KA 1N62C 2CLLA 1JCTA 3G0XA 4YWSA 3IJ8A 5FCZA 2H8ZA 3IGUA 4EVZA 1MVYA 2CC0A 5E70A 3AMZA 2ZWZA 2ZX6A 4I7UA 3UWZA 5E0KA 3MZ2A 4G5DA 3VNDA 4Z1DA 2Z26A 2RGMA 3GNDA 3E38A 4W89A 5RUBA 4H9XA 4BI7A 4L1GA 1W1A1 4FK9A 1AZ1A 1DE6A 4I9JA 2QCCA 3WD4A 2VURA 3TE9A 1GVRA 5DMNA 4P7QA 3H53A 1E4MM 5DLCA 1HO4A 3GTFA 1UBPC 4UCFA 4CNOA 4H8VA 1GVEA 2A6NA 1JI1A 1VBRA 4NL1A 1YXYA 4OIFA 2VZVA 4NX0A 1LYXA 2V9DA 2QIIA 3FW6A 4K6AA 1W1TA 5G4WA 4EM3A 2PWFA 3RPMA 1ITCA 3P62A 2JF6A 1QI3A 5EL1A 3QMSA 2EQ9A 4YNGA 1GOIA 1UJPA 4PBGA 3WG6A 4XUYA 1FWJC 4C6QA 3GH7A 3QZAA 3TJXA 1XUUA 4F0KA 4NUWA 3SN4A 2W3ZA 3S1WA 3T0BA 2J6XA 1HVQA 2VYOA 4C6IA 1YDYA 3RU6A 3FS2A 3LLFA 5FF7A 2YJQA 2B7QA 4KCTA 2GJXB 1H7WA 2PDWA 3DGBA 4CQDA 4DEFA 4QXIA 4XWUA 4IMCA 2A7NA 3GWQA 5JRBA 1KNWA 3AN1A 2X50A 1TRIA 4NG3A 2REQB 3TFCA 5E09A 1RPKA 3L65A 2Z29A 1TPWA 4O1FA 4K68A 2ZRYA 3EDDA 4F0RA 1OBAA 2QJMA 3DFYA 3UU0A 1DJIA 3NO5A 4H50A 2J47A 2VCBA 3Q45A 3OG2A 1KCXA 5A6MA 2R1MA 1KM0A 4MZYA 4KQNA 1GRAA 4MSSA 3W75A 4GACA 4WF7A 2VENA 5AYIA 4H7VA 1TTPA 1O5KA 2HTMA 1VFOA 3AXMA 2E9LA 3QLDA 1H7NA 4HMCA 3MI6A 3T2OA 1VD6A 5D2WA 1H1NA 5KVIA 1G4PA 3WLRA 1E6SM 1HQTA 2VO5A 2XTKA 3ARPA 3NZPA 4M24A 1SFJA 3W70A 4A8RA 1GVOA 2WMGA 3U7VA 3CIWA 5LIKX 2J66A 1J0YA 3C3UA 2QUUA 1HL2A 3NYDA 1E9LA 2H3BA 1LM1A 3MV11 2WOWA 1ZQ5A 5A6BD 1A53A 5HQEA 3WJYA 4YLWA 1US3A 4EANA 2V68A 3OBKA 3TWAA 2AL2B 4GVFA 1PZ3A 1TTQA 3DZ1A 2EPKX 4G1KA 4LS2A 1PHQA 3IJDA 2Z6IA 3KWXA 2W3SA 5U7SA 4A3RA 5DO8A 4ZZ9A 3W86A 1YBQA 3O6AA 4MFEA 2CLIA 4RNFA 4QJ3B 1KQYA 1IZCA 1TV2A 1WE5A 4GWEA 3EX2A 4AG0A 1CENA 5LXXA 3OYZA 3W7JA 2VHLA 2ONEA 5LIYX 3GSMA 5KSWA 3WLJA 4TUFA 4XG1A 2VGFA 3NOEA 1KFCA 3OIXA 1EJSC 2NUWA 3KVJA 3OBEA 4NKCA 2R1LA 4WY0F 5A8QA 3CUHA 4WXZA 3GY1A 4F0LA 3KL0A 1EXBA 1KBLA 2BX7A 1DJHA 4IISA 1KWKA 3A64A 4FZIA 4H4IA 4BK9A 3CBWA 1GQIA 5CZSA 1QTWA 1DXEA 1IT8A 2WBAA 2ZX8A 5A6SA 1RQHA 3T44A 5C7HA 5H2ZA 1A5BA 5E0CA 4K8EA 1AG1O 4B91A 2CKSA 4O11A 1ZRQA 4BV6A 2X0SA 4LY4A 2GL5A 1FCBA 4HMDA 4MZ8A 3VM7A 3USZA 1JRBA 2DZUA 3UERA 6TIMA 2GDQA 3F1QA 4KT2A 2BOFX 3AOFA 1OFAA 1HL9A 3B8SA 1XINA 2HPMA 4E0CA 4B3KA 4G1NA 4U4MA 4PRWA 1WP6A 1GRHA 1PWLA 3VZXA 3NRZB 1W3KA 3DGHA 2PDXA 1AQHA 5CPLA 1TWZA 4DJDD 3USBA 1C7TA 5CBJA 3WQFA 3LEPA 3NURA 4S3FA 1M5WA 3EMCA 2FB2A 1Q7ZA 3UXAA 4HOZA 3VOHA 4TVYA 1HJUA 1Z6KA 5BNKA 5K9XA 5HPOA 5DY2A 1J18A 3QY7A 3PNZA 5EY5A 2PURA 2VQUA 2EQDA 3SBFA 2QF7A 5D4YA 2PTZA 3KBVA 1MUWA 3N3MA 5FACA 1PE1A 2DU2A 1LL7A 1ZBVA 2DFAA 1A0CA 5DCEA 4GRTA 3SRDA 4IF2A 1MFUA 3CPGA 2OTDA 3OTRA 1A5CA 1GYMA 2Z25A 1GREA 3VYLA 3B8UA 3ABQA 3NNTA 4B92A 1E55A 2E5BA 2MANA 4HCHA 1J96A 4GZJA 1MYRA 3S6TA 4AH7A 1SQ7A 3PN8A 2DT2A 3PB0A 1ZBKA 3RITA 4FNSA 1EX5A 3L2MA 2WHJA 3TN4A 3O16A 3AS2A 3SIZA 1AJ2A 1K9DA 4DXKA 1JFXA 4AQLA 3DFSA 4MYAA 1ISXA 3GYEA 3FG2P 2X42A 3EWYA 4B5UA 2ALRA 4U3CA 3T09A 4D6FA 2V67A 1E9ZB 3AYTA 1OY0A 5DCBA 5G1TA 2WNQA 2Z0IA 5AVHA 1O66A 4EAMA 1WKYA 1R46A 2H90A 1P48A 3VDCA 5HWNA 4PTWA 5U1OA 5JCKA 1I45A 3KBJA 3EX4A 5H91A 1EZ2A 3ITGA 3TX9A 2FIQA 1R2RA 3K8KA 4IOTA 1KM6A 1P1MA 4BF9A 3AIEA 3QGVA 5G5IA 3U4AA 4JD4A 4DVOA 1FH8A 2X8RA 4EF9A 4R27A 4JICA 1HG3A 4GUIA 2X16A 5M1TA 4I5UA 4LUIA 4LCRA 1Z42A 1RV8A 5A5WA 4DLFA 2UY4A 4PCSA 3CB3A 2V63A 4YVPA 4H6EA 1ZTVA 1K9EA 1UJQA 5BOEA 3VA8A 1VCGA 1KXVA 4M6PA 5ABGA 2WC4A 4Q22A 3DU0A 3UR7A 3BJFA 1D8CA 5BOOA 1OZQA 1TTJA 4V33A 5EMLA 1XLGA 2VX7A 3R7MA 3DK9A 3BLIA 3LSBA 5CLTA 3LS9A 4U31A 1QO2A 4JEQA 3TN6A 3E0VA 4TTGA 7REQA 4DI9A 4CN1A 2P3EA 3CQKA 2VL4A 4OBSA 2WCSA 4HU4A 1R3YA 1EGVA 2FHCA 2RJGA 4NJKA 1SGJA 1GQKA 2WBGA 1XI3A 4KEUA 3PG6A 2ACSA 3NJ3A 3O0HA 1F6PA 4H9MA 5CPMA 1BTCA 5H1WA 3TZFA 1HGYA 2VC5A 3S5OA 1YE4A 3VD3A 1O6IA 2XN0A 1JXJA 4HJFA 4ZENA