3P9ZA

Crystal structure of uroporphyrinogen-iii synthetase from helicobacter pylori 26695
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
222
structure length
213
Chain Sequence
b'MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLKMLQNIPAYALSEPTAKTLQDHHFKVAFMGEEIFPLLEKKSVLYLRAKEIVSSLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFLENYTAISIGNTTALYLQEQGIPSYIAKKPSLEACLELALSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen III cosynthase (HemD)
publication title Crystal structure of uroporphyrinogen-III synthetase from Helicobacter pylori 26695
rcsb
source organism Helicobacter pylori
molecule tags Ligase
total genus 61
structure length 213
sequence length 222
ec nomenclature
pdb deposition date 2010-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02602 HEM4 Uroporphyrinogen-III synthase HemD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p9zA02
3.40.50.10090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p9zA01
3D8NA 1JR2A 3D8TA 3D8RA 3MW8A 4ES6A 1WCXA 3D8SA 1WD7A 3RE1A 1WCWA 3P9ZA
chains in the Genus database with same CATH superfamily
2GFIA 3QMVA 4CPDA 3E82A 2CB0A 4ISCA 3QEAZ 2KYRA 4MWOA 2VOEA 2P0YA 1CV2A 1RWQA 3RB8A 1CNMA 1EGHA 3A6KA 4DR5B 1LPPA 4DYDA 5K9ZA 3MUFA 4H7KA 2JGAA 1VJDA 5B3JA 2Q6OA 2VJYA 1H1LA 1JQ3A 4RCYA 4U2CA 4MINA 4K40A 3KU4A 3RS0A 5IXJA 5EHNA 3OKAA 2JLVA 2HEIA 5FADA 1BFKA 3GP3A 2FX3A 2QTCA 3ABZA 5P8WA 2FF7A 1STOA 1WXWA 2X3UA 2ZR9A 2B8EA 4H4CA 4O2AA 3X1JA 3BMNB 5DTEA 4EHIA 3ETLA 1ZRNA 4IZIA 2X86A 3QOXA 2PV7A 1XN4A 3WIBA 5LR6A 3P0EA 1IVSA 4UTPA 4K6GA 1FSZA 1W5BA 4ER7A 3JQCA 2YV3A 4PAGA 1CLEA 1JKIA 2JHAA 1RBQA 1ZBQA 3UHOA 4JVMA 3ER9A 1PFQA 2OGSA 4P35A 4BWFB 4D7AA 3A7EA 3NGLA 5WRFA 1OXKB 3CPHA 2FWRA 1OE0A 2QGZA 4LY6A 4MV5A 2XXBA 3ZHSA 1XN1A 4KJZA 2RGCA 1FLVA 2ATCA 5H81A 4CIDA 4XQ9A 4YT8A 4E5VA 5JARA 4RTOA 2ZRKA 3DP7A 2IYRA 5CXQA 3C15C 3B6MA 3TB6A 3ESXA 1K08A 3JQPA 4DQKA 3MOIA 5LQNA 1SXIA 1V7QA 1ORWA 2W6NA 1EWQA 2WJHA 4MWEA 4MRAA 4ABTA 1EZ1A 1H3EA 2QLFA 1VBKA 3BD9A 3HACA 3FAKA 4X6XA 2ZT7A 4HYTA 3UWOA 4CDNA 4CM4B 4F96A 4CKZA 2V59A 2M6RA 2VDRB 1W5TA 4EG7A 3LWNA 3Q98A 3RSSA 4UTRA 1G18A 1T0HB 4DHWA 5CR9A 4XDZA 3PJFA 2P79A 5IF9A 4I3HA 2Z8ZA 1WHTB 1WLSA 5B58C 3KUXA 4XPZA 3TSYA 3HA5A 4IJUA 7YASA 1DIBA 5C1PA 1Q92A 4NOMA 3VR5A 2VJOA 2ZR0A 4JP2A 5KVAA 1L5HA 5SZJA 4I4NA 3JWPA 1C9JA 1CHDA 1JECA 1PEAA 2ORED 3WL6A 5MDHA 1LX6A 3GVPA 3RJZA 5J4LA 3WDSA 1MEEA 1X6VA 3INRA 2OY0A 1Z6AA 3BGSA 4EF4A 3IPYA 1V45E 3OEED 2CDCA 4I4LA 4CQMB 2YN0A 2ACVA 2B7BA 2GEKA 1EM8B 4Y7DA 3RSOA 3R9XA 1DCMA 3TNDA 3UJ8A 5A1JA 5FOQA 2R2GA 2CE2X 4P31A 4ETNA 1BD4A 1BOOA 5CB4F 1I7QB 2XNDA 4J4HA 2H54A 1VJ1A 1KAEA 4BNIA 2TMYA 1NFFA 1IDN1 4PNHA 2PT6A 4LBZA 1TPYA 2FEAA 3MTQA 4RC9A 2JI6A 1K4MA 5JHGB 3I61A 3N74A 2FZ4A 3OETA 4RTJA 4ZT3A 2EJUA 1X80B 2A2ZA 3VPFA 1D9ZA 1IN5A 3OFVA 4Z8YA 3OT1B 2HJWA 1IAVA 1NKSA 2VP4A 4G2NA 1UPAA 1EXNA 2VUSA 2YMMA 3BWDD 4NMLA 4F3KA 5BW5A 1M2EA 1QF9A 1N77A 3GHYA 2WYHA 4FWIB 4DLXA 1AUQA 2GYYA 4HNUA 3VU3A 4DR1B 3DO6A 1J9EA 1UR5A 4ZHQA 2ZK7A 4ZVLA 2LUOA 2P4UA 1W47A 1T9HA 3HVUA 1WZIA 4G0UA 2ZZMA 2WYOA 3SS9X 5DXFA 4DNPA 1L4YA 4MIOA 3SC6A 2C2MA 5A5GA 1QK5A 4MRPA 1TF5A 3A3OA 3RROA 5FJIA 2ZSFA 3FTDA 5J5CA 2Z2XA 3MT8A 5CT6A 5ALLA 4F4CA 1W581 2H4ZA 2RHGB 4D82A 3FPAA 2Y3IA 3BB3A 3PKZA 1T3TA 3LIPA 5COBA 4DABA 3R1IA 2VBIA 3OJFA 3CV3A 4O4IB 2QD5A 4ZOAA 1SZDA 1GYPA 2IQ5A 4US1R 1E5DA 3KJZA 1OTXA 2CBGA 3PD7A 1GQFA 2IUFA 4HEHA 3UHAA 4BNNA 2EU8A 2H85A 3H2IA 3B5EA 4JSYA 1OH7A 1WUKS 6REQB 1H65A 3GMSA 4IOKA 4MO9A 2FETA 2R79A 3BXXA 5FEMA 4Q1AA 4ZO7A 2DUJA 1GAEO 1QYIA 1QNLA 3KELA 3L6UA 5AO9A 1YA8A 4LZWA 4A82A 1Z73A 2GCNA 3CGGA 1V1MB 2D2EA 2QHXA 3P9IA 3B89A 4MULA 4X65B 2AFIA 1YWGO 2AR0A 3FPBA 3T5DA 1CZRA 3U62A 3RUAA 1U8XX 4OLAA 3THWB 3SHOA 5CH3A 1G1AA 4IVNA 2J9YB 2HRDA 4E4YA 4HXGA 4A0RA 4HZUA 4QTUB 4C4ZA 5B6PA 5C4MA 2AD5A 3OCVA 1SU8A 2A0UA 3ONDA 5BWMA 4BUJA 4D6XA 4L4YA 5JROA 1KJIA 2B2NA 5AKJA 1OI4A 3VDNB 2B35A 2AEFA 1KMMA 1NVWQ 4D1YA 5B36A 4QD3A 3RBVA 4GRDA 3B12A 4LV5B 3PQ6A 2J3KA 2ONJA 4UCXA 1DQZA 1GWNA 2AVNA 4U5QA 2PH3A 2FPKA 5H0IA 2Q28A 2E4YA 2DYKA 3DAGA 3O94A 4EO7A 5CDGA 1F20A 4Y2RA 1OLSA 2C92A 3C7DB 2QMUA 3FCUB 4DSZA 5L4NA 3GEHA 5FUMA 4H7EA 4U7GA 4D4HA 4UTNA 3BGDA 3NHZA 5CK5A 3ISVA 4YJKA 1K7YA 3EIFA 3TZCA 1ZQ1A 1GITA 4Z4IA 1GSHA 2GA9A 2AE2A 4NZ9A 3L9WA 5D8DA 4C0QC 1N1MA 1DJOA 4LSZA 4UAJA 2VZ0A 1JR3D 1PP4A 2W48A 3NIFB 5HKLA 2VT2A 1GZSA 3QOYA 3EBLA 5FI1B 4YR9A 3Q3CA 1DC6A 1XRLA 1JHYA 5G41A 2R65A 4BX8A 5ADUS 2CLDX 4J94A 2BAGA 1W1WA 2CNKA 2R68A 1Z5PA 3GZJA 4HQOA 3OICA 1SVNA 2GJ4A 1E64A 2R8PA 4JXKA 4U7FA 1X9IA 3OY7A 4GX2A 4M7RA 4TYNA 1P0FA 2WA1A 1ML3A 3GFVA 2JLRA 1GZ5A 4R68A 2R7AA 4LOHA 4ARZB 4YVFA 4EQZA 4GVXA 5G0TA 4YP7A 2WJPA 2OFWA 4BNUA 1XJQA 4UM8B 4B3JA 5EJFA 5BRAA 4ER5A 1SXPA 3T7AA 4RW0A 5IXSA 1DLIA 1SPBS 4JB0A 3DSRA 1BKDR 4HSEA 5D85A 4B44A 2J32A 1P7CA 2QZZA 2X19A 1P31A 4R9NA 4EL5A 2A0WA 2MYUA 1P5RA 1YV9A 4W82A 4JY7A 3KE8A 1ZD9A 2IEZA 4HH4A 5L7WA 3TG2A 1R5BA 3CGWA 3CUEF 3GLHB 4RK4A 3WLNA 3AESA 4LV8B 1EXMA 2ZVPX 4DM4A 4C4TA 4ZKDA 4J3FA 1U80A 1M73E 2MSWA 4YCAA 2PBRA 3MUOA 4TYPA 4EUSA 4YIHA 3STXA 1USIA 1Y3IA 4ZCSA 3RKSA 1E6MA 5I7EA 5JAPA 1ZR4A 1EXDA 3I62A 4NMXB 3U6KA 2REBA 5GOTA 1KIFA 1H0RA 1KYIA 1K98A 2Q4OA 4YONB 3U7RA 1PI3A 4HLUC 4FILA 2E21A 2YVKA 1E0JA 2KMLA 1FQWA 3DDOA 4WNCA 1WCIA 3JRXA 3LRPA 4X92A 4WA8A 1DJMA 1TM4E 1RBMA 1N36B 5EIBC 4DNXA 2A0KA 3VSEA 4FCWA 4MW6A 4J6EA 3SIPA 3BF7A 3AFGA 3LTNC 4KGZA 1EJ2A 2B8TA 3ZVLA 4WFKA 3H87A 4J90A 4LVNA 4IEEA 4I46A 1E5XA 5DFAA 3O7MA 1QQ7A 5DNEA 3WSWA 5JY6A 1EIZA 3WMFA 3RREA 4JZYA 4EHBA 3Q3VA 5JYBA 4FCCA 4A36A 1ADJA 1Z26A 5DNDA 3EZLA 3RTDA 1MJNA 1Z4NA 3ZDDA 2DCMA 1MO5A 2QU8A 5HKKD 5JOQA 3NALA 3SICE 1RI5A 4F2PA 1MX5A 2G1AA 3W04A 3X1WA 3LPDA 3V4FA 3PC7A 1N0VC 2ILVA 3S8EA 5IWAB 4KWEA 1JHXA 1DGQA 1Q83A 1YHNA 3E2MA 5JVDA 4YACA 1L7RA 4TVKA 1M1YB 3D6TB 4MCIA 1W59A 3ISJA 1G3QA 3IX7A 2VRWA 4OM7A 4M1ZA 1Z12A 1KMQA 1NBEA 2A3RA 4UZEA 2VHYA 5H5JA 5IFKA 4DR4B 1GAQA 4PZYA 2AEEA 3GJTA 3JD4A 5JQGA 4J0CA 1I8TA 1KMHA 1E5QA 1U6KA 2MWMA 5HJEA 2VDMB 4JDPA 3QLVC 5JFTA 3N9IA 3IQGX 3AB8A 3T9CA 5EJ6A 5LN1A 1KDTA 2O8EB 3OJCA 4CEJB 3AVPA 4WWHA 3R7WB 4X60A 3GMIA 3EEBA 4EJSB 4IFTA 4BB9A 1B8PA 4CKBB 2QTBA 1GKUB 1SU6A 2G0TA 3KEGA 4XIFA 2QMQA 2YWGA 2PZAA 4XM1A 3BMXA 4PLPA 4PYLA 1ODTC 1JDNA 2P2NA 5CG1A 4P8RA 5DN6A 3RUIA 3LC2O 3RK0A 2VIIA 2FUCA 2WVGA 3EDOA 3KAQA 4LDNA 3BS4A 1VPDA 1NVFA 5B4UA 1Y3DE 2W2OA 4HEA6 3RFXA 2AN4A 3QIAA 4HQRA 3KM0A 4OJQA 2A7XA 3PX2A 2HPZA 4TLEA 1T36A 4E88A 5IEJA 5K3OA 2WSYB 2Z57A 4M53A 3EVDA 1XDUA 3G7NA 3EDCA 2JANA 3I6BA 3KQVA 3PHHA 4IGIA 3RVJA 2FWAA 3PNOA 3UJCA 2F00A 3OQOA 3UQZA 1MV8A 4H7JA 1OD6A 2O3QA 3DPUA 4R71A 1XF9A 1NUAA 3UTCA 2Q4BA 2PIAA 2NPFA 1HYQA 5E9AA 2DFTA 5A6SB 1Z35A 2HPAA 3DZIA 2RGEA 4OHFA 1V16B 1QVRA 3BTUA 1P2BA 4WLOA 2PSDA 4EW6A 1LC0A 1Q0ZA 1XMXA 4D4MA 3D4NA 2XY4A 3DBRA 1EK2A 4N5IX 5KWSA 2ZJ2A 3HSKA 5IMBA 1UBRS 4RPHA 4CXMA 1ZMXA 2IEDA 5AK5A 2O57A 2YHBA 2QMHA 4BNHA 2OHIA 2IXFA 4TVOA 3PIRA 4TWRA 4OBBA 1JJ7A 1VYHA 1XZNA 2GPSA 3C14C 1KO7A 1V96A 4S0ZA 5IC6A 3RF6A 5F78A 2NN3C 3D2CA 1VL5A 4X6LA 4BN0A 4F60A 2O8BB 2Q8PA 2EFDB 1QH8A 2ID9A 3D5EA 3RNLA 3IHTA 4DB2A 3TNLA 1UKCA 2DUMA 5AHOA 4UUOA 3EEOA 4CV3A 4LFBB 4B6FA 4ZK2A 2NSHA 1L5ZA 2JD2A 1H2XA 3U80A 1Z39A 4ALIA 3JALB 3QG5A 3U16A 3FDIA 1NLZA 3FGOA 3FF1A 4MB0A 2VK1A 1DC8A 1JILA 3L1HA 5DSTA 5JV5A 1T15A 1FFHA 2FMIA 3O31A 3KJQA 1PJ8A 2Q5FA 1YR6A 4OHXA 4J1QA 1N92A 3M33A 3QUBA 3F5MA 3QBTA 5J4VA 4P0PB 3EUWA 1T4BA 2B3DA 1UDWA 3PUIA 1V9LA 3TW0A 2ZIGA 1G3MA 4YX9A 1FIUA 2IHNA 1O1YA 3ZY2A 1ZJ6A 5B6JA 3HCDA 1U7PA 4J03A 4ARUA 1Y5MA 5A6VA 2DR2A 2DPHA 3G23A 3GAMA 3B38A 2MSLA 1M2HA 2Q0HA 2QLTA 3C0KA 3HDTA 4TSRA 3SYMA 1OLXB 2K5UA 5EQJB 1XRRA 1NX9A 4C87A 1OTYA 3LKZA 1ITZA 2G70A 3C5HA 3DAOA 2WAOA 4BBAA 2QENA 2QVYX 2ZU6A 3BRWA 5AHXA 5JMPA 3UQYS 5IKEA 3FFTA 1G59A 4N39A 2F43A 5EMJA 3OIDA 1T10A 3T9DA 1MRNA 3N75A 1U4NA 3EPJA 1I6LA 3BQNB 3O4IA 1QHNA 2ZS7A 1XK6A 1HDZA 1XNRB 2AN3A 4Z1MA 3VYUB 1XK7A 2AZXA 1R5JA 1T4CA 1VGVA 1WW8A 2FHSA 1FNBA 1DFGA 2LVBA 3LAWA 4O1IA 5F7ZA 5BSRA 1QZXA 1JG2A 1VBFA 2VWHA 1E0DA 3EDQA 3B9QA 2JZCA 4WZBA 3V4VB 3URMA 4LTDA 4YYZA 5K7SA 3FTFA 3B5IA 2GNOA 1E6UA 4KWHA 3O3NB 4U2DA 2WAYA 3WGHA 1ZICA 3IBFA 1KPIA 1ZFNA 2IYAA 4IY1A 2H2IA 5A03A 4FB5A 2UDPA 3I2JA 5C3MA 4JVSB 2G3YA 5KEIA 1D6MA 4MQFB 4IXNA 5BT9A 3N1UA 4JJFA 1CETA 4LYGA 2E48A 1IHDA 3EA4A 4L9RA 4CKEA 4Q9LA 4C1BA 4MA0A 2QRZA 4GOMD 4MWCA 3CB2A 1RZ3A 2QN2A 2QRKA 1MVLA 1N5IA 3FGZA 1Z2AA 3TBFA 5LJIA 5LPNA 3RYTC 3MBOA 3NYWA 1FP7A 4Q93A 4HDRB 1MOSA 1T3LA 4EBFA 1XF1A 1K92A 2IW1A 3EFOA 1ZUNA 1GADO 4MLDA 1NVAA 2JRCA 2P9HA 1U1CA 1VBMA 1XELA 3N8NA 4KN6A 1FFXA 3A4VA 3UPDA 4ZAXA 2XCTB 1RRCA 2UXDB 1EK0A 1LI7A 5IM5A 1V1RA 4O2BF 3OEEA 4Y2QA 3SX2A 4JJEA 3B1VA 3QVOA 4P53A 2FPOA 1N5RA 2ZIZA 2HJ9A 3CR8A 4UU8A 1XO1A 1K0UA 2AZTA 2A57A 3OJ0A 2PE5A 3BOSA 1Z45A 3DZFA 3SOZA 4YLYA 1JE0A 3MYYA 4L8GA 1NQOA 1CT9A 2G1UA 3S8YA 1FMLA 2ISSD 4QVGA 4LF6B 5HK8A 1H6DA 3WHLA 1RS0A 2Z9BA 4QBKA 3LNTA 4CR6A 3EFEA 1UZMA 4F4FA 3TSOA 5D87A 4BX0A 3UA4A 1L8LA 3A6GA 4ANFA 3CX8A 1ZESA 4QEZA 4XASA 5BUQA 3ZXSA 2EBHX 1GKKA 1P1HA 4KQXA 1SXJB 4ZQBA 4BNDB 5HF6A 2GO7A 2A35A 4JIGA 4LRUA 4RIIA 1DAOA 1QYDA 5FBHA 4PQEA 1HQKA 5L3ZA 1IXYA 1WQ1R 2Y2VA 4LNUA 5KWEA 2O52A 1E1RD 1G21B 3JW8A 5I45A 4MDYA 4EBBA 3KTAB 1HGXA 1AVTA 4QRHA 5IWCA 2BEVB 1S2IA 2BCGY 3SX0A 4FDMA 4ER0A 2IITA 5L3RA 1QIKA 2BEWB 1NP6A 2EQ5A 1XA3A 3KD2A 2R1TB 2DFNA 1XNHA 3IAAA 3NHBA 1E5VA 1GNVA 4ILEA 5LZ5A 2D1TA 2WNHA 1G8PA 3HNRA 1C9KA 3O8BA 4DV4B 3ZC3A 2O05A 4M76B 5LKRA 2HSWA 4IJ5A 4IRXA 4L78A 2PH7A 1JIXA 1GXSA 1GQOA 2RHOA 3BIOA 1JSCA 1O9GA 3C3XA 4KPFC 3D7RA 1QP0A 3DEIA 2OQ2A 1QGZA 3AILA 2YDYA 3I5MA 1Q1QA 4MCAA 1E1DA 4MRRA 4RJKA 5CFRA 5J1TB 1C2TA 3LF2A 1LDYA 3HE3A 3DFKA 5AHKA 4FDLA 4HDNB 2OMEA 5KTTA 3FGNA 3OKCA 1M2VB 2GCOB 1G2PA 3UHJA 4EHKA 1P2UA 1P4GA 1EHIA 4YQZA 1YDWA 1S6YA 3OF2A 2AT1A 2HNAA 4K46A 3WGIA 2C96A 4MLPA 1UMCB 3ENZA 3IBGA 1MW9X 4LG1A 3UNXA 2YQ5A 4UCQA 5CTAA 1GTVA 4UNRA 3KE9A 1MC4A 1ZGZA 2HMAA 5EFZA 1U02A 3NV7A 3FE2A 3PZBA 4AXXA 4C4AA 1XQ1A 4OQEA 1PAUA 2X0DA 2IDZA 3VJRA 3KQQA 2X7HA 1AGNA 4JVOA 4P9NA 4CMBA 2QG6A 2LGJA 3GRCA 4KNYA 3DFZA 1M1NB 4BUZA 2F1RA 4FGSA 3FBGA 3UT6A 5KC9A 1SVLA 3UJDA 1YL7A 3GJ0A 2H07A 1W9HA 3OCYA 2GPWA 2ZIVB 5IXYA 2BF4A 3BRQA 2F6RA 3JTEA 4XH9B 4XOIA 1NURA 5KNCD 4A4DA 4A1OA 4OLFA 5M7EA 4PZZA 2EP7A 3K1AA 1NW5A 4EW3A 2PKWA 4Q01A 1E2BA 5GONF 5A06A 4MW9A 3DZDA 1JFRA 3P2MA 1HG0A 1FRNA 1ZD5A 2A9FA 2AOTA 2CHEA 3GGCA 5D51S 3NC1C 3DOJA 1KQPA 3H16A 5DH9A 4CIXA 2R6CA 4LPSA 3AYZB 3G2MA 3WDMA 4FR2A 2WT8A 2C7OA 4PV7A 4LNAA 1D7OA 3PLNA 1T4DA 1CE8A 2WD7A 5JSZA 2RCYA 1OR8A 4G23A 3OF3A 4PQRA 4ARSA 2R7LA 1ZK2A 1BVRA 2WUFA 3B1JA 1W2GA 4OGFA 4XB1A 4X7BA 5M3BA 3VC2A 4C3ZA 1KHHA 3HDHA 1M2GA 5GADl 3HKCB 3DTTA 1OBCA 3C6QA 1C30B 3GVCA 1UFKA 5IT9A 3U49A 3GLFA 2QF7A 3WNBA 1ZL2A 2HRRA 2VHWA 5KQRA 2ODAA 3W1WA 5CP8A 2TMDA 3Q1KA 4XGNA 1M8PA 3HCPA 4PCLA 1HT0A 4B3DA 1Z2PX 1JP7A 2PO7A 5FBKA 1IN7A 5L7YA 1W36D 3NETA 4KXMA 3RVOA 3PUKA 3QX3A 1B6RA 1X1AA 4OEHA 3L4JA 4PU0A 3LRXA 1JQAA 1GFWA 2DKFA 3BKXA 3KR1A 5FOWA 4ALJA 3OH8A 3QYAA 4DCMA 3OFJA 1VKHA 5G0VA 1WVGA 1MO6A 3O75A 1PSDA 2H4FA 1F48A 1E18A 2D5IA 4MROA 2NTJA 4B6SA 3OZWA 5CX1B 3IKJA 3V97A 2JAXA 3PTZA 1PEKE 1KI3A 2E4WA 4IOJA 1XAIA 2IHKA 2V6FA 2P6PA 3KPYA 3Q9SA 4I1RA 2PCJA 4IP0A 4QDOA 3EXAA 5A4DA 1CHNA 1GA1A 4YTEA 3AUFA 2VO1A 3W7VA 2HXSA 4YUXA 6PFKA 3F78A 1IG3A 1R3UA 1E6EA 3QVGA 4G0WA 4HUQB 5TT1A 1HTTA 1DBVO 1A9RA 2VPQA 2DQYA 3R3HA 3G9UA 2QTVA 4HWPA 4MS1A 4WERA 3G0HA 2XDQB 3HYLA 2ANCA 3LUDA 4IV8A 3MWDB 5D6NA 3RTCA 5A4IS 4HN9A 3ICEA 2C83A 2REXB 2RI1A 2YV2A 4MGIR 3JD2A 4QATA 1ZHFA 3OPVA 1RACA 4FQ7A 4RHFA 3ZE1B 4QQKA 4DRZA 4AAYA 1IXZA 4HWTA 3PEYA 2IY8A 3FDJA 3JQFC 4ZZ3A 2QJWA 4FHZA 5FUXA 2H5EA 3ZHOA 1UXJA 4I55F 1JDUA 4H7HA 5ALUA 4JT9A 4H18A 4WOKA 3L6EA 2LPMA 4KMOA 2P5UA 3N3AC 1EDOA 1QK3A 3X1MA 2Z6UA 1YDHA 1SEVA 1ENYA 2VQ3A 3QLJA 5BO5A 1N8SA 2XVAA 1O95D 1M6VA 2I6UA 4INAA 3ZZ1A 4Q3AA 4NVRA 3FHCB 1UADA 1NWHA 4KPEC 3EIWA 1ESZA 1IC6A 4I81A 1J49A 1EYZA 4RSRA 1ONOA 3QHPA 4B2PA 1FU8A 1BTOA 5EWJA 4JVLA 3W05A 4N3CA 3A4NA 2WIBA 1Y1LA 2N42A 2GM4A 2GSWA 1G16A 3S1SA 2I6SA 4R3NA 1EWTA 3HZZA 4J7CA 1EA5A 2LW7A 2KBFA 3SAJA 3N07A 1U3GA 2VDWA 1U0FA 1RQ2A 3D6NB 2FDCA 2O06A 4G1UC 4JEMA 4F1JA 3I9FA 4RK5A 3CR3C 4HNTA 5IDYA 4YJHA 2HIGA 3E5MA 3D7NA 3R3WA 2HHAA 4HHEA 4OREX 4OI4A 4W6ZA 1QF6A 3P9QA 1PR6A 3WK5A 3F74A 1HO3A 4LKRA 4UULA 3G49A 3WWZA 2FMTA 1LLUA 4PLGA 1V41E 1DJQA 2B20A 1EUCA 2O3SA 4PGHA 5GY7A 4DJ5X 4CN9A 2J5RA 5LQMA 1X15A 1L5MA 1MQ8B 4BKRA 2OHGA 1J2EA 2ATXA 2LR0A 1Z6YA 2J3HA 3KR0A 4A8PA 3FOEC 3OTIA 2NXJA 4KEAA 5F9HA 1RPNA 4UQLA 2WC1A 4YAOA 1C4WA 1RD4A 2X41A 3KXIA 2J9FA 5E8RA 2X0IA 1B2LA 2P6MA 3EQ2A 2OV4A 2HJHA 3L06A 2WSSA 4A2PA 4E94A 1MG0A 3TQTA 1UMBA 2A6PA 3BH6A 4JC5A 5B7PA 4N54A 3USCS 4NESA 4L15A 2BYTA 4FFSA 4V0QA 4RY9A 4XDYA 1US8B 5GAJA 1ISIA 1EHCA 3G79A 4WHMA 2V0CA 4GMKA 4WSOA 1PWZA 2FEXA 4NH4A 1NXVA 4GNRA 2OFOA 5LNK1 1Q50A 1CQWA 2HW8A 4HWSA 1N2HA 2PRYA 1F2TB 3PYXA 3ZDCA 1QFXA 1TXGA 1KBZA 4FE3A 2FQXA 4RKYA 4OD0A 5ALRA 1KSGA 5C1OA 4JI7B 3UO8B 2A0FA 3HDGA 1BXRA 2Z2JA 3KFLA 1H2EA 1E1QD 3AOEC 3QU4A 4JWKA 1HORA 2XZTA 3DKIA 2EZTA 3ZI7A 1U1EA 4DQLA 1X7DA 5T4FA 4GP6A 5K3DA 3IQFA 1NR5A 2OHVA 2RMKA 1L3BA 2EJTA 3DEJA 2YHUA 3PXBA 1MNAA 2GJSA 1SXJC 3KQTA 5DK6A 1Z4LA 5H9VA 3U6BA 1CQXA 1NMZA 3FN4A 4L6AA 1MAVA 1U5CA 2A67A 2IA5A 2YXBA 3PL5A 1DDOA 3N8GA 1WXGA 1YUMA 3FCEA 1QOZA 1AZWA 4JQZA 3F96A 4FHDA 4UUQA 3P2YA 2HF7A 2EFCB 2QR2A 5KOIA 3RRBA 1GPAA 3EZGA 4BO7A 5ILGA 1CRZA 1H2RS 3O83A 4R1MA 4RD6A 5AI5A 3TIFA 1Z7WA 4TTTS 1F9AA 4QPNA 3OZ7A 1RFGE 1BE0A 2AHOA 2H2GA 2DOKA 2PTHA 4FYVA 5CA0F 3ICWA 2L69A 3JWHA 1YVDA 1I3MA 4B0PA 1Y1RA 5CA1B 3DLIA 5IZ4A 3AQ4A 2B36A 3WJ7A 1DBIA 5CT9A 1GKYA 1ZSYA 4B6JA 3I04A 4POAA 1L4LA 1LNSA 4FOSA 3A6LA 3GLVA 2C4MA 3UH1A 3V33A 5ADHA 3L7CA 4A23A 1R6XA 3D6UA 2MR5A 1E66A 4AY3A 2JBAB 3PNSA 5K0LA 3H9CA 4ZRMA 3K70D 4LYDA 1NXOA 1X8XA 3O2SB 3T5TA 2ZAMA 5HTOA 2J3IA 4QRIA 3RS9A 2HY7A 4J3JA 4M6WB 1LPMA 1Z0UA 4NPAA 4WNAA 1HM5A 3GNSA 1Q7BA 2FR8A 2R8OA 4NQRA 3AMVA 3EF0A 1DPFA 2W6JA 1TEZA 2TRSB 1CY0A 1Q2UA 1THGA 2GX6A 4JYBA 2JLSA 4U2FA 4AO7A 3VMFA 2GTHA 3VDXA 1D1PA 3WRXA 3D02A 3EPRA 3M4XA 2HCBA 2JVKA 2QSYA 4BEWA 1WPXA 5JS2A 3GFQA 1WW2A 4E70A 4EY8A 4X3CA 2PXCA 5CLQA 4XYMA 3T9EA 3EODA 3OO0A 4J0HA 4ERXA 5BQFA 1CNEA 4GLFA 4XGQA 1DL5A 2WAXA 1FDWA 4RFLA 4FFNA 1OZGA 1Z2EA 2FG7C 2OQIA 4L73A 3LJKA 3ZKWB 2BI8A 2XVYA 3RS8A 1JXOA 1VMDA 1FVFA 2FMHA 4HFRA 1C7ZA 3WLKX 1X7YB 1TTQB 1QIIA 1VMEA 3PRHA 4RH3A 1A8IA 1IJFA 4PFSA 4AT1A 5CEJA 2RGGA 4IDNA 3AIIA 3B7GA 1RHRA 1ZYUA 1FE8A 1NJ6A 3N87A 4XD2A 3R6GA 5LUAA 4IOMA 2C7RA 5FLEX 2C7BA 5KZMB 2FEPA 1R50A 1PEDA 2I76A 2HV8A 2VP5A 3ID6C 3A9CA 3K0FA 4R8MA 2B78A 3TQCA 1DAEA 2B25A 1HDGO 3W06A 4D8YA 5K3AA 1AURA 4ENUA 4DCUA 3GRUA 1I3CA 2AN5A 1ECGA 3HMKA 1XC7A 3GT7A 4R9VA 5DLYA 1UK7A 2PSHA 3U9LA 4AN1A 4CT5A 4IIXA 4KE7A 2PZ8A 4QBHA 1VMKA 3ZIAD 4UTVA 1X7ZA 1KJ8A 5BMOA 7MDHA 1JHUA 1CEEA 2O5RA 4RGVA 5IHPA 1SC3A 5LBTA 3IB6A 1T26A 4DIFA 3O91A 1TKRA 4WRRA 4DM7A 1MVOA 1MB3A 4FMCB 1N9GA 4C6TA 4H7DA 2WJAA 1FQJA 2VXYA 4ER6A 3D8RA 5G0WA 4DARA 4YNBA 2N3ZA 2BKLA 1E1RA 2ZBGA 3W6UA 4BVFA 4C88A 1H4QA 2DTDA 3C3JA 1ILWA 4PZAA 4RK1A 2OG2A 4ABYA 2R5NA 3LL7A 1WABA 3WK4A 5L7TA 5ITSA 5LMNB 2D0IA 2J3DA 4CLOA 3I9OA 4HTAA 5BXYA 4E7PA 5LYJA 4Q15A 4F5EA 2XBMA 1IWBB 2DR3A 2ODWA 3D3QA 1AN0A 2JVIA 2NQ8A 2RBGA 3EMVA 4CMEA 4K1LA 5JCOA 2A5LA 5A05A 1A5BB 1GFZA 2H8KA 2FW0A 2HHLA 3ROKA 4NAVA 2GWRA 3AEKB 1TA9A 4ICIA 3FZNA 3G2IA 3RTBA 6ADHA 3FHJA 1V43A 2EFJA 5LXTA 1T0PA 2MSNA 4OMFG 4WKPA 4CLHA 4DJAA 3ZDBA 3H6KA 4I6JA 4BO1A 4RA9B 5L6MB 1HLPA 5BV8A 5AVKA 2Q0QA 1T3HA 3IR7A 2AG1A 2QGNA 3D43A 4RELA 1R9JA 4JQCA 1N4DA 5ELXA 3GEEA 1T25A 5J40A 1FNCA 3NONA 1ZVVA 1Y42X 2DTXA 4MVXA 3H5IA 1U7WA 3JQ9A 3I1IA 4AJ9A 1DXHA 1NXWA 4B81A 5JD6A 3BA1A 1P1CA 3PJEA 1DKOA 5CLGA 4B76A 4ARBA 1TTPB 1C0KA 2BFAA 3KTOA 4RX1A 4EFKA 1NKTA 1TEHA 4C0SA 2VQSA 3M6VA 3ANYB 4F6RA 3DBLA 1MJ5A 3ECSA 3OM8A 4D0SA 3FLMA 1M74A 3L7AA 6REQA 5H82A 2ZT5A 4IFEA 4Q48A 3FETA 5LZ2A 2K7FA 4HR7A 3P27A 3TPZA 3CNLA 1KI6A 3CRRA 3T1YB 3KKOA 4U8GA 3ESAA 4JR0A 4ETWA 3TN7A 1SUWA 1A95A 1BVUA 1GN9A 1QHGA 1RAFA 2MOKA 2R4QA 1AE1A 2Z1DA 3QVKA 3L4KA 3JZMA 1DKQA 2QW8A 5DULA 1IN8A 5FPHA 4U2GA 2QT9A 5D3QA 3FOFC 1U63A 4NHEA 1FDVA 2IBSA 1E1CA 2D1FA 4KL8S 3FNFA 4MI3A 1NN0A 5AUOB 3DC7A 1B73A 4F97A 5JSKA 1NVVR 1S2LA 4RH0A 3KXLA 3JWJA 3U4IA 4F38A 1PLJA 3K0SA 2XE7A 4DMCA 4KR2A 5F64A 1YC5A 5I47A 4K28A 1ZSNA 1KVTA 1XZDA 1YB7A 2FSGA 4WN9B 1U2RA 3PHBE 5K09A 2YZMA 1RAGA 2JGEA 2LKCA 5K6TA 2QP3A 4KR6A 2YW2A 4FHCA 1GLNA 3NKVA 5LZ8A 2A0YA 5AUPB 3JSXA 4P86A 4X71A 5HUHA 2M6LA 3VTZA 4P2GA 5GZ1A 1JBQA 1V4VA 4LY0A 1VGQA 2VNHA 4M46A 4NOLA 2BDUA 4PSKA 4Z99A 4TRNA 5JXHA 1AMUA 3ZHVA 2A1IA 3DVAA 5C3UA 1CP2A 4MV3A 1Z28A 2BM0A 4WPGA 4EO4A 5BQOA 4HK4A 1ZH6A 4II7A 5IJZA 1ZUWA 3DZHA 1FUIA 3BC1A 2PJUA 1R3DA 3MCUA 5FOUA 4BNKA 2LP4Y 3HR4A 2GZRA 2NUTB 3X3HA 5AR1A 2GXSA 3VAYA 4EEKA 1QIJA 1LQTA 3K20A 5DU2A 3Q8MA 2ZJAA 4YV2A 3I53A 2XNHA 5CJJA 1L3IA 1GA4A 2XCLA 4H08A 1KZHA 5JSHA 3IAS6 2QP9X 1WP9A 3BIJA 3EX7C 1YF3A 3ZGZA 3HFGA 1HRDA 2QJRA 1BXKA 3DQQA 4GUDA 1JS1X 5IDWA 1CZLA 5A4AA 2BFWA 3KPJA 4LDAA 3HO8A 3Q8XB 1XYYA 4FEGA 3NIWA 4M0LA 2P41A 1HYBA 2QM0A 1FJ2A 2ZRHA 3LDFA 4QECA 1KETA 4XX0A 1PT7A 4JEUA 2YWRA 3RFUA 3ZDYB 4S0XA 4B4DA 4UEKA 1IAQA 1B3BA 3IPAA 2O2YA 3F0TA 1OUMA 2BFEA 3CC8A 1OBHA 4IUYA 1J8VA 3IO3A 2XKAA 2RGYA 4IICA 4RKEA 3ZQ4A 4CIVA 4UOZA 4YUAA 3GJ3A 3FKQA 1MHTA 3H6HA 2OD2A 2GXAA 2DBYA 1VP9A 1PTJC 3VZPA 2SICE 3L49A 4FX2A 3U7HB 4ZYLA 4P82A 3L01A 1S2OA 1WNTA 1E7WA 2OOKA 3OPYI 3RODA 3OPYA 3UXHA 3AHHA 4AS3A 5D3MA 1RQNA 2HEGA 1O95A 1YXMA 4UVGA 3OZBA 3U3XA 4D42A 4RKWA 1KZ1A 1KGSA 1QGYA 4HVCA 4QLBA 2XWBF 3ADBA 2IHZA 3ICVA 5EWMB 1PJSA 2X58A 3A4LA 3L8MA 2OUIA 1QKJA 1WXDA 5IAAA 2FCAA 3EAQA 3H11B 3T3NA 1U9IA 1NRIA 1SOAA 2J48A 4CMAA 4NS4A 1Z6QA 3GJSA 5AW6A 3OCWA 1UWKA 1NP3A 4XSVA 3UMVA 1POWA 1CZNA 2PZLA 1G4HA 4WCFA 3RT1A 2JATA 2R3SA 5ICSA 2PD4A 4HH3C 2FSHA 2KM1A 3RYHA 1A2BA 1LPBB 1T1SA 2J31A 1YONA 3HKDA 3LYUA 1CY6A 1SQ5A 1JMKC 1V9CA 2FLKA 1ODCA 4Q6WA 5IAKA 2Q5QA 3DMTC 4LWOA 3WLQA 1EBBA 1I0IA 3B70A 3T3IA 1UDAA 2PUDA 1O4WA 4JYZA 4AI6A 1PF7E 2F1IA 5JMOA 4WVFA 5CAEA 2BM1A 3OVMA 3ZS9A 4ZKEA 1FUYB 3FXAA 1NZFA 3GRVA 2C9BA 4GQBA 3G5MA 4PXYA 4V1CB 5F9FA 1PNQA 1Z4IA 1PS0A 2E6UX 3PFCA 4Z7NB 4HV4A 1GYRA 4FOTA 3RV3A 3ZU3A 4URFA 4DT1B 4WZAE 3ZHUA 3O26A 3SJBA 1UAAA 4J0DA 1H8HD 1EFCA 2A7QA 2HA3A 1NMEA 1MABB 4EVRA 3AF3A 2OCXA 3FZQA 3D31A 2PHZA 1NF2A 1VYTA 5ED0A 3KYBA 1U04A 3BD6A 3G2HA 1JIQA 3CTMA 4Z4FA 2XRMA 1KXZA 3I04M 3RF7A 3UJ7A 1M1ZA 5AKLA 1ECJA 4UREA 5CHEA 2CXUA 5LIPA 1V26A 2PY6A 3I4CA 1M8KA 3LLUA 1QJ4A 4LZAA 5K99A 1P0IA 4P7FA 5KOJB 2OBMA 3AFIA 4OLJA 3ZDAA 2JDID 3THYB 3HQ4O 3I30X 2Z5GA 1G6Q1 1N5JA 3PEFA 4AJ2A 2VPIA 2JFZA 5DM60 2PSJA 7ADHA 1QTIA 3A1EA 4JB2A 1PTKA 4BIMA 1A96A 3H9UA 3G5TA 3ZCTA 2QAGB 2ODTX 2SCUB 5JI3E 3PTLA 1JYSA 1YCHA 4P3KA 3HKEB 4Z9XA 3HN6A 2PFGA 4JGBA 3LLCA 4Q9JA 1MAAA 2IKSA 4ZXFA 2JK0A 2PX3A 4UDXX 4YV1A 3HABA 4FW8A 1DJPA 3G89A 5LJLA 5DNYB 1FVXA 2PLNA 2V97A 4NZOA 3P1JA 1UF9A 2FX5A 3QELB 3UMGA 4ZJPA 4ZTZB 5EHGA 1PL7A 3G7UA 3RSLA 3VC7A 1SAYA 5IJ9B 3UXEA 2OBBA 4HB0A 3KYCB 2HWUA 4C06A 5JAIA 3JQRA 1D8TA 2NUAA 4JN6B 4ZV7A 3U4AA 1G8AA 1CWUA 1I1HA 2GYUA 2JH3A 1GKIA 3ZHRA 3WQBA 4B6EA 1HTWA 2P1DA 4ZAWA 3P94A 4O63O 5BMVB 5LU9A 3RSHA 1OWOA 1P33A 4HDSA 5EJ7A 4RDXA 2ADOA 2OWEA 4JLOA 1ZP6A 4N0DA 3U5ZB 1IXRC 5T8KA 1THMA 4ZOCA 2Q2OA 4WBNF 5THQA 1BYIA 3D7MA 4TYYA 3DUWA 1P4AA 1FYWA 3BB4A 4N3NA 3TE6A 3PE6A 5C51B 1OC4A 1R74A 4BKOA 5GVRA 3R74A 3QU5A 5BXQC 1W2WB 2J59A 3DTVA 1JDJA 4ZXPA 5EUBA 2EKLA 2POQX 2VRNA 2WVHA 2WYWA 3L93A 3ZQKA 3DL7A 4AY6A 5T4HA 4UD2A 2YVAA 5EKDA 3SVZA 5HW0A 5IYZB 3ILSA 3TD6A 1Z0SA 2K87A 3VKFA 1SHJA 4MHSA 4ZODA 1NQWA 2QVZX 1SOWA 4IIEA 7ABPA 4F04A 4GMGA 5FNZA 5HF8A 5L9AA 1J8MF 5GINE 3MQ2A 1WBBA 4ZIRA 1OAOC 3LTEA 1OW3B 1D03A 4YJ2A 2Q6VA 2CE7A 4UEWA 3AWDA 4WKGA 3LUBA 1NM5C 3STUA 3NORA 3V8QA 3PXXA 4KW7A 4OI0A 2GN2A 3QPVA 3VNUA 2J6CA 4R7ZA 2CDRA 4H59A 4L8VA 1SA0A 1Q95A 2XCSB 1VE7A 4P93A 2PL1A 1KYTA 3U31A 1BD3A 1P9RA 4Z49A 3J7AC 3UMJA 4ZGGA 1NVMB 3N39C 2Q3BA 3I9NA 1RXUA 4IHKA 3VSAA 1Q0RA 2GI4A 1SUIA 3MXOA 2I1VB 1W5FA 3UC5A 4CQNA 3A1SA 1DWOA 1II9A 3FOCA 5HMMA 1H0HA 2WLSA 4PRKA 4TS4A 4GMFA 4UNQA 1XMOB 4FINA 1BE8A 4O08A 2V7QA 3PCTA 1KORA 2GBIA 2UYGA 3QEMB 5CVTA 4BVEA 4RF3A 4E22A 3ORQA 1G5FA 4EQ6A 3D3WB 3C5EA 5K6AC 5FEUA 3S81A 1NW6A 1T8RA 3C16C 3LT0A 3M1AA 4DBVO 3K70B 1RYEA 1V11A 4M37A 1MDBA 4JGIA 3PWZA 4XXHA 5EXXA 5B37A 3ZY3A 2VPWA 5KSWB 4KH1A 1FNMA 1L7NA 3H1AA 3THXB 2JGKA 1WR8A 5K2OA 1OLUB 1KFEB 2QYHA 5F35A 3ECAA 2PSSA 2PQ6A 2F4NA 1ZH2A 4Y6PA 5CX4A 5EIFA 4EB0A 2XCOA 2WF8A 1GTSA 3K6RA 2DXIA 3IFSA 1NN5A 2IEIA 4G0PA 4PO9A 3GB9A 2P35A 3DOHA 4GD3Q 5CB0A 5JBNA 2ZRFA 1EAYA 1X86B 5DW0A 2NQ2C 3HGMA 5FI3A 5HKBA 2XT6A 3BBPA 2GN1A 2QP4A 2M1XA 3UHPA 1EUYA 2XWQA 5ILOA 4Y2VA 4ZYXA 1ADFA 3G8CA 1QHIA 1DBSA 4PC1A 1HC7A 1ZONA 2C5SA 4C6HA 5MN5A 2V7EA 1VPVA 3H18A 1MN6A 2G83A 4CLRA 3V1TC 4XVUA 1OJ7A 3ET4A 1J06A 1MXHA 1AZTA 4JHLA 1SBQA 4JWTA 1DQPA 5HJ5A 3GD7A 4XB2A 1NY5A 3K31A 3BT7A 4M0UA 1ZIXA 2C99A 4S1TA 3VUEA 5BMVF 2W6MA 4FK8A 1CS4C 4HB2A 5TMDA 4YXFA 2V4MA 1LTHR 1RMQA 1WO8A 3ENVA 3HCEA 1SC1A 3KB1A 4HCJA 1O97C 1X7WB 5KYVA 2DRIA 2DC1A 2OD9A 3IMCA 3C1AA 5CLIA 4DNQA 1LTQA 5K3SA 4X00A 2FMKA 1Y8CA 2X1VA 5TS3A 2ERYA 2QWXA 4R6WA 4Y7CA 1QWSA 2QUHA 3DYBA 5TPZD 4BFVA 4JLBA 1A2KC 2FAXA 1DIAA 1GGNA 2LXNA 1YR3A 5HSGA 2OCGA 4QM6A 2PUWA 1QV6A 2R8XA 4S1PA 4RD4A 5EESA 2ES4A 2GN4A 1YJBA 3CRMA 1WL8A 4WDQA 4D6PA 2XWPA 2GCIA 2BGIA 2YN4A 3BCUA 5B7QA 2QW1A 1DC5A 4MQ5A 4RQBA 3B5JA 5FO0A 1I30A 3RIMA 1ZD3A 4BP3A 4HRAA 3L7YA 5C8YA 2QVXX 1F2UB 3R5JA 1JFFA 2G71A 3NLLA 4QIHA 1EH5A 3UCFA 4YMUA 1Z62A 3ZK9A 4C1NA 3TE7A 3KOOA 3OIVA 3C5CA 5LZ4A 4NZYA 4YI5A 2OGZA 3WI7A 4HGPA 1DOAA 1S5PA 3OTWA 1VJ0A 4MAAA 1B76A 4OSOA 1NC3A 1O9HA 3AY6A 3PPXA 2AE1A 5I5EA 2HHHB 3OWOA 2HBYA 3T34A 1NZDA 3CX7A 4CEHB 4UCWA 1EB9A 4KRGA 2PJRA 1VPEA 3KCQA 3LO8A 2IIPA 5HIKA 3FOWA 3PHLA 1P1FA 2CNDA 4L95C 1P4SA 1E4EA 2E4AA 2FTKE 1BJKA 4IIJF 3UUGA 1QC5A 4WESB 2VXBA 4O8ZA 5CD9A 2QV0A 1L4FA 4Q3LA 4RXUA 2R60A 4UXJA 5BQPA 5TNXA 3NP9A 3U3ZA 5JRZA 1X8LA 2WF5A 3L04A 3TEFA 4BO9A 2F4VB 4YHHB 5HKAA 4KDEA 2XB8A 2NT4A 2DGDA 3KOYA 1ODFA 4NJEB 2H29A 3EOAI 4OU4A 4C7OB 5DTJA 2BY4A 2YXEA 3A6FA 4G8DA 5JHHB 5JAMA 3DVLA 1TAUA 1TUIA 4G0OA 4GYKA 4DIBA 5KSYA 1KVQA 3HXKA 3JZDA 4DN6A 2GQ0A 3S1AB 1P5HA 3EVFA 3HRIA 4GZ3A 3QP9A 1O94D 1WUYA 1CR4A 2NUBA 1JLKA 3TL3A 1WXEA 3LLMA 2OXTA 2X76A 3RTEA 1X1QA 3Q11A 4D4KA 4AYTA 2RE8A 3AUUA 2G72A 2OWDA 2O07A 1NXXA 1FNDA 3HU2A 4BFYA 4P3OA 5LYYA 2C20A 3IJRA 3BH7A 4LKOA 2AI2A 1OXVA 2XECA 4D9GA 1YO6A 2XPCA 3EXHC 1SOMA 1TM7E 4QDJA 4U39A 1NT4A 3ILYA 5CIQA 2QL5A 2DG2A 2GHIA 4AJ4A 1D5CA 2DHCA 2IZ1A 3U40A 2X9NA 2DHQA 3ZWOA 3QFCA 3S2UA 4XPIB 3M6FA 4U5XA 3ZE8A 4MVYA 4BO2A 1DEAA 1TQHA 1YVPA 1H42A 4Q5IA 3UBMA 4ZYWA 2J4DA 2WFLA 1JUDA 2ODQA 5DBHX 4KVFA 4WLNA 1LSUA 4MIYA 2BT4A 2EFGA 5KTYA 2QY9A 1JSRA 2JAUA 2ZUDA 3DYVA 3PC3A 4MYUA 5E0OA 4IPTA 4AIRA 2HRQA 2JA1A 1G55A 4EAQA 8ABPA 2D2XA 2QNBA 1TVMA 4DCSA 2PUEA 1KVUA 5CNMA 4NBKA 2Q62A 2QMOA 3NP7A 5JAHA 1ORHA 2FSVC 5G4LA 2PXHA 4IWYA 1GNLA 3SF8A 4B9AA 1BDBA 4E1BA 3HFSA 3JQ8B 5IVDA 3NOOA 2AC7A 3HZHA 2IPOA 1K6IA 3ICOA 4YA6A 1U2TA 1F6DA 5HDBB 5SY9A 1EVLA 3UV3A 4LVUA 2J6BA 1SQSA 2ISQA 4OA5A 1N2XA 1JVNA 4HNRA 3BGIA 2W8ZA 3QWBA 4IR7A 1GCIA 4L0QA 1KP9A 3I9MA 5DLEA 2ZXEA 2SKDA 4KLNA 2CXXA 1TUGA 5FPTA 3S2GA 1RPZA 1OU4A 5KKCA 3PQ5A 1VA5A 1PZEA 2C0QA 3CWCA 1RT9A 3DKRA 2X0FA 3ZLUA 3CEAA 3KOXA 1SXQA 1NMXA 4MMXB 1TB4A 5IW8A 3OLVA 1BA2A 1G8SA 4D25A 3CNQS 4UXIA 3OC6A 3KG2A 1D9XA 3DNFA 4NECA 4AMZA 4KFCA 1RKBA 2FGJA 2FOXA 2Q1SA 2YDXA 4CT0A 1UL1X 1CF4A 2YN2A 2ZRAA 4PYIA 2BONA 1K7XB 2A59A 1TC2A 3FUXA 3ESBA 4FHEA 4H35A 2REQB 4JR2A 4TSFD 3L92A 3DDZX 3Q0TA 4EY7A 4CF7A 2JH9A 2JFQA 4EYSA 5CGQB 3UTDA 1IL0A 4AG6A 3H9JA 2AMJA 4IIYA 3DKPA 3BAZA 3KKQA 1UXIA 4KDFA 4K0KB 1C5KA 1VRVA 1N2OA 2Q45A 1RVV1 3LKDA 4DM3A 3CNOA 4TUYA 2IOFA 1ZIOA 4JFAA 3I5UA 3NBZC 4KTTE 1S8NA 5CIWA 2EX4A 2EX0A 1BE6A 3E5RA 4QUKA 1VE9A 4Z2AA 4JX9A 2IPMA 3M49A 2CVFA 4HZIA 3LCMA 1M0EA 5K20A 3ZGLA 3KWFA 4N12A 2CJWB 4QOFA 4ZAZA 4RIHA 4FXPA 1E69A 4G09A 3UT5A 1CJTC 4K03A 4HATA 5FRDA 1P6QA 3EEIA 4OXRA 3RRFA 2OLEA 3D3KA 3DAFA 1C3OA 4MVJE 3NOQA 5A3SA 2R6DA 4ESVA 2FRVA 5F98A 5IBQA 4QGFA 1J9GA 5GWXA 3VZRA 3GNQA 3V1MA 4REMA 5A9RA 5CYGA 5KSPA 3VPSA 4P33A 1SHKA 2C2KA 2W7TA 3NC0C 2C94A 3ZCVA 3L4EA 2BCJQ 3BGOS 4TKUA 1UDCA 3K7EA 4J7AA 4ME6A 2EZ9A 4HY3A 3P0IA 3NGXA 2HC9A 4E5NA 1P60A 1ISSA 2P5YA 1OROA 1AK2A 2JD0A 4RV5A 4YJ3A 4DQUA 1LPAB 3C39A 1TU0A 4JJZA 4PFJA 1IZYA 1EFPB 1PQWA 1X70A 2C5EA 2QQGA 2ZAIA 2EF0A 3ESYA 3NM5A 1F4LA 2UVPA 4GDMA 4IIHA 4LECA 1X77A 5DDIP 3UKOA 1W35A 3L7OA 3TLBA 4GO1A 5CFOA 1JKXA 3CVOA 1AMNA 4KIWA 3UYLA 1D1SA 4NNPA 2XRYA 4QREA 2PTGA 4BZXA 4J0IA 2WD8A 2IHYA 1DXYA 4MRMB 1FS4A 4WNYA 5H59A 1SBYA 2XX3A 2GA8A 3UPTA 1PG5A 2JHCA 4UMDA 4DCGA 3SNKA 1EJBA 2RDMA 3R5KA 1ZC4A 4UFOA 3BIWA 2XE6A 5EA2A 1DKRA 1EHYA 3CXUA 3P26A 5EEGA 1JFSA 3Q85A 4DDUA 1VLHA 4FFPA 4LYEA 3N7TA 3T1HB 3JATA 2EARA 2J6IA 3D3NA 4XCXA 3TZ6A 4BVKA 5ECWA 3FTCA 4Y3UA 3ER8A 3PFFA 4MWBA 1BHO1 2D06A 3AKCA 2NIPA 3R0IA 5C7OO 4ASUD 1NJ1A 2CLCX 2YVUA 4RZ3A 1JDZA 2AJ8A 4O02B 3SLRA 1SQ6A 4ZI7B 1L7XA 1NATA 3TUJC 2QVCA 4BYMA 2I6TA 3UICA 1QVVA 2VUTA 5EZYA 4C7VA 1DC3A 5B3LA 3JQDA 2FR0A 3DE7X 3NWPA 4KAAA 6LDHA 3GRZA 4RMJA 2H2AA 2X8LA 1PWXA 4ZDIA 2PL5A 3AR4A 1Q12A 1FX0A 2NU9A 3QRWA 3BFVA 1N0UA 1C14A 4ZZ2A 4GFDA 1RWBA 3FYUB 1VCNA 3MAJA 3NTRA 2J5XA 1BDMA 1U9JA 3CUTA 4K86A 4NFYA 4WGGA 4AJNA 3H2GA 1DSSG 1FRZA 2B4YA 1TCUA 2G82A 4L72A 4MRVA 4N7JA 2OPBA 4MYCA 1GZUA 4OKIA 4F91B 3PYMA 3UJNA 1J0XO 4WCDA 1OYWA 2PWZA 3ILHA 1PZHA 4EITA 5BNIA 1UPCA 1AKWA 4GU5A 5E6RA 4MIKA 4W5TA 2C03A 2HXYA 1DBWA 3H2JA 5ESXA 1MC8A 1J2JA 1AU9A 2DULA 4G84A 1M6NA 2UZ1A 4GDFA 3ZPXA 1GTJ1 2I34A 3ZLVA 3OC0A 5TB5A 1RZUA 2AN1A 5ES3A 3VQTA 4EI2A 1M67A 4GBJA 4B7UA 3R7DA 3QV1A 2VDVE 4HGZA 2QN7A 4X61A 4AECA 4Q3OA 1ESEA 1VP3A 2VHUA 3EMDA 4P22A 5M34A 2VT7A 3BAFA 4Q4AA 3OJEA 3VHXB 2W90A 1O8BA 3LVQE 1YVUA 2IX9A 4C5AA 1UBOS 2EFEB 1KEEA 2AK2A 4Q21A 4D6YA 1N5DA 2FXVA 5LMUB 3BDAA 5AXCA 1B0AA 3GIDA 1MORA 5J4YA 3AETB 5JWOA 2ECPA 4XD7D 4ENSA 5AXDA 3ADOA 1JTEA 1XZAA 4HQKA 1LWOA 3HZOA 2H1SA 2GAOA 2MMCA 5M29A 4I50B 4X91A 2BHNA 2R00A 3JTMA 3CRVA 1Q11A 1THZA 2QZJA 3N6VA 4A10A 4TLAA 4MQ6A 1MRSA 2GOYA 3G0IA 3SKXA 2J4CA 5CLLA 1YQEA 2OL4A 2H11A 4GMXA 4JKOA 4HFMA 2JAHA 2WU8A 2XOXA 4RBNA 2QBYB 3GL9A 2DU8A 3RYFB 2GK4A 2O7QA 1Z25A 4G86A 3PUZA 2O5VA 4R98A 5FV7A 1ZCJA 3VR6A 2W4MA 1ADBA 1QH9A 1SKAA 2YTZA 2C82A 3AG5A 2X6QA 4UHFA 1G41A 1KOFA 3IUEA 5EFOA 2R2AA 2Q50A 5TPWB 2QZSA 1USVA 2ZWVA 5A62A 3N7AA 2WAMA 4PGGA 1LS1A 2WJJA 2XJ4A 3H3XA 3TD9A 1CVLA 1T5BA 4G26A 1MTOA 1ZM2A 4OO3A 5DCUA 3WJAA 4EB6B 4U7DA 2Q99A 4UMEA 4MKGA 1RI1A 4KSBA 4ZMRA 3AR2A 2X4IA 1UZAA 3F6EX 5D2CA 4KMSA 4OX9Y 2H3EA 2N1MA 2J3QA 3PICA 3W7AA 1ANKA 2ZQ5A 2XV1A 3PDIA 3PE3A 1F3LA 5K0JA 3ZIUA 2LD4A 4Y67A 2R87A 3L02A 2ZI3A 4G07A 4MP3A 1HTBA 5T3UA 4MRSA 4FFVA 2XUGA 1K9VF 2RHRA 1LRLA 1MENA 2I7DA 4KFSA 1J24A 4U00A 1Y7IA 3WK6A 1S1MA 4QUEA 2GN6A 3I1FA 2J3JA 1E6KA 2ZSHA 5ISMA 2GZDA 2P9GA 4Q02A 3MD9A 1ACMA 1EP3B 2FZCA 2ZKIA 3IDSA 4RHUA 5CDYA 1RAHA 3DV0B 1XV5A 3UMRA 1VM6A 2XTMA 4PCAA 1A9PA 1L7AA 2YR0A 2O59A 1UBHS 2OK7A 3ER6A 3NG1A 5JC8A 3FIUA 4ON9A 2PYDA 5I48A 2PX0A 2MYNA 1JAXA 1ZPDA 2W2VA 3NV9A 4OL9A 5H02A 4H3KB 4YUWA 5KCZA 5KBYA 2EWMA 2HU8A 1J21A 2QNIA 2SNIE 1Y63A 2ALJA 1N2GA 2VCYA 3MYRA 1ZGCA 4IYRA 2HBRA 5FLYA 2ZIXA 1F6WA 1M33A 2OORA 5MN4A 1Q2XA 4GPZA 4WT7A 4RO0A 4AQYB 1YRHA 1P7YA 3W1VA 1Q0UA 2R8YA 3QTTA 4OCZA 4YGYA 2WD9A 2F3SA 1Q7CA 1GGJA 3AERA 2FPIA 2QTFA 1PR4A 2RHBA 3JVDA 5KTPA 1REQA 3NVMB 5JZVA 3O7WA 2DMRA 2ZYRA 3A36A 3QFSA 1R6AA 3WG9A 1PR9A 1O6GA 3PR2B 4YYEA 3DTYA 1G8MA 1PJBA 4LHSA 4N8EA 3W5CA 4TYWA 4K9SA 2AEMA 1SBNE 2PKCA 3QU9A 1A1SA 2DECA 5ICEA 1SCQA 4J1TA 4C7KA 5DWDA 2AUNA 5JPCA 2AOWA 1P7PA 4MR7B 2H63A 1S4QA 1UJMA 1TE2A 3K9CA 1HSZA 2A5JA 5EGSA 4NV0A 1PR1A 1A88A 3TFQA 1C29B 1QORA 4CMGA 4PC2A 1GNRA 3QVVA 3UG6A 4IWNA 3N70A 4WCVA 3EMKA 2CB9A 4QOIA 3V32A 3LG2A 2DM6A 5A5DA 3EGXB 5L53A 4QBGB 3WYDA 1SVWA 4FYMA 4RPKA 1GQ2A 2VP0A 3RIXA 2PGAA 4FKZA 1G1MA 3DNMA 2AQIA 3EF3A 3ZOZA 4LWQA 1DQNA 2C2OA 2EEZA 2GZ3A 1VRWA 3HBLA 3PUXA 5DM4A 3PDUA 5FOTA 3WLMA 4JROA 3NJ4A 4OXNA 3SVLA 1YFLA 5EZ6B 3ND8A 4AKIA 3I58A 2WIKA 3G2PA 3KFXA 1ZXBA 1R5NA 2CXTA 2ENUA 1GNQA 1NUTA 3KKLA 3BULA 2YYAA 3JQQA 2BFNA 2W83A 2XXJA 5DMXA 2P2ZA 3F3MA 5EL0A 2VHZA 2VDKB 4EABA 4XSGA 1S2DA 1UT8A 4Q4HB 2BVNA 3EEYA 4K9MA 4YASA 1UJ6A 5LB2A 4F2HA 1VLVA 3LQFA 2V6MA 5DISB 2FK8A 4HAOA 1EDEA 3FPKA 1N0HA 4PZCA 4YCJA 2HREA 1Z75A 5DX0A 4TM7A 4AQ7A 5ALYA 1DPGA 4P4SA 4RLQA 1ZI8A 4LWZA 3EXG2 1QFSA 1J2RA 2JKVA 2RGNC 2IUEA 3Q6IA 5KYUA 2XE4A 5IU6A 1RZRA 1ZA2A 4Z8XA 2VZ8A 1KJYA 1KVRA 3T4UA 1HYEA 1XUOA 3KXDA 3DOEA 1T2VA 4I4TF 4LF4B 5CXUA 3BSYA 5C7IO 4TMVA 3FYCA 4J9VA 1L5WA 1UK6A 1U8UA 3E5HA 3VISA 2Y68A 3IPXA 4BMVA 1UDBA 3A1TA 1QO0A 1ODIA 4Q37A 3U61B 5KHAA 2HLHA 2Y67A 1ECLA 2C42A 2QUZA 7REQB 4CL2A 3QUCA 4CMJA 4IZHA 3FW1A 3QEKA 5TGTA 4G81A 4XYBA 3JASB 3R40A 4P5EA 2FMUA 5TGZA 2INGX 4PHCA 1E2IA 2DQZA 2Z43A 4NYMQ 3SBDA 1QM5A 2RKWA 3GRAA 1EFHA 1VHQA 1M1YE 4BQNA 3D0KA 3PC8C 5BPFA 4UU0A 4UBNA 2ZPAA 1I5OA 5BR4A 2NWQA 3SOPA 4NYJR 4ZVKA 1A7UA 4URZR 4F4HA 1J0EA 4EYKA 5FA6A 2GBPA 1GR1A 3C3YA 4D44A 2JFHA 3T1VA 4BCBA 3A9WA 2GILA 4G5FA 4LXGA 5AM0A 4V0ME 4K1XA 4ZC1A 4RL4A 4DIOA 4ZRDA 1D6SA 2IIQA 2I2DA 2NVBA 2QNRA 2XD9A 2YHSA 3K4HA 4FFBA 1YDFA 1GO2A 4Q19A 2YHIA 3HDVA 2X5JO 2IS1A 1L7PA 1YJAA 2P11A 2Q27A 2DQKA 2VSXA 3E18A 4OGWA 3O2QB 5EXEA 2C4KA 1FJGB 2YUTA 3QNWA 4JBNA 4DY4A 3N8IA 3NUGA 4JSRA 4RNDB 3U13A 4LJKA 3UJ6A 4MXDA 1RCTE 4EY6A 3IQHX 2OO5A 3AF0A 1C9YA 1ECBA 1AF4A 1AY0A 2W22A 3FYUC 3RS5A 4OFWA 3D6MA 3FLEA 4IYJA 4WJLA 3GGOA 3DBHB 2RHWA 5H1YA 1BVHA 1GPDG 2OYSA 1YS1X 2W4QA 3QBDA 5J3JA 2DQSA 4TL6A 4BC1A 4JC8A 2FZLA 3MNFA 3HL4A 3KHSA 1NVUQ 3O4FA 4OHZA 4MJLA 5IDQA 2QX6A 1T3ZA 1K6XA 1VIDA 1Y37A 1GPJA 2QRHA 2KB0A 2XB6A 1JAHA 1FYFA 1OGYA 2ZSEA 1JKJB 4HWRA 5H7XA 3QK7A 1ZN9A 4ESHA 3KKMA 3RVPA 1YFJA 1RW4A 3KRTA 1XEFA 4TRRA 5CFLA 5T64A 5JCPA 3OZGA 5E0KB 3EVNA 3IE0A 2GHRA 4AVYA 1TZKA 4IH4A 3M3HA 1QVWA 4I6EA 3DAYA 1QNFA 3BL8A 1FRFS 1RLMA 2W5UA 4YPVA 2XCRB 1X14A 4L22A 3VPGA 3CKKA 1WEHA 1YQTA 4LVOA 2DBRA 3VPBA 2E4XA 3DZKA 1E89A 1H05A 3E35A 3KKEA 4JUFA 4LRQA 4BO4A 1TGYA 1FSPA 2A84A 4D74A 1YCDA 2H3HA 1CVIA 1RXSA 2B5OA 1P2FA 4GLJA 5KINB 2ZVJA 1DRKA 3UW1A 4EYGA 2VQ6A 5D6OA 2PBLA 2VSQA 4LOLA 1RR6A 4W1SA 2QQEA 3VH3A 4V3BA 4YP6A 1UMDB 4RGBA 3W3AH 5JYEA 3RAEC 2JFOA 1ETUA 5E4JA 4EDHA 3V1NA 2RGWA 2PVPA 3VA7A 3DMHA 4ZVOA 1DX9A 1KR2A 2O3RA 1IUNA 2W6ZA 3L1IA 3P2OA 1L7EA 3OPMA 5FTJA 4CMCA 1YMVA 2P9FA 4QGGA 3MINA 4WFIA 2EJCA 4UFPA 4PC3A 4JLPA 4CF3A 3VO2A 2W2TA 5D00A 4UDNA 4C7BA 1H1DA 4L5AA 3RG2A 3LL4A 4ZCIA 2OFPA 1VIAA 5HGJA 4WZAA 3G6WA 3MIIA 2D6FA 4A0QA 1GEEA 3Q2OA 4G0YA 3TAXA 4BOYA 4M9QA 3KYIB 4KREA 2WYUA 2VK8A 1P7VA 3QLUC 4GOJA 4RDIA 4UAGA 3RC3A 4XYLA 4MVJD 3IAM6 4Y6GB 1EKXA 4AD8A 4AP9A 4PGFA 4QEDA 1XMIA 1R66A 3LC7O 4XB6B 1PUXA 2EX1A 3E3AA 2DERA 1EUDB 3STWA 4YRKA 4ASUA 1BEEA 4HFNA 3JARA 1A4IA 2VBCA 1TF7A 3MMSA 2AG8A 1JPNA 2I0FA 2OZPA 3C7AA 1KH3A 5HFNA 5AW8A 2LCFA 4Q4CA 5IASA 4U2EA 5AM3A 5IFLA 1L6RA 1ODLA 3EBOA 4NEGA 5J2UB 4MS4B 1K7CA 3ZG6A 5EIBD 5BNWA 4CUKA 3H7AA 3OCCA 3RVBA 1V7ZA 1T13A 1JMYA 5K05A 3IQZA 2DZDA 1LSJA 3RT7A 3TKAA 4ZI3A 1S8FA 5BURA 1FJXA 1CR2A 3ZJTA 5DBIA 4OQXA 1J8DA 4GRAA 3H19A 3VR0A 2EGHA 1D2GA 1H9AA 1NWCA 2GM5A 3ZXIA 3RHFA 3ZH9B 3LDAA 7GPBA 4IMIB 4Q3EA 4WXMA 1ZCAA 4DRXB 7AT1A 4FM9A 3FCYA 1U2PA 1YJQA 5KDOA 1YKSA 1ISHA 1EK1A 2EBWA 5M2QA 4JH0A 3GBSA 1ETHA 1CR6A 3WTBA 4IRUB 3RKUA 3TZHA 5MFZA 1ZOIA 1XTRA 2VF8A 3IQXA 5DTMA 5I7SA 5I7HA 3ELUA 3F5FA 5FLXA 3AKYA 4EPXA 4CL0A 3FZEA 1NC1A 2N47A 3IT1A 3OUZA 4RFSA 5DTQA 1ISPA 4QARA 2QGFA 3IR6A 3TRHA 4L4XA 5CDSA 1R88A 2A5FA 3E81A 3IJEB 4O4LF 1HZZA 1JIVA 4BJHB 1I24A 1Y6RA 1KPGA 1XWFA 1Z7EA 4NX2A 4X1OA 2G08A 1QPBA 1RIFA 1T6XA 1CZHA 1UH5A 3GEBA 4TWIA 1O5OA 1AF7A 2V7XA 3V8RA 5JZOA 2O2HA 3OZVA 4W99A 3V2GA 2A1TR 1U9ZA 1NJGA 4DGQA 4G5SA 3OCXA 1XFAA 1SUPA 2CXSA 2XDWA 2P2CA 3FRHA 4JLUA 2UYYA 2VHQA 4HSGA 3GQBB 3EVGA 1M8JA 1PS8A 3OZCA 4OTZA 4KR7A 2YYYA 3JCZA 4GX5A 3JRNA 2NZ8A 1TM2A 1EVJA 3EIEA 1P8AA 3KK0A 4OXQA 3ZVMA 3TRIA 3W5DA 1VKNA 3V7UA 3C1UA 5ULLA 1HDXA 4ECAA 5BV7A 3UXMA 1L4HA 5KYXB 2Y6UA 1EXWA 5CFPA 2D1YA 1DDGA 2P5SA 5EEHA 3SM3A 3LP8A 3AWIA 1NKVA 4N9WA 5BV0A 3L8DA 3JXEA 4C0KA 3IP6A 2B4QA 3SIXA 1Z3CA 3LT4A 2BH9A 1G21E 2O3JA 4UHDA 2QN3A 1K63A 3KLOA 4R1OA 2XTZA 2I8LA 3I83A 5EE5B 1W7AA 4JLWA 1XZLA 3VAZA 4L3WA 4F8YA 2JJYA 2ZETA 4TQ9A 4Z2YA 2DT5A 1AC5A 1SZJG 5I9TA 4OK5A 4BMXA 4CQMD 1ARZA 3PX3A 4DAEA 3IP8A 2OV1A 2R8RA 5EPEA 1P2SA 2F1JA 5A0TA 1TM3E 3IBTA 4H3VA 4D0LB 2QB5A 3FPCA 2XUZA 3ANNA 1T2CA 1MO2A 5JAUA 1OXMA 1SBIA 1JWAB 1U0EA 4BVGA 3H9QA 3PGJA 1XDWA 3CVVA 2QL7A 3BREA 5J2TF 5FWDA 1UM8A 1R27A 3WQHA 1QQTA 3AB7A 3C74A 4FMPA 4L57A 2AXPA 2QJFA 3L7DA 3JR7A 3CR7A 1A9QA 1RM5A 1KIMA 5J2UF 2FZKA 3OQIA 2HF2A 4M83A 4NU0A 4CRWB 2E9SA 1AKTA 2CDNA 4F9FA 1N3YA 1KQ3A 1C8BA 3MQ4A 1BJRE 5B6IA 2WHYA 1C0IA 3LX4A 5FPYA 2HRCA 2V1UA 4KRYA 2E55A 4MI6A 3ZGYA 3OD1A 3FUVA 5KOHA 4KIGA 2EFYA 1EVZA 1P1BA 1SCKA 2V5UA 3DV2A 3IJ5A 4GOLD 4MQUA 5DM70 4QE3A 2OMKA 1P1RA 3WLFA 4M9ZA 1CUYA 4C2UA 1HMYA 4TV8B 2C57A 4Q3BA 2BEJA 1NUQA 3T38A 1ORIA 3OOSA 3R24A 1UJ2A 1C7FA 1EEXB 1JT9A 3E9DA 5JNWA 4D96A 2Q5JA 3HV0A 3S40A 5BVGB 3SHVA 3PQ3A 1AKUA 1TUBA 2P90A 1UKVY 4NU6A 4UHKA 1KTIA 1TMGE 1ZVQA 2BMVA 3TR0A 3KVVA 5J4KA 3TGLA 2QM3A 1DS6A 1EEHA 2WUDA 1YI0A 2AJBA 3FGPA 3D0QA 2NO1A 3B8HA 4KOAA 4AZ3A 3ZGOA 3SGLA 4LBVA 1MR3F 2V6IA 4NI5A 1UWVA 2QUBA 1U1IA 2R62A 3KZVA 2PANA 3KHUA 3UH0A 4HTFA 2GN9A 4LJYA 3K5IA 1IY2A 2PH5A 1R0LA 2QPAA 4HAXA 4C43A 4C9BA 3TLEA 5C35A 3ZN2A 2JHPA 3OECA 4I5FA 3GJ4A 3I05A 2D59A 2C07A 3ONWA 4HAIA 4LHVA 4KO3S 3G82C 3NCTA 4OYHA 3MMXA 4HDAA 4LS3A 2VBGA 5AM4A 3U4QA 3TR6A 5I9MA 4JJ7A 2QI9F 3C6BA 4LYHA 4WOBA 4CF6A 3SIWA 2V03A 4DQDA 1VTKA 2QN6A 3C87A 5BNFA 3AV0B 5AXAA 1RKVA 5ALXA 3VHQA 1X2BA 3PR3A 2H9AA 4DNOA 1O57A 3AG6A 3R7SA 1CF2O 4RTSA 3KKKA 3FNRA 3HVJA 4M1SA 3QM1A 5I7RA 2K2QB 2BPOA 2IEAA 4LMBA 3L3BA 4QJBA 6CHYA 4WK6A 4EUKA 4Z1OA 3BD7A 2E85A 1WSBA 1K3TA 2H1CA 1FTQA 3LWBA 1Y1SA 3GO4A 4RPIA 4LF9B 3CVWA 1SB8A 3NHLA 1TZBA 1DWUA 2WVAA 2EVWX 4BMZA 4ZK6A 1PVDA 4N0MA 2B98A 2V6JA 4J1NA 2OV3A 2X23A 2ZSDA 4HAZA 3FDXA 4NOKA 4WOPA 5KVQA 3CX4A 1BW9B 2HU5A 3IP5A 4EJ6A 2PEZA 1WDWB 4BMPB 3BZUA 4LYYA 2C4TA 3P97A 3SQMA 3ROZA 1GT6A 1VLLA 5CXSA 3LOQA 1WD7A 1WKBA 1YRAA 4HS9A 3BMCB 4ZPXA 2H52A 4Y2XA 1TCCA 5AOBA 1E79D 2X2OA 2Q1XA 3W5JA 3T3PB 1YUNA 3KVNA 3O8NA 3VR4D 2HDOA 2BIFA 2OECA 3RU9A 2Q49A 1ZIYA 3P2KA 1IPFA 1VB3A 3IAFA 3S7ZA 1QG4A 1PHPA 2X7JA 3MT7A 1VFNA 4LVCA 2IELA 4L51A 3J81A 1A97A 1G6KA 4R4JA 5ICMA 3A27A 5IJXA 1SD1A 4B71A 1H1LB 2X8JB 2RJ3A 2Z6AA 4BDTA 5EOVA 3K2IA 3RRMA 3V4ZA 3ND7A 2Y05A 2ZCUA 2QM7A 3I2FA 3KYDA 5DWVA 2LZ0A 1W0CA 3CZ4A 2JCYA 5TQ0A 3JQGA 3WDLA 2QN8A 2FZWA 1P29A 2R44A 2DETA 4L2IA 1AHPA 4HAVA 1KKMA 3P4XA 5AW2A 3M6IA 3NDRA 2JHFA 4TV8F 3I0NA 3TLAA 3BUSA 1RC8A 4IF6A 4PPNA 4MKIA 8AT1A 4XR4A 5JXIA 3N0WA 2BUCA 1JLLB 3K09C 1MAUA 3E8SA 5TVKA 4JLAA 5E9JA 4WH0A 2ZUFA 5A7HA 3N2GA 1N2SA 1D5WA 5F23A 1M2OB 1M72A 1VJGA 3M3PA 4LJ7A 2P6UA 1QGUA 3GARA 3A37A 5A7GA 5JTTA 3I2GA 3THRA 2VAVA 1QVZA 2DFLA 4L16A 4MPTA 4ZQFA 4F06A 3SS7X 5HE9A 1KO5A 5HGXA 1XVLA 4N41A 2OBYA 3GN1A 5IH7A 4MAMA 2AKYA 3C85A 3DVRX 2WPDA 2PMWB 3M5WA 1PIWA 3A9RA 3AGQA 3L0CA 4KXQA 3WGMA 4C2BA 8ATCA 1QRUA 5A3VA 1B6SA 1YJCA 2Q1TA 4PBRA 4RV4A 4BB0A 3HI4A 2WJWA 2XCIA 3PDJA 2GLXA 4MHOA 4DDKA 2HT1A 5KO2A 2WHPA 1RWWA 1W73A 2XUIA 3DLCA 4IHJA 4RA6B 1BMFA 2WQZA 3OQVA 2CNNA 5T57A 3N8HA 4CG0A 4URUR 4JNCA 3FMGA 4PZDA 3IESA 5D5QA 4DC9A 3SXUA 3ANLA 1CUUA 4G5OA 4A8HA 2NTVA 1SC6A 1HZJA 3OJLA 4C29A 2IYQA 4FMDF 2P6OA 1WSDA 3SIRA 4Y6SA 4L4SA 5JECA 1M5RA 1XBTA 2IKQA 2BEKA 1B2RA 1FU7A 1KZ4A 3MJEA 3K2QA 3L0SA 3OO1A 3ZE7A 1A77A 1V8DA 3N2KB 4B4KA 2UUOA 1IDOA 5BN3A 4JUAA 2A86A 1DTWA 2ZYIA 4I1PA 3DUFB 2CVHA 1T0IA 3DF9A 2ZDHA 5DIZA 4JJKA 2G40A 1N9KA 4KPUB 1M1XB 3EF1A 1SCBA 5HBGA 4BLWA 5CEFA 1WUTA 5REQA 2WSIA 3TX6A 2EBFX 1K2WA 2PR2A 2ZGVA 1YQUA 2YOHA 1CW2B 2GF2A 2W6OA 3JVUA 4O4HA 2DWPA 4GOOD 4PAMA 4DF3A 4EJSC 1OWMA 1T9DA 2QRGA 4MYRA 1KC1A 3LIIA 4WEQA 4ZOLB 4FNMA 3OTOB 3CJRA 4RFVA 1O54A 4HO1X 4QNNA 2D7DA 2QI9C 2Z0MA 3ANMA 3G7SA 4RSGA 5B2FA 2RAVA 2VCEA 3R9XB 4OX9B 1CQJA 1HLFA 2QORA 2NU8B 5HFAA 3C24A 2Y0PA 1DLJA 3H97A 3VC1A 4Q66C 5KVVA 5FDFA 1XRMA 1KEUA 3UT0A 3GGSA 1S3FA 1T5OA 2XNCA 1XLTC 2Z2ZA 1M6EX 3R6DA 2IEBA 1PD1A 2CLSA 4OK3A 4QU9A 1ICEA 3CLKA 5DHSA 5ALTA 4EVQA 1D0VA 4YMVA 3A1UA 3RFTA 3AEUB 1ZAYA 1Q3KA 4QDUA 4F0JA 5LYJB 2WIFA 3EWAA 2DPMA 2CZCA 1ZS9A 2Q3HA 9ABPA 1CJUC 3UJBA 3BCRA 4BDSA 1DAMA 4WQMA 3NPMA 4C4YA 1QTNA 3WE7A 4NENA 4V0RA 1ZM4A 5DXAA 4KQGA 3RBAA 3RVKA 4AP6A 2HA0A 1AH2A 1KE2A 4I66A 2H2FA 4LCEA 1W0KD 3GLGB 3BH0A 5DP1A 4ZCQA 4WL0A 1AB5A 3T7IA 2PVCA 2YJNA 4MVJI 1PW7A 4CCYB 4MVJA 4DPMA 2C9ZA 1M54A 5LOVB 3OU2A 1AQUA 4B6RA 4N5NA 2JK1A 4AROA 3F6PA 3T7TA 1ZVMA 3WBJA 2VVTA 4O2AF 2QSZA 4HLUA 1NBWB 1QAMA 1T43A 4BASA 3QUAA 4A16A 4YJDA 3CLTC 2NU6A 1SK9A 3OU7A 3RR2A 3PSHA 3ADDA 5FPSA 3QXHA 2D3WA 2YY5A 1LDBA 5E1BA 3ZV7A 5KWIA 4FJ1A 4C05A 1Z5GA 3DT8A 2HCFA 4IJWA 2FPMA 3OCUA 2BF7A 2H5IA 4BQPA 3L9XA 2C7GA 2JJ1A 2I4RA 1NMQA 2H1OA 2BJWA 4HAYA 2GH1A 4W5HA 2OPHA 3WLLA 2P68A 3BMNA 4BO0A 2ZIWB 3GEGA 1AKRA 3F4LA 1Z38A 2CGEA 2IVFA 4MR8B 2DX7A 4EG3A 3ASZA 5KS2A 1RQLA 2YWEA 3HO6A 3M4NA 3QXJA 1K97A 4Y2TA 2PSFA 3JPWA 2ZBQA 3M81A 4ZAVA 1K75A 3ZCRA 4M1OA 3A05A 4CL8A 3H1PA 4DWOA 1HNXB 1TRKA 4KR3A 1S3IA 2AB0A 3ORYA 3DL0A 3FLAA 3ZI0A 1ZH4A 2FOIA 2AFIB 1GV0A 1XKXA 2BKVA 3AW8A 1MX1A 1WDMA 3D64A 4WADA 3DQPA 4LGCA 5E2AA 3UMBA 1FP4B 3WGYA 5CFNA 3LCUA 5JEDA 1MLDA 5GP1A 1LCIA 2XF2A 2YWJA 2FH5B 3L07A 4PGMA 4M38A 4NTZA 2ZEJA 2VWGA 3H83A 3TJRA 3FKSA 4KMRA 4J2TA 4EA6A 3LDUA 4I0WB 2QK4A 2JFBA 4Y1GA 3GJQA 4F3RA 2VH1A 1E6WA 4DHEA 3L7NA 1W48A 4LZNA 4L85A 3ROGA 4BO8A 1CX9B 3IA2A 2AZDA 5ANRB 5LUBA 3R7LA 2IJGX 2Y1CA 1DHRA 2ZJOA 4NFHA 1PO7A 1ZCZA 4X84A 1OH5A 1VXRA 3H2YA 4TROA 3K1ZA 2FQYA 5EMKA 4ZT7A 1FTWA 3CVXA 4UPVA 5EVJA 1WZEA 3PPYA 4LJ6A 4CDMA 4E21A 1JFTA 3A6PC 1KARA 2B6HA 2JRLA 2M98A 3VNQA 3W0LB 3WLRA 1WHTA 4LF8B 2I7XA 3H04A 3TW6A 5AVUA 2EIXA 1W96A 4RIFA 5FBLB 2JIDA 4COOA 1VXOA 3QKWA 4G4JA 3TTWA 3R75A 2D5LA 4P83A 3HLYA 2GSDA 3GJ8A 2HV9A 3JQBA 3BHNA 5G0UA 4NF2A 3CZQA 4MDEA 2VWQA 3OM0A 4H77A 1LKZA 3TO5A 1LFDB 1KS2A 1P8JA 2PUGA 1FPQA 5EWLA 1V25A 1VB5A 1U2QA 4CQMA 4PNPA 4TTSA 1EM8A 3O9ZA 1DT5A 3ESQA 4IBOA 5AESA 1O96A 4GSLA 5HP4A 2FEMA 1N0WA 2I3ZA 2W6QA 4US2R 1D1TA 4EGJA 2OTCA 5TY0A 4XIYA 2NTEA 5HFJA 3QVSA 2QD3A 2PU5A 2Z4RA 4INOA 4MUHA 1FX1A 4XJVA 4C14A 1L7BA 1N5KA 5DRYA 5IC5A 4C21A 4ZHQF 2H4XA 2PLFA 1AZSC 1Y1TA 4ENTA 5I9SA 1OGIA 1H3FA 3PNBA 3FR8A 1ULUA 1I1OA 5DSZA 3R7BA 2JFGA 2WWHA 3WLOA 1X80A 1HNWB 1OYVA 5CDUA 1NYTA 1KDPA 3ZZTA 2CDBA 3LV8A 3PUWA 2EQBA 5AUQA 3EUAA 3IA7A 3M34A 1FYDA 5KJ1A 4ALNA 1SXJD 5K8JB 3U2QA 1E6LA 1T2FA 3LBHA 4BNVA 2PMDA 3N05A 4IOLA 1YHYA 2OBXA 2GF0A 3SR0A 1Z5UA 5CNKA 5HOEA 1YJXA 4E2FA 3U09A 4KLRA 4ZOBA 1ONBA 4MR9B 3IDQA 2N1BA 5B64A 5K51A 1U8FO 4I3FA 2XXAA 5B3JC 5HYVA 4BBPA 3B7PA 2DLCX 1HQDA 3AJEA 4KZPA 5LQAA 1NZJA 4Q0MA 2QE6A 5FWYB 2FEKA 2HSJA 3NHJA 1DHTA 2FWPA 2PWAA 5AKIA 3VPHA 1DKUA 4EIWA 3UOAB 2Z6QA 3O1JC 1L5RA 1AHNA 1WULS 4O4IA 4M0CA 2M2IA 1JNXX 1B4DA 3ZGNA 2ACEA 2GDJA 2AQ8A 1QDLB 4L9WA 2ZZNA 2BDTA 1XJWA 2MYPA 5CVCA 1U3CA 4UEJA 1FNNA 5LA6B 1FDRA 1E94E 4K3VA 4DPLA 2P75A 3AI2A 3VKGA 2XKBA 3EQZA 4YI3A 4ONEA 3JD3A 1O9BA 1AKNA 4NNOA 4NCJA 3TTUA 3OQMA 2JLZA 5F73A 3VU1A 4ZEXA 2F8TA 2GARA 3O93A 1Q7EA 4TKVB 4EHHA 3OQ6A 3WFIA 5FOSA 5EIEA 3KV1A 1OIVA 4MA5A 4BVBA 1RXVA 1E2HA 2GHTA 5E6UB 5GV8A 1V1MA 3Q88A 3NBKA 5DNAA 2CNBA 5CIYA 2H1LA 1JR6A 1K6JA 4Z4EA 5CPFA 2JLAA 3U4HA 3THWA 1IBLB 4ZMSA 4QQNA 2IZ5A 1SJ9A 1UZUA 2NO9A 1O58A 1VCHA 2YRXA 1ZBDA 1C1DB 3ZH2A 4WACA 1QHHA 4J7UA 5JISA 1NR7A 2XGGA 4GM1A 3VV3A 2C00A 5B55A 5C53B 3TMAA 4Y2UA 1NUHA 3TOZA 2Q7DA 2ZSAA 1E9VA 4IXWA 4JJ8A 4US0R 4WKBA 4BU0A 1FZQA 1MV5A 1J97A 5E3JA 3RUDA 3T15A 4DMKA 3INYA 2ZUCA 3OG9A 4YHBA 4YFVA 2A9RA 4JS0A 3LPLA 1L5GB 1A04A 2HLDA 4S24A 4L07A 1YZNA 3QUSA 1CJMA 3GEMA 2PUTA 2YWBA 4FYWA 2YVLA 3DOFA 3V1LA 3VZCA 1XOIA 1N57A 2CMGA 2DPYA 3EC7A 4XE5A 1YIDA 1CR1A 3EZNA 4IIVA 3T4EA 4E2WA 5HWSA 4WAUA 3FNIA 2BTQB 2PKXA 1F6BA 2IY7A 2J0SA 2UUBB 4MWZA 3GVXA 1ODJA 3INTA 3VGJA 1BDJA 3LH5A 3U37A 3UEOA 2C8LA 2I71A 1Y4DE 1LJUA 2MSEB 4LX8A 4L8YA 4Y0VA 1U1FA 2NYRA 1R10A 4ND6A 5AI6A 1GG8A 1JHZA 5F2OA 6ABPA 5JC1A 3HVKA 4CCWA 1YA6A 2AMFA 4A9AA 4A0FA 5C5CA 3VPXA 1EFTA 1SHZA 1NRWA 3T3EA 3LFTA 4KQJA 1E79A 3SLGA 1NASA 2H08A 1L5KA 1F0NA 4HDQB 4QOGA 3VR4A 4OXXA 3HCAA 4LJAA 1T8PA 4IZ6A 3WFZA 5E3HA 3BMQB 3D4PA 3Q0IA 4M87A 3EG9B 3C3EA 2I62A 3L7KA 1E61A 2HD4A 2HA4A 3EY9A 5CNJA 4EX7A 2Q3FA 5K4HA 1FBNA 3OMWA 5GTDA 3NB0A 4GXQA 1I3OA 5FHQA 1XVAA 4KWIA 1EE9A 4YT5A 3PRJA 3ZE0B 1SBCA 1U98A 4PRYA 1KWKA 5FH9A 2O8CA 1M8GA 1FRQA 1VG1A 1VSTA 1FUKA 4IDQA 3FFWA 5A9TA 3WKBA 1P2DA 2NZUG 2GEVA 2OHJA