3P9ZA

Crystal structure of uroporphyrinogen-iii synthetase from helicobacter pylori 26695
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
222
structure length
213
Chain Sequence
b'MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLKMLQNIPAYALSEPTAKTLQDHHFKVAFMGEEIFPLLEKKSVLYLRAKEIVSSLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFLENYTAISIGNTTALYLQEQGIPSYIAKKPSLEACLELALSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen III cosynthase (HemD)
molecule tags Ligase
source organism Helicobacter pylori
publication title Crystal structure of uroporphyrinogen-III synthetase from Helicobacter pylori 26695
rcsb
total genus 61
structure length 213
sequence length 222
ec nomenclature
pdb deposition date 2010-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02602 HEM4 Uroporphyrinogen-III synthase HemD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p9zA02
3.40.50.10090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p9zA01
1WCWA 3MW8A 3P9ZA 3RE1A 3D8RA 3D8SA 3D8TA 1WCXA 4ES6A 1JR2A 3D8NA 1WD7A
chains in the Genus database with same CATH superfamily
4CQNA 3DOCA 1PJCA 3KSDO 1ZNYA 4NPHA 4P4LA 2SCUA 3DMYA 1TEVA 2AI2A 2LRHA 2IC5A 2Z8YA 2H4HA 2D2XA 3EEIA 4FLMA 5K8LA 4HDMB 5KYGA 5E38A 5AKKA 3FHCB 5FTNA 5TS2A 1LK0A 3ZGVA 4Q9NA 1A95A 3ESDA 3QLVC 1IZ0A 1GQYA 1CLEA 4PIVA 1HEUA 3NYQA 4YT5A 2GVNA 1L1FA 4GX1A 4HP8A 4IILA 4PHGA 5GZ6A 4E15A 1WXDA 3LH5A 1YIAA 2GERA 2YHUA 1KJYA 1KS9A 1QF7A 2W8ZA 2IIVA 4DVJA 1BHJA 1EWVA 1IHUA 5LKRA 2VQFB 4U39A 4R3UC 4ZZ1A 3QKSB 4ZI5A 1VJRA 2B98A 1Y3IA 5KCMA 1XZGA 5F78A 5KKNB 3OJFA 1MD9A 1SQSA 1SD5A 3MGGA 3Q3EA 1UMKA 3QYFA 4TTTS 5EHGA 5C8VA 5LNK6 3X1JA 1JLHA 1GA4A 2QIPA 3IB3A 5HFAA 4ZHQF 1FVOA 5K6AC 1VE3A 3ITDA 3FG9A 3EZLA 4YEDA 4CM9D 4JL5A 3P5BA 2XI4A 4PTYA 1KDVA 2IYXA 2VJPA 4UEOA 4XYGA 3I8OA 3ORRA 4IBOA 4E03A 3H4VA 1Q12A 4DDWA 4KQFA 2PLWA 4HTFB 1AK1A 4HV4A 4YPFA 9LDBA 5KOJB 3FROA 3PLNA 2QJFA 3QX3A 2A33A 1Z8DA 3R3HA 5B2FA 1AHNA 3E7WA 3KOUA 1B8VA 1BHSA 1Q1ZA 3AOGA 5DOVA 5TEVA 1RHQA 5H9WA 5FPTA 1NNUA 3AHGA 5CDGA 1DKPA 4N5HX 1QVRA 3NMUF 1J0CA 1KYQA 3FNIA 3UW3A 1N2CE 3F6PA 3NHLA 1WV0A 1L5LA 4F3KA 4Q9KA 4QTTB 3ZI0A 4DCJA 1Z47A 2BZSA 4BGUA 4Q9AA 1Y8RA 4GYJA 4Q3LA 1UXHA 1W4AA 4KPFC 1CDOA 5AKHA 1J0XO 2P8SA 2DPLA 1AUOA 3DL0A 1Y63A 1SZJG 3GLFA 2FSUA 3HZOA 1N5KA 1QNLA 2J85A 2PGAA 2XITA 4I1SA 4Q3BA 3W90A 3GPLA 3JQ7B 2EEPA 3MFQA 1KK1A 3ZDDA 4FGWA 1K0FA 3SVZA 1E2FA 2NW6A 3COVA 3D6NB 5JVDA 2ZYWX 4C0AC 4CKWB 2DLCX 3DKPA 4PQGA 1R1DA 1A4IA 1RTKA 3ZWAA 1YFKA 3MMNA 1WABA 3SR3A 5T57A 2BGGA 5BV8A 2DU8A 1XZNA 4NCKA 1P0IA 1UWVA 3MGAA 3R74A 3RUFA 2VATA 3BUSA 1YB6A 5KTSA 1J2TA 3AEKA 1HG1A 4KRXA 1PI3A 2Z0MA 2OV2A 3GD5A 3O93A 2PWPA 2CFTA 2W2KB 3FNBA 3NYWA 3OFND 3O0DA 3NKLA 4OY3A 2W43A 5IMBA 4DIUA 1R4MA 4UTPA 1UP4A 1KAMA 1U2QA 4YACA 4ZTZB 1JHQA 3BIOA 3T0IA 2DC1A 4ER0A 4UNSA 1G8PA 3IKVA 1BXGA 3RSOA 4M98A 4R2JA 3OFSA 5BWOA 4G4IA 3CYFA 1WB9A 3PXEA 2PMWB 1CF4A 5AHOA 2A5GA 4OF4A 1UQTA 1ZEMA 2VBFA 1A72A 4CLOB 2GVZC 4L27A 5TPZA 5EPUA 3ZCQA 4N0PA 2OHXA 1PV1A 3EFEA 3H1EA 5FF9A 4AZWA 4MGKR 2V4UA 3OH8A 5B3KA 5LWHA 1LPMA 1V1MA 2ZSFA 1FUUA 4FKBA 1P7VA 4HWGA 5J2TF 1GM5A 2AZMA 4EJFA 4X20A 1MAAA 2HM7A 3OF5A 4JC4A 4KLRA 1KIAA 1CIPA 1AK9A 1C9JA 1H8HD 1Z6AA 2DFVA 2H65A 2QAGA 4ISBA 1U0FA 2O0MA 4M1TA 3DLPX 3LXMA 5DBFA 1HNXB 3OT4A 4BB5A 4B40A 4B8YA 5DK4A 5KTKA 1SBYA 2OVFA 3D6HA 3FLEA 3GWGA 1UOQA 4HOYA 1DAPA 5HS6A 1WY5A 1VB3A 1FDUA 1QLJA 2A9JA 2BBTA 2BHTA 2X9GA 2CCGA 3HYCA 3O73A 4G86A 4AD8A 4FT2A 4PWZA 4Q5IA 4YGXB 3RVSA 1II8A 1P2UA 1OSNA 4I1IA 4XYLA 3EK2A 4KJXA 1CSEE 4NG5A 3WP0A 1QGYA 1T5OA 3H8VA 1FFEA 1N7GA 3IUSA 4TLMB 1GGFA 4YJ3B 3THSA 3R3VA 2B83A 2IUEA 2FRXA 4K9KA 4AKHA 5BW5A 1QH9A 1EFKA 1G8YA 1ZNXA 1SA0A 2BI4A 3WRYC 1VMEA 2J9YB 4AJ1A 5B30A 1ZR2A 4HBZA 4EG5A 2Z2IA 5FV4A 1QAOA 3LC0A 5JIBA 1U8XX 4RA9B 1CE8A 3SBDA 1CUAA 1NJGA 2C8KA 4DNXA 2GNOA 3H2JA 3QMVA 3T95A 1GUDA 3AFIA 1UP6A 3OJLA 2I78A 2AKEA 3RBZA 2OGSA 7AT1A 1FRNA 1P9NA 2IDZA 1YCDA 3RYIB 1UOOA 2FYTA 1X7DA 1CUBA 4G5YA 4CLOA 1RRKA 1II0A 1PU2A 3DBRA 4NFYA 1TVEA 1P77A 2HBQA 1MIOB 5TV2A 4O2AB 3TVDA 4D7AA 3ZJVA 2C9OA 2ATCA 3O91A 2JLZA 1E98A 1VMIA 5A4FS 3B1FA 3BXFA 1NVDA 1MABB 2IY9A 4MQFA 1EXVA 2FB9A 2HDWA 3L05A 2XCOA 4GBED 4BJHB 3COSA 3I53A 2BLLA 2J1LA 2K5UA 3NPAA 1BMTA 3Q4GA 3JYOA 5KHAA 4N7JA 3DE3X 2VHYA 2XMPA 3TW4A 4HL6A 3WK9A 3HGMA 4M1YA 4ARVA 3DZJA 1TVCA 1N6LA 4BBAA 1IOWA 2WTNA 5IT4A 2C31A 2A9PA 4KQMA 3G79A 4QFBA 5A4MS 1Z4JA 3EG5A 1YS4A 2JDIA 2BKAA 4JLNA 5D1NA 4DRXB 4RORA 1NU8A 2YVKA 5COBA 4YT2A 2DX7A 4UE2A 4KR3A 3H97A 4QBHA 3HN2A 2DHDA 2WOJA 4MW1A 4Q1FA 3VSEA 1EK2A 3STYA 1DKRA 1G5PA 1P80A 3A04A 3CLUC 4MWTA 1HDEA 3IMKA 4Z9AA 5DYNA 2OZEA 3SYMA 4PO8A 4JI0B 4NEQA 4M76B 2E3JA 4PRKA 4RDCA 1WLSA 5IYZB 2M1XA 1UWCA 4CQMA 3RTGA 1ONSA 2PT5A 3O90A 4FEEA 4MV8A 1ZGJA 2Q3LA 1LKZA 2Z3ZA 4KVAA 4WV3A 3DF7A 1Z2OX 3VDQA 1PUJA 3KZOA 3ZIAA 2VHJA 5DRTA 2ARKA 2IDKA 4PONA 2RG7A 5AVTA 1W4ZA 4HNHA 3I05A 2IX3A 2C7RA 4MVJA 1SQFA 3BILA 3KXIA 4GG1A 4W7SA 3RF7A 3KU1A 2GEFA 2P69A 4KXQA 1ZRMA 2F4NA 3V1KA 2H31A 4NVRA 2B1QA 4X6XA 4TKUB 3ASYA 4BMXA 5LA6F 4MO2A 4O4IB 1IBSA 1SA0B 2V7TA 5DXFA 1QKIA 2WWFA 2SBTA 2I4MA 1KDZA 5ALUA 3BGSA 4FC7A 5AUOB 1V0JA 2VTBA 3ESZA 4L4SA 4QQFA 4RX1A 3T15A 3LT0A 3KR9A 1JAXA 4WY5A 3BT7A 1Z39A 1SQ0A 3BD7A 3IT2A 4MMYB 2WFLB 2ZKLA 3IQWA 2QMHA 4Y2GA 3UWKA 3I30X 3B8HA 1RZUA 3EYAA 2HLDD 3OIGA 4WJLA 1GGMA 1GEEA 4KUHA 2HO5A 4Y0NA 3N2KB 3PR2B 4HGYA 3RFVA 2H1HA 2XT0A 3ZEAA 5BNTA 3K53A 3G13A 4UVIA 4DRZA 3GG9A 3GAMA 5JS6A 3UT5A 4YAKA 1I6WA 4LBZA 4C4PA 2PL9A 4MAMA 3IP1A 4V0SA 5KYXA 5REQB 4Z7JA 1UR5A 4M0PA 3DL4A 3OHPA 2Q7DA 4A0QA 4EEKA 1VYVA 2F1IA 4G9BA 1G3UA 1ZGBA 1NE2A 5D3QA 3VYUB 3RK4A 3ZD6A 2ZJ2A 2H51A 1VPTA 1C8LA 4K6MA 2YCBA 3KQLA 3AJDA 1U7UA 3NTUA 2NPFA 4A6DA 4WOKA 4W99A 2PLAA 1E79D 3K6KA 4F1WA 1RRGA 4PEVA 1NPDA 3BM5A 1M6NA 1W87A 3GH1A 5EKSA 5BSVA 1WVIA 1P6XA 4NK5A 1Z0SA 1WZIA 2XOKD 2DRIA 2HRCA 2C2HA 1EQAA 2EQAA 2RKWA 2X77A 4OLHA 5DGHA 4DLBA 3O9MA 2XCRB 5K03A 4MW4A 4C6TA 1F14A 3F1LA 3NV9A 2D1TA 4L8FA 3UGQA 1Z4NA 3OCWA 4JLSA 4P4SA 5L95A 1YVEI 4RTMA 4PPFA 2EHJA 2IPNA 1C0LA 3F4KA 3MTIA 3BCSA 5EL0A 4CCYA 1KMHB 4LMPA 5D01A 1N2HA 3PQEA 5JV5A 4MUKA 2ONJA 3R3JA 1CTQA 2L42A 1C7QA 3R3WA 5DLYA 3DVRX 1CY8A 1EFAA 3HDHA 3TLAA 1JLLA 1KH2A 2WD7A 1NBEA 2GSDA 3OZWA 2BRUC 3WZLA 2GI4A 5DNVA 1FOEB 5SY4A 2WJAA 3HE3A 4L15A 4MV4A 4RKEA 4RK4A 3SBXA 1SXJC 4GX0A 4PO3X 1I1HA 5B37A 3F9RA 4EPRA 4MVWA 4QBGB 1PK8A 2GD2A 5ALFA 3L4EA 4RA6B 3VDRA 3VR2D 1IWPB 1WZ2A 1PWXA 2Y92A 3X44A 3OQVA 1L4KA 1E61A 1FE8A 1O5IA 1S3IA 2XYQA 4JI3B 1CZHA 2HA5A 4B46A 5K4HA 5D2CA 1DO8A 1M1NB 3EW7A 2WUWE 3CVYA 2J7PA 1CS0A 2FAXA 2OM2A 4AZVA 3ZD7A 1J1IA 3N9IA 3UT6A 1CQIB 4JIMA 4KN8A 1Z4LA 3IP6A 2QOEA 4RNCA 5TF0A 3TLJA 1J07A 3BJIC 1MNQA 2MU1A 4WLUA 5AJWA 5AHRA 3FUXA 3OEHD 4CUKA 3ZDEA 2C2BA 2O0LA 1E62A 3PNPA 4CEIA 4YJGB 2E5FA 4NYJR 4RUKA 2VP3A 1ZPDA 2I5PO 1DFHA 2YFQA 4KE6A 3CKLA 2VF2A 2O3QA 2ZSIA 2R4TA 4HXEB 2ZI6A 3UTDA 3E35A 4MW7A 4FFPA 1JT9A 1P4RA 3KS9A 2J6CA 5IDYA 3NJ8A 3LKBA 1TVMA 2Q4BA 3BHNA 4MARA 4R1SA 4XFJA 5HIMA 1VIAA 4LEIA 2F1KA 3VHXB 2XCQA 1XMSA 3U2QA 3WQHA 4BQPA 4I99A 2O3JA 1IATA 2AYZA 1TZJA 2C3MA 5C5EA 721PA 3L6UA 2V8BA 2IWHA 2QX4A 2YWJA 3AM4A 3WICA 5T6BA 3CZRA 3VJKA 4Y6RA 5JDIA 1TU3A 1T9CA 1WS6A 2GNAA 3JQGA 5I9TA 3L4KA 2CLIB 3WGHA 1A3CA 1BXZA 1ZONA 3F71A 5C8YA 1X8JA 3H9UA 2IQIA 3IODA 4GM1A 2CN1A 1XMJA 2X0DA 4KNVA 4UOQA 1OXVA 2C42A 2LKDA 4H7EA 1L5NA 3UMRA 1FYFA 2J6BA 5GGYA 3ZU3A 5ITWA 3MJTA 1OMOA 2NSYA 3V3TA 2LE0A 3QUTA 5EJ6A 1JR6A 4OI0A 2A3NA 3QX8A 5HZKA 2GZHA 2H7CA 3SQWA 4B2LA 4DC0A 4V1CA 3SX2A 1Y8RB 5G40A 3A1UA 4EG0A 3GJ5A 3PQ4A 3S2FA 2O14A 1WKBA 1GUZA 3ZE7A 4R68A 5BN3B 3B9QA 3GP5A 3M1AA 4TMYA 4Z1MA 2CNLA 2I2XB 5JEEA 2JFGA 3JATA 1FTYA 2HA6A 3E3NA 3NWOA 3OWHA 2HLDA 1QR6A 1VKZA 1GNQA 2B4KA 2ZWPA 5KYTA 3G0HA 3AFGA 2I22A 4URZR 2BMVA 5C5IA 3V7NA 2BDUA 1ATIA 1JHRA 4D8UA 3AVXA 3LFUA 4RADA 1IZ8A 3AHDA 2Q50A 5F98A 2G71A 2NU6B 2HQRA 4N9WA 3K0AA 5EGSA 3KOYA 2WIBA 2AFHB 1Z45A 5JRDS 3EZ7A 4HAWA 3ELBA 2Y1CA 1ZN8A 3PDIB 4KV7A 3W2GA 1IQRA 4QICA 2Q28A 4PPYA 2RJNA 1GL3A 1NKSA 3EVEA 2XUQA 4RQAA 4RS3A 1CS4C 1QWSA 1UBGA 2C92A 1YL7A 4FGLA 4RHEA 3W8FA 1GYRA 3NHWA 1V4VA 3UJ7A 1O95D 2GFIA 4DA7A 2W6OA 2VJMB 4IIXA 3R7AA 2BI7A 2VP5A 3V33A 1CUIA 2GEBA 3BKXA 4M53A 1JJFA 4JBGA 4B45A 3TBHA 1ESDA 1ZC4A 4NU5A 5JADA 2ZE7A 3OSUA 2JFNA 3AF3A 3BB3A 4BKRA 1V39A 1YV9A 2IZZA 2D54A 4MJXA 3I2KA 5K0CA 1R9MA 2B2CA 4AJJA 2CFRA 5J23A 2QR2A 3EPKA 1VL8A 3OPXA 3UXHA 1G9SA 3LNTA 2VJYA 5TDHA 3LY5A 5GVSA 1CR6A 2B5VA 1M1NA 3WV4A 3JQQA 4FWIB 1HE8B 4M7PA 5BYBA 2B5OA 3DP9A 1BX0A 3MMPA 3OU2A 4HZIA 2I29A 2RJ3A 3BICA 1ZX1A 4KSCA 4WHMA 2WYIA 3SC2A 3TB6A 2H63A 3QVXA 3AB7A 1E2BA 1G2QA 1SUBA 4MKXA 2QU8A 3ZDRA 3K6SA 2IHBA 5IKXA 1BE1A 3UB4A 2FPSA 2JL1A 3MW8A 4U3JA 3C6KA 4NZ9A 3W7BA 1H2WA 4FOPA 1TCBA 5EE1A 4M38A 4DA9A 1YTUA 1LNSA 4OL9A 3X2SA 4KRFA 2O3RA 2WVAA 5F1PA 4EVIA 5HQ3A 1IEVA 2BSXA 2ISCA 5BN5A 4W7IA 1QB7A 1P2BA 1TUEA 4PLYA 4Z4EA 1I7PA 2V7XA 3AFNA 1W29A 5AR1A 2IXGA 2C57A 1VSTA 2WILA 1NBWB 1EZZA 4XSVA 4GAEA 4HQRA 2OXTA 2ACVA 3TNLA 1NNI1 3I2HA 1C3JA 2DHCA 2HSEA 2JF0A 2VH2A 2SKDA 1KR5A 1NYRA 2J3IA 3FPKA 3HSKA 1C1DA 3Q9LA 2BUAA 1ND5A 1CULC 4PSAA 1H93A 1A9TA 2H3HA 2YQ4A 3PWKA 2HGZA 3M2PA 3JWJA 1E1DA 1G98A 1K97A 4A1FA 1P19A 1AMOA 3LPAA 5DCYA 4LOHA 1J2JA 3OZBA 3RS5A 2QN7A 1E69A 4QOEA 4YAOA 1V1MB 4ARBA 2OG2A 2P2GA 4EW2A 4RH1A 4BUJA 2OK8A 3V32A 2WU8A 2UVPA 5HKLA 3EVZA 1TQ4A 5CT4A 4CZ2A 5ALZA 4CM7A 2VAWA 2ZJ7A 5JZVA 1YH3A 2UAGA 1Q44A 2H1WA 1T5LA 1IOLA 3ELUA 3PXUA 4JI5B 1TQ2A 3PGJA 1I0IA 4RFSB 3W78A 1IEXA 4H1HA 4NNPA 3T7IA 1NVAA 4HLUA 1OIVA 2QZPA 4MJ3A 4RPKA 2MSDB 2YV3A 2O8FA 1F2TB 1P72A 1SXIA 2NAPA 2PPVA 2P78A 2BFOA 2WNHA 1P6QA 2ZRBA 3EXHA 5EP4A 3RABA 1QRUA 3ZX5A 3NHRA 1MVNA 1GWNA 1S1CA 5F3RA 1OWLA 5A3JA 2O57A 2WM9B 4QUEA 4OOEA 2CLMB 5LQMA 1YWGO 4NABA 1ZM2A 3FOEC 5DN9A 3QEMA 1UEXC 2J5QA 5ITSA 3L9XA 2R7KA 3PQDA 3OZSA 1NVEA 4O25A 4LHYA 5DNWA 4DIMA 2GAOA 2VDJA 4BL5A 3VYTB 4D4JA 1NVGA 4ALKA 1OB2A 3DFMA 2CVZA 1K5PA 1H22A 1QIFA 4TTPA 3TLZA 3HZRA 1C1YA 4IEIA 4K87A 4C2AA 3PICA 3THYB 5HOQA 3H5LA 2QTWB 4ES6A 4M9XA 1P0MA 1V16B 4AY6A 2VHWA 4XUEA 2FN4A 2WJ4A 3EXIA 3V4LA 2E4YA 1ZK0A 2QTTA 1T1JA 3D8BA 5E0OA 4D57A 4DLUA 4HN9A 3E7PA 4XDHA 3OFNA 1T29A 3P26A 2Z04A 3ESAA 1XCLA 2R11A 3FFTA 2PMDA 4URWR 5JPIA 3T5GA 3HL4A 3ROZA 2QLTA 1PSZA 4EG7A 4G89A 4RV4A 4N48A 5JJIA 4GR9A 3EEOA 3O84A 2JGJA 4GD3Q 1E8NA 1OFUX 4HHEA 3RKSA 3CJTA 4RSGA 4O4IF 4E08A 3ADDA 1BEEA 1JIXA 4M37A 2COEA 5C18A 1PKXA 3R0XA 1J2UA 4FIDA 4QTXA 4B3RB 1ZITA 1UKEA 4RTJA 2WZDA 2AOXA 4CLHA 5ICSA 1HKHA 1RYNA 4PAGA 5B1HA 1YNSA 4UVGA 1WULS 2PFGA 3IXMA 2BGTA 4X85A 1U6IA 2EJUA 4LJ5A 3PR1A 4KYUA 2JAXA 4NWIA 5JJLA 1FYWA 2D1SA 2ZYDA 4PFSA 1D7AA 4UJ5A 3FFBA 3T52A 4FP9A 4MQ4A 4GR4A 4INJA 4REQA 4OQ4A 3ER8A 3U56A 2Q5OA 3MD0A 1XO1A 3EFBA 2I6GA 2ODAA 5JO0A 3AF1A 1FJGB 1EWTA 4PPGA 4P5PA 1V11A 3P2EA 1EFVB 2VNHA 1QBKC 4RTKA 5SV2A 1U8AA 4GPBA 3U7JA 4WN9A 3VU3A 1IIBA 2Q8PA 2XOEA 2N3ZA 3QI2A 1A0OA 3A6EA 4H1VA 1ULUA 1XCPA 1OXKB 4LYYA 4IZHA 2NMVA 5EWJA 3EH1A 2G1KA 3X0DA 4DR3B 4LW8A 1VHJA 2G77B 1E1RD 2IU3A 5H7XA 4QUBA 3VNVA 3WRXC 3UMMA 5CB0A 1HNZB 1LTQA 4CM8A 1HYGA 4GZ5A 1XX6A 4Q4CA 3LVQE 3C3JA 2NWQA 4FMBB 4UREA 2IDMA 3MEQA 4PYLA 2HV9A 1PNQA 1P8JA 5KIAA 4UCFA 5BT9A 3L7YA 3RC3A 3EWNA 2IUYA 5C81A 4Y18A 1RC1A 1T9GR 4I2NA 1QZTA 2JH8A 3N8DA 3LU1A 2P2NA 2Q3BA 3L8FA 3PA6A 4M87A 5JBQA 1A9XA 3B53X 2EP8A 3RSGA 3SQDA 5EIEA 1P0PA 3R7BA 2YJZA 4RE6A 3K09A 4EJMA 1GCGA 3VO9A 1QPZA 2JK1A 3WTBA 2Y0EA 5JY6A 2HSDA 3ECCA 1X7XA 1COWA 1E32A 1SQ6A 2V5VA 4BFZA 4XASA 1R0WA 1T3ZA 5KVVA 1ZO8A 1LBQA 3KZNA 1HDZA 1Z6TA 3PF8A 4RMNA 5AW4A 1IBKB 1MB0A 5IKPA 4MS1B 4MVJH 4E7PA 4JYBA 1DKMA 2FA9A 1BDJA 1QGDA 3OBIA 2D0PB 3KJFA 4JC5A 4WN3A 1CQZA 3OKFA 4J16A 1RHKA 3DV0A 1PTKA 4V2IA 1RI4A 5FWYB 3FRHA 5TMPA 2CLHB 2Z9BA 1G6HA 3KX2A 4N3CA 2RGXA 4G8JA 1YQXA 1ICIA 1VLMA 4NJMB 5DPMA 1PWEA 4N5NA 4HEHA 4MUJA 4ZQBA 3QELB 2H0RA 4V0OA 5IAKA 5KREA 4BO1A 4PTZA 4Y9DA 2PTGA 2ZRAA 3PGVA 5AKGA 3ZV3A 2DETA 3C6XA 5F9FA 3OQBA 4B83A 4XKJA 3DZCA 1Z6XA 4JA0A 3RLIA 5L45A 3MB5A 1N3LA 3U7QB 4PX9A 3QE0A 5AWFC 2HIGA 5C7LO 3N6RA 4L9RA 2PL3A 1NUHA 2B21A 4LDPA 5E9WA 3BD8A 4NV1A 3SDZA 1U2ZA 3QU9A 4LJKA 3QLEA 5F7XA 1MHTA 4P81A 1LX6A 3FVWA 4AFNA 4NCXA 5L3QA 1KHTA 1Z5VA 4KDEA 1SAYA 1RTTA 3CG4A 4A27A 3RQIA 1P0FA 1VIMA 4H4DA 4IJMA 4A7PA 3LYAA 4M55A 1GPWB 2C95A 2NYRA 4LJRA 4NBLA 4N40A 5L4SA 2D1FA 5CDFE 1JJAA 2PL1A 4EY8A 4F6RB 5B64A 3IQEA 1JB1A 2Y9MB 1HLFA 2FZCA 3F5DA 2C7GA 2JAQA 4G0VA 2ZULA 5J2TA 4J0GA 4F4FA 4HVCA 1OZGA 2BMEA 3GCXA 1XQ9A 5E4YA 3FH0A 3GRPA 4YRLA 4ALLA 5FEUA 3HB4X 1A96A 3JQDA 4I4IA 1YRAA 4EQZA 1DAEA 2CXOA 4EH1A 4CE6A 1PZNA 1L8LA 2NO5A 1IXZA 3UWOA 5LNK1 2HLPA 3TRHA 3GGPA 3BIXA 3NLLA 4IDCA 4AP9A 4HQ0A 4C1NA 3DFKA 3KNZA 1S1MA 2BM8A 2Y71A 4I8IA 4BMCA 1GSAA 2YXLA 4ZZ0A 1TM3E 1YVDA 3PITA 2P2ZA 3A31A 4LHWA 4TT3D 4XIGS 4IDDA 3TEFA 1N1GA 1U7HA 3DDSA 2MJLA 4QXPA 2I3AA 5JQGB 2ZLBA 1VBNA 4PYKA 1GL7A 3RG2A 1G8FA 2J3LA 3W79A 1OCEA 1R6BX 1PZHA 4LF5B 4NH4A 2AOWA 4UD2A 1FQWA 1P4SA 4EGAA 4G4GA 1C9EA 1HBJA 3D0OA 4WFJA 5CFOA 3L4BC 4LY9A 3IHTA 2A0XA 3DPIA 3DXYA 3MQFA 4KEAA 5AT1A 1NMQA 3N0VA 3V8NA 4KU4A 2P67A 4MWCA 5L3SA 2YV4A 1J90A 1JDUA 4G97A 3RAGA 4F8JA 3AOEA 5DRYA 3KQNA 5DNAA 4ZI3A 3KOMA 1R9JA 4LNAA 3W77A 1GGKA 4B6FA 2WABA 1T2VA 4JB0A 4NPCA 4RNDB 4RVOA 5HBGA 3BS4A 1SIBE 3VKFA 4M2LA 1XYVA 5KNCH 1N3BA 3CE6A 3SE7A 5I7VA 2GB4A 3VUFA 1R16A 1VSQA 4KXMA 3QVWA 3IAAA 4EW1A 1ODLA 4O4IA 1KJJA 1Y3BE 2ZRCA 3RANA 4J2HA 4IVNA 4KIUA 2EWMA 5CITA 2QUHA 3HVHA 2VO1A 1OYWA 2Y76A 3O1IC 4QOIA 3C6ZA 1P1FA 1THMA 2X2EA 3GZ4A 3PTLA 5IUNC 5H59A 1CETA 1I2CA 1X39A 3BTVA 3FPCA 2HNKA 1YNOA 3MMSA 1J22A 1KSHA 5A3RA 2OO5C 4FU0A 1LW6E 3U48A 1L1EA 1LD3A 1J8YF 1V5GA 3B38A 1UOPA 2W2VA 1FX1A 3D8RA 4Z0TA 3GRVA 3IB6A 2PZKA 3KKQA 4RKFA 3E05A 1FFYA 1BYUA 2VLIA 4M9RA 2OSBA 2IRWA 4N82A 3JZFA 3D5EA 1GTJ1 5IBPA 4J7AA 1PT7A 2PS1A 4OL0A 1P0CA 2P6RA 2CF6A 4GM0A 3LCVB 2AOTA 1UFQA 3TUJC 4I8DA 3E03A 3COZA 2DTEA 1C14A 5JDCA 5A0TA 2P5YA 2KPOA 3INNA 2P41A 3NIDB 3PYXA 1F4VA 2CNBA 3PWZA 4UFNA 3VTZA 4CU2A 9LDTA 3OMXA 2QTNA 4PZ0A 2FMIA 3G0DA 4YRAA 4L73A 2QRQA 1CDDA 3I9JA 1RXSA 4BZQA 3RGWS 3IE0A 4YRQA 2XD9A 1OAOC 1VG8A 1DJMA 1WKVA 4MYDA 3QGMA 1O6BA 1Q3TA 2O2IA 4FHCA 4LVNA 2H18A 4XW2A 1AKUA 4IHJB 3ZGYA 4CT4B 2WUEA 1G9TA 4HRAA 3OJCA 4IIJF 4PBRA 3E5NA 4RL4A 3T3OA 2D00A 4D9NA 2ADMA 4MW5A 4A6EA 2R68A 3BSFA 5KB3A 5CA0F 3UAGA 3SLRA 3C1TA 3VSCA 3ZS9A 1UP7A 3AI1A 4NH0A 4E31A 5CBPB 1BEZA 3H13A 4Q3KA 2PUFA 2OMKA 1BFDA 1XAHA 3KQOA 3N2GA 1ZIDA 1DZIA 2HY7A 2HZ7A 3B9BA 4G8CA 1XXHE 4M0CA 5DLDA 3PXCX 3U37A 1EHYA 1AX9A 4LV6A 5CGZA 1NX9A 2IJGX 4J8PA 1BRTA 1NJSA 2JD2A 4P3PA 4R1OA 4DDVA 1SCBA 1QQ7A 5HOEA 2EYQA 3KZCA 2EATA 2QDXA 3C41J 3NBQA 1HR0B 1SOVA 4TWJA 1LS6A 1I1OA 1R0SA 2RGNA 1F2TA 3I5YA 5JC8A 1ZCZA 3TGPA 1N8SA 1OYYA 4UMVA 5KNDA 2VDWA 4KTVE 5EP1A 1ZYUA 1Z63A 5HM6A 1FJXA 2H2HA 4FJ0A 1U8UA 1WUIS 3ZQJA 3OT5A 4QQ8A 5JO9A 1WEKA 3F67A 2P3OA 1LRKA 2R96A 3LQFA 1NVKA 2EX1A 3R3XA 1DU4A 4CF7A 4NECA 4RM2A 1Q5PA 4CN9A 4GVPA 4JA2A 1E2NA 4QXQA 1XELA 1XKTA 1K5HA 1NAIA 1HT0A 2WJ3A 4JQCA 1PJBA 3H5IA 4G8BA 1CJMA 1HL7A 4BFCA 4IQGA 3LV8A 4EHNA 3QLVA 4DMCA 4FR0A 2ODPA 1AS0A 3ICVA 2XWJI 4C5AA 4E5NA 3ZJYA 5GTDA 2ZI5A 2UZ0A 2YS7A 4UNIA 1J1ZA 1K7CA 5G1NA 4ALNA 2F90A 2VTKA 1PV2A 3MTQA 3C85A 2AXEA 1XPJA 1Z6GA 2GLUA 3EVAA 4QU5A 5K3OA 3L8EA 1OLOA 2WWTA 1CZUA 3W2HA 5JQWA 1HE5A 3WNDA 2QTFA 3UMYA 2ONKA 3ROXA 2B35A 4HY3A 1L4BA 1SFRA 2JRCA 2VJOA 3MLAA 1OPRA 3NDIA 2WAAA 4OXYA 4YJFB 1NC1A 3EWIA 3FR8A 1T43A 4O5OA 5HG0A 3Q7TA 4QOGA 1IG0A 1UKCA 1W85B 2JHPA 1TQ8A 3MMXA 4KO3S 4R54A 4RVUA 5KNDD 4BNZA 1WHTB 3FNEA 4KNWA 4PF1A 4CDGA 5HWSA 2FHSA 1U9ZA 3Q3IA 2C2WA 3A1SA 2WZBA 1CZOA 1K6XA 3BDIA 4X8MA 5I6DA 2VF8A 4N76A 4HJRA 3KJEA 4IS2A 3QKRA 4IHKA 2BBWA 4LDNA 4M9UA 4PSKA 3TKLA 4BV3A 4YR9A 4ZRNA 1GG5A 1ZMXA 1NZDA 4MRPA 5E2BA 4EA7A 2JI7A 1UWLA 1IHPA 4LXHA 3GWZA 1NBOA 2X0JA 3GCWA 1PUIA 1RYFA 2XQGA 4WOCA 2FGKA 2IBSA 1TYDE 1XOIA 1WAMA 5JXIA 3KB8A 3RUAA 5HPYB 3G02A 1ZGAA 1O54A 1Z7EA 1S7GA 5D00A 3W5CA 1CR2A 3MXTA 1OU0A 3QHQA 4L5AA 3U3XA 3AJEA 3IAHA 5F3WB 1O94A 2P5UA 2W2MA 3OWXA 7GPBA 2DWOA 3NGLA 2AVDA 5FPPA 2O7VA 1S9DA 1I7DA 1Z38A 1AZSC 3A9RA 4EY6A 2XRMA 3CW8X 5DW0A 3I64A 1R00A 2ZT7A 4NJEB 4NV0A 4QODA 4E70A 3O8DA 1QRAA 3UB2A 3LBFA 3LYLA 3MXOA 3TOXA 1TIPA 4BB0A 4YDHB 1P33A 3CZAA 1UMCB 3F5QA 1XWIA 1NJ2A 5A02A 2QPAA 2ONCA 4BQFA 4EZIA 2VZLA 1F2UA 5LJIA 3CY6A 2H3EA 4OHCA 1MIHA 3TG2A 3OZFA 4O1IA 3CB4A 2AFHA 1ONBA 3IVAA 1OR8A 2IYUA 1COZA 3DO5A 1WMFA 3UN1A 2FW8A 1YS1X 2NXJA 3T38A 3QTLA 2EGHA 4YJ2F 4G0WA 5LQDA 3HKBB 3OOWA 2PBLA 5H4GA 3RC1A 2ZRMA 2YOHA 1P2DA 2J07A 2PZBA 4ZRDA 2G4VA 1QVWA 2P9YA 2ZRDA 2OV3A 4WQMA 5JH7F 3HWX1 1Z83A 3RHTA 4XWWA 1YOVA 1ACJA 4G1VA 2FZLA 3UKOA 2C2MA 5KDDA 4BNHA 3G17A 4O2AA 3ANSA 4AY2A 1CUVA 2Q62A 3AQIA 3F3YA 1SHJA 3D3KA 3ANNA 1ZQ1A 3JQ9A 2FSVA 3LBHA 3LUBA 4IVPA 4WLEA 2ZXUA 5HMMA 3UFXA 4MQEB 4OHUA 2WIJA 5GJVC 1YCHA 4JUAA 4TUYB 4YN3A 1YK0A 1Z88A 2Q5IA 1DADA 3A1CA 4IIVA 3AP1A 3S1LA 3AVYA 2VRCD 4P5EA 4NR0A 3I09A 3HC7A 5JARA 4I0WB 1FFSA 1WHTA 2OBNA 2H8GA 1C7IA 1POXA 2Y1LA 2GQ0A 4KN5A 5IAEA 1K5DA 1X1SA 3HG7A 4EO9A 4Q1BA 4YJ2B 5FPKA 1EU1A 2RGCA 3PGLA 1FLNA 2EG9A 4CKCB 2PKQP 4MYHA 3R7LA 3B3JA 2HYIC 1OH7A 1SBIA 1H1LB 1JSXA 1WQ4A 2EF1A 3NTOA 1Y33E 1JJIA 1OBFO 2Q4EA 5TXGA 3W4KA 3M3DA 4WEOA 1DQNA 4DM4A 5H82A 2FW1A 1L5WA 2C5GA 2D59A 3ZUPA 4P54A 2NNLD 4Y6QA 1FS4A 2R1TA 1J8DA 1GAXA 1WE2A 5T4FA 2PWAA 4V1CB 2OC9A 4INZA 2XMRA 5AW0A 2CZGA 1LPBB 5C8XA 5FKJA 2HF2A 4N6NA 1IZ7A 1ZRHA 2DUWA 1VP3A 2XMGA 2W48A 3ABOB 3AEQB 2BEWA 3ND7A 4MI6A 2ONYA 5CB6A 5C3MA 5C53B 4BXOA 2PVCA 4M8LA 3DEAA 4RPCA 2AJLI 3GAAA 4CMGA 2VXYA 5B36A 4GDMA 2X5JO 4J0DA 2VJKA 3AF5A 2I2AA 1PD1A 2JIQA 3R0JA 1H2BA 3MS2A 3RS4A 2XXBA 4LHSA 121PA 2VP4A 1HFJA 2YZ7A 3O0TA 5ADVA 3K8YA 1SM4A 5CDSA 3F8TA 3GLHB 2B61A 2XYRA 3CW9A 1TMOA 5I8WA 3KO8A 1FYDA 6REQA 4OQEA 4RV5A 2JHFA 4U6QA 1BIFA 4LE1A 5FL7A 1N2IA 1EP3B 2I87A 2A92A 3QX9A 4HYQA 4M83A 1T1SA 4AULA 3CNBA 2MHCA 2ZCUA 4Y3UA 1IRIA 1WO8A 4CMBA 1AOXA 4ZV4A 1MO2A 4WXRA 2Z9CA 5JYEA 2CHQA 2CVFA 3DB1A 3QFSA 1OV4A 1I7NA 3NBMA 2ZI7A 3DXFA 1M8KA 2B82A 4BWFB 4EB0A 3U3ZA 1AKTA 1A1VA 3PHJA 4RZXA 4B5KA 2PE5A 4WXPA 1DCMA 1L5VA 1PJZA 2COUA 4C0JA 2DR0A 4LWZA 4Q66C 4L9AA 2JZNA 4FD3A 3USZA 3GA7A 3P20A 4OBWA 2JJ1D 3UAZA 1LY1A 1C9YA 4I4TA 1SVIA 1CRLA 3ZQUA 5LDDC 1GZHB 3OCYA 3EPHA 3ZGLA 4AJEA 1WSDA 3LHSA 1GNLA 3GW8A 3HNPA 2HEIA 2J59A 4BCDA 1NXPA 2CBGA 4XDZA 4CMCA 2BCGY 3BYZA 3VO2A 3OFVA 2XWQA 5CYFA 1ANKA 4UOEA 2VCHA 1JEQA 2NQ8A 4RLQA 2WQZA 3WRYA 5KOYA 4WERA 3T61A 3EGWA 4BXOB 4MDFA 3THYA 1MR3F 3WQBA 4L0MA 2GEUA 1RWWA 1JQKA 1XR3A 3GO4A 1NNEA 4C7OB 4A1OA 4DADA 1UXJA 2WAOA 2Z5VA 3IMGA 3LCMA 4BJ6A 1D0VA 2I2DA 3N2KA 4RABA 2ZRQA 5H3LA 4LF9B 1RJFA 3QBJA 4WA8A 3FZEA 4EYOA 1A4RA 3GRYA 5ALHA 4DMMA 2Q5LA 1T1EA 3IYLW 1MG5A 3MSXA 1NFQA 3OC0A 1OGIA 4ZEOA 5E1OA 3ZH9B 4MITA 2H54A 2AXPA 2UYGA 2AMLA 1COWD 4NBUA 4NAUA 4I19A 4V02A 1PLLA 1Y8AA 4H7DA 2O54A 2VJQA 3E2IA 4NJMA 4X20B 3LUGA 5ALQA 4YA6A 1I7LA 1T4GA 3M6FA 4BNDB 3H05A 4YWHA 5MN6A 1WBJB 2GPJA 1N0WA 3CZCA 3PVCA 4C7KA 4DA0A 3DTVB 3HB9A 1NW5A 5KCZA 3OETA 1EDZA 3DZGA 3KDSE 4UHHA 2KJQA 4U7PB 2QQFA 1N34B 3T94A 5K0TA 1KZYC 1FBTA 5C1PA 4B09A 4HNTA 1M8PA 3QVVA 4YWJA 3DYVA 1GQQA 1FTSA 1KEKA 5HJ7A 4RAOA 2J3EA 1MMFB 1Q0QA 2FLWA 4TQGA 1IL0A 5ERYA 5G4LA 2VTBB 4B3FX 4LI0A 5BR8B 2PO7A 4JODA 4MV7A 3H7IA 4UCXA 5IDQA 1XZHA 2PGXA 1OKKD 5AI4A 4D41A 1NBMD 2MSNA 2IPMA 1GUYA 3FSRA 3HGQA 5K8TA 1U0LA 4OA5A 4BV2A 3KQSA 1DI0A 1E9AA 2J41A 3EAFA 1T4MA 1DEKA 1L7DA 4CL2A 3I61A 2N47A 2NSJA 1NVUQ 2K6GA 1E1KA 2CKDA 3AUXA 3V48A 3P9IA 4AM8A 1AQLA 2C4TA 1QJ4A 3PX3A 1Y1RA 5HUJA 1BHQ1 2WOOA 1O0SA 2OEPA 3AKEA 1SMKA 4MUAA 3QBTA 4IQ0A 1CX9B 3CONA 3I9FA 2HUPA 1YT5A 4G5QA 4MICA 1XU4A 1WUTA 3U3KA 1YR7A 4XQEA 2Y3IA 2HX1A 3AM5A 2XNHA 1H85A 3LHIA 1P44A 4BNDA 4DMHA 2JLCA 2VK1A 1WW8A 1RHMA 3IPXA 4LWPA 3TZLA 5BW6B 4P0TA 4JNKA 3T34A 3FMFA 5HCIA 1MH1A 1JHOA 1MC1A 1Z12A 2XT6A 4HVTA 5DMHA 5F2NA 5IHXA 2QL6A 1TM5E 3KVRA 3GAFA 3QOYA 2F9LA 2HJSA 1LW7A 2LCIA 1TM7E 3HY4A 4V0MA 4JZYA 4D3ZA 5CYGA 2OESA 5F33A 4NZOA 1WQ3A 1NLZA 3QYPA 3ZVKA 1QGAA 1O58A 1Y98A 1EQUA 4OUKX 4OUDA 4B6QA 5GPBA 1SJ9A 3L8DA 5JAPA 1U7WA 3OX3A 1B0UA 1FP6A 2JJQA 4I4CA 3FMOB 4V0NA 4TUYF 1OAAA 1Y5RA 2E4ZA 4JVSB 3EGOA 1CJBA 3GFSA 1KNXA 5BQFA 5DIFA 3B7WA 4CIAA 3ICCA 2BONA 2XHZA 4RQUA 3F74A 2BLNA 1QXSA 1AD2A 3NBAA 4EMTA 2WMOB 2AEFA 2PANA 5IEJA 3N8IA 2GN0A 3OTWA 3DE2X 3DWFA 1B7GO 3LCCA 1QOZA 4FFDA 3RM3A 2PGOA 4MEJA 4DJ5X 4E1AA 3F3KA 5LBIA 2C7VA 1F9EA 3W5DA 1XJQA 4CKYA 1GKUB 2DBVO 2A94A 3EVGA 2NZJA 4LQDA 3UOGA 1PBTA 2XQJA 3FOBA 3KZ1E 4Y9TA 3ZU5A 3NAMA 1SUSA 1OIXA 3SSAA 2HRZA 2FW6A 1EM6A 2PLNA 1U0JA 3V34A 4LYDA 2ZBEA 4YO7A 3KPJA 3GZNB 2XUKA 1XF9A 3FOCA 1Y6FA 3KL2A 5JDIC 4INAA 1QH0A 5IN4A 3W06A 3ELWA 3MAJA 3TCNA 4E09A 3JTEA 5LWQA 5HRCA 9ABPA 1L7XA 2X15A 3NANA 1ZM3A 1H42A 4N7RA 4RGQA 5HJ5A 3DBLB 2H92A 4XRGA 3HO6A 2X9VA 2AR7A 3JASA 5COAA 3N3AC 1VSUA 4XM2A 2A14A 3FUUA 3M4JA 3OOEA 5FWXA 1JG2A 3DDOA 5AOCA 4BPRA 3FNRA 1XRLA 3C0KA 4U2BA 3T1VA 1M2VB 3P32A 3PR3A 1PYOA 1CU1A 1JA9A 1JAIA 1X1CA 4ZQCB 2G4CA 2QTRA 4I5DA 5C4GB 3MUNA 3CINA 3SZRA 3C5WP 1EUCB 2C3OA 1IIRA 2VHCA 4PAOA 3V4ZA 4D42A 4DXHA 4JDUA 3HBFA 3FKSD 3QVKA 4F2PA 4IDHA 2Y93A 2W6NA 2XMBA 2QMQA 3EGCA 1PT9A 3WGQA 2QTAA 1I10A 3AP2A 5FR2A 3N76A 4MYRA 2OQVA 4MKIA 4LOIA 4KLCA 3W9SA 4G1BA 1LQ2A 1ZLYA 5TR9A 2BKLA 4KO2S 1VJTA 3KLOA 4XLZA 1WDWB 4Q1DA 3HRIA 4KQ2A 3SC4A 4P08A 4YMUA 4EGCB 1A27A 1ZN9A 4RO0A 5EQTA 4YREA 3U13A 2XECA 1Q20A 1QGOA 1USGA 5CDHA 3I5AA 2VQDA 4NS4A 3SKVA 1NYQA 4NI5A 1LDGA 4NMWA 1QQ5A 4KXWA 4LKOA 4UTZA 4ECAA 5E6RB 1H69A 3WKDA 2ZRHA 3K8OE 3SS9X 1UBHS 3NGXA 1YOBA 3U5TA 2F9FA 1TZBA 1JTEA 2OVBA 1RLUA 3EUEA 5HYVA 4EKNB 1AB6A 1YDMA 4BO4A 4BO2A 4XB2A 4D9HA 2JKVA 3TVTA 4HNUA 1DOZA 3O8OA 4BBZA 1BVYF 1P18A 1TIBA 3L06A 3BE5A 3UW1A 4PNEA 1KYZA 1NOJA 4F3RA 1JX6A 1R6TA 2YC2C 2PEZA 3IUBA 3STUA 2C5LA 2HK6A 1EHCA 3AUSA 2RB5A 2ZYHA 4L08A 4D5GA 4NCAA 3HDJA 3T3MB 4G25A 2YN0A 1DS6A 1EX9A 1SOUA 3H2BA 2D4HA 1B00A 2X0RA 2YCLA 4NFHA 5LFAA 2YY6A 4XAQA 5DX1A 4W8HA 1F2UB 4M8NE 4HZGA 5TPWA 2WTMA 2QU7A 1B6TA 1TUGA 3K0CA 3QFCA 3TJRA 3KSBC 1P45A 3HS3A 1ZMOA 2RB4A 1XALA 2UZ3A 4A3SA 4L5CA 2EC5A 4MV0A 1K88A 1MUUA 1KMMA 2R5FA 2YV2A 2Z2XA 4OQFA 1KAQA 1G2OA 1OC4A 4L07A 4CI0B 5K0EA 3U4MA 1FFGA 1HFEL 3HY3A 4ZCPA 3NEAA 1C4OA 4BP8A 1WNTA 2R00C 2XKBA 3CU5A 1YBAA 3F47A 2B69A 4Y2PA 1S2GA 4A10A 4BRSA 4DG8A 2AMJA 2V6BA 4E88A 1M0SA 1SVOA 1YZHA 4N5LA 5FIUA 5BVHA 3HPQA 4KYVA 2JIBA 4DQ0A 2X1HA 3T99A 4DV6B 1DHTA 3UCXA 2WIAA 3K9BA 3HJCA 3KLBA 5C1IA 3OKCA 2WR8A 2CK3D 3ZI7A 2FSFA 1RQRA 5TQ2A 2HMWA 4F3TA 2XGSA 1GPKA 2VXBA 2EFHB 3BBLA 1I30A 5CNIA 4F4CA 5ITZB 1JQ3A 4WJKB 2X1VA 1ZGCA 4E12A 2MYUA 2OBFA 3WAGA 3WLTA 5HIKA 3N2LA 221PA 2ZB4A 3HV0A 5E8RA 3HI4A 1FNDA 4HEA6 1YS2X 2BRUA 1IN6A 1PFGA 1THZA 1RQ2A 3IPLA 5K51A 2DHQA 4MGYR 1NBAA 1K06A 4BNVA 1SQ5A 2BWJA 1YZTA 5A6VA 5DTJA 2OM6A 3Q3HA 3FMPB 4Z86A 2AXNA 2V8OA 2A3RA 1CV2A 3QM1A 4PLHA 3GR6A 1BXKA 2I1LA 4TMXA 4P36A 1CNMA 5EVCA 3LOUA 1QDEA 2XUZA 4FGJA 4GPIB 2R4UA 1PR0A 1Q16A 4ND7A 2A9KA 2JIDA 3GLIE 1WUKS 1B73A 3GCGA 5JAHA 5IVKA 1KDPA 3NP7A 3V2HA 4AF8A 1MHPA 3HR7A 1J0AA 4OAPA 2JASA 3NNDA 1BN7A 2JGMA 4R1QA 5E3JA 2IZ1A 4H7JA 2KHZA 5HF8A 1GN8A 4EO4A 3OEHA 3SMVA 3WYEA 2XOXA 3KSZO 4N1AA 4QTUB 2ZJ8A 5LVAA 2VYVA 3TQOA 2QGFA 3CH5A 3K92A 4ID3A 2D7CA 4AMYA 3KJIA 4RXMA 1NYTA 3GJSA 3PEYA 1HDYA 1UT6A 3QKUA 4E14A 4RA9A 2DPGA 2APJA 2XYPA 3FF1A 2VUUA 3DV9A 2NXNA 2SKCA 4V03A 4YBRA 1MOZA 4OQZA 3MLEA 3KUKA 3WGYA 1J25A 5DBOA 4JC8A 4UNNA 4LI3X 3ZY2A 2G63A 3CCCA 4DAEA 4IG9A 1C30A 1TW2A 2GKGA 3B6KA 4Y9UA 1VPDA 2GTHA 2MYNA 1M54A 1AVTA 2BFEB 4XVQA 2CVPA 3NIFB 1SZCA 3MCWA 1TT7A 2CBXA 4JJEA 4U2FA 4D4MA 1CR0A 4XGIA 3VMMA 5ESDA 3CEAA 4G0ZA 4LNHA 3OMLA 2QUJA 2WVJA 4PC7A 5LMCA 4Q16A 4GPEA 1WXXA 4KZPA 5TQJA 5JPCA 1RIFA 2RK4A 2Q2OA 5EQFA 1XMQB 5ALKA 1XLVA 2FEAA 4A36A 3QHPA 4NBSA 5EFOA 3KQYA 4TQUS 5CR9A 4HH3C 1RVV1 1YDHA 2MINA 4D0NA 3A2KA 3ONDA 1O9GA 1RJEA 1VCHA 3HUFA 4QL3A 5JSUA 2RE8A 4DR1B 2C7OA 4U2EA 2JGIA 1QHGA 2YS6A 4BECA 3AF2A 2ZPAA 2GCGA 3K0BA 4Y2SA 2IYPA 4J7UA 2E6UX 4ZYVA 3E81A 2XE8A 1HZZC 2OBMA 3OOJA 4NCHA 4NP6A 5BV1A 2O7SA 4N8EA 4ZI7F 4P4SB 2DTXA 2DYKA 3KKMA 1QMGA 2JCSA 1VLZA 3DEZA 5LB2A 1IEWA 4DBLC 4BVGA 1Y4SA 3WB9A 4X5OA 4WLOA 1JR3D 4UBKA 5BSUA 4GI3A 4A8JA 5IJ9A 5EKUA 3TD9A 1SUWA 3MBIA 4MIYA 3TR0A 1C7EA 1NV9A 1QC5B 4BX3A 4C0XA 2JFZA 1BOOA 5K3SA 5A7FA 2R60A 1O7JA 2HLNA 2RIRA 1JPJA 1TTHA 3CPHA 3SHWA 1NJ6A 4CL0A 3A27A 5BN1A 4HGQA 3KJQA 5MFPA 3IKMB 1FDRA 2PQ6A 1K6MA 2R7MA 4EUKA 1QQAA 3FNFA 3U09A 1NG1A 4MW9A 3RW9A 3C6MA 4C43A 4CV3A 5IAGA 5KNCA 1BW9A 2EBUA 1W2GA 1E8DA 1K7XB 2IIQA 2Y8EA 3K1YA 3NC0C 3A8TA 4CF6A 5E4JA 1Y1QA 5CFZA 1XXHA 5ELLA 5THXA 1B15A 4KITB 4K28A 1X0XA 1MRNA 1NNLA 4QGHA 2VWHA 4GIBA 1JS1X 2WVHA 1HZZA 4RVNA 4DAOA 5AVQA 5I8PA 5H5JA 2ZAIA 4II2A 1E6UA 3TLYA 4KR6A 4KQ9A 4G26A 2W6ZA 1QPGA 1WR8A 4MW2A 5J5AA 1LTHR 1E1RA 3SJZA 3ZXYA 1UMBB 4DUPA 3JARA 3T12A 1N36B 1LB1B 3BFJA 2IYQA 4YFYA 2R97A 5E7QA 2XMSA 2H2FA 3T7DA 1TTQB 1YB5A 3QQ5A 3KZXA 4DLWA 2JKYA 1CYEA 4ZOLA 3UUFA 3WBFA 4P0QB 5I5GA 1M0EA 3NWBA 5FRDA 3FF4A 4M4SA 1SEPA 4K3VA 2DMRA 2C5FA 2DKNA 4GUAA 3EVDA 3ZZ1A 2XA9A 3PDJA 2ZJOA 1DB3A 2J3HA 1PEAA 5LQKA 4P4NA 3LK6A 5E3IA 4IMRA 1XFDA 4JWTA 3MBKA 1KKUA 3FCXA 5FOSA 3MUOA 1V43A 4UXHA 4D9JA 2QN8A 3FOZA 4JLPA 4DV2B 2I6FA 3LC1O 3QA9A 3PQ8A 2Q9CA 3RVMA 1I9GA 2VUTA 3B6EA 4DLAA 1A9XB 2F62A 2NZWA 2W4MA 3ZE8A 5B4VA 3KKKA 4AG6A 3LVFO 4KAFA 1NR7A 4HAIA 3KWFA 1GL6A 4MUIA 2JFQA 3BTOA 4MMZB 3I6ZA 2VHTA 3FDZB 4NULA 4UBMA 2BFEA 3FGNA 1C3LA 3VR5A 4CMAA 4MSUA 3SIXA 2P4UA 1H2AS 5IWAB 2QTBA 4QZVA 3H0CA 4FD2A 2ZATA 3GMTA 4J07A 3TZCA 5H8WA 4RPIA 5EZYA 4EF4A 4YCNA 4BLQA 3EZ6A 2O9JA 3SKXA 3UJCA 4ZK6A 4DMUB 1NN0A 1JT2A 2JIMA 2M6RA 4W1RA 2VAPA 2FK8A 5B4TA 2Z2JA 3VKHA 2O6LA 1V6CA 2MTBA 2WINI 3NORA 4P3XA 3A6HA 3C3EA 5L6LB 1KBZA 4MKZA 5EZ6B 2J0EA 2ZSHA 3DEIA 3DWGA 3E9DA 2C4UA 3DZ8A 3LPLA 1B8NA 2VYND 4U7TB 5DI3A 1B42A 3CF2A 3WA6A 5GV7A 4KO8A 1YR9A 1NY5A 2RFLA 4RJJA 2NLOA 4ZALA 2DR2A 3QPAA 3YASA 4DMLA 3FN4A 4JITA 4ESVA 4IWNA 2YWEA 3PKZA 4LYJA 4LDRA 4D4HA 3VJMA 1ZCJA 3PUJA 2NSDA 3NJ4A 1L7VC 5U4QA 1SXJA 4KWTA 2CZQA 3GOQA 4GC9A 1NVFA 2QP4A 3FTDA 4Y1EA 3E9NA 4S0XA 3H75A 3BDAA 1U6JA 4UHEA 3VZDA 5BMVF 1U5AA 1N9ZA 2XCUA 1IBMB 2DKFA 3OOSA 3DLHA 3O8NA 4RFSA 3MCVA 5CLHA 2D8MA 5F5LA 1EUDB 1KC1A 1ML3A 3NONA 1WF3A 3GT0A 3QLTA 4MS4B 4QYIA 3AFMA 2YZNA 4WCFB 3BHIA 4CCYB 1OH6A 1UFRA 2G40A 2P2CA 2ZGVA 4K81B 5H4HA 3HB7A 3GEIA 1VPLA 2IQ5A 1ND6A 1TI7A 1Z6YA 2PX5A 5J5CA 4AP5A 4BWYA 2Y1DA 2O8BB 1Q1GA 3ESXA 4JLBA 1ONNA 3I9V6 3BREA 4FN5A 4EYGA 4IWYA 1X7WB 1TTTA 3ZOKA 5KSZA 3QPBA 5L6MB 4CEJB 3MGBA 3IE2A 1XJ0A 1CLUA 4G9GA 4J49A 4RF3A 5IANA 2O8CA 4NU0A 2DJIA 1J20A 3LWZA 3OQJA 4IKPA 3MTAA 4ARZA 5JSKA 5LQAA 1TLTA 1FJ2A 4PSUA 2QPLA 4HK4A 5CT6A 3FOWA 4EY4A 4EGJA 1N5JA 2H2IA 1L5HA 2OYRA 3WK4A 1YRQA 2GM4A 4BYGA 4JP2A 2D0OB 2HH9A 3AZQA 4DLRA 5IPFA 1JDBB 3WX0A 4YAFA 2BH9A 1RPZA 2R1UA 2XTAA 3MCTA 1M2NA 2QJTA 4UDXX 5CURA 1X7XB 4PCAA 3W9BA 3GU3A 5M2QA 3KKOA 4EAAA 2BKUA 1YBHA 1Z2AA 3G5TA 3NNSA 4TL7A 5DI9A 3ZQ4A 2HBZA 1RQXA 3E22B 4DDUA 4YXFA 1CQWA 2RONA 3LT2A 4IMPA 1E1YA 1Z0FA 1ZR4A 2AWNA 4D1YA 3UK2A 1PDWA 2CSXA 1YUMA 4HMPA 2JHAA 2QXYA 1ISFA 3HVJA 2AOVA 2RCNA 1RQPA 2AJTA 3DJYA 2WKPA 4WN9B 1UJ2A 1KY4A 2V7GA 1UZLA 1NNSA 3BL6A 1ZH2A 2ZK7A 3JVUA 4GI1A 5DX0A 5J4VA 1IN8A 2C98A 3N5KA 4QYXA 4ZV9A 1UBKS 4QOSA 3SPXA 4EB6B 1ST3A 2O8DA 1SUEA 4XX1A 4DWJA 3W5SA 2A59A 2HREA 2D3TA 3FPGA 3ODGA 3AHJA 4IZIA 2V4MA 4P2BA 3T3GA 5IWCA 2XZOA 4LXUA 1ZK4A 4B0PA 4UUAA 2AGVA 1I2MA 5CT9A 1MFPA 1Q1EA 4CQLB 5HP4A 3IRUA 4ETIA 4IV8A 2X8JB 2I9PA 3VU9A 3MJSA 5I4CA 2PG3A 1KZ4A 4W6ZA 3FVVA 4GNRA 4PG7A 4KZKA 1U9IC 2AL7A 4G6ZA 1IOZA 3TXYA 4G0UA 2QN9A 3NWPA 2O8EB 1EUDA 4IIJA 1M0TA 4UCWA 1TMYA 4RV9A 4U8HA 2OCKA 3V4VB 2VJNA 2CL6X 4IIEA 2EIHA 5LZ7A 1YIDA 2R1VA 3F4LA 2VCYA 3QXHA 5F76A 5HEKA 1RAGA 3OTIA 2Q0HA 3RJTA 4NOMA 1YD7A 5JCOC 3NBYC 5KWSA 5DYTA 4QELA 3ZZTA 1F0YA 3BWCA 4GSYA 3ZCTA 1DBVO 5I01A 2EX0A 3ZLTA 1C0EA 2BFBB 3EXEA 3JPWA 4QSHA 1JKIA 4E5SA 3DDHA 3V8RA 1GYPA 5ITZA 3UIEA 5CVJA 5AM4A 3KTAB 5JR3A 1OYOA 4W7HA 4CKBA 3VMFA 2P1ZA 3H3JA 4U3JB 4MYCA 4BLUA 1Y7TA 2CDNA 1WDMA 2Q5CA 3WYGA 1NXVA 1K3UB 1SCJA 4W4TA 3TJMA 2FOIA 5ILQA 2VNKA 1I32A 4A92A 3EAQA 4GGMX 5D7NA 1S89A 1PYGA 1DDOA 3K15A 4FUTA 3SYLA 5CA1B 5JEDA 4FMCF 4E5UA 5JSQA 1SBZA 2OD9A 5JJ5A 2G1UA 2CLCX 4K26A 5L40A 3OLWA 3KPWA 1C5KA 4FEGA 4RY9A 3EHDA 3E58A 1N2GA 2IH4A 2ENUA 4A91A 3V7FA 4HMQA 1AA6A 1EP9A 5EKTA 4O3MA 1GSOA 4XWGA 2DBQA 4K8OA 4UFOA 2JLWA 4FFVA 3A1VA 4RGVA 2JAHA 4UNRA 4JXJA 4OHVA 3ND9A 2Q3FA 5LYJF 3E84A 4FDUA 4XCVA 3B3AA 3A2LA 4Q0MA 2B7LA 4WNYA 3DEYX 3HBAA 4O4LF 5D3MB 1WUHS 2ZRIA 3O3CA 1KJNA 3DO8A 5G0SA 2CJPA 3DMGA 3JQFC 4KN9S 4Q7JB 1HF3A 3F6RA 1XQYA 2EARA 3Q87B 2BFCA 5IDWA 1ZJYA 3PHCA 4MUXA 3TDKA 4DQKA 3WFJA 4FS3A 4GKAA 3AL2A 5K8UA 5HW0A 4MUNA 3QBEA 1ML4A 1L9XA 3Q5EA 3T7AA 1JAYA 3PUZA 3I12A 1QFYA 4AJ2A 1KJWA 5ARDA 5K45A 4RTNA 5EA2A 3USES 4GE0A 4GLFA 4DSZA 1CEXA 1HYQA 1ZZEA 4X45A 2UZ1B 3G8DA 3RR2A 1EVJA 2QUAA 2F48A 1F20A 1QTRA 1ODKA 2WKWA 4NJEA 2OCXA 2CNOA 4LFBB 4MWZA 4XCQA 1E99A 3WAJA 4CEHB 1OASA 1YJAA 2AXQA 4KI0A 4P1ZA 5HFJA 4L7QA 1GUAA 1NQTA 1YB2A 2YJNA 2V7QA 3FWKA 1OFTA 4RHTA 1LVUA 3LT4A 4CTOA 4O3FA 1MFZA 3VR2A 2TECE 2FFAA 3BJZA 1Z28A 4YDRA 1H6CA 3MT9A 1JG3A 4TV8B 1KJQA 3LLMA 4C4AA 1FMTA 5LD2B 4YUAA 4GX5A 3RVJA 4CMEA 4V0ME 5BSEA 1KQPA 2ODQA 5JJBA 4O59O 1F0KA 3G85A 3K9NA 4AXBA 5FADA 5T41A 3T1HB 1JZQA 1VPEA 3P2YA 1DV1A 2GHQA 4D56A 2XTNA 3KQMA 3VZPA 2A5JA 3H11A 3M1IA 3SCZA 1W8IA 5HCUA 1GTSA 3OZVA 3AL0C 1NI5A 3BEDA 3ZU6A 5C1OA 2WM3A 1JA0A 1PZXA 3DLCA 1VGRA 2EU8A 3W04A 1U4OA 2QN1A 2UYQA 4QJ4A 5GONB 4A8JB 4KQHA 4OV6B 4ZT6A 4YAEA 3B78A 2LBPA 2VAXA 4OH1A 5DSTA 1JKMA 5B3LA 2HF7A 3CJRA 1VBFA 4RKYA 1AIPA 2C54A 3QLUC 1UBOS 3IO3A 4KUEA 1YZNA 2YL2A 4B8ZA 1M2EA 3B5IA 1XHEA 1EEHA 1Y1KE 3KOXA 3O4VA 3C3AA 3QVSA 1FZTA 1CUEA 2RBEA 2W8BA 4GVXA 4YJ3F 2PUTA 5CB4F 2GESA 1MAHA 1QBGA 1Z2EA 2B1GA 1X7ZB 2HWKA 3MILA 2BCEA 2MMGA 1HX7A 2ZAYA 3TE7A 3JYQA 1B3RA 3ERCA 2Z4RA 3UMGA 3OQOA 1EK0A 2Q1XA 1Z22A 2HU8A 4JYAB 5JFOA 2XADA 2KW5A 3PIIA 4LV5B 2ANBA 1NXWA 2PA3A 5CM2Z 5JVDF 3CT6A 3HB5X 1WHSA 4ZAWA 4MWGA 1AF7A 4PANA 5K3DA 1KO5A 2RG1A 2ZJ5A 5EHIA 2CCKA 3ONNA 4DM3A 2FMTA 1PHRA 4TTRA 1TZCA 1RM5A 5BN4A 3X2EA 3PXGA 1VGVA 1E6LA 1DNPA 3Q0TA 2B4AA 2FWNA 2PV7A 1MEOA 4JELA 1F1BA 5FI5A 4M9SA 4EGFA 1YGYA 4AG5A 4W9NA 3TPZA 4K2HA 2ST1A 2FRDA 3CZQA 3VZCA 1BGVA 4I1RA 1UOEA 1U3CA 2C2KA 3H5VA 4H4EA 1IM2A 4Q3NA 5D5HA 5DGIA 5E9JA 5EZSA 1R4NB 5FAKA 1OAOA 1S3SA 3ZLVA 3S4YA 4CYMA 1P4AA 1H6AA 3CNHA 3RT9A 5YASA 2YZKA 3G9QA 1TADA 3ND8A 5FNVA 5LU9A 3L1IA 1R0RE 2PJDA 4UTXA 3SF8A 3TQRA 1QRSA 3IURA 5JPDA 4JYZA 3M83A 1VMKA 1U3GA 1BDHA 4OJYA 4OXNA 1EJBA 1X7YA 1O3YA 1T1IA 3O82A 3A25A 1JIKA 2G17A 1NXTA 2WHYA 3L7NA 421PA 3ZWWA 5DHPA 3TSOA 5LQUA 4YYEA 4HVLA 1C7JA 2EIXA 2J5XA 2M98A 1FSFA 1FXWF 1LLUA 3MN1A 3S7TA 3WP1B 2DGDA 2Q1WA 2O52A 5BP7A 1XQVA 4FS8A 4Y2YA 1LNQA 2IEBA 3TSYA 3P0FA 1G8GA 4EKYA 3KSMA 2UYHA 1BX3A 1H4VB 2JIPA 1L7OA 3HBLA 3MYRA 3WLMA 1JXMA 1O97C 1X3LA 4KFUA 4Q02A 3THXB 1FMFA 1QVZA 3U1VA 4QU8A 1H23A 1K92A 2BI8A 3HCCA 3O1LA 2H2AA 3LXXA 4OG2A 4B75A 1RYEA 1T34A 4XIJA 5FFNA 3TNFA 1NPTO 2YHAA 5AXAA 3TL2A 1EYZA 5LM3A 2YWHA 3QWHA 3U1BA 4EMSA 5CVTA 4LK2A 4LZNA 4EHLA 4TKVA 2AI3A 3FSEA 2P9BA 3LVBA 3N0RA 2X22A 1N2OA 2QMOA 1UWKA 3EUAA 2XYGA 2YNMA 2Q3CA 3O2JA 4MV5A 1RRVA 3CZMA 1IMOA 2CLEB 3ADOA 3P2JA 1DOHA 2W6JA 3R41A 1KY3A 1VQ1A 3R3SA 3I2JA 5I9SA 4W1QA 1Q0LA 4DWOA 2Z6VA 5KNBD 3DDZX 3GELA 3ENWA 3KWLA 5C3UA 1ZHHA 5KI6A 1TPZA 4LQCA 1O57A 3RUPA 2Y68A 2VFAA 1XTZA 1CXZA 1J8FA 3WJAA 5DM4A 1MJGM 5JWRA 5L7YA 4XWYA 3B5EA 2OXRA 3GJ4A 2B30A 1PGPA 3GT7A 1M6HA 2G04A 4RYDA 5F3DA 3E8SA 2QRHA 3TG8A 1NWCA 4JHLA 3SZGA 3VSBA 3OY7A 4EW3A 3IR7A 2F8MA 2B94A 2LIPA 2PQ0A 4Q4LA 4Q7QA 4I3GA 6LDHA 2OE2A 1P1KA 3E0QA 2RI0A 4AYTA 1KRHA 3AVWA 1QHEA 1V6SA 4FDMA 3AV0B 3UJAA 1AKEA 1WD7A 4OHPA 1IPEA 4II3A 3TINA 4OHYA 2E1RA 5JNSA 5E1DA 3RUCA 5J4KA 1WOMA 3DCNA 3NAQA 4NE2A 3LLUA 2QM0A 3U4QA 4QDJA 1YFZA 3I01M 3WGKA 5IM4F 3VR0A 3T7RA 4RELA 2BFAA 4H0CA 1V1JA 2JFPA 2NVUB 2AN5A 2WM2A 4HWKA 3RADC 1TAHA 4G5GA 2QPOA 4ZHQA 5BOSB 3ORYA 2NUBA 3OQIA 3PIRA 5LQSA 3WGTA 3QFHA 3V2IA 1CW2B 1EGAA 5BN4B 3GIDA 3GMDA 2C1XA 1QHHB 3MPOA 1RJWA 4J4HA 5EQDA 2JEOA 3STVA 1Q22A 1E58A 4GMDA 1R5NA 4CDMA 2CJFA 1XEWX 3AESA 2IW1A 4IOKA 2Q5FA 4ONEA 1SVUA 4G0OA 1JHUA 2CNWA 2QENA 3G0OA 1DAFA 3H5TA 4HLUC 1Z3CA 4IP0A 4JQSA 4B31A 3K9LA 4B3DA 2JFXA 3KBOA 2FFHA 3QMMA 1UC5B 2ZBVA 3IEKA 1LXCA 1F2DA 2AD1A 4EB8A 2ZTUA 1RPTA 3COWA 4D5EA 4CR6A 5FD8A 1GV1A 4WGGA 4AMGA 1AXEA 2DAPA 1N3IA 4LYAA 4CI9A 1GT91 3OIUA 1LSOA 4BX2A 2PMEA 4F2HA 2RD2A 2IELA 2R7NA 3ZW7A 2FWRA 1L6IA 2WKQA 4UUOA 1ZOOA 2BMAA 4GXNA 2H4FA 3F96A 4DXAA 3GNQA 4UUPA 1M2VA 1RQ7A 1FW8A 2OBBA 5H0IA 3UBMA 5THKA 1UZUA 3QHAA 3IAEA 3U60B 2XUIA 5BPFA 1YHYA 2OQIA 4QBFA 1EUCA 5FBRB 1OOEA 3G1WA 3HYTA 1GPAA 2JFFA 3PEVA 2VHQA 1V1RB 3PUIA 4O2RA 3OIVA 1OT5A 2F3SA 4R0VA 3KHKA 1II9A 4BNTA 1JDSA 4I50A 4KVGA 5KJ1A 2R8OA 3EMKA 3RVDA 1QE3A 4MQLA 5LP6B 3FPEA 1DWQA 5ALEA 1NHGA 1YU9A 5BWCA 3OQMA 3EZ2A 3RDPA 1UINA 1KPGA 3G0GA 1SKBA 4XM0A 1G18A 3N07A 3N87A 4L74A 1AE1A 5KTRA 4AZ3A 5KHLB 1LV8A 1QVVA 5AW3A 2FDXA 4FZ5A 1P17A 2FP4A 1ZIXA 3KR1A 1PG0A 1LPSA 2G06A 2QUZA 2R84A 3GLKA 3QFFA 4G2TA 3FLBA 1SB8A 2HQBA 2YW2A 3FSGD 3QSYA 3DL2A 2Q45A 3LUKA 4I4NA 1ZA2A 5B4UA 4CFZA 3DE5X 3QTTA 2XUAA 3ORHA 4JZKA 1ZU5A 2IOFA 4J91A 4Y1GA 4W5WA 4PINA 4PS0A 1ZDMA 3QIAA 4LPSA 2NV0A 2Q8NA 4Q4JB 3NP9A 1BFKA 3H19A 4HI0E 3P9YA 2R6GA 2VZ0A 3M4NA 4K8RB 1JMVA 5JNVA 2XSZA 4JCCA 5ICFA 1XP5A 3RQSA 1NASA 4D3XA 1FS6A 1NMSA 1HTWA 1N5OX 4G56A 1JDNA 2BR3A 4YRIA 1UFKA 3VX4A 5CCBA 1JAHA 2C94A 3VAAA 5KNDH 3T0FA 3EOAI 2WHRA 1U3DA 3QFTA 1H4SA 3RO7A 1FTGA 4MDYA 3C3MA 3E2PA 2GBIA 3DS8A 3H5AA 1RYYA 1WX1A 2V7QD 3PI6A 2EZ4A 2OXCA 4IDNA 3X3HA 4FX5A 5JMOA 5FLXA 4B4WA 3DA8A 2V6MA 3AR4A 3E8MA 3RSHA 3GPDG 2A58A 2XQIA 3TWOA 1EE1A 4PICA 2P4SA 3C3YA 1AG9A 4XGKA 4W5HA 4Z2YA 3ANMA 4MR9B 3S81A 1ZI9A 1IXKA 4FHZA 1WJGA 2WNSA 3QKWA 4E33A 4YI5A 1E64A 4KMMA 5CVCA 3KETA 2QW0X 1NSYA 1EB9A 1Z7WA 3A6GA 1Q0TA 3OE7D 5F9HA 1VI6A 2NVUA 2W58A 2H07A 3NHJA 3S2ZA 5AVWA 3GP8A 1DKQA 2D5AA 1JQAA 3INYA 2VJLA 5A6SA 4GLLA 2ZYRA 3N7TA 2PQMA 3F1KA 3LUCA 4NCJA 2PYIA 4HSGA 4C5CA 5ED4A 2YVUA 1U4SA 2XKKA 5KAPA 4YMWA 3JWHA 5HIJA 1SU6A 1D8TA 4J1TA 4ITRC 3WQQA 2W22A 2RGNC 2QBYA 1M6WA 4NEHB 4DQVA 4QU0A 4CL8A 2EHDA 2VYVD 2OV6A 5F1KA 4PN3A 2C8LA 2X0KA 3LUFA 5DGTA 2F17A 4NXMB 3O1HB 1ZKDA 3R7DA 3ZTTA 2HD4A 2ZREA 5FOWA 1DJPA 4LHZA 3JD0A 3O5AA 2GJAA 1E63A 2YJTD 4OGFA 3SHVA 1B43A 3ZJ4A 2QJRA 2RGAA 1OW3B 2H52A 4A6XA 2FWJA 4OKNA 2AX3A 5FTMA 3NKFA 4EMUA 1RACA 3UM9A 4FZRA 4PAQA 3RC9A 4I1UA 1I3OA 1EVEA 3DSRA 1GD1O 3NTXA 1K3TA 2E48A 1I5RA 3WIBA 1B1AA 1FTQA 3HN7A 2X2OA 3CPSA 1TYCA 3LMKA 1K89A 4RHCA 3D8NA 4DCVA 2J7PD 3H2HA 4W82A 3JQ6A 1E60A 5EHQA 1L7NA 8ABPA 1G2PA 2Z95A 2V7VA 3AFHA 3DJFA 3OCXA 5TVKA 3W2FA 4ZT4A 5JRZA 3F90A 4QLAA 4QPJC 4KH1A 2QVYX 4QYWA 4UBJA 1M2JA 3BKWA 1WP9A 3OZUA 2LCQA 4Z4HA 2ZYSA 1SUPA 1L1QA 2RK3A 2FW7A 4ZYWA 1II8B 1FDWA 1DBPA 1S8AA 1GTRA 2B6HA 1QHIA 2B92A 3GLRA 3VI4B 1QO9A 3D54D 2B34A 1PJQA 5GM1A 3SEQA 2IHYA 4R31A 3D64A 1ARZA 1T8WA 1ZXBA 2RK6A 4WIAA 5FORA 3KKEA 2F3UA 2RKOA 3VPXA 4EFKA 5IF3A 2QYHA 2PUDA 1V3UA 4QUKA 2C2ZA 3G0IA 3P71T 4R2XA 5KQRA 3CPJB 3I6BA 4R0MA 3DGFC 2DECA 4RHYA 2A4KA 2DFKB 2O07A 3OZIA 4HGNA 1CF9A 4WKOA 1BH6A 2IH2A 3BOSA 4NFLA 1R9NA 3G5UA 4UOZA 2E1PA 4AUEA 5CFLA 3EB9A 3GNLA 4TLBA 3UJPA 1GZUA 4GM4A 5CD9A 3WDLA 4OD0A 5AH0A 5AM2A 1NULA 2QL5A 1ZJZA 5KPJA 4BEWA 2HT6A 3W5VA 4BU1A 3EIHA 4P7JA 4A2CA 4IICA 2Q2WA 1ZD3A 5JVDB 1CEQA 1H9AA 4ZV7A 4DSNA 1RBMA 4GLJA 1L7AA 3GIWA 2ZYTX 2IYEA 3C4VA 3U62A 4CKEA 1QV6A 4D0LB 3ZHRA 1TCAA 3S5JA 4B3JA 2VHXA 4MKGA 4FK8A 3OPQA 2BFDA 3P1JA 1K8XB 3NETA 4BHTA 2A9QA 4HGOA 3VYRB 5ICMA 5IC5A 1FTNA 2B25A 1Z37A 4ZVRA 5KC8A 3AW9A 3U40A 4EY3A 2CFSA 3RRYA 1QS0A 2OGUA 4F7DA 1W2WB 1TD9A 1CZNA 4DEYA 1AKRA 2GBLA 2YJGA 4FC6A 5FL3A 821PA 1Z68A 2JBAA 3I9KA 3S1AA 2P2LA 4DOMA 3FPBA 3L7LA 3HL0A 3DCJA 3LLVA 1P75A 4QULA 3DZIA 2VHVA 3PNYA 2ATEA 1OZHA 1X13A 5T4BA 4CETA 1DL5A 5DGDA 3UOAB 1MZPA 3HABA 2PVSA 1TYZA 1H0HA 3JVVA 1JTVA 3D8TA 5KEIA 1U81A 2AVNA 3MS4A 3SP1A 3F7TA 1Q2XA 5EMHA 1W47A 5CM9C 4JBXA 1KE1A 4TRRA 3ZW8A 5HKKA 2ECPA 3EPJA 2ZBUA 3FHTA 1EFPB 2OV4A 1YVPA 2CNWD 1D1TA 3A1FA 4DT1A 5JYCA 1V3QE 5JNLA 2GAAA 2QZZA 3OQ6A 4G1UC 4JT2A 3ZWYA 5D86A 5EIXA 2PRIA 3L2OB 4R8VA 4TS4A 1NE7A 2JHGA 1S2DA 3IIMA 4DW8A 2YJ4A 5TT1A 3S28A 4ND5A 4DRXA 4ZOEA 2W9XA 1VKNA 3GX1A 4FMDB 1X7GA 2X5NA 3IT3A 2ZM5A 2C04A 4RK5A 3STHA 4EYQA 1X80A 3RV3A 5CG1A 4DJEC 2O2GA 1A7JA 1BS9A 3M6MD 1XKXA 1P7YA 2CLLB 3DMFA 3HR4A 3ZGZA 4GFDA 4EHDA 3AWIA 1RJ9B 5FUYA 4AO7A 5BOVA 1EIWA 3HYLA 5JS7A 3AETA 1LJ8A 4R2LA 4F2GA 5CDUA 3FYUA 2QA5A 4BVFA 3QEBZ 2BGWA 3AERB 3GARA 1A82A 1IWBB 2X5KO 1HSOA 4GDFA 1JMYA 4MDHA 2FZVA 4NHOA 4YUVA 3ET4A 1CC1S 1Y89A 1GCUA 4BATA 3U9LA 2LTAA 1APBA 4M0DA 2I8CA 4EBBA 1E18A 2HWYA 3WSWA 3LO5A 4LZOA 1U9JA 3KEGA 1CUDA 4WK4B 3KVYA 4WOPA 4MR8A 4DE5A 1QP7A 3TTVA 2PSEA 2QLFA 3R7NA 1IJBA 3IEPA 4D3SA 2IKQA 1TQDA 3SQXA 1Q7TA 3WMFA 3CB2A 4QVIA 3BXEA 2KE5A 2FSGA 3WZ2A 3HP1A 1XWFA 1N92A 3IQXA 4ZA2A 4B2PA 2M32A 3NAGA 4QJBA 1JEAA 2CUZA 4UBOA 1OGJA 2YC4C 4GMGA 2VQEB 4YQEA 3K5PA 4R2HA 1BHO1 4C2BA 5EXTA 4LHXA 2C9MA 2H1FA 3EA4A 3ENNA 1IUKA 1T9DA 3MRTA 4M7OA 4BQQA 4YUXA 5A5DA 1KTIA 1W36B 2GCPA 1O6ZA 4O02B 2JC3A 3FCSB 3QOFA 2HF9A 3HJUA 4GYWA 4MVJG 5CVVA 3RBAA 3TL3A 5I7UA 2WWYA 1Q1NA 2CMKA 2OFFA 2Q1UA 3VKUA 3WLOA 5BNWA 3ZV7A 1J9EA 2XJ9A 1YI8A 3BMCA 1SXQA 1HFKA 1C7RA 5IEBA 4BQNA 4ZFNA 4TKMA 5CD1A 1GLNA 1CR1A 3HA3A 3RVKA 1Y34E 1IG3A 1C7ZA 2C2XA 1JHXA 3FVTA 3CIFA 3GOHA 1SC9A 1XVUA 3IA2A 3N3BC 3R6WA 3JQBA 3GEDA 4HQLA 1H2EA 2H85A 1VFPA 2PUJA 4H18A 4D92A 1OHHA 1T2CA 3OUTA 2Y0PA 4LZAA 3FTNA 5B57C 2GDZA 3JAKA 4FUQA 5BVGA 4WY8A 5EWMB 1V25A 5HK9A 5I4IA 5K0BA 1BCRB 2H1OA 1P39A 1ZY2A 1V7PC 1Y4DE 4PSDA 5HS4A 1JW9B 3M8KA 5IFKA 2YUIA 5FULA 5C2JB 2RCYA 4RY8A 1LNZA 3A9VA 4J0QA 5F77A 1I4EB 1UANA 1W49A 1Y48E 2GZMA 1KYWA 2PUWA 2PVPA 2LIVA 3CURA 3GJRA 4J0KA 4JJIA 5IT0A 1MB9A 5DB4A 4GF5A 2C03A 3IP8A 1B2LA 3ZE2B 1BG6A 2GTIA 2DFNA 1TZ2A 4N5IX 4RIEA 3TLBA 2O50A 4XDGA 1Q7GA 3TBKA 5AFSA 4A15A 4XUGB 4FXPA 2YH2A 3DVLA 4PGFA 4ZJZA 6REQB 1J49A 3DTVA 5BT8A 5ALLA 2PU7A 1RKBA 2XUFA 3AHEA 3FCUB 3DVQX 1BMDA 1RHRA 2I2CA 1AKYA 1IN7A 1PE0A 2Q49A 3MJRA 3ZHQA 5TB5A 2PH1A 2O23A 1WD5A 4HNSA 5CLLA 1IXYA 3O21A 3QOWA 1BXRA 2OKCA 3RU3A 3SYKA 1JDTA 2H7XA 2O1EA 4RVSA 4ALIA 1FNCA 4DT1B 1NU6A 1VJGA 3V1MA 2B4YA 2W00A 1T36B 2OGZA 1DEHA 2AC2A 1KO7A 2Y1FA 2B3DA 3KKPA 1XYYA 3L7BA 5GINE 2VUIB 4ZVMA 3AKZA 4LRUA 2PPLA 1BSVA 1RQNA 4QG3A 3GB9A 1XD8A 4PX5A 1D0SA 1BQ4A 3K6RA 2DG2A 2FG5A 2WG1A 2HRDA 2REXB 2MT9A 4MROA 2QI9F 3CF4A 1H9BA 2FETA 3OT1A 1P1CA 3D1JA 3VI3B 5E2IA 2I7CA 3THRA 4AJPA 4DABA 1JEQB 3C74A 3NS7A 5LOVF 2GARA 4FEAA 4LE2A 5MN5A 2F3TA 1NQXA 3J80A 4TS9A 1VSBA 4ISCA 1RM0A 1UM9B 2JA1A 4UM7A 5ALPA 3ZWVA 4RK7A 2NV2B 4Y2XA 3G8YA 5KPDA 1Z4KA 3SHTA 2NU8A 3T3EA 1EK5A 1YJ5A 1NW6A 4WK0B 3QXCA 4HNAB 4MWSA 3KUDA 4IMIB 2TYSB 4BFXA 4D45A 1JBEA 4TS1A 3QE2A 2PYZA 4I4TF 1ZSYA 3AP3A 2VUSA 4XFDA 2WJGA 5DW3A 3BJRA 1PR5A 3I3OA 4WSOA 4HTAA 4XD7A 3R9WA 4B3TB 2PRZA 1TA4A 1PR3A 2JIZA 5KYVA 1YRWA 4CIBA 4WXEA 2WT8A 4YT4A 3JV7A 3ZD9A 2FH5B 2PS3A 2K87A 1WUJS 2RHCA 2Q4RA 3WHIA 3S68A 3OAAD 4WZBE 1EJ6A 1W581 1ECBA 3NOXA 4ENSA 1U0GA 5CJPA 1G2IA 3W1WA 3AR2A 4COKA 2II6A 4E0BA 4KQEA 4E32A 1UBEA 2HADA 3T5AA 3DOHA 4GOLD 4X1YA 1I24A 1K6JA 1DC8A 2GZDA 5E95A 4PRYA 4IDAA 1NF3A 3PQ5A 4DPLA 4QBTA 1QK3A 4WKBA 2H9AA 4WXHA 1PHPA 1QKJA 4XLLA 1Y3DE 3G9UA 3V8VA 1V5EA 4BN4A 2IYVA 3R2JA 3ZE0B 5ESRA 2MDTA 3B1JA 1JDBC 1M9NA 3T5CA 1WPRA 5JJKA 5BWBA 1QMPA 2Q6KA 4XYMA 5FPYA 1KETA 2XWPA 5F2EA 2CJYA 1J2RA 3ZXSA 4H7IA 1JQLB 4TTQA 1JSZA 2SNIE 1LF0A 2ON6A 2QJOA 1E3JA 3WDMA 2DKOA 3V00A 4MRMB 4OK5A 3SXUA 3KVOA 4K0RA 2AUTA 4L6IA 1FQJA 1A69A 2DFTA 4AKGA 3ZNNA 4C03A 1BQEA 1WPXA 2ZOSA 3VX3A 3UT5B 4WBNF 1PQUA 2LR0A 3IDQA 4PQFA 4CLEA 4CCAA 2O2XA 1W6UA 2PYDA 2IS1A 3ROTA 2O4UX 4UJ3A 3TR6A 3B13B 3MC1A 3RVNA 3VR6A 3AO0B 3T5MA 4OP1A 1RWNA 1DFIA 2CDAA 2DUJA 5FUBA 4L7VA 5CT5A 4HO1X 4XVCA 3P45A 2ORWA 3WBKA 2QXUA 2C4KA 1XZJA 1Z5OA 4LY6A 4UULA 4RVFA 3T9CA 2AG1A 3Q7RA 2A1IA 2BTOA 3UG7A 4UMDA 4A0FA 3ON5A 3IBSA 1XCOA 4KPEC 3R8FA 1T9AA 2ZR9A 1N77A 1VLJA 1HG0A 3KDPA 2R8XA 4EUHA 3UBTA 3K20A 1N7JA 2C82A 3HRHA 4UHCA 5DTMA 4E5YA 5JNRA 3BQ9A 3RG8A 4ZK2A 1E9RA 2A35A 5ES4B 4HWRA 4YXWA 1E5DA 4D82A 1WA5A 3OZRA 4FR2A 4C88A 4PSVA 2VHZA 3I4CA 2JI9A 1N0HA 2BE9A 4UDYX 5KWEA 1GG9A 1SG9A 1D3AA 7REQB 5ECYA 4E6PA 2YHIA 4A23A 4XGNA 1OHHD 2WE8A 3KYDA 1R74A 1FIUA 3M5WA 4AO8A 3OICA 1YFLA 2C5HA 2OPHA 3LHKA 1B8PA 2W2OA 4RZ3A 2FFBA 1B6SA 2CXHA 3OC6A 4QPDA 4BUZA 4OOFA 5AK4A 1YDGA 1VG0B 2IPXA 3TI9A 4FQ8A 4RANA 4BYMA 3A6PC 1QSGA 1LEHA 3UUGA 2EKPA 4RJTA 4X90A 4F4DA 3NDRA 1W5FA 2IX9A 1YS7A 4K88A 4BNGA 4D99A 2JCBA 3B2NA 5CLIA 1PJ8A 3NBUA 2G82A 3C39A 3ZY3A 1XVAA 4YR7A 3JY6A 5B1EA 1YOVB 1JBQA 1WIWA 3P9QA 1KDOA 4QE3A 2TSYB 1DKLA 3G2OA 3PDIA 2AW5A 3UK0A 2R79A 3AJAA 4GICA 3EQ7A 4R4JA 1OTHA 2WQ6A 1QU2A 5SYMA 3DMNA 5DHTA 1LJUA