3P93A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
403
structure length
384
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF D-MANNONATE DEHYDRATASE FROM CHROMOHALOBACTER SALEXIGENS complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 144
structure length 384
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3p93A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3p93A01
2OO6A 3ZVHB 3ENLA 3U9IA 3RGTA 1EC8A 3CYJA 4M0XA 3GC2A 1YEYA 4JN7A 3ES8A 5FJOA 3CB3A 5FJUA 3Q4DA 3FJ4A 2AKZA 4MGGA 4GYPC 3DG7A 2XSXA 2HNEA 2P8CA 3P93A 2ZC8A 1EC9A 2ONEA 3TWAA 3ZVIA 3I6EA 3SSZA 4DYEA 1MNSA 3R1ZA 1SJCA 3MY9A 3H70A 3UJRA 3VDGA 3QN3A 4ZCWA 4DN1A 3OW1A 3PK7A 3N4EA 1F9CA 4DWDA 2PU1A 3KUMA 1ONEA 4DXKA 2QDEA 2XH4A 2QJJA 3R0UA 4KPLA 2XH7A 4HN8A 3MQTA 3R11A 3RO6A 3CXOA 3RR1A 3MZNA 2GGGA 1DTNA 3VA8A 3FCPA 1MUCA 4HPNA 3MWCA 3CK5A 4X2PA 3NXLA 3RRAA 6ENLA 4G8TA 2QGYA 2POZA 4H83A 4IL2A 4GYPA 3V4BA 3H8AA 3P3BA 1KCZA 1XPYA 4YWSA 2QJMA 4HNCA 3ZLHA 4K1WA 2HXTA 3SN1A 3QLDA 2I5QA 3OZYA 3B97A 2PTYA 2PODA 1TZZA 4GIRA 1ELSA 2DW7A 3VC6A 3ZVHA 2PP0A 3N6HA 4HCHA 3VFCA 1KKRA 3DEQA 1L8PA 1TE6A 4E6MA 2MNRA 2PS2A 2MUCA 4H19A 3JW7A 4KT2A 3I4KA 2OQHA 3D47A 4IP5A 1MDRA 3UJEA 4E8GA 3VC5A 3PFRA 2QQ6A 3EKGA 3GY1A 3JVAA 3VCCA 4M6UA 2AL2A 3MKCA 3IJLA 2FKPA 4GFIA 4IL0A 3IK4A 3UXLA 5FJTA 3UXKA 1OEPA 2P3ZA 4EWJA 3S5SA 3QPEA 3EEZA 4FP1A 4HCDA 2XH0A 4F4RA 2OLAA 3N6JA 5EU9A 1R6WA 2CHRA 2GL5A 4HCLA 3FVDA 1R0MA 3STPA 1SJAA 1SJDA 2OG9A 3UJFA 1EBGA 4ENLA 2P0IA 2OPJA 1XS2A 2OVLA 4GMEA 3SQSA 5BOFA 1IYXA 1TKKA 2DW6A 3R25A 3OZMA 4HYRA 1EBHA 4MKSA 4K2SA 3PWIA 4ROPA 2OFJA 1PDZA 4DHGA 1KKOA 2PGWA 3Q45A 3ZLGA 3GD6A 3N4FA 3H7VA 2OZTA 2QVHA 3MUCA 4IHCA 3SJNA 3TQPA 3K1GA 3OPSA 3DERA 3THUA 1JPDX 3DG3A 4Z17A 2OX4A 3T6CA 3T9PA 4JHMA 3TJIA 1P43A 2QDDA 3TTEA 3S47A 3TCSA 1NELA 2PGEA 5BOEA 1BKHA 1FHVA 4J3ZA 3PWGA 3T4WA 1MRAA 1WUFA 2PTWA 3DDMA 4DX3A 3NO1A 4A6GA 2PU0A 4KWSA 2OKTA 4IZGA 3TOYA 4K8GA 1JPMA 3UJSA 2AL1A 3T8QA 2GGEA 3V3WA 3BOXA 4H2HA 2P8BA 3H12A 3NFUA 3MSYA 4GGHA 4HNLA 1E9IA 2QJNA 2XH2A 3ES7A 3UCDA 1KD0A 3U4FA 2ZADA 4IT1A 4MMWA 3DGBA 4E5TA 3SBFA 4GGBA 3DIPA 3OP2A 3FV9A 3QTPA 3HPFA 3SN0A 3TJ4A 2HXUA 4J1OA 5IDZA 1WUEA 1ECQA 3TWBA 2P88A 1JDFA 2OZ8A 3VCNA 4IP4A 7ENLA 3I6TA 4E4FA 2OZ3A 3CT2A 5FJPA 3CAWA 2PSNA 3DESA 4JN8A 2PP1A 3R10A 4E4UA 3RITA 3SN4A 3V5CA 2PPGA 3DFYA 3BSMA 2NQLA 3DG6A 1EC7A 3ZLFA 3IJIA 3NZGA 3BJSA 5J04A 3OTRA 4A35A 2PTXA 2XGZA 3IJQA 3DFHA 4H1ZA 2PCEA 2RDXA 2AKMA 1BQGA 1NU5A 1PDYA 5FJRA 3UGVA 2PP3A 2OQYA 3QKEA 2AL2B 2GGIA 2GSHA 3UCCA 4GISA 2GGJA 3R0KA 1JCTA 5ENLA 1P48A 4Z1YA 2FYMA 4A3RA 1W6TA 3RCYA 2PTZA 3V5FA 2O56A 3FYYA 1SJBA 2PMQA 3D46A 2GDQA 1MDLA 3JZUA 3FXGA 4ZA0A 3TW9A 3UJ2A 1FHUA 2GGHA 3GO2A 1RVKA 2PA6A 2HZGA 4KEMA 4FI4A 3P0WA 4G7FA
chains in the Genus database with same CATH superfamily
5HPCA 4KWUA 3ZVHB 1Z41A 5AHMA 3ENLA 2W6RA 3RLGA 3TEVA 1YE4A 5DMYA 3QM3A 3JZEA 4XZMX 3SRHA 1UBSA 2PRMA 3LCGA 1UMLA 3DI1A 1OFRA 4MJ2A 1FWNA 2YBTA 4OQVA 5ECUA 1S46A 1T40A 3GAYA 5DRCA 3L4WA 4AIOA 4UTTA 1TQXA 4DYEA 2NQJA 1WXJA 1A4MA 1UR8A 4AD5A 3VDAA 4Q8WA 1R3QA 1FH8A 1XLDA 3ARRA 5FEPA 1DP0A 2HRWA 1VFOA 1UKPA 3ARZA 1XGEA 2NT0A 4EXAA 3VILA 4GX9A 2VX4A 1YLVA 3LG3A 1GVEA 2QDEA 4ES4A 2QJJA 4KPLA 1W8GA 4OT7A 2R8WA 4F0KA 2DZTA 3UERA 3CXOA 3K4DA 1EJUC 3L23A 3N25A 3BMVA 2GUBA 4MYXA 5TD4A 1T96A 2ZYFA 5BWFA 4RLIA 1V59A 2EQ7A 1BYAA 3GDMA 4HU8A 3CWOX 1NARA 1RK6A 1X1ZA 1J0HA 4QDPA 1XPYA 2V3EA 3B9AA 3E02A 3TIMA 3OBKA 4B92A 4E2DA 2C1IA 3A7UA 5LIXX 4CQCA 4JTTA 4MB3A 2SFPA 2V2DA 3KCOA 1R87A 1VFMA 3KZSA 1GXFA 4OOZA 4WXZA 3KWXA 4JIEA 1A3WA 4OVXA 3A21A 2CESA 5MKGB 1E70M 3VYLA 5A6KA 1G4TA 2BY2A 3QY8A 1LQ2A 1JCYA 3I3BA 4S3EA 4XAYA 5AHNA 1A5MC 1Y0EA 4HCHA 3HQOA 3H2CA 4I5UA 1KXQA 4DJDD 3ZJ7A 4A05A 1LBFA 3DYPA 1KA9F 1EDQA 1UQYA 3WNKA 3OODA 3NZQA 1B54A 1ZJAA 2P1FA 4GUGA 3HM7A 1JZ2A 1QPKA 3LV5A 4C6CA 5C9ZA 3EKGA 3KDOA 3ZR5A 3BLEA 2VENA 1GYMA 2PCQA 2ANUA 3QR3A 5IXEA 2IPFA 4APNA 4PSRA 3W6YA 4Z2JA 4JCMA 3GNDA 1PZ2A 1XDLA 4M1BA 2VX7A 5K4ZA 4HYVA 2XIIA 1MEWA 4I8YA 1ONFA 1PKLA 3S5SA 1XDIA 3B40A 1TR9A 1UKTA 4L9XA 1GYLA 4GI9A 3VO0A 1QI4A 1RLDA 3AIUA 2XVGA 1SJAA 3GC4A 3RU6A 4UQEA 4YIWA 3S5OA 2WBGA 4H4PA 5F2LA 5D30A 5I02A 3P74A 5HPOA 2HBXA 1UKSA 2DW6A 4HMDA 4LVFA 5HATA 3WD3A 3QW3A 3GFZA 4GACA 1QHZA 4IMGA 3KFTA 4UQ9A 1J0IA 1J96A 2E5AA 1Z48A 1LG2A 3GDKA 4XZ9A 4WKFA 1PXGA 2PGWA 4DELA 3ZLGA 3LHVA 5AZ1A 5I3GA 1XBZA 1TJ2A 4L5ZA 4P7OA 1YADA 4NRRA 4Z2GA 5AECA 3ID7A 3LPFA 3QC0A 4EF8A 3MS8A 4YS1A 1IQ8A 1R85A 3G3DA 1E72M 2Q3OA 3F2CA 3CZKA 2ISDA 3UETA 2DUXA 5AC6A 5FIPA 1XIJA 1ZUAX 3TQVA 2CCRA 1OT2A 1PV8A 3TTQA 3POCA 2Y63A 1H49A 2QPXA 4B5UA 4CU6A 3NO1A 4E2VA 3TOYA 2Y7GA 1ZJHA 1K8XA 4KERA 4XKYA 2FZBA 4BY3A 3EPMA 1OY0A 4NYYA 3LI0A 4ECLA 3ARTA 1E0WA 3MUXA 3BOXA 3FYPA 4LS0A 5HOSA 2D24A 3H12A 2E40A 4LUYA 4G6CA 1JCMP 3PJTA 3V35A 2GQ3A 5I2UA 1RK5A 1AFSA 3VMNA 3CTTA 3GIYA 1LRTA 5E1QA 1MUWA 1LVLA 2G3FA 3GU9A 1WKYA 2E77A 5RUBA 3UYCA 1QTWA 4E5TA 1PTGA 1TV2A 2XFFA 1RV8A 3DIPA 2W3ZA 3LNPA 1ZY8A 3M5XA 4CCCA 2PDBA 5I6SA 2QV5A 3GU1A 2Y88A 2GWNA 1I60A 2OYMA 3TWBA 4LX4A 3E9AA 2P0OA 1CGWA 1XLIA 4Z1BA 2YXOA 3LHWA 4DJFC 4H7VA 2EO7A 1KV5A 1V0LA 4KFNA 3W2NA 3BSMA 3F5LA 4CN6A 4JIRA 3N4AA 4G5DA 3EX3A 3C2FA 1ZSXA 3QSTA 2FZ8A 1C9DA 3HQNA 5REQB 1NDZA 1GOIA 2CHOA 4UMAA 1JPHA 3RCMA 1PAMA 2RGMA 4FX8A 4JHOA 4KCUA 2REQB 3WUGA 3OA5A 3PTKA 4R9XA 5CC3A 1GHSA 1DJGA 4GISA 2PDWA 3M7SA 4UZSA 3MDWA 2BB0A 5HNNA 3W2UA 2FYMA 4DZAA 3IC9A 3TX9A 3ARSA 1R2SA 3GVRA 5E9XA 1Q45A 3CMGA 4WY0A 3QW4B 4ZQPA 4Q4PA 2FPVA 3UGRA 1MOKA 3FXGA 3LTSA 3W74A 4C6JA 3STEA 1PS9A 2GGHA 3BAXA 4LIIA 3A3XA 1E56A 4G7FA 2BVDA 2PZNA 4AD4A 4L6HA 3BV4A 4C65A 1UD6A 4OBRA 3LXBA 1OCQA 3DH7A 5I3KA 1GQKA 4IOTA 3FFSA 1UP3A 4NJKA 5HNTA 4KFOA 4GHRA 4EAYA 4M80A 2QNEA 5C54A 1JZ5A 2V5DA 4IIHA 1RBLA 4MWAD 1XUZA 4WR3A 3ZZ1A 1XLKA 3S1VA 3GXIA 2PB1A 4YTSA 4LA1A 3WBYA 3L67A 3THAA 1WDPA 4ZCWA 4DN1A 1KFLA 1JD9A 3GYCA 2XU2A 3S1WA 4AWEA 3C5QA 3II4A 3K8MA 4J57A 3LMYA 3OVGA 4UR7A 4NAEA 1R7OA 3AOFA 1Q6OA 3MQTA 2W3RA 2V5BA 5TBOA 3MVTA 5XIMA 1GRBA 1MUCA 5CPQA 1FFRA 2J7HA 1UWIA 4L6DA 3KVJA 3G1DA 2RABA 1OFPA 1F3WA 3TW6A 3HBLA 3ELFA 3PG9A 1Y8BA 2XSBA 4OU1A 1C8YA 4DXVA 1LROA 3EOUA 3EOOA 3V4BA 2NV2A 3URAA 3WEZA 1OVDA 1BWKA 2F84A 1JZ3A 4GRTA 3IJ8A 3ZLHA 3W84A 1XH1A 3KS5A 1PPIA 4LWWA 3M0MA 3LLXA 3EOLA 5A6BA 4EM3A 2WVSA 4IXHA 1V97A 2XVPA 3D3FA 3OZYA 3LHTA 1VS1A 2GJRA 3R89A 5AKQA 3EANA 1OK4A 4TX9A 3MI2A 4GY7A 1M1BA 1SU5A 4V2XA 2I56A 3DH9A 5BMXA 1IZCA 1VRDA 3CUFA 1OYAA 4LEQA 5F7UA 1NM9A 1H5VA 1NFBA 4JKKA 3W6LA 5CGQA 1L8PA 1D2KA 3C8NA 3TMLA 4F9JA 5C7VA 2EPNA 5BXPA 3B8WA 1UD2A 1SSDA 1XR2A 4BF7A 4H19A 4LY4A 2OZ0A 4O53A 1TYGA 3I4KA 1MDRA 1W9VA 3ZFHA 3EDDA 1TX2A 3F5KA 4FPSA 3M1ZA 3CS2A 2BY1A 1VEOA 4B2DD 1VBHA 3FN9A 3AU2A 3WMSA 1NP2A 3RMEA 1XIMA 3LENA 3DFSA 3VD4A 2CITA 4MY9A 3IEBA 1E6SM 2BP1A 4XQ6A 2P3ZA 2Z00A 4DO5A 1MW0A 5G5GB 2DY3A 3PZ9A 1EP2A 3CEPA 1MYRA 3F4CA 2PLCA 2BV9A 2GL5A 1J9YA 1I2RA 3S5NA 3UZZA 5CJ5A 3CL8A 2Z6JA 4ENLA 7REQB 2DZVA 2E6YA 3LHYA 3WEOA 5CZSA 3EWCA 4AY7A 3S6TA 2PDXA 2BZNA 3MKKA 1X1OA 5A8OA 2BNJA 2VZUA 4D1IA 4OV4A 2DH2A 1A47A 4QM1A 1QPOA 1TJRA 4QROA 1MEIA 1S5VA 3BMXA 2GK1A 4QBXA 2VYOA 1GYNA 3KRZA 1RA5A 2J75A 3OIHA 4JDYA 4IHCA 1E6NA 1RA0A 1R9ZA 1Z44A 4FK9A 1HGWA 4O19A 4Z17A 1FWGC 1XV8A 1ISZA 1WZKA 1W2VA 3VD5A 5FL1A 1S2CA 1TA3B 2XN0A 4ZL1A 4J3UA 3IACA 4LAKA 1QUMA 1WE5A 4UTKA 4GJ1A 1GCYA 4H41A 4FNUA 3GXNA 2AAMA 1TFVA 2G97A 1P6WA 1PIFA 2H3DA 1GRAA 4PODA 4QX4A 1W3JA 1LWJA 3N04A 4KWSA 1KM3A 3R7MA 4GD0A 3BAWA 4I8DA 2NX1A 4XISA 1UA7A 2JK2A 4B91A 4OJYA 3AWOA 4J5NA 4Q4RA 4HKPA 2UWFA 4QLLA 3IS4A 2FFCA 2P8BA 4QCEA 7PTDA 2Z27A 1QNPA 4PUUA 4FOJA 1J0YA 2UY5A 9CGTA 2FLIA 2WPBA 1M7OA 1YXDA 4GVGA 3F2DA 4RNIA 3PZIA 2VEIA 3SBFA 1B31A 4GC3A 1GESA 2AQOA 5EA9A 3E74A 3CUGA 2CXEA 2EEXA 2DORA 2CKRA 3MB9A 1V03A 2ZTJA 3ARXA 5EBAA 3IJ6A 4Z2KA 3P84A 2OJPA 2VEFA 3MUIA 8RUCA 1F74A 4IFRA 3CZJA 4IX2A 4QJ4B 3EX4A 3B0UX 4C90A 3IVUA 3O15A 3UPWA 2OZ3A 3AM9A 1QNOA 4ZEPA 1EF2A 4KWWA 1WCGA 2YA2A 3PFMA 5I09A 2VWTA 1V3MA 3CO4A 4HNNA 4HN4A 2WQPA 4QG9A 2G3MA 2BVWA 4A35A 2W4XA 5HWJA 2J9ZA 2B7OA 3AXMA 3IJQA 3PPCA 4AF0B 1TPEA 3C56A 1W1VA 2AKMA 2O9OA 4LV9A 5T91A 2FDSA 5GRTA 4AD0A 2A6LA 2J6VA 1VFLA 4DJFA 5ENLA 2OOGA 4IGNA 1BTMA 3KCLA 4PBFA 5HULA 1TMHA 3WL0A 1JZ6A 3WLTA 5CBJA 2PLKA 4L64A 1NWUA 4XG1A 1GOOA 2OU4A 4EIVA 5AVHA 1X6UA 5EGRA 1JYVA 4E2OA 1O5KA 5GNYA 5PTDA 1HP5A 3LERA 3EOEA 3IJDA 3VMPA 3A7RA 1U5HA 3F5JA 1H50A 4B3ZA 4I9AA 5FF0A 1W3HA 3KVKA 4L1GA 4FOUA 3CEUA 5FJOA 4O12A 3F4DA 5IBXC 1E5JA 1V7YA 2FZ9A 3FJ4A 3TUUA 3O0KA 1EZWA 2IMRA 2XSXA 2Y85A 1V0MA 3TWAA 3C86A 1NHRA 4MLRA 3PZOA 5C5YA 3CUZA 4W87A 4ZQRA 3NWRA 4PL2A 4Q8OA 4BZYA 2TODA 2X0YA 4PMXA 1EA9C 3NO3A 4L7ZA 1ML1A 2POTA 2OOFA 2QIIA 4NJGA 2XH7A 1F7BA 4HN8A 2VGFA 3P5ZA 3CGCA 3RX3A 3WLJA 1GPWA 1HL8A 3V5OA 3DK8A 1V6UA 4ZQMA 1AK5A 3UU0A 4HPNA 4ATWA 3KVLA 1EOMA 1NH6A 1TR1A 3R43A 2Y0FA 2GQ9A 2WCGA 3PTMA 1E0TA 1BGAA 1YNPA 1EJSC 2QT3A 1RD5A 1SO3A 3UZJA 5LHEA 2BX7A 1VEMA 3S3GA 1XDMA 3MCOA 5AN7A 2Q3RA 3TYUA 5LIYX 3G8EA 2XDFA 5ABFB 3RLUA 2FHFA 3PHAA 1Q1RA 1PIGA 4YJ5A 3W1XA 2DZWA 1E0UA 2A3CA 3OLGA 3WNPA 2UY2A 4KF1A 1PL9A 1KKRA 1JNDA 3SQLA 2J88A 2MNRA 4BQ3A 5C55A 4C1LA 2H8XA 4NNBA 5K7JA 1N82A 1YPFA 2WMFA 1RLCL 1EXBA 2GLKA 6ALDA 3CQJA 2BOGX 4X9SA 1TVPA 1Y5XA 3CC1A 4ADTA 5KMYA 1I75A 2X16A 4JFWA 1HKWA 3VNIA 3B8UA 3BJTA 1KBKA 1W3IA 1H63A 3DKJA 1HKMA 4M6QA 5BROA 5HWNA 3SCNA 4IPLA 2PEVA 3D5HA 2ZQ0A 3H54A 2PDJA 2Z1BA 3W71A 3GXDA 1U22A 4HVXA 1SZFA 4ZB5A 4JX5A 2ISVA 4XD5A 2OLAA 4AWUA 3GDLA 1CB7B 4TVDA 2EG7A 1VBRA 1LOSA 3M07A 2ZZ3A 1R38A 3OA3A 4YN5A 2GPTA 4BCEA 1RPKA 2DDXA 3FG2P 4AHOA 1FEBA 1L9WA 3SQSA 1ISVA 1S2AA 4HT3A 1W9PA 4W88A 3NDZA 4MZ1A 1VQTA 2CLKA 3PZGA 3W1LA 3DFOA 2O7QA 2X42A 3RLHA 4F48A 3OZMA 1XM3A 1E5NA 3W2MA 4DI8A 4FX6M 3ETRB 3PWIA 1H51A 2D0GA 1R8LA 4PCFA 3W29A 3WFZA 5EMUA 3WQ6A 3N4FA 1AVAA 3QQ1A 2DSWA 1HL9A 3TP4A 2WM0A 1P5BA 1HG3A 2YLAA 4X0NA 2VUYA 3MC5A 3IJ9A 1EGVA 4JIPA 1JPDX 4D6IA 2WPCA 4XSMA 4IJBA 3ERPA 3MSRA 2HDJA 1AW2A 1KTBA 3CJPA 4KBXA 3G1FA 3SUUA 2E67A 3S47A 1BRLB 3FNDA 1JYNA 5BOEA 5CPMA 1VHNA 1GQJA 2GZXA 1ME9A 1TIMA 2GJXB 3M0VA 4GX8A 1NDYA 1M68A 5CAKA 4QFUA 4ACYA 4RZ6A 3VVGA 3TV8A 2D2OA 2YB1A 1M5WA 2IQDA 5FS8A 4K6AA 1P4CA 2JIWA 4XVEA 1KXTA 3T8QA 3CAVA 1Q6GA 2V8ZA 5AZ0A 3ME3A 2C91A 5TNVA 7ODCA 4DBSA 4HU0A 5G2WA 1JRPA 1KWKA 1DBTA 3IIOA 2NT1A 3GIPA 2FDMA 1KFKA 4XK2A 2G96A 4O16A 4BHYA 3GFYA 2J3NA 4JQ3A 1H0IA 1KLZA 3FEQA 4LY8A 4JAWA 3EBVA 1F2JA 3FK4A 1WB0A 4HQVA 2JE8A 1M7PA 1H7OA 5D2TA 1VAHA 3OU8A 3MA8A 5IDZA 2VGIA 5A8GA 1Q63A 4S3GA 1J79A 4DVOA 3SIMA 3EZ4A 5G5IA 5IDIA 1ZZMA 4FS9A 1FWWA 3LPOA 1OFQA 2CLEA 2VI0A 5CSRA 3DESA 5ABHA 3S2LA 3SN4A 2NVCA 3AIBA 1OFOA 5GNZA 3W37A 2OYLA 4GI8A 3QXBA 5BU6A 1H7WA 3UXAA 2W55A 4X3ZA 1EEPA 3CHCA 4EF9A 4EM4A 2JKEA 1OCNA 4JKLA 4FAMA 2BC0A 2I7GA 1ZK7A 1MVYA 3GTHA 2HTMA 1E6ZA 3S6OA 3UGVA 1XBYA 2P53A 5D2XA 3TC6A 3QHMA 1VZWA 3UR8A 5BZAA 1OX4A 3QOMA 3GW3A 5CPNA 3I10A 4WJXA 1GVFA 4P7QA 1YDNA 3RILA 1XIIA 3CH9A 3TDFA 1CI1A 4UTHA 3GRTA 1V3LA 2VM8A 5IBXA 3UFYA 4V33A 3EDFA 5F1VA 5HUPA 3FYYA 4O11A 3VGGA 2PMQA 2BMBA 3VOFA 5LA1A 3G77A 4OBSA 4MIMA 1LORA 1GJUA 3WL1A 4GQGA 3GRSA 1QI3A 4BF9A 4G1NA 2BHYA 1UHVA 3HV9A 3NPXA 2WC7A 4X63A 3QPZA 1RM6B 4CQ9A 1NEYA 1D8CA 3L4ZA 3GC2A 2JQXA 4H9TA 3WDHA 1OABA 3BG5A 4HHMA 2FGLA 2JF7A 3W27A 4GYPC 4UFKA 3GX9A 4B4FA 4FA3A 2ZRZA 3AALA 3Q67A 4EKJA 3C3UA 4ATDA 3GTXA 3B05A 4GVIA 3VNLA 1J10A 3W83A 1E0XA 4FDCB 2INFA 5EFFA 3VGEA 3R6IA 2JFEX 1O66A 1OBAA 2ZZ5A 1J6OA 1UD3A 2EGZA 3H70A 4A2SA 3RJYA 4ADSA 3I7SA 3GR8A 5K4XA 4JFUA 4YTQA 3LV6A 1EBDA 4AMCA 1RP8A 1QHOA 1JULA 5C8BB 2OMAA 3M43A 1O5XA 2FJKA 4EMWA 1YNQA 3C52A 2O7SA 3TZNA 3BAYA 5AC8A 5FKYA 4TVCA 2CPUA 3MZNA 3MO4A 4PFHA 2PDYA 1SW7A 3NSNA 5DO8A 1S3HA 3GU2A 4Y8FA 1UROA 3NXLA 3FXYA 4GH1A 3UA4A 5E0KA 2DT3A 3FAXA 2E6FA 3ARVA 4QE5A 1XIBA 1I1XA 3SZ8A 3GQYA 4J28A 1RP9A 1TZ7A 4K37A 2PC8A 3FVMA 3H26A 1TPC1 1WYGA 3RNMA 4CQAA 3SN1A 1UC4A 1QRQA 2GUUA 3LBCA 4BQ2A 4RPQA 1Q85A 3E3HA 3E5PA 5XINA 2WVVA 4HB7A 1XRFA 2E9MA 3W7CA 1GETA 3TJLA 4A21A 1UZDA 5DT5A 2I57A 1WDQA 1XKYA 4FXSA 3N6HA 4K38A 4K8HA 4XZWA 4Q8PA 4WJEA 1W3LA 4TX8A 3ZS4A 4JFVA 3AIRA 4QE1A 2MUCA 2YDQA 4I9MA 4J3SA 4JQ1A 4B16A 3OHIA 4DNMA 3QFBA 1HO4A 5TF0A 1VPYA 2W79A 3CGBA 1A3XA 4S23A 2BDQA 1SPQA 4E8GA 2HS6A 3CV2A 2X8GA 3S6DA 4O28A 4MPQA 1L8NA 3JVAA 3PBYA 4M6UA 1W91A 2B7QA 2XWEA 1Q8JA 3QQ0A 2FKPA 2ZXBA 3SR7A 4IL0A 4HOXA 1XHGA 1GVYA 4TTUA 1Z32X 1QJWA 4I6KA 5FEWA 4Q6XA 2XIMA 4U2ZA 5A69A 2IXUA 1BG9A 3W26A 1OF8A 4FNTA 1J8VA 3QPEA 2Z25A 2QUVA 4FP1A 4IMDA 3KCJA 4NYUA 1X38A 3LD5A 2QUNA 2YGYA 1NFGA 4JPGA 1A5SA 1XX1A 3J7HA 3BC9A 3NQEA 4WZHA 4Q7IA 3MUAA 2QIWA 4JHZA 5JH2A 2A79A 2DZXA 4AIBA 3LXDA 1K70A 2Z28A 4UTMA 4NZ3A 2RGLA 2EPKX 2ZVIA 4IPNB 2NQ5A 1JGMA 5BOFA 1WPCA 1TKKA 3HB9A 4IM4A 3O8AA 1XSJA 4K7ZA 1PHWA 4Z1AA 1FWSA 3MU7A 4L56A 2NWRA 4NVTA 2CLIA 5G1YA 4F79A 4LC6A 5BU9A 2CLMA 1KKOA 3EX6A 3UZWA 3WG6A 3H7VA 4KPRA 5C70A 3P67A 4WSHA 2DT1A 2B81A 2PTDA 1GZ1A 3LOTA 2Z2BA 1ZJBA 1XG4A 4LU0A 3THUA 3OVQA 1K6AA 4I9TA 4ZOHB 3U8GA 1E71M 1FX6A 2VQTA 3WZ0E 2W62A 1NSJA 2OLSA 1WZMA 1HJXA 3TCSA 1X2HA 3WH6A 1H4PA 3A3WA 3TN5A 1ZS2A 4OTKA 3TJXA 4RUBA 3L2IA 3HG3A 4WGXA 1CLVA 1Q6FA 3WJWA 2ZRYA 4NKCA 5I78A 2R91A 2PTWA 5H91A 5CH9A 2ZA3A 4B5WA 1KM5A 1VLWA 4GNVA 5AC7A 5FACA 4N9BA 3UJSA 3L66A 3QTGA 2F9RA 4E3TA 5EBUA 3PUOA 1CXIA 3KS6A 1YMYA 1I2PA 2YYUA 2ZRUA 3WUFA 4NZCA 3OQ8A 3SUWA 3EF6A 1DJYA 4OFCA 1KRMA 4L9YA 4LYQA 4GZ7A 4GQ0A 1IWAA 4IGHA 4KQNA 2PLJA 1CGXA 4H9VA 4AVOA 4JOMA 4H4TA 4NJJA 4NRSA 4V15A 1SM9A 3TN4A 5AFDA 5CCZA 3N17A 3FA4A 6A3HA 1ZKQA 3B9OA 4WLCA 3BLFA 4LW7A 3VX1A 1BLIA 1LG1A 2F7FA 3NPUA 4O1FA 4HZ8A 2Y5JA 3BCDA 5EFDA 1E51A 2MANA 3TYDA 4JKMA 2WOWA 1VCGA 1UASA 4E4FA 1JCNA 2I1OA 2QF8A 3DI0A 4NG3A 3WYZA 3RITA 1E6PA 2OX1A 4HU3A 3PNUA 4GXMA 2GVJA 3NM1A 1BYDA 1WKEA 2ZXDA 4JXCA 4TVWA 1KXHA 2QCCA 2HQMA 4RNFA 1EJRC 4REQA 4M5PA 4LC8A 1EP3A 2PTXA 4JFTA 2XGZA 4KKXA 4H9YA 4WF7A 4UTLA 3QGAC 3FHAA 2A85A 1V02E 5LNUA 2ZX9A 1W1A1 3NZPA 3B06A 1R3RA 2VGBA 4A3RA 3WO8A 2YFOA 2WWCA 4BEQA 3NDOA 2WKGA 3FOKA 3W82A 4QSFA 1ZMCA 2EAWA 2V5CA 3TFCA 4UNIA 2V3GA 1JZ7A 4U5KA 3P82A 3GZAA 4NUWA 2XHYA 3DBNA 2REQA 1C92A 2A3BA 3N2OA 3GG8A 1VBUA 1HVXA 1NTHA 1C8VA 2J7CA 2X50A 4BA0A 1W1PA 1TV3A 5HWMA 1VJZA 1HW6A 3GKAA 2LLEA 4JTCA 3U5YA 5CXPA 1PCKA 1GZGA 4H4SA 2DU2A 2Y2WA 2CIPA 2P8CA 1BF2A 5JVLA 1F3XA 1PX8A 1EC9A 2GJNA 2J77A 3B0YA 4ZE5A 1D9EA 5FEZA 3RPTA 3LDVA 1MNSA 1XG3A 4MVAA 4ZXLA 2C0HA 2XFRA 5CZKA 3H2EA 3L12A 9RUBA 5KZDA 1B3WA 1A4LA 4F9DA 2FGZA 4Z2IA 3KBMA 1ZX9A 3FGCB 2PU1A 5T26A 3RHGA 3LCLA 4PB4A 4F40A 1H7NA 4PR4A 1XH0A 1TRDA 3GSMA 3QFAA 2PF8A 5LIUX 1W1ZA 2G0WA 3U2ZA 1N8IA 4PUEA 2PAJA 3H7RA 2EJ1A 1DQUA 4R5EA 4CGTA 2RH9A 3GWQA 5LA0A 6ENLA 1G1YA 3ISIX 4JS3A 1NWRA 1JYXA 1BWVA 2YCLA 4PCPA 3P60A 2DSZA 2PLMA 1O12A 4D6HA 1WZLA 1A5UA 3V1PA 2W54A 4M3PA 4QDWA 2B0MA 3SJ3A 1IIGA 4LB3A 1MNZA 4XO7A 5FD0A 1US0A 2BASA 1RJQA 1L2QA 3G1RA 3TQ0A 2F38A 2OWCA 1CX9A 3M0ZA 4ROQA 3VC6A 3ZVHA 1Z42A 2CBVA 2XIQA 3ABXA 3BW3A 2Z6IA 3VGBA 1G4SA 3EWUA 4QRNA 1XLFA 3WFLA 2OQHA 3WDPP 1KM1A 1WDWA 3E0WA 4FXJA 3AYRA 3FIGA 4PGLA 4KFPA 4W4QA 4A3YA 2WNWA 4C91A 4HMEA 4LB4A 4ACZB 4ZMGA 3WY1A 3TN6A 5EKYA 1EDTA 4PUKA 5IHRA 3NRZB 3K5XA 3UY8A 4K7YA 3NPVA 2BGSA 2G3IA 4LUIA 5A6JA 4JTDA 3RX2A 3QZEA 4DNHA 4A3UA 1S5TA 5CPLA 5GJNA 1BVNP 4RV8A 5JCIA 3LX9A 1ICPA 1DNCA 5DCDA 4WDTA 4RL3A 4HSOA 1NWSA 3NQFA 3N6JA 1KC7A 3AISA 3B4YA 4EWND 1R30A 2WOVA 4MWAB 3FVDA 2OKOA 3G2GA 1BWCA 4PBGA 1KFWA 1CTNA 3SUVA 3CLMA 2IUZA 3G1YA 1HT6A 1YTKA 4QIUA 1R9YA 3BLDA 3GDBA 2QAEA 3AHVA 2WZEA 4INFA 2WZHA 2P10A 2V5KA 3L0GA 1CWYA 5E0FA 5FAGA 2CETA 3E12A 1BWLA 1H0GA 1IE7C 4PUDA 5DF0A 1C91A 4MAVA 5H8UA 1DJHA 2X0HA 5F2IA 3WLSA 3GNPA 4W86A 3WQFA 2XFYA 4LFYA 2QMKA 3SJNA 4LF1A 1B3OA 4CEUC 4JQ9A 1GK8A 3WBXA 1K1DA 2VX6A 4MHBA 1U1UA 2OEMA 3RNDA 3B0VC 1XLAA 3TJIA 1S1RA 1GERA 4FIQA 2HVOA 3B8VA 2QDDA 3M6DA 2GRTA 3QV7A 4IMFA 3U7BA 4OUIA 4P7NA 1B3VA 3NG3A 2DZAA 3LHUA 3ATZA 3E0IA 4W8BA 4XWUA 2E28A 1X98A 2W0UA 2X41A 1E40A 4D1JA 4PCTA 4N9EA 4ZSTA 1NJJA 3ICJA 3QJAA 1V51A 2BY3A 4A6GA 4ERGA 1R46A 2DEPA 3UYIA 1DWGM 1V6WA 3ARPA 4N42A 4XSLA 5G1TA 1M01A 3M0XA 3V3WA 3MHUA 4D6GA 2Z4GA 3MV01 4DZ5A 3GVQA 2ACQA 1FHLA 1E1FA 4J2MA 4TX6A 2IXVA 2Q71A 3NFUA 2GVYA 4GGHA 1Q66A 2E7FA 4J56A 2AGKA 1Q13A 3VIIA 4C1KA 3W1UA 2W91A 1U5JA 4Z2LA 1YIXA 2CBIA 4NEWA 2PWVA 2XFWA 1NIUA 4N4PA 1ZAJA 2XTKA 4POCA 1VENA 2AOSA 4M82A 3AS2A 4R9OA 3UXIA 5DN1A 5EY5A 1A5OC 3FV9A 3QTPA 3R8HA 3SCQA 3VD9A 5I3FA 3TJ4A 2ZZCA 1GKQA 5HR6A 2XPKA 1C8QA 1L6WA 3E38A 1O5QA 4GXPA 4QR6A 1FCVA 2PDFA 4Y96A 1AJ0A 4CNUA 2QHAA 3S1XA 1UH2A 4QNEA 3V5CA 3CV1A 3HZ3A 4DF2A 1D7YA 1P1XA 5HNRA 5CPSA 3HW2A 1NOUA 2WKLA 4C6OA 4QG8A 5E6YA 2OYKA 3NOEA 4EANA 4KCWA 1UMYA 3GVWA 5IM51 3PS7A 3GUWA 4HPGA 1WAWA 4JNYA 1SW0A 2AL2B 3CHFA 2WPGA 2ISFA 4E8CA 4JYEA 4PMNA 1D7FA 3W9ZA 4GOAA 2WPFA 4FHAA 5K3VA 5U4NA 1DJXA 5ABGA 4WOZA 1E4LA 2NXHA 4OE7A 1T0OA 4B5XA 5KTLA 3SR6B 4QJ3B 1XKJA 4DUXA 3QGVA 3GNNA 5A6AA 1TMQA 1ZNNA 2GDQA 1PBGA 4AQLA 3ARQA 4M6VA 1I8JA 1XRTA 3PM6A 1KNWA 1TIWA 1SO5A 3B0PA 1BYCA 4MY8A 1LLWA 4ML4A 5E6ZA 2EPLX 2WSQA 4H4WA 3OVRA 2BGQA 1BZLA 5HINA 3VAVA 3W01A 4D8AA 1K4HA 3GD4A 2VC5A 4TUFA 2Z0IA 1C7TA 2HEJA 4QCFA 3W0KA 2Y8UA 4URIA 4NX0A 5F4SA 2PBOA 1LP6A 3KOZA 1FWIC 2FIQA 2Y62A 4RCXA 4A22A 3MCNA 1DWAM 5M2FX 1QFEA 2WMJA 3HQ1A 1ZY9A 4EACA 5HANA 3PZUA 4W85A 4LUJA 4A8LA 3HMJG 3ECQA 1US2A 2GQAA 3S46A 1VYSX 2WJFA 1YW1A 1UJQA 3PZMA 3O16A 4IICA 3USZA 3NQBA 4QLJA 1I9CB 3MUY1 3KRBA 4P2VA 3EUB3 2ESCA 3NL6A 3W1TA 3AFBA 1J01A 1KXVA 3AHZA 3D0CA 3SW6A 2BOFX 3AHTA 3THQA 1EA0A 1YPIA 3NTYA 1MI3A 2Y89A 3M64A 5HJXA 4LOCA 4G8TA 4XAPA 3W25A 1QHPA 3PZTA 5REQA 3GUGA 1XCXA 3W7DA 3FHQA 2B31A 3N2CA 3IJ7A 3V7PA 4X9YA 2R1MA 3NQAA 5LNVA 4WX2A 1WAUA 3E49A 4P8WA 2HBVA 4H9ZA 3WQGA 4I5RA 3E2QA 1UR0A 4Q8NA 4RNJA 3N18A 1M6IA 1TUXA 4O10A 4O54A 4KEUA 4ZFMA 3ITGA 1TPH1 1H62A 1XYMA 4QLKA 1V93A 1DWFM 4JNMA 3DGZA 3CZ8A 2YL6A 4EPEC 3JW7A 1GVRA 4PFMA 1GVOA 2D2GA 3W88A 2ZX7A 3GR7A 4D6DA 4NF7A 4PEEA 2ZZ2A 2ON3A 1W1B1 3W1QA 1Q5MA 3LTYA 3L0NA 3EGJA 1NPXA 1ITXA 3LPGA 4AEOA 3IARA 2ICSA 1E6RA 2OSYA 2YCLB 3L65A 2G50A 1AMYA 1W3KA 3OBEA 4ZXOA 3CUHA 4H7ZA 1LZOA 4LRTA 4EWJA 4CN1A 4C6DA 3QQWA 5FJJA 4LAZA 1YKWA 2C3ZA 3OVPA 2EQ6A 3NZRA 1OFDA 1E43A 4Y9PA 2XUCA 1POKA 4AD3A 3EWBX 2OTDA 2GQ8A 4O15A 3OYZA 1SJDA 2OPJA 5A95A 1XS2A 3EPNA 1HKJA 4DQWA 3B9EA 4S3FA 4Q8UA 4DRSA 1ONWA 3G0XA 4H00A 3GHSA 4S3KA 2J8FA 1LRNA 4XO6A 4WDWA 3WF0A 2WNQA 2WZTA 4JIQA 1Q7MA 3SGGA 2ZUWA 1G7VA 1OYBA 2YW4A 3MP3A 4V28A 5D8ZA 3NSMA 3A13A 1CXKA 3AHXA 3KBNA 4CD5A 3SCUA 3VUPA 3IVSA 3MP4A 3OPSA 4JTSA 3TLQA 3T4CA 3T40A 1WZAA 2QS8A 3T6CA 4HYWA 4R7OA 2XINA 4C6IA 2E25A 4W7VA 4QITA 3GBDA 3IAPA 5I03A 3AMCA 4ACZA 5I3DA 1W37A 2J13A 3UR5A 1GG1A 3HFYA 1UQZA 1GRFA 4O50A 4JBRA 1I1WA 2NPXA 3WD4A 3CAQA 2NVKX 4DX3A 5A8QA 1P0BA 5FAJA 3R13A 1L2UA 1UP2A 2D2JA 1RZMA 1V3KA 4GQRA 4J9JA 4MJMA 4Q7NA 2VD8A 4PUWA 2WV8A 3NL2A 1KCXA 3CAKA 4JY9A 4IIFA 3TCEA 4GO8A 1V4YA 2CLFA 1YRRA 1PYMA 3ABZA 2WHLA 3WH5A 5JXQA 3N9SA 1AQMA 3FJLA 1UCWA 2EQDA 4RE4A 2DSKA 3UP8A 5LA2A 2NQ9A 4K8DA 3CWNA 4HPJA 4DZHA 3EDJA 1P0NA 1E73M 3I4EA 1W5QA 4C6BA 4C5YA 3HGJA 2BOEX 4RK8A 3CXBA 3AHYA 4GBDA 1XLJA 1OC6A 3D9XA 4HNVA 4AY8A 3LB8A 3AROA 3CNYA 5LIKX 2J7DA 4UOZA 4DWSD 1PO9A 3AIEA 4TV6A 1TV5A 4ZQOA 5MKGA 3KL5A 4E8DA 3PAOA 2C14A 3H21A 1JRCA 4PCSA 2HE8A 1QW8A 1LF1A 1O60A 1OWQA 3FJ6A 4ZOEA 3KTSA 2A1YA 3QVQA 5TAOA 1N55A 4U2YA 3W7GA 4MOZA 2V69A 3PPFA 4B90A 1UH3A 2QF7A 3FSUA 3SDOA 3IRSA 2PCEA 4BFAA 5CSYA 2C19A 1QNVA 2OQYA 2WMKA 3SM0A 2A5HA 3F4NA 1XD0A 4ILSA 3TNOA 3GLCA 1JCTA 4UXDA 3SFKA 1KFEA 5BRQA 4O1EA 1AOGA 3U3HA 2WYSA 2GR0A 2ZUUA 4RKAA 2ZX5A 1R3VA 5M17A 1NFPA 1O7AA 1VRXA 1XL9A 4HOWA 2D23A 1DWJM 1GVSA 4XD6A 2WBKA 2JKAA 4DUVA 1NHQA 3VIOA 4HSHA 2YVGA 2J7FA 3MW7A 1WBJA 4LSBA 2GH5A 2OO6A 1NY1A 3CPUA 1XLLA 3W2LA 2YJQA 3SAZA 1BQCA 3N3MA 5ABEA 4UTJA 4ICMA 3OHMB 1NHSA 3S5ZA 4LF2A 1B5TA 4UFJA 5F4WA 3A3HA 4YHEA 1LUCA 1CIUA 3V75A 1Q4WA 4O8AA 4YYCA 4L4OA 4B4HA 3CZLA 1B4EA 3TXZA 2VNCA 1O1ZA 1JCLA 1W9BM 5HQEA 3FLUA 2F6XA 4QS5A 5D4YA 5JRBA 4GLEA 4L61A 2E09A 4JL1A 4DXKA 1OFBA 3LEPA 4DLFA 1XIGA 2WB5A 3ABSA 4E0CA 1DV7A 2Z1VA 4AEFA 3FCPA 5JBFA 2V2HA 3AC0A 1TO3A 3DC8A 5GJMA 4IMAA 1NDVA 3WFAA 3O06A 2VWSA 1DOSA 5FS9A 4GYPA 4CD6A 1CYGA 2XVNA 2VT0A 3MYOA 3K4AA 1KCZA 2V6OA 3U2EA 1XI3A 1PTDA 2OLHA 3FS2A 4AFYA 2WQDA 3TLLA 3K46A 4K1WA 1HJQA 4ZQNA 4H4RA 1Q6EA 2H6RA 2PTYA 1JF5A 1SFSA 2Q01A 2YKKA 1XXXA 1DVJA 2IQTA 4JDRA 4DY1A 4AY1A 3GTIA 2GJXA 4FF7A 1WP6A 3NCOA 3BDKA 3LGGA 3ITCA 1ODUA 3K30A 4GG9A 3BANA 3T42A 1IR2A 4K36A 2B7NA 3IRDA 3NXFA 4UQCA 3C2OA 4F2UA 1KQYA 5EPDA 3NVWB 4UMCA 4I5XA 3W7PA 5DRIA 1TPFA 1TA3A 4A8RA 3OZOA 3AXIA 4LJ3A 1P0DA 3MKCA 1S2VA 4FNPA 3GS6A 4PRTA 5DXXA 4QE4A 1A53A 1F6PA 3QV9A 3TYEA 4N9DA 2E8ZA 1BG4A 3GVVA 1ECEA 2WMIB 2EPOA 4GIAA 3N12A 4U28A 2YBVA 2B4GA 4H4ZA 1GOKA 1ZBVA 3P5YA 4O14A 5C2XA 1JUBA 5M03A 3ARUA 2FHBA 4FIRA 2VOMA 3EB4A 3CGTA 4XZIA 2C79A 2G41A 1W17A 2G4FA 4BR1A 5F2GA 1OYCA 3MMUA 1CBGA 5DX7A 3AMKA 3N15A 5CAHA 4GYJA 4C6QA 4J3TA 4KETA 1J2WA 5D38A 1HZYA 3T09A 4GY1A 2OFJA 3CGEA 2KZHA 1UKOA 4HHPA 3H55A 1ODZA 1TWIA 5LNSA 5ER0A 3CGDA 3AZSA 3W7QA 1GTHA 4D71A 3T81A 4UQAA 3QY7A 1UP0A 3LA4A 1GEHA 2GR1A 3CU2A 4LAOA 4B3LA 2ZICA 4MKVA 3DG3A 4XVDA 3ZJ6A 4DAFA 5H8MA 1C3FA 4RZBA 2ASHA 3UZ5A 1ESWA 4BI5A 1CXEA 3NQGA 4IPPA 4IISA 1X8FA 4XBJA 1UWTA 3M0JA 3LGDA 5CPOA 4O0KA 4D2JA 3AYTA 1HNYA 2PURA 4KESA 3BQ6A 4W8LA 2QZRA 4FO4A 4H04A 4P8UA 1QWGA 1WOBA 4FXRA 4QAWA 4ORMA 2HK1A 5JBDA 4CQBA 3QPYA 4J2PA 2OEKA 4GA8A 4MWAE 3RG6A 3OO2A 4GINA 4KGJA 1TTJA 2ZRVA 3H6OA 2WANA 4QSHA 2INEA 3SCTA 4H8UA 1OJXA 4TV5A 1TJ0A 1XINA 4Q8QA 2D0HA 3AU6A 3MSYA 4A2RA 5D33A 5M1TA 4AHPA 1AQHA 3WELA 2ZADA 3UPMA 1VBJA 2E5BA 2HVMA 4KS0A 4B5VA 2VFGA 4W84A 4MFDA 4GGBA 3S4TA 4GUIA 4RZ4A 4E4PA 3OP2A 4M52A 1UOKA 3WD2A 2I16A 4YU1A 3AXKA 1VKFA 2J27A 3VNKA 5SWUA 1TYPA 2GDVA 3MSDA 3DHDA 1FWRA 3T0TA 5FMHA 5AC5A 4OUEA 3ITXA 3EKZA 4GO9A 3VKDA 4Q8TA 2QUUA 3TE9A 1UWSA 3BLOA 1QMLA 3CT2A 3STFA 1M53A 1ZALA 1TZ9A 3NZ1A 5F2MA 1HP4A 1MFUA 1RPXA 1EX1A 4DYKA 2CNCA 3C0QA 1K9FA 2ZX6A 4ZQCA 5CSUA 2HE5A 1X8CA 3IJIA 5CLWA 2FTPA 4C6EA 3NVZB 1UR1A 2QEZA 4UFIA 3UG4A 2WM1A 4RDZA 1M7JA 3GTFA 4JD4A 2X1TA 3H23A 1FCBA 4C60A 3A4WA 3MMDA 4LVAA 4Q6JA 3AUOA 4FNQA 4MFEA 3M46A 3UCCA 2VFHA 2CZ5A 2GGJA 2D73A 2QJGA 2RJGA 1X6LA 2W5FA 1XIEA 3W2KA 3ZWTA 4UTFA 3HJEA 4WEVX 3SGUA 2Y4SA 4DJEA 3OEXA 3I68A 3MPGA 4PTXA 2ZRXA 4AISA 3HG5A 3C8FA 3O6DA 2C1HA 3JZUA 3TW9A 1MW1A 5DBUA 5E09A 4GKTA 2FB3A 1F8MA 3MJMA 1ONXA 2X99A 4JQ4A 2C15A 2NV9A 2VCCA 1LWIA 3RGTA 1EC8A 4FR6A 1Y5VA 1MQPA 3WJXA 1YEYA 4BV6A 4PMYA 3NYZA 3SI9A 1AZ1A 1FWJC 3E5BA 3CM4A 5FF3A 2F61A 5LYRA 5DFAA 2WPEA 3CQHA 1EF3A 4C6MA 3ONCA 4LANA 2QCFA 1L6SA 3O63A 3TROA 5I5RA 2DZPA 1CGUA 1VDVA 4IIDA 4LCRA 3EMCA 4EQSA 3K1DA 1US3A 5DCBA 3MANA 1CEOA 2NX3A 2Z1XA 3CMJA 3HV8A 3VOIA 1DXEA 2BXYA 4GK8A 7A3HA 8CGTA 3GM8A 1BSIA 4IX0A 5L6UA 3WQVA 3HG4A 3WF4A 2J6XA 1SR0A 3WF1A 5B80A 2QUMA 3AJXA 2QULA 3GDTA 3MI6A 2CU0A 2G37A 4PB5A 2YVFA 3WSUA 3CPGA 1XYCA 2VD9A 1GQNA 2TPSA 2WCSA 4H83A 4DWSC 2VDIA 3S8HA 1EFZA 1Z8AA 3HPAA 1QPNA 1TJ1A 5FESA 4O52A 1LTDA 4FLQA 1JAKA 4LQ1A 1GRHA 2WSRA 2QCMA 3L0KA 4DB7A 1GJWA 1YBQB 4DO6A 2YYTA 3RIKA 4DAIA 4KCTA 3ANVA 1B0IA 4NILA 3EOSA 3N2BA 3F7JA 3MSGA 3OGVA 2GWGA 2PS2A 4DIAA 2XG9A 3UWQA 1C90A 3WQ8A 1I0BA 4C1NB 4RW5A 1FWCC 2V67A 2NLYA 4US6A 3WQOA 3VC5A 1EWEA 3PFRA 2XIBA 4EAMA 2PUZA 3AS1A 3K8LA 4GYFA 2DJXA 4EMIA 1JDCA 4QTGA 1WX0A 3LS9A 5FSEC 4UIOA 1ZGDA 1TV7A 3AUJA 3N29A 1ME8A 4WDUA 1OD0A 3R12A 3GNOA 1J6PA 3UXLA 4YYFA 4QG6A 3G1SA 1P0EA 4XIMA 3BPWA 4IF2A 5GNXA 2PWFA 2J7BA 3EEZA 1Q3NA 4WSJA 5TIMA 4U3CA 1N8WA 3HFTA 4OECA 3N9KA 2TYSA 3MO7A 4HCLA 5HJYA 1WDSA 2W27A 3N9RA 4OV9A 3VZYA 1I2OA 4IJCA 2BTMA 3LXAA 3P14A 1WXYA 1DE6A 1WKFA 3PBMA 4LUTB 3QR1A 2OCZA 1RH9A 2CW6A 3U4AA 1RCQA 4J4KA 1IYXA 1TVLA 4DBDA 4JTUA 3KOFA 4IG2A 4B9YA 5A6BD 1XIDA 1EDGA 4MKSA 3W7KA 1VFUA 3PBUA 4ROPA 3VKCA 2JALA 4ASTA 3A4AA 4MWAC 3Q45A 3WQWA 1IZJA 3P8JA 1K9TA 2G95A 3F1QA 1UC5A 1X2GA 3P80A 3CQKA 1YTDA 3TQPA 4AEEA 3OLEA 4HJFA 4S3BA 1LLOA 4CN4A 3PSVA 2NUYA 1GZJA 2E68A 4AIEA 2HMCA 3KDNA 4AZIA 2R9RA 3MHGA 1TJPA 3BICA 3LZ3A 4AWSA 3GXMA 3USBA 4NHVA 3T2QA 1REQA 3ZSSA 1WUFA 3VUSA 3ITTA 4H9XA 1JL8A 2G5WA 3WDRA 4ZVJA 3DZ1A 1OX5A 1U1HA 5DXYA 3W4RA 2VP8A 2DZSA 4FEZA 1JPMA 1UUOA 5EMMA 3S5YA 1BEUA 5AYXA 1Q6DA 1T7LA 1V5XA 3DFPA 4WSKA 1E9ZB 4TXEA 1E0VA 2Z2AA 2ATSA 5C2CA 1ALDA 1M7XA 3OLDA 2NXGA 3CQ0A 2ZKMX 3UCDA 1DXLA 1RBOB 2IPJA 2FFIA 4MMWA 3T44A 3E0VA 3DGBA 3DU0A 1VJSA 2CKSA 1MQRA 3GKFA 3W72A 3V0SA 2ZZBA 5JCKA 4OIFA 4NX5A 4E2BA 1W5NA 3UNTA 5LIWX 3URBA 2EPMX 4Y6GA 1ECQA 4JX4A 4UCFA 1VP5A 2WO5A 1JR1A 2FTWA 4CQ8A 2WXDM 3SCPA 4KIRA 4IP7A 4NI8A 5AYBA 1YDYA 3FSTA 5FJIA 3SSJA 3CAWA 1S1PA 2PSNA 3TTYA 3DYMA 3W7EA 1DXIA 3LCIA 3PR2A 5AVNA 1QI0A 1ZCOA 3B8TA 3CASA 3UG5A 3W53A 5BXSA 3DFYA 1U1JA 3PAJA 1JEZA 3HJZA 2CERA 2VEGA 4MUZA 3AS0A 4Z0SA 1SO4A 3NZGA 5J04A 2A7NA 4F2TA 1GW1A 4J3WA 4H1ZA 2CZFA 1NU5A 1EH9A 1HX0A 4PULA 2EJAA 3HGSA 1S5MA 4BWLA 3LTPA 1MFVA 4HBKA 1BTCA 1DEDA 3R0KA 4PRWA 4RV3A 2DT0A 4UOJA 3LQLA 1FH7A 1P6BA 5H1WA 4P8XA 3AMGA 2V68A 3FX4A 3VK5A 1PWLA 2O56A 1P7TA 4Q4KA 4CUCA 3U5UA 4I6VA 2VC9A 4AU0A 3UJ2A 2ZOXA 2I14A 3VDCA 3M16A 3NGFA 3IANA 3JRKA 3GVGA 2YCJA 3GO2A 3WNMA 1SVDA 4EMJA 2Y5SA 3CH0A 3P0WA 4Z2HA 4WXYA 1SW3A 1UR9A 3GG0A 3QYQA 4GZEA 1GQIA 3SO7A 1G4PA 4PL1A 4W5ZA 1S38A 5KETA 3QEZA 3ES8A 2EG6A 5H2ZA 3AWNA 4UQDA 1N60C 4F66A 4TQTA 1LJYA 3C0LA 2EXOA 2YCIX 5C7HA 1HXJA 2ONEA 4XD3A 1XBVA 1PE1A 3I6EA 2C6QA 3SSZA 1CCWB 2R94A 4EVZA 2CZDA 1FY6A 3QGKC 2R24A 4IPIA 4Q8MA 3W24A 4PC8A 1LWHA 2OELA 2OGYA 4HSNA 1VFHA 3ZJKA 3M5ZA 3S1GA 5MF5A 3AS3A 3KUMA 3PSWA 2ZX8A 3EMZA 4MNMA 2IQ0A 4PE8A 3AN1A 2WMIA 3R0UA 3UD6A 4D6FA 1UPMB 3R07C 2WSYA 1SUXA 4Y7EA 1FWAC 1JQXA 1Q1WA 5FI8A 3CK5A 2ZWYA 1J4EA 4MNLA 4XB3A 1F3PA 4FF5A 2R82A 1KM6A 3AJ7A 1TQJA 4ZZ9A 2BHZA 1KQZA 4YWSA 1B30A 4WCJA 4JTGA 1I45A 2PDKA 4DBWA 2HXTA 4NEVA 5LGZA 4PN2A 1XICA 1F61A 4O1CA 3KBSA 1RR2A 2UV8G 4AZ6A 3N73A 1TZZA 3TONA 3WMBA 3MDUA 2CFFA 3UEQA 2INZA 1F4HA 1XBXA 4IIEA 2XISA 3MI3A 3NQ6A 3LRLA 2PZ0A 4E6MA 1CPUA 4LYRA 1KFBA 4A4AA 1SFLA 1IEVA 2V9DA 5AHEA 1IXQA 4ZTXA 4RE3A 3SCVA 3UJEA 4H4VA 4BK9A 2FQIA 3GG7A 2I5IA 2OWWA 4ML9A 3TZFA 1R5YA 3BG9A 3MCMA 4U5IA 5CJNA 3LN3A 1V8EA 5G2HA 1PB0A 1KWGA 4C6PA 4MDOA 2ZUSA 1AH0A 1F07A 3IK4A 3WH7A 3BAJA 3ORWA 3UXKA 3GXPA 3TTOA 1B2YA 5CPTA 3A4XA 2YLLA 3LBMA 4JN6A 1OZQA 1TPDA 3NJ3A 1S2WA 4MZYA 1J11A 3MMTA 2DQXA 1A0DA 3BK0A 2O9TA 1UB3A 1TTIA 2PDNA 3W7OA 4HNUA 4BWLC 2QCDB 4EK7A 3I6RA 1S39A 1POJA 1RXOB 4L6OA 1DIOA 2X30A 3K2GA 4A3QA 4PMDA 2TPRA 1CB2A 1QVBA 1Z69A 5EMJA 5D05A 4FLRA 1W2PA 1Z6KA 4FB7A 3AICA 2J47A 4D72A 5I3IA 3BZJA 3VU2A 3WNNA 1IGSA 3TSDA 1G94A 9XIMA 5T9CE 3E2SA 4GH3A 1GPFA 4MM1A 4PMZA 5FF7A 4N6FA 5JQ9A 1TYTA 1FWBC 3PBWA 5CC7A 3B9NA 2Z26A 3CTLA 1GWJA 1TTQA 4M56A 2Y70A 8XIMA 1NAL1 2YL5A 1FQ0A 4UR9A 4KH2A 3JS3A 1KM4A 1B9ZA 3L4YA 4GI4A 1BKHA 4RE2A 4O18A 2VEMA 1TWSA 3W2JA 1MRAA 3EX2A 4MJZA 2QJHA 3IUDA 1ZAHA 2BLEA 4HZMA 1XLEA 3CO8A 4AIUA 1LRQA 4KCVA 1LBMA 3BGAA 3GNXA 4HK7A 3WLOA 3C2VA 2AL1A 2EF9A 2ZUVA 4RW3A 3REQB 3UA3A 4PMUA 4ADUA 3PANA 2VO5A 4RPPA 3ATYA 1NDWA 2DZBA 4I9JA 3WQ5A 4Q22A 4TVUA 2NVAA 2R1NA 4CD7A 1KV8A 4MLJA 4XAZA 2X1IA 2D20A 1UJPA 2ZZ6A 3BLIA 3BCFA 4IT1A 4ICCX 4UTWA 1GVQA 1JVNA 3BJFA 2OQLA 4WY0B 1ZTVA 1XQKA 1EOKA 1QW7A 5HK4A 4G7EA 5CLTA 5D2WA 1IXOA 1Q6QA 2HK0A 2P5NA 5ECVA 1UZ4A 1K03A 4F0RA 3UY7A 3D6NA 4O4VA 2OZ8A 2O9PA 1E6XM 7ENLA 3MKVA 4N0RA 3RMJA 2BS9A 4GJJA 1LYXA 1ZRQA 1YTEA 2ALRA 2X0SA 3VIMA 1Q2RA 2C0AA 3M0IA 1FFVC 4JTIA 5BMWA 3L21A 2VEPA 1K77A 3BJSA 3CHEA 4UNLA 3GZ3A 1B1YA 6XIMA 3TN3A 1YHTA 3KBJA 3QLLA 2C3CA 1W3TA 4AW7A 1XANA 1B9BA 4KRZA 5EBKA 3NQVA 2QYGA 3CMFA 1O94A 2JGQA 1K3UA 3VIJA 3BSGA 4AC7C 4I7VA 4GUJA 3UESA 1F8WA 2HV5A 3K13A 1F73A 1E9YB 2XJ7A 2CEQA 1K02A 1FXQA 1F4AA 1QR7A 5BYWA 3H4GA 3EA1A 1TCDA 1UR3M 1VD6A 4MAZA 2PA6A 2P3EA 3N13A 3VGFA 1OSEA 4P8VA 2BC1A 1RY8A 5G4HC 1DKWA 2VDGA 3VPLA 2RDWA 4UR8A 2PDMA 8A3HA 1K6WA 2JF6A 3HF3A 1I6NA 2QCLA 2WK2A 3TH6A 1WV2A 2HNEA 1F6KA 1UR2A 2YVJA 2ZC8A 3LMZA 3ZVIA 1WDDA 3H2OA 3PB2A 1JJKA 3AI0A 3R1ZA 3NQ7A 1EIXA 3AQUA 1R2TA 1GGOA 4TMCA 1NQKA 2DZUA 2PGFA 2YL9A 1XHCA 3VD7A 3XISA 2Y7EA 4H6EA 2YIHA 1OIMA 2V82A 2X1SA 1VR6A 3LLDA 1ZDLA 3UVIA 2PD9A 2ZUMA 3G1HA 3R79A 4HZ7A 2GDUA 1EPXA 2Z29A 5LGXA 6CGTA 5JU6A 2D22A 4ZGYA 4JCLA 2ISWA 1H1NA 4D9PA 1E9LA 1ZAIA 3FJNA 5D04C 1WOAA 4CVUA 4UFHA 2QGYA 3CV6A 3HN3A 6PTDA 2OO0A 2QCEA 1DTUA 4S2CA 5I3HA 4UUIA 1LL6A 2Y8VA 3VFLA 4EQRA 4HNCA 5AYIA 1WA3A 1B4KA 3ITYA 1SO6A 3BZGA 3LPPA 4AHQA 2Z2UA 3T0DA 1JI2A 2ABAA 1KO0A 2Y24A 1CZ1A 2I5QA 1XYFA 2PODA 3SGZA 4EPKA 4MB4A 2H9AA 4WK9A 4F0MA 2FH6A 1B3ZA 3IIZA 1OD8A 1QNRA 3VZXA 1TE6A 3AZTA 3W7JA 3BW4A 3C4UA 5DEZA 1OK6A 3P2VA 1JEHA 3PG8A 2YCKX 1UWAA 3RR4A 4XUGA 4MADA 1Z9AA 3WDIA 2F2HA 2ZE3A 2PWEA 2YPIA 1GKPA 2PD5A 1TSIA 4BS0A 5LHFA 4NXSA 3A22A 5IFTA 3NEVA 4UTTC 1CXLA 2XSAA 3OG2A 1MZRA 4ALDA 1AG1O 2A3EA 3GH4A 5DBTA 1X7FA 3S83A 2OR2A 1C8XA 4PYSA 4RE0A 4DWSA 1GUVA 3W1PA 3RCNA 2O0TA 2WLZA 4DJED 4M81A 1IWPA 1WKDA 5EU9A 2WZIA 4PSPA 4IFOA 1R6WA 1LT7A 4UMBA 1V02A 3BH4A 2J4GA 2WNNA 4A29A 1L6YA 4S38A 5CGTA 4HU4A 3LGEA 3TOPA 3ITOA 4LALA 1PWMA 4JNZA 5H8PA 4Y9MA 3QHNA 3THCA 4X22A 1OINA 2V3FA 4R85A 3KHJA 1EBHA 1NOWA 5D9NA 4H4QA 4C7GA 1XIHA 1LDCA 1R7AA 3E0LA 1D8WA 3LNMA 3FY1A 2QVHA 4JL2A 5HMSA 4WRHA 2R1PA 3LK6A 1C93A 2VZOA 3K1GA 3OLIA 2XIOA 2V0TA 3O07A 1WXZA 2DSVA 1BKSA 2XN2A 1LPFA 2BSLA 3GHUA 4UCGA 4JHMA 2VCAA 1XC4A 1K4QA 4D6JA 5KSWA 3PN8A 2XN1A 3I3DA 3WLLA 4KEZA 3UWVA 2E8YA 4LPCA 3A4JA 1OG0A 4HHHA 5D9OA 2AGTA 3H24A 3CL6A 3TSMA 1HL2A 4O0QA 1PCWA 1LOLA 1B90A 3DDMA 1CGTA 3MTWA 3ABRA 2OKTA 2X40A 5BW6A 1GEUA 4GR1A 4YNGA 4NSBA 1FO4A 3MZ2A 3RPDA 3TKFA 3YPIA 4PCNA 5ABTA 4IIBA 5I3JA 3WLRA 3VNMA 1XISA 1W54A 4DI9A 3LY0A 4R33A 2V5LA 1O1HA 3PTQA 2XH2A 2OODA 1FBAA 3L5LA 4NT0A 4V1YA 3LRMA 1OGBA 3O6CA 4LRSA 4ERAA 1KR1A 2VGGA 2IW0A 4M29A 1F3EA 4AX6A 4JTRA 2A0NA 1KTNA 3AMZA 1V3JA 2VR5A 2TRSA 3APYA 3OBAA 5JBEA 1ADOA 5A8NA 3HPFA 4KRTA 4YLWA 5CSSA 4DUWA 1ZJIA 1V0NA 2F6KA 1N8FA 1JDFA 2IKGA 1EUAA 4LXFA 1FA2A 1S3TC 4R7JA 1SSGA 5BXRA 4BI6A 1UIOA 1JAEA 3EAOA 3R10A 2J7GA 1IXNA 3TAOA 1DWIM 2FVLA 1SQ7A 2HQAA 2OB3A 3MT1A 2G8ZA 4WJ8A 3N34A 3AIVA 1RJPA 3T07A 1G4EA 3GYEA 2C7FA 3ZSTA 3M9YA 4HOZA 4JTQA 1SB3B 1XD1A 3UVAA 3DFHA 2CLLA 1J12A 2DQWA 4GKLA 3RPMA 1BQGA 3LCWA 4Y90A 2XZ7A 4R53A 4X2RA 5J5RA 3NS1B 4HMNA 1R3WA 2VRKA 1NOFA 2VFDA 2VZTA 1QBAA 1H09A 1T8QA 2WW5A 2PC4A 4XAFA 3Q94A 1W6TA 4FNRA 1FWEC 1WBHA 1ZLPA 4KW2A 3QZAA 4IG2B 2PDIA 4YVXA 3Q2DA 5DANA 1SJBA 3DJJA 2PFHA 1LCOA 2PWHA 3N2XA 3G6LA 1N63C 5D9PA 1J5TA 1BAGA 4KEMA 1WDRA 2BGNE 3FEMA 3GK0A 5JCNA 4QQUA 1JXKA 2H8ZA 3QV6A 3W76A 1REQB 1J93A 4OGZA 5AOUA 3GAKA 1DIKA 5C2GA 1VIZA 5AC4A 1HUVA 3MBDA 2WZMA 1PKMA 3UBPC 1EYEA 3P61A 3M6YA 4CNOA 1GT8A 3L9CA 2QCHA 4C6FA 3SRDA 4FMVA 4X0VA 4MSSA 1QK0A 3C3NA 1JFHA 4DBEA 2Z7KA 3UT0A 2Z24A 3MV11 3LYEA 3QN3A 1TG7A 3IGUA 3R5EA 3OW1A 3N4EA 3ZM8A 3VIGA 4DWDA 4IWWA 2V63A 1VFTA 1HTIA 3CUXA 5T9BG 3C2EA 3G24A 2I17A 5HQLA 3W70A 5IHSA 3S2CA 3E96A 1JROA 3GD3A 3R94A 2QAFA 4UWMA 1K4GA 5E9AA 1LBLA 3KWSA 4H8NA 1KFJA 3WLMA 4GFSA 1QNSA 1NWTA 2YA1A 1WQ5A 3Q58A 3SCSA 3MWAA 5C9XA 1EEXA 4ADWA 3P3BA 1X97A 1JGIA 3HU7A 4GNKB 5DMLA 1NF7A 4L4MA 2YAUA 3F4VA 3UWUA 1A49A 4XKMA 2DT2A 2FVMA 4CNTA 1VBGA 3NVYB 4MTVA 5CZTA 3BOFA 1NDAA 4IUGA 3TR2A 1WO2A 1XSIA 2WLYA 5A94A 2C16A 1UZHA 4O13A 4AMAA 5D32A 3URNA 2AQWA 5FF2A 3BMWA 1H41A 5LNWA 2GUYA 1VPQA 5DY2A 3ZR4A 3WD1A 4CCZA 4L9ZA 3G22A 4Y2WA 3SADA 1AQFA 4LV4A 5AHIA 3N19B 4RXGA 3A9BA 4PUJA 4TMBA 3V36A 2YR1A 1CECA 3MUZ1 3STCA 3TYCA 3A64A 1DQWA 1HO1A 2X1RA 3VCCA 1PTAA 3CIXA 4R7WA 2WC3A 4PMJA 3WQEA 1MW3A 2DSUA 3B04A 1Q6LA 5HDRA 5FJTA 1JZ8A 3VKJA 3PJXA 5J8LA 3GTNA 2D0FA 3W23A 4XZHA 4CNPA 5C9WA 4U33A 4DLMA 2DH3A 1YPXA 3ITLA 4MJ4A 5KINA 2TSYA 4DYJA 4HCDA 3BXWA 2O92A 1TCMA 1VF8A 2GFTA 4NAEB 3ZOAA 1N7KA 3LCHA 1VFFA 2VZSA 3B4UA 4RR4A 3URQA 2VQUA 4KEVA 1LL7A 3CL7A 1MO9A 4WQ6A 3R58A 3S0CA 4J27A 4FLSA 3KE0A 4QISA 4JTAA 3GW0A 4U10A 1P7TB 2Z1WA 3HA1A 3ZIZA 4KMQA 1SGJA 4JICA 4V1XA 2H9AB 4RX0A 1PX3A 3W73A 3CLWA 1JZ4A 4K2SA 3KAOA 4WVXA 3FYOA 1ME7A 4K68A 3HQPA 4O0ZA 4Z1CA 4Z42C 4LBSA 3TFXA 3LM7A 2GVLA 2ZFAA 4F0HA 3VNYA 5HBFA 2ZWZA 4Q4OA 5DY3A 5G4WA 5C6MA 3WMLA 5KZ6A 3BAKA 4K7VA 3AAMA 2QUTA 3ZR6A 4J35A 4FXFA 1OGGA 1XPGA 3U0HA 3VOGA 4YTUA 5G2IA 3TQKA 2YZRA 2XYLA 1B3XA 4I90A 4ZO8A 5F1UA 2WHJA 3NPWA 3T4WA 3LXCA 3NEHA 4NXKA 2P50A 3L2MA 1DJWA 4MPKA 3NSXA 4XTIA 3URHA 5BCAA 4LYKA 2Q8ZA 1AMKA 4U31A 4HTBA 4AZBA 2D3NA 3IIVA 1B57A 3W7IA 3T2OA 3H22A 2C71A 4S1FA 1Q8AA 1E9IA 1V3IA 3NNTA 3LLFA 1HJWA 2FPYA 3R2GA 3V1HA 3U4FA 3DK4A 4ZO7A 5I79A 1KCKA 2KX9A 1CGVA 4XV0A 5B7ZA 1VGAA 3AO0A 1LOQA 3FDKA 1C29A 1QOQA 4ZODA 1KGWA 3O3RA 2ZDSA 3WQCA 3OGRA 1UZ1A 1X39A 1UIPA 1TVNA 1S2TA 1U5VA 1M9HA 1L6GA 2X1UA 3BV7A 4BURA 1B3YA 2WP6A 1TELA 5I06A 4BKNA 3W1RA 5ABFA 4Q33A 3ZJ8A 2QDHA 5FJPA 1AODA 1AH4A 3PZQA 1XLBA 4MDPA 8TIMA 5CQ1A 4FSAA 2BVTA 1KRBC 1O6IA 2VVNA 2PI6A 5A6TC 2CBUA 3WX7A 4ZOBA 1TTPA 3OTRA 3ZT7A 2D2HA 3G8RA 3EB3A 1DL3A 1XWYA 3B0XA 1FEAA 4ZOCA 1X96A 3A5VA 2VL4A 1J18A 1JG9A 2W3SA 1T5AA 2FPTA 1JPKA 1A5NC 4FR1A 4JTJA 4LVDA 1MZHA 4FOKA 4Z1YA 3BGJA 1W5PA 3SRKA 1BXBA 4W8AA 1R86A 2VDHA 3IK2A 3WCZA 3W3OA 9XIAA 4IFKA 3C0SA 5M5DA 3NGJA 1BYBA 4OWGA 3S2MA 1JF6A 4IPJA 1EO5A 3T0AA 3PG6A 2A3LA 1JRBA 4EQXA 4KWVA 4PTVA 4M19A 4JN7A 1H7XA 2J74A 2WSKA 3H2AA 4R27A 1JDDA 1PVNA 2FJUB 1QAPA 3DYOA 4QNWA 1G9HA 3U7VA 1VC4A 3LQGA 1N61C 2J79A 4B2DA 2WP5A 1JNEA 4N6EA 1CXHA 3UJRA 1FCUA 1DHPA 3TYBA 4DUOA 4AWTA 2QVNA 3BE7A 3FDGA 3EYPA 6TIMA 3VE9A 3W75A 2XGIA 3ZWSA 3PUEA 3VIKA 2Y1HA 5HMFA 5K9XA 1LT8A 4AX7A 1XLGA 1XUUA 3P7YA 3GDRA 3WLKX 2W61A 3KLKA 3R11A 1MSSA 2WVUA 5HXMA 3FKRA 5U1OA 1W32A 1H7PA 4MNKA 1H5YA 3O6AA 4ZSUA 3KBWA 2VRJA 4GI6A 3G6MA 5HQMA 4EXQA 3PTDA 3UNDA 4EQWA 4P61A 2WOQA 1XFCA 5IFPA 3UR7A 1BVWA 3DK9A 1C7SA 4GJIA 1EXPA 4C6KA 5A1AA 1YNYA 2Q8LA 5FS7A 4LBRA 3DGRA 1KGXA 7CGTA 5IRPA 4BF5A 4CQDA 3BLPX 1UYQA 3EAUA 1V79A 1TPVA 1AD4A 1EQPA 2V38A 4MG4A 2VFEA 3L4VA 3IV3A 1ZXIC 1PZ1A 3S9IA 1OADA 2WNZA 1F05A 4ZE4A 1XRSA 1XP3A 2BWGA 2J9YA 3QSRA 3VFCA 1G7UA 3CPRA 1E3ZA 4E3VA 4XUYA 4JTLA 3CBWA 4GZJA 1UWUA 1F3TA 3RXZA 3EWYA 3IUIA 3WLHA 4AF0A 4WKHA 2J24A 3EWXA 5DLCA 2WHKA 1NQ6A 2HPIA 2QCGA 1KM2A 2NZLA 4QGCA 1W5OA 4W9TA 1GV4A 3HG2A 3IJLA 1ZHAA 3DECA 1FRBA 4W7WA 4UQBA 1E55A 1MW2A 1VFSA 2YSWA 4C6NA 3QC3A 2HSAA 3U48A 1KRCC 3WQ4A 3QFWA 1A80A 3CWHA 2HJPA 5A2AA 4G56A 4B15A 4E38A 2YW3A 1AL8A 1R3SA 3VE7A 2CLPA 1G0CA 1UG6A 4Y9OA 3CHVA 4IQJA 1R0MA 3RLVA 4OHQA 1EP1A 2QCNA 1ITUA 3UJFA 1GG0A 3UR2A 2FVKA 4QQ3A 5FF4A 3OGSA 1W8SA 2WC4A 2NSXA 1IR1A 2E1WA 1F8IA 3KRUA 1H7RA 2CWXA 2QXWA 3R25A 4TTGA 3RF9A 1R47A 2VX5A 3IVTA 1BSLA 4JIHA 1E4IA 1ITCA 4PUMA 1PDZA 4AB4A 3VIHA 2CBJA 2CYGA 5FSDC 3MUCA 4ICNA 1FIQB 1MXDA 3UZYA 2YBUA 1U30A 3GXFA 1HJVA 1MXGA 5JCLA 3H53A 2E6AA 1TREA 2ISSA 2OGJA 3CV7A 3DC0A 4ZOAA 3G1XA 3T55A 4JYDA 1UOZA 1EHAA 3N2MA 1KGUA 4LVBA 5EMLA 3SURA 4A8IA 2GR2A 1JCXA 2PGEA 1IEXA 3W07A 3QMRA 1TV8A 2C3DA 3PWAA 2WVTA 2XVKA 1DJQA 5D02A 5D37A 2WWDA 1YDVA 2WHMA 5CC6A 1Z89A 2J66A 3EXSA 5JUVA 3EKLA 1MQQA 4H6QA 2IKIA 1Q65A 3UWZA 1ADDA 4XTDA 4L4PA 3N11A 2ZZ0A 2NV1A 3PB0A 2E0PA 2D69A 2PWUA 4HTYA 2X09A 1VQZA 1CW2A 2GGEA 4N2YA 3ANYA 3EMQA 1G67A 4N9CA 3UWEA 3BLKA 5IOBA 1TRIA 3H4WA 1KM0A 2IPWA 4PTDA 2W0HA 3DENA 4H4UA 1XCFA 3STGA 4H7CA 5EMKA 3A5FA 3WJYA 4H8HA 1G6CA 3WDQA 3EXTA 2WJDA 1W1YA 2RHGA 1J5SA 1EPVA 3SN0A 3IGXA 1JFXA 4YXGA 1MWOA 2OT0A 4PB3A 1OZMA 1RBAA 3OC4A 4MY1A 3MJYA 5G4EA 2A6NA 3LBOA 1AJ2A 3R0DA 1HJSA 2ACSA 4GQQA 4AUBA 1AJZA 4PH6A 3ZO9A 1FP9A 4W93A 2A7RA 1UWRA 1UR4A 3P81A 4ORIA 2PPGA 3NR0A 1TV4A 1TMLA 3ZLFA 2FZMA 7REQA 3WUBA 1FHDA 2CC0A 1GNXA 2VMFA 2ZZ1A 3VKKA 4GCXA 2AQVA 5CEWA 1FCQA 5CZ0A 1JUEA 2AAQA 1CLKA 3H7UA 1XSKA 3WKZA 3JUGA 5KITA 2WVVB 4M8UA 2H3BA 3QKEA 3W85A 2GSHA 4JYFA 1GRGA 2NUWA 2HS8A 3RK8A 2V2CA 2VHLA 3ONBA 4GVFA 4XBSA 1EGZA 2FMOA 1SZEA 1QCWA 3W1MA 1PKNA 1QOXA 1MDLA 1YDOA 4ZA0A 2Z7GA 4H8VA 3MHFA 3M44A 1SFTA 3THDA 3HPZA 1QW9A 1RVKA 3WH8A 3CIVA 3TW7A 2G3JA 4AXKA 3VI2A 4FI4A 2O4QA 4ATLA 4YTTA 3RDKA 4XBKA 4YVPA 1ZMDA 4J3XA 4ZB0A 3CYJA 3QV8A 4MZ8A 3MVIA 2HISA 1OJTA 2WOIA 2X7WA 2AKZA 4MGGA 1PKYA 1F6YA 1MO0A 3TC3A 2TAAA 2VOTA 4MB1A 3N1AA 3P93A 4KWOA 2Y6ZA 1KCLA 4IH3A 3IAQA 4JX6A 3M7WA 4C1NA 2E9BA 3OZPA 1DE5A 5JH1A 1SJCA 2D3LA 3S2NA 2ZCGA 2ZVRA 3SIZA 1THFD 5BRPA 1I0DA 1TPUA 3VIPA 1P1MA 1BVZA 6REQA 1F9CA 1PIIA 3KLJA 4W5UA 3NVTA 4Q4QA 4JDBA 3RX4A 2DFAA 4B3KA 4H4YA 1VLIA 3M41A 1IF2A 4DO7A 4HZ6A 1QPQA 1YBQA 3QH2A 4D6EA 4GBUA 2YDSA 1TB3A 1ZBWA 2W67A 4P5UA 3DXIA 3MWCA 2WMGA 3EX1A 5HNUA 4X2PA 1N5WC 1M65A 5KVIA 2POZA 3DJGX 3QMTA 3C6CA 2W9MA 3AXXA 3TSBA 1SMDA 1JXJA 3H8AA 2DVXA 5CZJA 3T05A 3KOYA 1XJBA 3LB0A 3UG3A 2V81A 4M7SA 1CNVA 3QR0A 2WKJA 3B97A 2YDAA 1HVQA 3IV8A 3DBPA 1XQLA 4HIBA 5LXXA 2OWXA 1ZU8A 3S9ZA 1XH2A 2JEQA 4YCOA 2NW0A 4IMCA 2O4MA 1IEIA 2Y7DA 4LAUA 2CFYA 1Q6CA 4WY0F 4TOQA 4Q4SA 3D47A 2ZUNA 2Z1KA 4DZIA 4WHBA 2V3DA 1K8YA 3V16A 3B8IA 3L7RA 4JTKA 2VURA 3T7VA 4IMEA 1T3QC 2Y61A 2W66A 3G1VA 1AL7A 1DPMA 1J2BA 3HURA 5M3WA 4GFIA 4L4LA 2V5JA 4IQDA 5JIWA 4US5D 3T08A 3KEHA 1OEPA 2A21A 4LTSA 3AMLA 3PF3A 1FDZA 1BFNA 1QASA 2XH0A 4DNAA 2YXGA 4F4RA 3OOQA 4EP8C 1ZQ5A 2FZDA 4CNNA 3VDHA 1S7MA 4H50A 4REQB 2OG9A 2OXNA 3W87A 1GREA 3LSCA 5D9MA 1VEPA 2OVLA 3QRHA 1SZRA 4GCAA 4GPNA 1BGGA 1XYAA 3DHUA 3SY5A 3L5OA 4JY8A 1H2JA 1GSNA 2BXVA 3MBFA 3T2PA 1OCBA 2E9LA 3U2CA 4Q3MA 1SYTA 2QW5A 1OM0A 4LEFA 2A2IA 5F4XA 1RCOB 2WCAA 1JD7A 2KAUC 4DXXA 1HKVA 1G5AA 3GD6A 1QXLA 1STZA 3KOWA 3KW3A 1QU4A 3PJWA 2YL8A 2PWDA 2RJHA 4O1BA 5CKSA 1QO2A 3EEGA 4LNYA 4B5NA 4QAIA 1VPXA 3TTEA 3BOLA 1A5AA 1XFBA 2ACRA 2CDUA 5EB8A 3WK2A 1DORA 2ZIDA 3B8DA 4PRRA 3DFNA 1K7FA 4NZFA 3I65A 4L80A 3A12A 3A7AA 3HOJA 3BW2A 1EZ2A 6TAAA 1JI1A 2R14A 3RM8A 1K9EA 4LCQA 4TIMA 2QGHA 3I3EA 5AHFA 3TTSA 4US5A 1D3GA 4CU7A 4K8GA 2VXNA 4JTFA 1GOWA 3APTA 4YWIA 1RQHA 2HNHA 4HJWA 3VOHA 4HA1A 4JR5A 1HGYA 1UD5A 2CHNA 2GVEA 2IPGA 2NUXA 3RO8A 5E93A 3NURA 2FHCA 3WDJA 4PMOA 3SCRA 3WBAA 1ISXA 4IQLA 5DMMA 3A9IA 5FEXA 2QJNA 3L2LA 3UZXA 4KGLA 4HP5A 3VOJA 1FFUC 3WENA 3W00A 4NZJA 3QF0A 1PZ3A 5JCMA 1FOBA 4NJIA 1QATA 2ZZ7A 1CLXA 1ZPTA 1XC6A 2ATMA 5L9FA 3BUVA 3PNZA 5I24A 3VM5A 1QNQA 4ZBCA 1EUNA 3DKLA 2HXUA 3ZT6A 4DO4A 4IIGA 3WUEA 4AZCA 1I2QA 1D3HA 3SQMA 3WK0A 2QCDA 1OC7A 1J0KA 3HPXA 2I9UA 3VCNA 3WQDA 3TA9A 1E1EA 3C61A 3NDYA 1SFJA 2J8GA 2HCVA 1TX0A 3DCPA 1N62C 5EMYA 5K2ZA 1TWWA 2ALDA 1ZBKA 2ABBA 1EJWC 4WUIA 5FA5A 2ZTKA 1UUMA 4IXXA 3VIFA 1S2UA 4QJ1A 3PUDA 3B8SA 3S2JA 1FVPA 3NQMA 2DUZA 2WAGA 3DFTA 1CGYA 1DHKA 2PP3A 3SB0A 1T8XA 2BVYA 3LRKA 2GGIA 3HMCA 1OCJA 4B9ZA 1UWQA 1XLHA 1FTXA 2VCBA 2J7EA 3S1UA 4UBPC 2NSOA 4XX6A 4I7UA 4HNTA 3LCFA 4D8LA 5C0QA 3Q6JA 5HJLA 3EWDA 4X61A 1IV8A 2NXIA 5DQPA 4XKYB 1JIBA 1ZP4A 5LSMA 2EG8A 2RDTA 2QPUA 1M41A 3VOCA 1I2NA 3U9IA 2F2KA 2EHHA 4L65A 1E15A 4KIEA 2ZXAA 5FJUA 1SMAA 5AYZA 1SZNA 1O4UA 4M6PA 4CVWA 4JEJA 1UD4A 1U2YA 4HK6A 2Q02A 3TVAA 1AZ2A 1W1IE 4JEQA 3WNOA 4BI7A 1QBBA 4G9PA 3B9DA 1NP0A 2QV4A 4F2BA 5D03A 1MUMA 1I4NA 1QWKA 3PK7A 1H60A 4DBUA 2QKFA 1BRLA 4PMQA 1ISWA 3DUGA 1S5NA 1U83A 1HIZA 3W22A 3WN6A 2QJIA 3O0HA 4GYKA 1XCWA 4NZ5A 4PMRA 2IKJA 1IEQA 2VTFA 2CXGA 4GWEA 1LQAA 4YCPA 2GGGA 4P7RA 3F03K 4UNKA 1Q6RA 4H3DA 3VA8A 3KP0A 3A23A 3I7QA 3RRAA 4LS1A 2OSWA 4Z0JA 5K9DA 1HKKA 1J0ZA 2QLYA 1EJTC 3KRSA 1N5XA 4IL2A 3W38A 2YFNA 3BGGA 1W1TA 1A0CA 2JBMA 5CBIA 2CWNA 1EIBA 3S42A 1UA3A 1O68A 2DUAA 2PBGA 4DJFD 3A24A 1H1ZA 2NQHA 1H3GA 1LL4A 3WF3A 3IIPA 4I3GA 5FS6A 1V3HA 4R3UA 4K3ZA 4GIRA 3VXGA 4AVFA 4PA8A 1BHGA 2PWGA 4LUSB 1A3HA 2OSXA 1FDYA 4MF4A 2OT1A 4IGMA 3A47A 3WBWA 1ZP3A 1Q4NX 4ZO9A 3C0JA 4G7EB 4UFMA 3CT7A 3HTWA 2DVTA 2C13A 3S9YA 1X7IA 2ACUA 2O9RA 3M0HA 4TU1A 3L5MA 3VINA 3O1NA 3RU8X 2PRLA 2QQ6A 3VM7A 1K7EA 5FOOA 4NI3A 2QDGA 3KHDA 1YQZA 3BSHA 4GIEA 5BRBA 1HF6A 1E1CA 2GJLA 4H6RA 4Y8EA 4UZUA 3D3AA 1AD1A 4WOQA 3TR9A 1KRAC 1M3UA 3O2LA 5D8WA 3M5VA 4KRUA 4L1XA 4S3DA 5T8GA 3KVMA 4AAJA 1FWTA 3BG3A 1FFQA 3G18A 1YYAA 5CGMA 1R9XA 4PTMA 3LUTA 3WLQA 1A5KC 1F5ZA 4GMEA 1AA1B 4CLMA 1XGDA 3PZVA 4GC4A 3T0CA 1YXCA 3OG3A 1KBIA 1PX4A 3NO5A 4RJEA 3WQPA 1D7KA 5A8MA 1VB9A 3G5EA 4HYRA 4BEUA 2Y5EA 4XZBA 3LM3A 1JDAA 2J78A 4H4IA 1HN1A 4CU8A 3PZNA 4XZNX 2TMDA 4CD8A 2EQ8A 1K9DA 2OZTA 3BVJA 3ARWA 1JPIA 7TIMA 4EOUA 1UH4A 1T41A 3KOXA 1E4MM 4JQAA 3U6WA 3IPWA 1PSCA 1TUFA 1CXFA 3EA3A 1XDJA 2EKCA 1P43A 3TXVA 1EHNA 5C71A 3HGRA 3BQ5A 1IEWA 2PF0A 3PVFA 3IGSA 2IS7A 4MNJA