3P9ZA

Crystal structure of uroporphyrinogen-iii synthetase from helicobacter pylori 26695
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
222
structure length
213
Chain Sequence
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLKMLQNIPAYALSEPTAKTLQDHHFKVAFMGEEIFPLLEKKSVLYLRAKEIVSSLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFLENYTAISIGNTTALYLQEQGIPSYIAKKPSLEACLELALSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen III cosynthase (HemD)
publication title Crystal structure of uroporphyrinogen-III synthetase from Helicobacter pylori 26695
rcsb
source organism Helicobacter pylori
molecule tags Ligase
total genus 61
structure length 213
sequence length 222
ec nomenclature
pdb deposition date 2010-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02602 HEM4 Uroporphyrinogen-III synthase HemD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p9zA02
3.40.50.10090 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p9zA01
1WCWA 3P9ZA 3D8TA 3MW8A 1WCXA 4ES6A 3D8RA 3D8NA 1JR2A 3RE1A 1WD7A 3D8SA
chains in the Genus database with same CATH superfamily
1H4VB 1Q74A 1YVDA 3BXEA 2EFJA 1EJ6A 2I7CA 4TTJA 3BXGA 3SJBA 1ZD1A 4RTQA 4BMVA 2J46A 3VX4A 1PSDA 2IP4A 2LWIA 2J4DA 2X9LA 1KEEA 4OMFG 1QU3A 2A9RA 3GJYA 2WTBA 3N8GA 1QYWA 3PPVA 2I33A 3A4YA 2ZIXB 3O3OB 4V0MA 4C0HA 1BO6A 4JLWA 3HYLA 4QXRA 1JIXA 4A7PA 1PD0A 3Q7SA 1VE3A 4NECA 1Y81A 2AOWA 1JDBB 1BQ4A 3ID6C 3A3KA 4UBMA 3V1LA 2RIPA 3U7FB 2YZ7A 4O29A 3DQQA 4HLUC 1VL5A 1W93A 3WQRA 5AVQA 1YR6A 3DTYA 2R3SA 1JBKA 2HNKA 1BYIA 2WM9B 3P9PA 2VO1A 4PSUA 3UMYA 3OZVA 1Q7RA 4JLOA 1O9BA 2G5TA 3PE4A 1KH3A 5AM4A 3U3JA 4NICA 1HKUA 3NFRA 1A5AB 2I91A 5T8KA 3MS4A 1IBKB 4TS1A 4CUZA 1PR2A 1GY8A 3ETGA 5J2UF 1SULA 4JMPA 1FUUA 3T8YA 2I2DA 3UJAA 3ZV5A 1OGIA 4BASA 3QVTA 121PA 5GJVC 2PZMA 4N3GA 4KMRA 6PFKA 3OCZA 5HWSA 5KC8A 3HTXA 1YVEI 2XF2A 3OJEA 5K4HA 3V3TA 1QS0B 3R0IA 4JROA 5IAJA 4K1XA 5DNCA 3WRWA 1R64A 1T1IA 1U2SA 2YJTD 2RBKA 3D1VA 3LX5A 4DJAA 4DC1A 3FUUA 1QZXA 4C0SA 3TRJA 3MJRA 3GJ4A 5COAA 1GN8A 3A2KA 4KE8A 2BRUC 3D54D 3F8SA 2CE7A 3JQQA 1MFPA 1XJ5A 3N0TA 3M6IA 4CR6A 1KNXA 3JRNA 4IVRA 4KBGA 4HZGA 1C8BA 5D00A 4HAXA 2OFFA 4B4KA 5F3DA 3KJNA 3R41A 1QMPA 4DDHA 1EDEA 5BMVA 2NV6A 4MV9A 4OQPA 4OSEA 1UIRA 4YJFA 5DLDA 5F21A 1X38A 2Z6VA 4IMRA 2AGVA 4K8RB 3G9TA 1EAMA 2ZXFA 4NF2A 4UUNA 1KPGA 3X2SA 5ESWA 1A8SA 4DLYA 5KJFA 4EYEA 3HRIA 5B4UA 3LBHA 2Z04A 3A36A 4MUBA 2DERA 2ORYA 2W6ID 5TX7A 2BP7A 5I7AA 4BJHB 5MDHA 2B36A 1OC2A 4CF4A 2V7BA 2X2FA 3BIFA 3I04M 6LDHA 1ORHA 2D5CA 2QT1A 1WOYA 1NHWA 4U6SA 2M6LA 3I1YA 3R40A 5KDLA 1NDQA 3WO0A 3ZCUA 1B7GO 4BLRA 3ZVMA 5FUBA 2DETA 4CM8A 4JBNA 2PLRA 1VBNA 2ZWVA 3MS2A 3R5FA 4R4JA 3W2EA 1WMSA 5TS2A 3VR6D 1JBQA 1E3TA 1YA8A 2O1EA 3LY5A 4PQYA 4WEOA 5FOWA 3UV3A 4AD8A 4BVGA 1UBFA 1NXWA 4BATA 3WRXC 2XMBA 5KSWB 1FSGA 4P1ZA 3Q12A 1MU0A 2YR0A 2LV8A 1UODA 9LDBA 3WKDA 4YO8A 3X43A 3W7VA 1QM5A 3T7SA 3DP9A 1VCHA 4FR5A 2L17A 3PR2B 1C50A 4DA9A 4EHNA 5IJWA 4E12A 3C3PA 3W8EA 2H9YA 3J81A 5ILGA 3U9TA 3LFUA 3G9ZA 1J90A 3P0EA 2AFIE 1R88A 4LYAA 3ZD7A 5I9MA 4WFIA 1X6VA 3GLRA 3C8DA 3PFIA 1FJXA 1J8MF 2BI7A 5DHSA 2VG8A 4O2BF 3NTVA 5JDCC 3DVRX 1WDLA 3HHEA 4JI6B 3U7EB 3FDZB 4ZI7F 2R62A 3GOHA 1C3OA 3HJBA 3OVMA 2NUTB 2UZ4A 1UFOA 5EXSA 3UPDA 2QR5A 3G02A 3O94A 3LMKA 2AB0A 3HSYA 2OOKA 2Q5HA 5JR3A 1FTQA 5LMNB 2FI1A 2IHTA 2ANCA 2X0JA 4XX0B 5SZJA 2KPOA 4PINA 4Q0MA 2Q6KA 4URZR 4WK0B 1M73E 4OYHA 5J63A 1ZGGA 2C4TA 2ZVDA 4YR9A 3GG2A 4KPUB 1WWKA 1S2NA 2YWFA 5I8PA 2HSWA 1A7KA 2D7CA 4PZ0A 2NZUG 1WW3A 3U09A 5EZSA 1ENYA 1FL9A 1OSNA 4NKRA 1ABBA 3TVDA 5B30A 3NPAA 4M0MA 4YMSA 4CLHA 1SRRA 4RH1A 3GG9A 5TJ9A 5LXTA 4O6VA 2RHCA 3H8JA 4ROTA 3NXSA 2IP1A 1Z8NA 1NATA 1GJRA 1GPWB 4ZC1A 1CR0A 1PJAA 3TE6A 2HA7A 1U9JA 1ECJA 3JYHA 3PDIA 3P4UA 4KL8S 4GZ5A 4DB2A 1TVEA 1DX9A 4S1TA 4W9RA 5C5DA 1E2DA 4P7GA 2O3TA 2X4LA 1AMOA 5CGZA 3NGXA 4BZZA 3A31A 3T7TA 1Q12A 2PX5A 2JFWA 3BCRA 3HB5X 5EIHA 1GNTA 2A59A 3HEBA 4LVOA 5AJWA 4FTWA 5ES3A 3VSCA 1XVTA 3DOOA 2JL1A 3DTVA 3KJGA 3WWEA 3B82A 3ETJA 3BHMA 1O8CA 1HL3A 3BWYA 1N6LA 3C5CA 3EGEA 3DLIA 4CFZA 2X2EA 5LPNA 3KKEA 5K09A 3O5AA 4OHZA 3LW8A 5DNAA 3KQKA 3K5PA 1B16A 4V0KA 3ZKWA 5D7BA 5AM2A 3C16C 3PV0A 5H0IA 3FNEA 2I03A 3C39A 4Y2JA 2B1GA 2QX9A 2PO7A 2V59A 1KI4A 3HXTA 5YASA 4GDMA 3IVMA 5JQGF 4NDZA 2VDWB 3WYEA 3FUXA 4R3NA 4UDXX 5ELLA 5HG0A 2B35A 3BF8A 4KR2A 2WIFA 4R71A 1GSHA 4DNXA 1KO1A 2OCKA 4PXAA 1GRNA 1UAGA 3I8OA 4GNKA 4YJFB 1E2LA 1VDMA 1R00A 2CT8A 2R4QA 4PG4A 4M99A 3W6NA 3MCAA 5LD2C 2XUIA 2PS9A 1U3DA 3CSSA 2RAPA 1SBNE 3PNOA 2BWJA 3GJRA 3C1UA 4HDNB 5ALZA 1I80A 3A9WA 3NDJA 4RGYA 4NR0A 4TV9A 5BOSA 2QSUA 1JVBA 2EKDA 4CQNA 1Y1PA 3LVFO 1AKRA 3H9BA 1ARZA 3K4QA 2CLDX 3VGJA 4BO2A 1Z63A 4RMGA 4LRUA 3H9JA 5JZSA 5BW8A 2DB3A 3GYGA 4Y1EA 1LFDB 2BTOA 4OFWA 5AK6A 5FPQA 3SVTA 3WYGA 3GFGA 2O0HA 4FWBA 3JU3A 1FDVA 4DNOA 1N9ZA 5FO0A 4YJ2F 1SG6A 5A4FS 3F9RA 5K8VA 4IGEA 3RWOA 1W8IA 4CM8B 1A8UA 4QLAA 5G2OA 4GOMD 4L95C 4O4HA 4AU1A 4BQSA 2ATEA 2BIFA 2YV5A 4YCSA 3UHJA 2WSLA 5T57A 4HPWA 3D6JA 4CM4A 1Q22A 3VTFA 1I4TD 1T1SA 2D8MA 2I4MA 2JJ2D 2RJNA 1EWTA 3IMGA 4TS9A 5CXXA 3PNKA 3JQGB 4G2NA 3NHKA 1Z88A 4G86A 2FP4A 5DBFA 4JB0A 5H70A 2F3SA 1Y37A 1G38A 4EY7A 2GYYA 3OT1A 2Q9BA 2C58A 3BTSA 3A1UA 3DP7A 3MGCA 1L5ZA 4P84A 4ZVTA 1O6GA 3VKWA 1J8VA 2HSZA 2QM3A 3H5TA 1L7DA 4YRTA 1GTSA 2HMWA 3AM3A 4QBFA 2A0KA 3SEAA 5ENZA 5CVDA 3OPXA 3OT4A 3A1NA 1YHNA 2JJYA 1WHTA 1R1DA 1Z37A 2AOTA 3EGDA 4PLCA 1CY7A 3FWZA 3NIGB 4JK3A 1P33A 5KVQA 2O2DA 2OCXA 3WL3A 3L0YA 4L2IA 1G19A 3QLJA 2GX6A 2V6IA 3QVJA 1L3IA 3DHWC 2HMUA 3QE2A 4GSLA 4NCBA 3JALB 2PSDA 1L4NA 1V39A 4R8KA 2VNIA 3DMRA 3QVUA 4QU8A 1ZMRA 4JD5A 1Z2NX 2FMUA 4JHLA 1AGYA 2IHVA 4R1NA 4HH3C 4M7WA 3T34A 1RZRA 1OZGA 2ZU6A 3DMPA 1LDEA 2B2NA 4KRFA 2WIBA 1NA5A 3TOCA 2FUG6 4B3BA 1N2GA 1MCZA 4U63A 1OB2A 4GLOA 3JYPA 1D4ZA 4FLFA 3IE2A 5ETJA 1VBFA 3ZXSA 4D8UA 1W30A 3P4XA 4GNRA 5K9ZA 2NNLD 3RU7A 1XPUA 2OD2A 4Q3EA 3N2NA 1FLAA 2WF5A 2W2VA 5EP3A 3ZJTA 5EKTA 4IIUA 2PSEA 4KMMA 1M8GA 2CDAA 3EZ9A 3WTCA 3ZY2A 5G4KA 1VLZA 4C5AA 1OYYA 1PNVA 3INNA 3SKYA 5FPKA 4I5FA 4WL0A 5BSFA 3LC1O 5EC8A 2WPNA 1JE1A 4O5OA 2L19A 1KSGA 5F9FA 4F5WA 4D6XA 1OZFA 4NBTA 1QF7A 3CCCA 2YIVX 3I2KA 3KOUA 4FW9A 3SM3A 4K6HA 4D0SA 3DTVB 4O1HA 4ZVMA 1NN5A 4G56A 3AYZB 5CVEA 1B0AA 2M32A 1YU6A 1YNOA 4J3NA 2H1IA 3QFHA 4HGOA 3NGMA 1QGUB 2K2WA 4L75A 1Z5ZA 3KQOA 2YMLA 3RBXA 1KK3A 4UHHA 3HWX1 3ZKWB 3VZQA 3ENVA 2RGGA 1CRPA 3UJ3X 5AR1A 4JZYA 4R81A 1K6JA 4DIUA 1K4KA 1ZVMA 1TQ2A 3BQNB 5ANRB 3ZOKA 1HT1E 3R4VA 1B8OA 4RBNA 2QOEA 5CXSA 2C82A 2PUWA 3A6ZA 3CNEA 3DMFA 1EDZA 1ZMXA 1JTFA 4RKWA 4FYJA 5DHFA 3T7KA 4L16A 4CIDA 3JAWA 3R7SA 1OFUX 2ENUA 2QN1A 3DZFA 3JQBA 1CFZA 3O3CA 1OI2A 3M6LA 1KJWA 1YRWA 3D8TA 4YDQA 4FZVA 1YQGA 3B85A 3WGHA 2CVHA 5EXPA 2HF8A 3RRXA 3W5BA 2C4NA 2UXDB 4EI8A 4UHEA 1CJMA 4X7MA 2FEMA 2OQ2A 1FX0A 3LPNA 2GJ9A 2OQIA 4RVDA 4LKRA 3L41A 3W1WA 4LZNA 1VYTA 2FLVA 2VA9A 3G5MA 3LZCA 4MVXA 2QVLA 2ZE5A 1BDHA 1GCUA 2QLBA 5CEJA 1QRUA 1G6OA 3SD7A 1JA1A 3EVBA 2QMOA 3CUTA 4GPD1 4W7HA 4HC4A 4MA4A 5E1DA 4ZYLA 3KZVA 4N18A 5DI3A 4IJWA 4C5BA 4AQ7A 1E2BA 4LTMA 4B0PA 2EKQA 2G83A 2IHYA 1F2VA 1H2FA 4ZD6A 5I3ZA 2GVNA 5FX2A 1K8XB 2F67A 3I72A 1M6VB 4RPKA 2FHSA 3G7UA 3VNQA 3UOAB 3WYBA 4S1NA 1V47A 4HF7A 1M3SA 3IJEB 3I73A 5DCWA 5EYPA 4C1BA 1HF3A 5IAEA 3AHHA 3OJCA 4V3BA 2YICA 3OM9A 5KSPA 1LVGA 3IP6A 1J8DA 4F1JA 2K87A 421PA 3BD8A 1E7QA 1KHTA 2JRCA 3AUFA 4CKXA 2FQWA 4XASA 5NLLA 2ODPA 1SH7A 4CF7A 2FP4B 3FCUB 4F5YA 1OT5A 1DFHA 2PH3A 3OT1B 2J32A 2BHLA 4TGLA 5KNBD 1LNSA 4GL4A 1L8XA 2QNBA 1L4MA 1E6KA 1P4SA 3PNBA 5DN6A 2GD1O 2RDMA 1OYVA 1WHTB 2CZGA 4UAVA 4LQ4A 5EVCA 4IGAA 2RH5A 4EL0A 4N8EA 5BP7A 2OOSA 2SICE 2XMQA 1QVRA 1XRQA 2C3OA 3A10A 3L82B 4MI6A 4ZEWA 4C06A 4N5MA 3PDJA 2VQFB 1AKWA 2A9JA 3ROZA 3ZQUA 3G59A 2Z2ZA 4MWZA 3AZQA 4JN6B 2BEWA 3HXQA 5LJIA 2XE8A 3CF6R 4KIUA 1TYEB 3D4LA 4PZCA 2H18A 3RRYA 1LLFA 3FDXA 4DRZA 1QP0A 2ECOA 1XVIA 1VCMA 4PLYA 5DNVA 1EVZA 3FTNA 3G13A 3GZ4A 16PKA 2CXPA 2CCJA 4FHFA 5KOYA 1NFRA 2PX0A 5FD8A 3V8VA 5GVSA 2SCUA 4I8IA 4P08A 4L8VA 1YB5A 3F6PA 4LVCA 3E2MA 4Y1RB 3C41J 4Q6WA 2EVWX 3O93A 2J9XB 3A9VA 1FLNA 1UQRA 2GARA 3HR7A 4GYKA 3WMEA 5GZ6A 2ZU0C 2XVAA 3TI9A 1DCMA 1XQXA 5LWQA 2P90A 2X1MA 4HLNA 5DTRA 3GPDG 3KJHA 5C8YA 1H6AA 4QDJA 4CJXA 3UOGA 2QTGA 3R7BA 4IV0A 4QQFA 2W2NA 1TVKA 1QHYA 2A9OA 2BMWA 4TUYB 2H1LA 1T5HX 3LY8A 3D7NA 1UL1X 4UD6A 3TAUA 4NI5A 3L04A 2QTVA 4G8CA 1HBJA 4MKGA 2HOQA 3KEFA 3ZVLA 1ZVKA 2QRLA 2WP0A 4GM1A 2JCBA 3AC0A 4P3YA 4RQAA 4YI5A 3GZTB 1A96A 4DIMA 1LRLA 4LF5B 3FJ1A 3N58A 1VECA 4QYTA 4Q3DA 5IHXA 4PY2A 2ZE6A 3H05A 3RGWS 1E2QA 1Y1SA 4C4SA 2I3DA 3NBYC 2QGNA 2O2CA 1WE2A 2QW0X 2WP8J 1HO3A 2VLIA 4UNQA 2VP0A 2V8BA 3ZZMA 4N01A 5ALMA 2QX6A 3WWZA 2VQDA 3PDWA 4B43A 1Q0RA 4J8PA 3PFHA 3GZJA 3JAWB 1E60A 4QUEA 3V7FA 1TTHA 3ZOZA 3ZCQA 1G2QA 2OHFA 4R7GA 3FYCA 3WK8A 1Z5NA 1YVUA 1JIVA 2UZ0A 3OEHD 4RNCA 5JNRA 2YW9A 4YIKA 5IUJC 2ZPTX 1NQAO 3LTEA 4RIHA 3ZCTA 1G21B 4UXJA 4D41A 1IUKA 3GX1A 2UUAB 4LSMA 5DWVA 4FINA 1T0PA 4QGHA 4DZZA 1AX9A 5FUVA 1FX0B 1FA9A 1E3LA 1Z56C 4XYEA 4BMSA 1EUQA 4J75A 1KS9A 1YQTA 4Y9TA 4GX5A 3EZNA 1S3FA 3L1IA 4GYJA 4LIPD 1VKNA 3CBGA 5IC5A 5EJ9A 2QTBA 1BKSB 4NAHA 2DWOA 4JLMA 1E79A 1IBCA 4BVFA 5DI3B 3K8ZA 1C29B 2WDPA 4DDMA 2Q7XA 5ICSA 2O3SA 4P0QB 2IE0A 1TMGE 3QH4A 1U2DA 4IDHA 1SVOA 4HQOA 4HS4A 4JVOA 4WK6A 1D4OA 3GCZA 4CT4B 3CRW1 1R3DA 1FS6A 3SHOA 5CLQA 3SQMA 1H4QA 1SD1A 2NXCA 3U3XA 1CJTC 3BGSA 5DSZA 2RD2A 2C84A 3IVXA 1ZGBA 3IEIA 2PCLA 2QKYA 4DQKA 1RI2A 5EYPB 3E5MA 1VHQA 4I3FA 1WTCA 4MLPA 2KWIA 2ZTUA 4KFRA 4QU5A 4UEKA 4HXEB 2DUMA 1EXNA 5C0OE 3DT6A 3WL6A 4F4CA 2O2IA 1E59A 4MKRA 5HILA 2V6GA 1XV5A 3FCCA 1PLKA 4TLLB 3GFBA 4R69A 4U2KA 1PS8A 3OIWA 1WJGA 2Z4RA 1M1NA 5I5EA 5BNTA 5NULA 2PJZA 5DXFA 3PDCA 3FLMA 4CKEB 4AF7A 2GR9A 4UUOA 2HHCA 2XUAA 3F6EX 1G6Q1 2NU8A 3RLFA 2H4YA 2Q4TA 1I3MA 3NHPA 1IWBB 1X1TA 1P0CA 3VFDA 3VQTA 2EF0A 3NHMA 1T6NA 2R7NA 3HJNA 4DF3A 4ETNA 4JJ7A 3R3HA 3BJMA 2H4HA 2MYTA 5JOQA 3I9V6 4D3XA 1ESEA 2ON6A 2B8WA 2ZYSA 1IOVA 3MD9A 1NUHA 1WP9A 2F4NA 3BZUA 1SXIA 1TLTA 1ZJ5A 3DVLA 3OA2A 2FPPA 1MPTA 1YR1A 2HRCA 4PX9A 1OI3A 1EE9A 2L82A 2SKEA 1ZOIA 5JIBA 2ZJAA 4Q3OA 5AW1A 2C7VA 3KB1A 1BE0A 2BFOA 3IPLA 3OT5A 3W0LB 3KV1A 4E21A 2BN4A 1SXJC 1KU6A 2YQ5A 3MN1A 4MYUA 2REXB 2HDNB 2JLWA 2FJPA 1ZHHA 1XALA 4QGBA 5EUQB 1IATA 3FB4A 2ASVA 4QGSA 4J16A 3G2KA 3AJAA 1RLTA 1I4DD 2DPXA 3ND6A 1B4DA 4U3JB 3WYCA 4A03A 4XOIA 1V7QA 2FZLA 3X1KA 2WD7B 1G9SA 5JPIA 5C7IO 1N1MA 1Y7IA 3GT7A 4EIWA 3F4KA 2IVFA 2D0DA 2QQ5A 5ITVA 3U9LA 4G9BA 3QPBA 2YV1A 1U0SY 4LI3X 2QRQA 4DYDA 3H0CA 8AT1A 2WMDA 5JAZA 4KUHA 4BC0A 5K01A 1Y5NA 4D26A 4ARVA 3BTOA 4WBNA 5AXBA 4EQ6A 4LBVA 1N7GA 4GOND 1TCAA 2FX2A 1E64A 5EMHA 4RZXA 2OPBA 4C2UA 4BNGA 2AV6A 4F9GA 4KFCA 3OP4A 4AP6A 1JFFA 2B83A 1BVRA 1BXKA 4BLUA 4NS4A 1PVVA 1WP4A 3KKMA 4EHLA 1CVLA 2B4RO 3ZDAA 4Q7QA 3OLWA 3ESRA 4YRJA 3PVZA 1VMKA 3OH8A 3OU2A 4CKCA 4EKDA 1U4SA 3RROA 4DCVA 3MUFA 5KSZA 4R98A 4RO0A 2XQJA 1SIUA 4H77A 1JSLA 2VDLB 3QI7A 4EI9A 1WUHS 4NYMR 1B76A 1PV4A 3EBOA 4II7A 1DX4A 3N8KA 3ZJ5A 3I5YA 1HT2E 2JLRA 4C2BA 2ZB3A 3A11A 1UOQA 1TJNA 2RMKA 2AI1A 4OL9A 3WIEA 2H51A 1EFLA 4DHEA 3BUSA 2X0DA 4BLSA 4OAQA 4UDNA 5CAEA 5KYWA 3QI2A 3DQZA 2GD2A 1UEJA 4JEIA 1I14A 2B9VA 3PQ5A 4Z0NA 3QKSB 1F6BA 3ZU2A 3CJTA 2Z8ZA 3HDGA 1VL6A 5HF5A 3Q8KA 4FNGA 5SICE 3ADOA 4E4TA 2OHJA 3L3BA 2CVOA 3GPLA 4R1UA 5LU9A 1JIJA 1Q1EA 2HSDA 2AJDA 4ZPXA 5AM1A 3NVDA 3PPXA 1B3BA 1UOEA 3RS5A 3C97A 1FRQA 2NO5A 3RUAA 3I0MA 2H2HA 3TLEA 1JFRA 2OD9A 4RDIA 3UJ6A 5DBHX 4B3TB 2NU9A 5KNBA 4GI1A 3PG5A 1SKYB 3W77A 5ALJA 1M2GA 2J5QA 3GD5A 3UB3A 5MGNA 1LDYA 3CKLA 2FEPA 4YXWD 1LZLA 5BSHA 3H1FA 3OOSA 4C7KA 4P38A 2HFKA 3ML1A 1RM4A 1T5TA 2R79A 3GJTA 2QGFA 2HCFA 5EL0A 2TMKA 1V8DA 221PA 5EXEA 5FOTA 5ECYA 5JCJD 2CLSA 3E22A 4P5PA 4A26A 3AY7A 1QIIA 5L7WA 1IVSA 3R09A 3SYMA 3TW4A 1XPRA 3U37A 5JUWA 2QJTA 1QCDA 1M1NB 1NP7A 1E20A 3DCYA 3N8IA 1GUDA 4HDOB 4XSHA 1E2KA 4FUQA 2C29D 3H8SA 5TPZD 3RK1A 3RUPA 2NU8B 1KS2A 1BOFA 2A9PA 3GRVA 2BW0A 4A0HA 3QYPA 3AHGA 3SZRA 2GN8A 4NL4H 5EXXA 7ABPA 1D9ZA 1ZAKA 5CBKA 1TKBA 2CFRA 5H80A 2YW2A 1DAOA 4FFMA 1KTVA 4EEKA 4NYMQ 1E7WA 1MB3A 2O8NA 2R6CA 1AZSC 2X5NA 2YZ2A 1U0GA 2ZAGA 4M53A 4UDYX 4YECA 5IFKA 3R9XA 3FPCA 4M1OA 4J0CA 4L3WA 3ESQA 2X0FA 2J9ZB 3I62A 4WI1A 1P75A 2FMIA 3OTWA 4A23A 3J7AC 3O03A 3AYXB 4IOKA 4Y9RA 3T9AA 1SHJA 4LFBB 2G80A 1T36B 4FYMA 4L08A 3N7AA 1S6YA 4UC0A 3L0PA 2G1KA 4EL5A 3SS9X 4C2TA 2H17A 1EP1B 2BSQA 1GG5A 4HWPA 4YQEA 5A7GA 1QQ7A 2P1ZA 2VKQA 2YDXA 2O2EA 3BA1A 4PRZA 5GONB 2XD4A 3CUWA 1IB0A 2ZDQA 4FX2A 2RI1A 4PNEA 5AOVA 5HK9A 1L5QA 3AJDA 2J0VA 3IHTA 4MPPA 3VVLA 1JAHA 1PFUA 2XTMA 2C4HA 3FCYA 3NKLA 4K2AA 5DO9A 2FFRA 4CE6A 5C1DA 3UWPA 2L18A 2OZEA 3L6DA 1UANA 3ESAA 1RC8A 4MOWA 2FN3A 2GF2A 3ZNNA 4OATA 2W2TA 3NPMA 3UOWA 4EQ6B 4ALIA 1Q84A 1BHQ1 1JJBA 2BGUA 1T9KA 2FOLA 2HIHA 1F38A 2ZYWX 3ZWYA 4XDHA 5A9TA 3DHNA 4ND6A 1D2CA 3EXHB 3UBMA 1AB5A 3OEHA 3W5UA 2RB4A 1JFFB 5AXAA 2GT1A 1Y3FE 1L7BA 1X7YB 2FKAA 2CD9A 2RHBA 3O1JC 5E2AA 3KYBA 3GLGB 2NO0A 4DV0B 1K9SA 3BKXA 2PTHA 2ZJ6A 3W6UA 1TJ3A 3ZVRA 3O4HA 1JKJB 4RFVA 2IKQA 3KKPA 4B31A 2XUGA 1UBSB 2ES4A 2QAGB 2WJWA 2J1LA 3MS7A 1OWMA 5F77A 1DRVA 3VSBA 4L8GA 2OFPA 4S2UA 4JJ6A 1ZU5A 3CUKA 2Q0XA 2EZ9A 4I2VA 3WGKA 2HMSA 1TUIA 3K8YA 1SOMA 3W3AD 1R8JA 4XWWA 1DWQA 2BEUA 2BH9A 3M7IA 4HFNA 1A9XA 1PFYA 3L7KA 2YHBA 4Q9DA 1RYZA 2CBXA 2ZJ5A 2QE7D 3ESBA 4ZT6A 2FRDA 2JFGA 2BTQA 4TZKA 5CAEB 4YMVA 3GQVA 4J03A 3G9XA 3OPNA 1N5DA 2FSUA 4ZOBA 3TGWA 3HNPA 3ZDBA 2A33A 1AQJA 4LK2A 3SX2A 1Z8HA 5DW3A 5AHOA 4E2FA 2XITA 2ZSAA 4XARA 3H4TA 4KVZA 3KZ1E 1Y4AE 1HC7A 1JJ7A 5HX7A 2X76A 3OLXA 2VPQA 1KDVA 3CX3A 2XBUA 4ZO8A 1C8VB 3FOCA 1O9HA 1VJDA 4RAOA 3QTBA 1A4XA 4ZVQA 3BE6A 1OFHA 3GBPA 4XVRA 4AZWA 3NEYA 3AMVA 3RK4A 3SXPA 3QKRA 3VHXA 4BP9A 5JW6A 2A1IA 1SXGA 2VHVA 2IE8A 2JRLA 2LRHA 1EGVB 1LCIA 1J7KA 4N5IX 4X6UA 4ZU1X 4E08A 1E2NA 2OB2A 4MPTA 2X1VA 4EO7A 3D81A 5K4GA 1KBOA 2VS1A 4KR9A 1H0KA 2JLYA 2F1RA 1W8DA 1H05A 4J4HA 4DJDC 1VG1A 4UU0A 2AN1A 2BGMA 2VXBA 3KOMA 1K3TA 2PBLA 2Q4EA 4CV1A 2ECFA 4B75A 1R5JA 2EQ5A 3PX7A 2Z2KA 4K6MA 5F1PA 3PKZA 3BTUA 2OAGA 4FYXA 3QY0A 4HBGA 3FSJX 3BIWA 3Q72A 4Z9AA 1TAQA 5AQ1A 4KQHA 1A1VA 4BRUA 2G72A 1T2NA 1U1CA 2C0QA 1IK6A 3BMOA 4N9WA 3HUUA 4WOJA 1YQQA 2P75A 3H19A 3NG1A 2QMQA 3HLKA 4C88A 1AO0A 1F9EA 3FOZA 1GFSA 1ZD4A 2ZULA 5ICGA 3DDCA 4PPQA 5ALIA 2JGIA 4YP5A 1DBWA 1BGXT 1A0OA 1TZ2A 2NTJA 3BGIA 5FWNA 4MVJG 3ZCXA 3O91A 3G3EA 5WRFA 3AW9A 3T6KA 2JJMA 3HADA 3LV8A 4IEEA 1Z0UA 4E5DA 2R47A 2C00A 1X74A 3O7WA 1FXWA 5DIFA 3UK1A 4OH7A 1QONA 4KGXA 1QTNA 1U5CA 3ZD9A 4X6YA 2DAPA 3MW8A 4NG4A 4QD3A 1Y9JA 1YC2A 1XRPA 5I7SA 1NQTA 1KMMA 1GGFA 2IL1A 4WBSA 1WMBA 5B55A 3TOXA 5JWOA 1YGYA 4PYMA 3EIOA 3QEMA 2VSFA 4JGGA 3G8DA 4J3FA 4C30A 4BUJA 2FMTA 4D3SA 5JY6A 3TF5A 3KOYA 3UV6A 1XG5A 2E5FA 2G8NA 3OQBA 4LBZA 1PR5A 1UJCA 4TROA 1RC0A 3WRVA 3R23A 3Q0TA 4IJKA 4TL8A 1PNOA 2CHEA 4AICA 1DIAA 1V11A 1JZQA 4ND4A 3VPSA 1VLVA 4EPRA 4GGOA 5IX8A 1GTRA 2ZGVA 2HQOA 4GXNA 4HDKA 5BSMA 5FXMA 1G8JA 4ZKDA 1WKVA 2BZ0A 3KB6A 1YR9A 4QG7A 3W3ZB 5CXQA 2MMCA 4XQ9A 4OGWA 4FEGA 1PR9A 1C3JA 4DE5A 4UTNA 4RF3A 2PUTA 1B6RA 1LDNA 2KLBA 3OO0A 5FNVA 2JI7A 1T4BA 4TLAA 1J1ZA 1EEXB 3JW8A 4WNIA 5AM3A 2PL9A 3ILYA 2HHJA 1BCRA 1UF9A 1CUJA 3ORSA 4I6EA 1RCUA 1TKAA 1EXVA 2GAAA 3U60B 4TZ0A 3ZI0A 1EWQA 3F6SA 3ZGLA 1I5RA 4R1MA 1CWUA 2H1WA 2Q1WA 1QGZA 1TRHA 3DTTA 4A8JA 1W36C 1ODCA 3ZCPA 2G4CA 2DUNA 1FVXA 1U98A 3V1YA 1KEZA 3AIOA 3DEAA 4YONB 1G5QA 1A9XB 4IM7A 4A4DA 5T5QA 4BUCA 1X1SA 3K72B 4M1ZA 2YJNA 3WV5A 4XM0A 1MHTA 5FRDA 2O3RA 3BULA 3OIUA 1MAHA 2PSSA 3TYXA 3VC2A 5CFQA 5IN4A 3BEDA 4OK3A 4ISCA 3UW1A 5IT4A 5A7FA 3PC3A 2I5PO 3KJIA 4IMJB 4UHJA 2O5EA 5IYZF 2VNAA 4CTJA 2GSWA 4NCXA 5CM9C 1NQ5A 2W6ZA 3L7IA 1QIKA 4KLCA 2ZRIA 3H6HA 5AVUA 1SU6A 2NTEA 1PS0A 2O1SA 5DTQA 2PM8A 4EA6A 3IEMA 1G8AA 2A58A 5IEJA 2WWTA 5JCJA 5TQJA 4UD2A 4ZC8A 3UMJA 4DRYA 1QFYA 2C77A 2Z9BA 3OJFA 4KACA 4YX9A 3N07A 1QU2A 1XDSA 3GI1A 1H6DA 3KLOA 3EH2A 5TGDA 3VHXB 5K45A 1P29A 3RSHA 3ZHTA 2XQIA 1FYEA 2G04A 1QIGA 4REQB 4JBIA 5TPZA 3HKCB 1VPWA 3RVBA 2YKGA 1J5PA 1FRFS 4M1WA 1B6GA 2WI8A 4TLMB 1I1OA 3OQPA 1TU3A 3HP1A 4UJ5A 5K8LA 4UUAA 3GNLA 2XUPA 5JD3A 3JZAA 3KSMA 3PCXA 3JQ7B 3HKDA 2HEIA 2RK4A 3T4PA 1WM1A 4E5SA 4EW1A 2V65A 1N77A 3JQRA 3PI6A 1CB0A 3VNSA 1PBTA 1AGPA 4IMIB 4CQLB 2Z6QA 5KJ1A 1PZHA 4XWGA 3DAGA 3MMXA 2E2WA 4DMKA 4F11A 2ZIVB 3BMOB 1R4MA 4QPJC 1WPGA 1PW7A 1KK0A 2Q4DA 2P9HA 3K4PA 3LUCA 4EMUA 3CN7A 2XMZA 1FPMA 4JEUA 3AVUA 5CB4A 3AW8A 3QBDA 1WUTA 4G1CA 5EG5A 4PG8A 3HP7A 2VH5R 3RRBA 1ZNWA 3RC3A 3WLJA 4CL0A 1Y6JA 4BL5A 2HPVA 4OGFA 3G0BA 4LOAA 1SA0A 3HVKA 4GKBA 4FR0A 5D51S 3O6VA 4ZHQB 2A4KA 4ZCLA 3EWSA 4YMIA 4EY8A 4O2RA 1BXGA 3OP1A 5DCYA 2OGUA 3H18A 1QO0D 3GB9A 3I9JA 4HH4A 4C0KA 1KFBB 1CY4A 2ZS9A 5ICCA 3JAKA 2NAPA 4R41A 4WY5A 3WYNA 2D5IA 2HAEA 2E6UX 2WKWA 3ONDA 4LFCB 3OCWA 4GI7A 1E1QA 2QJOA 3KV3O 1DRUA 3K6JA 3ESCA 1G5HA 3E84A 2JG3A 1JQBA 4MWEA 1KI1A 4H3SA 3R7AA 4CCYB 2FTKE 4CU5A 1DCTA 2FXVA 1H3NA 1X8KA 2HU7A 1OFGA 2GM3A 2ODAA 2P9FA 4EJSB 3JWPA 1X3LA 3FRIA 3GGSA 3LLUA 1Z8FA 1ZK3A 3MMPA 2HQ1A 4GAEA 1G21E 4PHCA 2XCQA 3LKVA 4XUEA 3J80A 3HJFA 2D8AA 2M9MA 4KDFA 1XI2A 1V11B 1SUAA 4WE3A 3P2IA 2PD4A 2C0PA 1MENA 2K7FA 3N3BC 1O94D 3BFPA 1EVLA 1XHFA 4N0EA 4N5DA 1C3VA 3C3MA 3T9CA 3V8BA 3VR5H 1KKLA 4HDKB 1Y63A 3QLVC 4JI8B 1SVSA 4ODIA 4WKBA 4V0SA 5HA5A 2EQBA 2QRKA 4ENVA 2X5XA 2XDQB 3VR3D 3W3AA 3FYUA 3TK1A 2VC2B 4LPKA 3B3AA 1M33A 4YRFA 4CLRB 4B82A 2OORC 4KQCA 2Q7DA 2PX8A 5CURA 1HA3A 3WGZA 2QE7A 3K5HA 1PUJA 1SXPA 1X86B 2GF9A 1Z5PA 2JCYA 1RYYA 2WF6A 3GEGA 4HVAA 4LV6A 3TPCA 3ZHVA 2VRBA 2DHQA 4MW5A 4G5RA 2B1IA 4N3AA 1I1QB 1NN3A 4LYGA 1DBPA 3G2NA 2CFOA 2Q3BA 3KTDA 1LDGA 4F6CA 4LYDA 2A5GA 4A8JB 4EW3A 5C3UA 2Z1MA 1FP1D 1RQNA 1X15A 1XVVA 4IHJF 5FL7D 4NZPA 1NLYA 1Q7EA 3M3DA 1F4LA 1SWWA 1ZISA 1TQHA 2BDEA 3QXSA 3CEMA 2I2XB 5HDBB 4ZTZB 1V4NA 2FW1A 2V45A 3DEZA 3R6WA 1S2OA 2JGRA 4I66A 3VKUA 2F1HA 3CEHA 3I9OA 2RHHA 1E8NA 4IZ6A 3PKJA 2MSCB 1A4IA 3VI4B 1G5PA 4EVIA 2AN4A 4I9UA 3WGGA 4D8XA 4H0NA 3AHIA 4DG8A 1QBGA 3JQAD 4NCIA 2QL6A 3KJQA 4D0LB 4TKVA 1UBJS 1GU0A 3I4FA 3ZLJA 3G0DA 2YXLA 1QHXA 1G2OA 4RHYA 4E6EA 2VYQA 1T35A 4OYLA 4DDKA 3QE9Y 3L7YA 5K3BA 4XJVA 1E89A 5CK5A 1OE0A 1TU4A 1JF8A 1VFNA 2FSHA 2NSLA 1IQUA 1GG9A 2YVAA 3O1IC 1N6KA 4KUEA 4PG7A 4WRRA 4LJ5A 3G68A 5JPCA 4OHWA 4NE9A 4EUSA 3P52A 4L3OA 1IHDA 4EB3A 2BFDA 1P6XA 2VAXA 2IPXA 4UFNA 2GPBA 3F6RA 3IPCA 2H9IA 3WY9A 3SSMA 4S1PA 3BE5A 1E96A 2ZUTA 1JLLB 3DZKA 1W73A 3HKDB 3LFTA 3SCZA 4BB0A 5LQMA 4CM6A 3D2BA 4JH0A 2HDHA 5IJAA 4D5GA 3QVOA 4CTOA 2GTHA 3HRHA 2IWRA 3R75A 3UA3A 4CLDA 2NLOA 4ZZ1A 1DIOB 1U1IA 3LA6A 3EY4A 1I6LA 3VU9A 1NUPA 2GLXA 4NK5A 4XQGA 3RVNA 3U80A 3L0SA 4PYLA 3AY3A 4UBOA 2WAMA 4Q15A 1SCIA 4XDZA 2ADOA 3TZCA 5CB4B 1I2MA 3L6EA 1J8FA 1C0KA 5DF1A 3U7QA 1B6SA 4ZAYA 2DFTA 4RWZA 1LDMA 5ENDA 4B6OA 5DM70 3DAFA 4G1EB 1TCUA 1W1IA 3OQJA 3OMLA 1KI3A 3CR7A 2YHIB 2NO6A 5EJGA 2G7MC 3SDBA 4F3KA 4KXFB 3HCAA 2XYHA 5DSTA 2YJZA 3GJ0A 1QYXA 3E1GA 4ZYYA 1MXHA 2EKPA 1CIJA 3OE7D 3JAKB 4OJQA 3KLBA 2AIRA 3PQCA 3QUQA 5EHIA 1KY5A 4JBLA 3Q1LA 1IN1A 3AIIA 3QBTA 3IUEA 4HB4A 4RKQA 1FU8A 2WAAA 5L3QB 1RMQA 2B7LA 2LIPA 3BRWD 1XKTA 2C04A 3PVSA 1ZNZA 1JA9A 1V5WA 2AT1A 1L7PA 2XBLA 2YQZA 4RK0A 2X58A 4YRGA 5IULC 1IMJA 1QRTA 2YZGA 3L1HA 3R3XA 2YOFA 2O4UX 3VZRA 4Y2YA 4Z53A 2H2GA 1VM6A 5CLJA 3BK2A 4JVNA 4CXMA 4OPMA 4DPKA 1ZNXA 3RRMA 2QLFA 1O54A 3HU2A 1K6IA 1FNCA 1KI7A 4PBTA 4TWAA 5E1OA 2ZRPA 4J4BA 1PKXA 4NDAA 4XVQA 4NBVA 1ZUNA 4ENTA 3L1VA 1IOWA 4C20A 1SOAA 2Z57A 2I71A 2PH1A 3DPUA 4HWGA 3MD0A 4KXYA 5AJXA 3SSOA 4N5HX 2J3JA 3PNMA 1JXQA 1KDOA 4P4GA 3USZA 1ND5A 2IS2A 1GZ5A 4D2IA 3IQGX 2Q1UA 2PKRA 3HCNA 3DMNA 3KSUA 3KZKA 4AG3A 4CR8A 1PX0A 5KWJA 2VWHA 4IICA 4F45A 1HLDA 5JEDA 2OESA 1MO4A 2AQ8A 3KELA 1QH8A 2WNHA 4GGPA 1DX6A 4NMLA 4B35A 3T3IA 2Q3CA 1N3YA 2BI8A 3RVLA 4EFDA 1SKYE 3Q7TA 1Q17A 2JAQA 3JD4A 4DMGA 1SZCA 5THKA 2Q1SA 4ZZ0A 1UKYA 4PQGA 4KZKA 2BCGY 3GRFA 1F3OA 3AG5A 3EW9A 3I9NA 3TJZA 4EGFA 3G6KA 1TE2A 2WVAA 5K3DA 2CK3D 4LXGA 3ZW8A 2C9YA 1EX1A 3FOFC 1Q7BA 1AKEA 4L22A 4POAA 4YRDA 3TL2A 1QKJA 3RSSA 2HF2A 4GEGA 1T9BA 1Y6RA 1T5DX 2IYRA 3EAFA 1DKQA 3GGDA 1A88A 3CF0A 4LN1A 4OHRA 2XNJA 3D3JA 3U4GA 4EVSA 1K2VN 1NVDA 3CNHA 3DMGA 4LE0A 3HDTA 2XOKD 5EKUA 4CZ2A 3L7DA 4UCXA 2YXBA 1G0NA 3H4IA 3C5WP 2Q29A 3QE4A 4FNMA 4QYSA 4C6RA 5K0NA 3C3EA 3TTTA 3VNAA 4FQ7A 2O7NA 3T3EA 4DC9A 3ADBA 4CEHA 4ILEA 2MYPA 2HK8A 3C43A 3FTCA 3I01M 3MXOA 2KB0A 4HG2A 4PGHA 4XA8A 1Q1AA 1TGYA 2GBPA 1PTJA 1SM4A 3A1FA 3L7MA 3O9ZA 4HAVA 4HEJA 4X93A 4MSUA 1JDBC 1SCUB 2EJCA 1TJ4A 2H1RA 4ZPJA 4YT8A 3E9NA 2CUNA 1X14A 1C5KA 2X0KA 1B8PA 3WXBA 1R15A 2P9ZA 2J09A 1Z5VA 3VDQA 4C6TA 2AMFA 5KS2A 4F5EA 2I7VA 3DKKA 1IYZA 4FD2A 1K27A 4D8WA 1MVOA 1IWPB 1WLSA 2JBAA 3V4FA 3B5EA 1YOBA 3IV9A 4FXOA 4LHZA 3QVSA 4GXQA 1DIGA 4BNDA 1XZDA 1JEOA 4D9CA 3EGXA 1IM8A 2GESA 9MHTA 3GFQA 4C5CA 1UR5A 3S27A 1B23P 1V9LA 2R6HA 2J4CA 3GLSA 4R16A 5BNWA 3A1WA 5EN4A 3N6RA 2XRFA 2WJHA 2WRZA 3KR2A 1QJ4A 3G6WA 3VU9B 4KNYA 5K1ZA 4RANA 1XMSA 1NFQA 3RPEA 4KQIA 3UG7A 3ZJYA 2Y6UA 5T6MA 2FPIB 3DFZA 1FVOA 5JSZB 5K0JA 3OTOB 1NURA 1BKYA 2JCGA 5LQCA 2REQA 1K7SN 4B3HA 4ER7A 2A4MA 1YJXA 1LSUA 3HC7A 2XYGA 4FZ3A 3BOSA 1GKUB 2J45A 2ZWPA 3U1VA 4QOGA 1JQ5A 1S1CA 3P2MA 2YZNA 4DLKA 4BNNA 2G6TA 3RUHA 2PT5A 3BWCA 2PKYX 1GKLA 4O4JA 2FR0A 3GLGE 2DT8A 5BT9A 4JZKA 1AK1A 5CK4A 4HN4B 3OHSX 1JXOA 1Z45A 4L0MA 4FIZA 1UXJA 5GVRA 1O94A 4O4LB 1BOOA 1PX2A 4KQ6A 4B3FX 2H2FA 4MA0A 1L7MA 5I3CA 3T7JA 3UAWA 3MAGA 4IWNA 1I7DA 5J23A 2XIJA 1FBNA 3U3MA 2FWAA 1I24A 2OKGA 3PDHA 4IGIA 3VR3A 4QOHA 1IN8A 2IYLD 2QRVA 4M0LA 4MW7A 3QKIA 1QR2A 4MMZB 4OQEA 2HXGA 4WV3A 2X4GA 3DDOA 4AZTA 4H6XA 2CUTA 3DWIA 3WLQA 5H9WA 3RYCA 4IFEA 4IH9A 4OYYA 1J33A 2WJJA 3FLAA 4KV7A 4M37A 3GF4A 4C9BA 1IZ8A 2VK8A 1ID1A 1G5IA 2AWNA 2G0TA 4LRQA 4OK5A 3CB2A 1UBCA 2X9QA 2OQVA 3W9YA 1RQLA 3QV1A 4KU4A 2WJIA 3FVWA 1R6TA 5B3AA 1HMPA 2YWDA 3H99A 4Q48A 1BMQA 3HGMA 1H3FA 1TECE 3VKHA 2I8LA 3WGVA 2VDUE 5E3HA 2BE9A 1QGED 1VDZA 3FPEA 3C6MA 4LWZA 1Z4KA 3VO8A 4FLMA 5EXDA 2BGIA 3CONA 2CXSA 1V1JA 3KFXA 3UAZA 1CUHA 5BSVA 4X62B 4IIJB 2QK4A 1OZHA 4DDWA 2WUGA 4W5OA 4G89A 4JX8A 3OX2A 3M4YA 2QSJA 2E82A 1RRKA 1RZ3A 5D2CA 1BVYF 1VL2A 1FP2A 4FMPA 4J6FA 3W3AH 4CEJA 4WKNA 5GY7A 3VDNB 3U44A 3HA3A 4PYIA 1XDDA 1ZK0A 3MLBA 5FAXA 3ZQ4A 5CXUA 3TBKA 2YC4C 5HIAA 3GV0A 1PL7A 1GNPA 1XCLA 1P3DA 1X7DA 4P7KA 1RCTE 4U9IS 2Z9DA 1VLJA 2C9MA 3WSTA 2GXAA 3FPKA 4BRZA 4IO0A 2J5XA 3CWZA 3L8EA 3O2SB 2NO7A 1WBBA 1QV6A 3HWRA 4G01B 2XUKA 2XYRA 1ABEA 5FBWB 2Y9PB 1MJFA 3KB2A 2XCRB 3ANYB 4CEHB 2ZBDA 1TRKA 3WLRA 1IUOA 2XB4A 2GRUA 1YF3A 1JXAA 2QZ4A 2I3BA 3NR2A 1JHMA 4L6AA 4OP1A 4PCVA 4Q37A 1FEZA 5EJFA 1H2HA 2ZANA 3DXZA 4MNTA 1N2JA 3UUGA 2CHFA 1VIDA 5F5LA 3QOFA 4G23A 1YI0A 4P58A 5L53A 1E0AA 1ST2A 2V96A 4C6TB 1G8FA 5ENVA 5FLYA 5J40A 4LHXA 2VBGA 3SZUA 1PGJA 2XI4A 1XMJA 4MQUA 3CIOA 1TOAA 2JZNA 3NETA 4NC9A 5I9BA 4BQEA 1U04A 5T8KC 3DYBA 3SPXA 1GZVA 4I9GA 2EJBA 2FSSA 4QLBA 1FUYB 1CJSA 4P7FA 5IF9A 2EIXA 3THYB 3EGXB 1PT5A 2JAXA 1KMNA 3IKTA 4REOA 1FFYA 3VR1A 5F98A 3B60A 2IHNA 2O19A 4URXR 5A6SA 1ZKDA 5KTPA 5GINE 3U5ZB 4G5QA 3NEJA 4AZSA 1CQZA 1OROA 1XWWA 1AS3A 1UWLA 2VZEA 1GZ6A 1P5FA 1XVUA 3BSYA 5H02A 1XIVA 4UM8B 2VEOA 3OE7A 5FI1B 2F3RA 2CHQA 3A6HA 4RMIA 3R9KA 4KO1S 3G88A 1YBFA 4QT0A 4P7BA 1C7EA 4OBWA 2REQB 4FDMA 4XI9A 4FOLA 5IP5A 1JSRA 1MGOA 1OY1A 3UPUA 3BRWA 3T15A 3P0RA 3K2BA 3NXKA 4POOA 4OOFA 3TM4A 3H5NA 2HPAA 1DCKA 2Z2YA 1T4DA 3FYHA 1P4JA 1ZZEA 4B81A 4BHTA 3EHEA 3I61A 2W43A 1V6CA 1P0FA 2AQIA 4L0QA 1U8UA 4JUBA 1R9NA 1NQWA 1SHZA 2RGBA 1SKAA 1USVA 1Y1TA 2QWXA 1RYNA 2BISA 1KH1A 3CWQA 1DIRA 1TK2A 3AH8A 3ENKA 4GVLA 2AKYA 2OZPA 3O83A 3QNWA 4INOA 3DO8A 1XTBA 3QPVA 1UUFA 4MCIA 4MJLA 2FVYA 4PGFA 4K9DA 4AKEA 1KL7A 2QUBA 4EUEA 2EXXA 4MAMA 1ADYA 3IRUA 4OQXA 4AS3A 3JQ6A 5CA1F 2X1LA 4PX3A 1RXYA 1ZS9A 3P1JA 1TO6A 3UT6A 4BQIA 5AVSA 4OUDA 3K0SA 4DKJA 3D7RA 2YV2A 3DMTA 1XQ6A 3LBYA 1KZ9A 1YGPA 1F8FA 1GRCA 1T5SA 1YQUA 1A72A 4GECA 4NNPA 2XZDA 2OM2A 5CA0A 1U2TA 1FS4A 2GFQA 5HJ5A 3WO1A 3NC0C 2RHLA 4J1SA 4YAGA 4Z5XA 2PMCA 2Q07A 2E4VA 4ZARA 3PFKA 4L50A 2J3MA 4MQLA 5FIUA 4GXRA 2FEXA 5HE9A 4DWVA 5LIPA 5CCDA 5L7YA 1H5NA 2FZ5A 3A3YA 4YREA 5E7MA 5JS6A 3EVCA 4ON9A 3LZ6A 2CK3A 4R9NA 2HI0A 4M4SA 4L85A 4AAYA 3O4RA 4Q18A 4YA6A 2HKIA 2B8NA 4IXNA 4YJGA 1G8PA 1W4ZA 1C1XA 1LY1A 2YFQA 2I1VB 1QYCA 2COEA 4JIMA 2VHZA 3BDVA 4B4VA 3LTNC 1NI4A 4RQBA 2OA0A 2ILVA 2XOKA 1AUVA 1Y5IA 3UWKA 5EEHA 1J0DA 2WZBA 2YWHA 4WNCA 3QF4B 3ZC3A 1K5HA 4BFTA 1PFKA 2CVZA 3PL5A 4R2LA 2WPDD 3E3MA 3U7RA 4MGYR 3WDMA 3RSGA 3WX0A 1EHCA 4UCQA 1ZH0A 1EIZA 2A0WA 1N5JA 2P35A 3BHIA 3JQAB 4M38A 3A7DA 4AMZA 5H59A 4QZVA 3LGAA 3PICA 1YS4A 2V7XA 3OF5A 5DX1A 4YAUA 1XRMA 4OY3A 1YJBA 2B4KA 2XA1A 3MOIA 3DVAA 3FBTA 3RFUA 1SNYA 1J8QA 5TVKA 4TMWA 1QO9A 4ZT4A 1I7PA 3NBFA 5C5IA 1G0OA 3CIFA 1E99A 5AI9A 1Q0QA 2WIAA 1G3RA 3FNIA 2CNNA 3T1OA 4OLAA 2V0CA 3ZE0B 4BO8A 4EG6A 2R8ZA 4LRXA 3I9KA 1GUYA 4W5TA 1E9SA 1YRHA 1FVFA 2XD9A 3JPWA 3TD9A 4LBYA 4KE9A 2BGWA 2QI9F 4B32A 4JYAB 5LR6A 4GOXA 3WRYA 2D1SA 2FWMX 3N2GA 1U31A 4G8DA 5LYJA 3KNZA 5P21A 2A78A 1UZMA 2Z83A 3EIEA 5EZYB 3G8YA 1SC9A 1ZCFA 2ZUCA 3B89A 4N0DA 3QVLA 4BNXA 1Y8RA 2A9KA 3FF4A 1U8AA 1K5GA 3LSYA 4PRKA 1CNEA 2W2KA 1GHTA 1JLKA 3HDHA 2NW6A 4RK7A 4RSGA 1GL6A 4XB1A 4QT4A 1QKIA 5JNLA 3V4ZA 1T2VA 2WKRA 2QUAA 5EP1A 1FDTA 1V35A 4OL0A 3Q0EA 2PMWB 3O92A 1XN1A 4HYEA 2ZSKA 1MX3A 3G0IA 1JDZA 1OBCA 2EZ8A 4I81A 1TEZA 4LDPA 4E32A 1WMAA 1WMEA 3V00A 1Y8AA 3S5UA 2VPIA 3NONA 2QNIA 4IXDA 2IEDA 1GPKA 1HURA 3WWDA 4X5OA 1DT3A 4F6LA 2IY7A 1NJGA 4HXGA 2GZ1A 2MT9A 3JRWA 1WU8A 1DBIA 3JSXA 3EZGA 3Q15C 4XUCA 4WZBB 5AW5A 2I76A 3D5EA 2AG8A 3TQCA 6REQA 4DT1B 4UEOA 3P19A 4E5MA 4FCWA 1Y8QA 5LLTA 1KFJB 3RS4A 1LI4A 4IFIA 1UBHS 1H69A 1JEAA 4MQEA 3EVEA 4ZAZA 2J59A 4MARA 4QUKA 4WBXC 3W34A 3KU1A 4M1TA 4CMGA 1UT8A 2N9UA 1IM2A 2W98A 3OKPA 3ZWVA 1W85A 4REMA 1ZICA 3CZCA 3WYAA 4KQWA 4NBUA 1SG0A 2W4IA 2VAPA 1GGKA 4HCJA 4HGZA 3IOBA 3X1MA 4FBMA 3GT4A 4KG7A 4NMXB 1O96B 1RJEA 1ISMA 1OMOA 3E9CA 1MAAA 3LL4A 3OQIA 4G5HA 2AK2A 1FE8A 1ZG3A 3GBVA 4RY0A 5CUQA 5CIYA 1S2IA 3GBSA 3F47A 4QPZA 5IM4A 3LBNA 1RACA 1U9ZA 3KAQA 2NSHA 3E5NA 3UIEA 1H2AS 1EP3B 1FZTA 3TOSA 5L95A 2W2MA 2NZ8A 4YCAA 1PWEA 1ZCJA 3AU9A 2I1WA 2HO5A 3V4PB 3R2JA 1V1MB 3OCUA 3H5LA 1E5LA 3OESA 4J7CA 4FGZA 4RGQA 3F1LA 4ZAWA 4RMNA 2HQSA 4C7XA 4NBKA 3L6BA 4C4OA 3NDBB 1G8KA 4MKXA 2DWUA 2H8GA 2QG6A 4NV3A 4YN3A 4IXWA 1XZNA 4EJMA 5EPUA 5I4IA 4GRAA 1GA1A 2IUFA 3WDSA 1X80A 2P5SA 4QTZA 4EOGA 3D59A 3L05A 4YJGB 1CK4A 3RUDA 3U3DA 1DTWA 1BEZA 1WDMA 3D7LA 1QHHB 3U0BA 5FR1A 2KHZA 5E2BA 3DZ8A 4M9CA 4AW9A 1NI4B 3CVXA 1GAXA 4P32A 4EY3A 3FMVA 1AKTA 4LXHA 2ZT6A 3PGXA 1SQ6A 4H1HA 5AUPB 3B1YA 3N6XA 1XNRB 3RT9A 2FWIA 4WKCA 3SMVA 4OUKX 3TSYA 4GMGA 5F12A 4ZKEA 1PJ2A 3BJIC 4G0UA 1S5PA 2GEVA 1ZEMA 4YLYA 1FFXA 1JUDA 3H97A 4LJ7A 4WCFB 3OIYA 4BKPA 1BWRA 4DCGA 1DG1G 2BM0A 3K2EA 1RCFA 4HX5A 3P7MA 2W9XA 2GI4A 2R00A 3R5TA 1R4NA 4GPEA 4YAFA 2FJ0A 3NTQA 5EE1A 4LUCA 4DA6A 1FLDA 4MP8A 1QYVA 1YA6A 2JJ8A 1YDWA 2HJHA 1Q3HA 3S68A 3K6RA 5EWLA 3GLIB 1OHHA 1XTVA 2E85A 4NENB 3QLTA 2ZJ2A 4G0WA 4BTVA 3WLSA 1NUQA 1AUPA 3FHCB 1DXQA 1FDRA 2J87A 3S8MA 2PZBA 4DJJA 2HIMA 2H0RA 4PC7A 3VTZA 2RIRA 1JIIA 4DABA 1J21A 4JQOA 5G3ZA 5LYJB 1M0TA 3K0FB 4QUGA 4LHVA 1ODJA 1UXKA 1CZHA 3FSEA 1ADBA 2Y2VA 3LLMA 5U9CA 1VI6A 3Q10A 4I7EA 1GDTA 1FVHA 2WINI 2ZUDA 3GLHA 1Z25A 2G70A 1M2OA 3X1YA 2OILA 3GAZA 1T2CA 1JECA 3R24A 4E7PA 2WVHA 4YCMA 3GMSA 3MTEA 3OIVA 3N70A 2JFYA 2GN1A 1T9HA 4NH0A 2H4FA 3MCWA 3L77A 2JLQA 1QG6A 1GAEO 3G79A 1QQAA 2XVXA 1TL7C 3O73A 1TM4E 1KQNA 2CXRA 4N3CA 3G2JA 4YDRA 1VMDA 4ZU3A 1KF0A 1NIJA 3AF2A 4JT4A 1QAMA 1J49A 2L2QA 3H8WA 3MRVA 4R5HA 3TKAA 4EHFA 5KZMB 5KYUB 2EATA 3RBZA 1SUFA 4J9UE 2WQ6A 1LTHR 1QCCA 4M9ZA 1DKUA 1GYPA 2BEJA 1Y8QB 3QHQA 3U4AA 5I7WA 3A1SA 3K8OE 5CX4A 1G6HA 1IM5A 5A06A 2Z5GA 4AN4A 2VXYA 3TNFA 3MBKA 1S02A 2XQFA 3E58A 3RS9A 2E48A 3WHIA 2HLDA 1UBNA 2XVZA 1BE8A 3WLEA 2YWCA 1EZ4A 3DMDA 2Q62A 3T1TA 2CFSA 1WSBA 2O2GA 3RUCA 3OBIA 1EK1A 3TTVA 3WB1A 3CW8X 5D5HA 2V0GA 4K9RA 4Q4JA 4B2LA 4EHBA 2H4ZA 2LNDA 2XUQA 3OZUA 3PYMA 4M7OA 3NVKI 1PNTA 2FWRA 3D0OA 3Q9UA 1Z68A 2F8MA 3U4MA 1SBYA 1ADJA 1SEPA 4MZDA 2JGNA 5ALLA 3WIOA 4F71A 3STXA 3ZY3A 1Y4SA 5DNYB 5CMLA 3N76A 3HJAA 4XX1A 1RQRA 2XT0A 1CJBA 3IPRA 1VKZA 1ZQ1A 3DLAA 3FWNA 5JS2A 1II8B 2ZAMA 4A0GA 4EUKA 4HOYA 4FYWA 1Q3TA 4K88A 2NUAA 4BMOB 4K9MA 3G2HA 3DJFA 4X9XA 4F4HA 4MUHA 1P74A 3CRNA 4A2QA 4ENWA 2C7BA 2DY1A 3QVGA 2KS6A 4LJ4A 4W5HA 1M8KA 4XPIA 2DJ5A 1JDSA 3TLXA 2CLKB 2OEPA 4ISBA 4EFLA 4FEYA 4FEEA 1EFUA 4XJSA 2QSYA 3KAJA 5ERYA 1N7HA 1BRTA 1ZW1A 2DFLA 2PGJA 1A2KC 1CF2O 1V0JA 2WPDA 3G85A 3LXUX 4MO2A 4DQUA 5EJ7A 4FNAA 2H63A 5DOZA 4PC3A 1MOSA 3QIVA 3GXOA 2EERA 3M1IA 3ICPA 3JATA 3DKVA 2WJYA 3R6LA 2QYHA 4OHUA 2VH2A 2PIDA 1FIUA 1O57A 1FDOA 1NIPA 3UK6A 3LDGA 5DXAA 2OR3A 4TMYA 3KQNA 3OOYA 2ZRBA 3NP9A 4JKOA 3E2IA 1WD5A 4QARA 3HDJA 4DMFA 5THQA 2E37A 4I14A 3CPJB 4HP8A 2GAIA 4JR0A 2SNIE 2CLEB 1WXWA 2VJOA 1GCGA 1ORRA 3OLZA 3IDOA 3R3YA 3EQ2A 1RZVA 4KX5A 3U2QA 4EKYA 1N6OA 5ER9A 1NG1A 2CXUA 2HTFA 3K0KA 3C3CA 5EA2A 5C5EA 3PA8A 4YAEA 3ROQA 2IW3A 1V37A 1KYYA 5H83A 2WUEA 4Q4CA 2GZAA 1ESZA 4RA9B 4WKPA 1FFSA 2XZPA 5HJEA 1DBSA 1VGRA 5AKXA 4D46A 1JX6A 1SOUA 1GG2A 3D2AA 2WBLC 3JRXA 4AS2A 4B33A 1QV9A 3FKSD 4EI2A 2W2LD 2PLNA 2VJMB 3AQIA 3GDFA 1RP7A 3GMIA 3H11B 5KQSA 8ABPA 3T7CA 2NO9A 5CEEA 1S01A 1XAIA 4AJ1A 3VO1A 4J90A 4FBLA 4QQRA 2GS9A 1NJ1A 4WADA 3K9FC 4D5EA 4H2DA 3K0BA 1TVMA 1BRMA 1WCIA 3FZQA 4OHOA 1K7CA 1OBVA 1M1XB 3H9UA 2GZDA 4G5GA 4AKTA 1ZN9A 1RZUA 4IINA 3TRHA 4CKZA 3JD1A 4H6PA 3JV7A 3TL3A 5KDOA 1EGQA 4EKIA 2X22A 2O48X 1Z6ZA 2CV0A 1NBEA 4TRNA 5CBPA 1BC5A 1M2OB 2AEMA 2HSEA 4DR7B 1T1JA 3UGQA 1J39A 1CVRA 4FCCA 3T0IA 5EIEA 2R4TA 5IWCA 2V5VA 1GNSA 3FXAA 5JMOA 3A9RA 3TW0A 5FO1A 1A7AA 3PHJA 1AQUA 2Y1FA 3FZGA 3IUSA 2PEZA 3NKFA 4LY0A 5LB4A 2EBHX 4CMHA 1HDXA 2C7RA 1ZRMA 3WGJA 1RAHA 4DW8A 4HGPA 3OAAD 2AR7A 4URYR 3KTOA 2FWPA 2R8PA 1NPTO 4IDBA 5DWDA 4JL8A 4IAOA 4O63O 2ZRDA 3SLGA 5CDTA 5EJEA 1CJKC 7AT1A 1VL0A 4RVUA 4GD3Q 1OX5A 2W42A 1GZSA 1OLSA 3H04A 2HIGA 3GRAA 1P91A 4Z9XA 2ZVJA 2VYNA 1Z7YA 3RK0A 5HTOA 5KQPA 3PT5A 1IRXA 3GFPA 4YMWA 5G1PA 1CUDA 3SLKA 2HHHB 1LQUA 1MAVA 3KUUA 3MT8A 3RWMB 4BFSA 1GADO 3DNFA 3JQ9C 4I50F 4R0MA 1WF3A 1RKQA 4ND8A 3CU5A 3PC8C 4MGEA 4BAGA 3BX1A 3QG5A 4WFQA 1ZHFA 1C1DB 1TGVA 2BKAA 4LJ8A 5ESDA 4A10A 2JLXA 4X20B 1G7RA 1EXDA 1AM4D 2UU9B 5KI6A 5C51B 2VSNA 1TA4A 4FS3A 4QDXA 3K1AB 2QE6A 4MYRA 5K3OA 2Z2XA 2IQIA 3B9PA 2Z30A 3K0AA 2PQ6A 2PNFA 4UXHA 1M8PA 4NYJR 4TS4A 4DCSA 3K0HA 2I4IA 1GFZA 1K8QA 2A6PA 2VDJA 2H54A 2YY6A 2H2IA 3KPVA 4PZ9A 1JILA 5KWEA 3P0HA 2AK3A 4EKNB 2I34A 2A8YA 2FKNA 2WOJA 2ZSBA 5HCIA 3RAJA 3MJ4A 3RYTC 5LVAA 2XOXA 4Q47A 3QLEA 3H5AA 3NHRA 3KE8A 5KIAA 1U2DC 2IEZA 1N0IA 3PD0A 1U6JA 4YXFA 3DBOB 5SY9A 4XPIB 4XYLA 1KDPA 4Z7OB 2UXCB 1BH6A 3VYUB 2GNOA 4KIFA 5G41A 5JAOA 3DLPX 2DC1A 5FI0B 5FWXA 3A1CA 4R9SA 3P2EA 1NRIA 3IOCA 4NCHA 1TYZA 4MJ3A 4MEAA 2OZLB 3HSSA 1FDWA 4EW6A 2O8FB 2CXXA 4RESA 5EQDA 3IODA 4BEWA 2BONA 3O3MB 4MCAA 4AF6A 1HV8A 5BSGA 3O4IA 1DSSG 3Q5EA 8LDHA 1G1MA 3B1FA 5JH7A 3IALA 3KRTA 3QU4A 3I42A 1MRNA 4M89A 3WLPA 2F8SA 1OIWA 4BQNA 2IIBA 4J0QA 1WBJB 1SUBA 5ALWA 4CQJA 2PDAA 2FWBA 4X64B 3I9V1 1BHJA 5DYTA 1T4CA 5CB0A 4DLAA 1UWCA 3LBFA 2EW1A 1F2TA 1UZNA 5KEIA 4MLDA 4X1YA 2XSZD 1XJQA 1BXRA 3KPJA 3CH6A 1WXHA 3JQ8A 3OSUA 4WWHA 3SR0A 2XKBA 4MPRA 2JD1A 3ITDA 4E30A 3OQ6A 6Q21A 2HXSA 4BAUA 4ZZ2A 4N76A 4Q4AA 4FW8A 2WSBA 1E3MA 4Q34A 2RK6A 4A0RA 3LUPA 1W47A 3D4NA 3DW1X 1J42A 2PUGA 4IDFA 3DDWA 2ZAOA 2GERA 1KEUA 1UKAA 3OOJA 5AJUA 5BVHB 5LP1A 2X77A 4CBVA 3TVYA 4KI7A 2NYAA 3T3PB 3ZX5A 4ZZIA 2B69A 1K7EB 4DGQA 4TV8F 1PV2A 2ODEA 4GT1A 2HJSA 5AKZA 2CZQA 3ZWWA 4F5ZA 1P6QA 4ZYUA 1MVLA 3R0XA 1C7RA 1Z9BA 5JV5A 2G5CA 1E9VA 3R4CA 5KMGA 2ZSEA 4MTLA 4OB7A 2G67A 3BRQA 1NJ2A 2GJ4A 1RRCA 4J7UA 2P6OA 2BFNA 5TPWA 2A0FA 2V9ZA 2QN3A 1DEKA 1TCBA 1M6WA 2HTEA 3ILSA 4OK6A 4HNQA 3DE3X 2VQ6A 2D1QA 1XQ9A 2LPMA 3FYSA 4QUDA 2YCBA 1OKKA 5DISB 1IPEA 1SGWA 2YVQA 3IURA 3OF2A 4H31A 4M0CA 4EVRA 5C4IA 3PZRA 3AGQA 2H08A 3DXYA 1TA0A 3PA6A 3WC4A 1B3RA 2P8SA 3KKNA 3U4IA 1OX6A 3GPIA 3EXHC 2H3EA 1E8MA 1EESA 4GWKA 4TXLA 4FZJA 3L5OA 3ANLA 4FFBB 4RTNA 1TO2E 1RM0A 3OEWA 2O5RA 4H1UA 2HDOA 4R2IA 2Y92A 4ITUA 2B8JA 3OBBA 1HFJA 4ROSA 3O8RA 1WETA 1U28A 3SQWA 3WBBA 2G9VA 2P9BA 4WCVA 4FCVA 2QAGC 1N7JA 4TTSA 4GQBA 4YRMA 4YMHA 3O8LA 4KR3A 4MUKA 1AHHA 3DO6A 2AXNA 3OETA 2ZM5A 2N46A 2OXIA 5IANA 1IUNA 4ND8B 3Q8WA 3H7AA 3S7TA 3RWBA 3ZX4A 4OKSA 2QL7A 3WHLA 3RCBA 3R7WB 4BE7B 2P3LA 3UEOA 5FDFA 2TRSB 5AW3A 2B61A 1CSEE 4YLGA 1QLWA 2VA8A 3PXCX 4N41A 4INAA 8ADHA 3INRA 2O3QA 1FFHA 1LZKA 1OXMA 3CVUA 1SHUX 1SEVA 3AILA 2O07A 3ESDA 5ERXA 4F21A 4I9FA 4RIIA 2IH5A 1P5ZB 3AXSA 2MINA 4CF5A 4JQCA 2PLWA 3I2IA 3LA8A 3IDFA 2HJ9A 2H7YA 5J4KA 3BRSA 3PRYA 3SSAA 4GL2A 4C0JA 1P19A 1JQDA 1Y4ZA 2N1BA 3ZV4A 3RYFB 1U7WA 1V8BA 4JOCA 4D6YA 1I94B 1J8YF 4XLTA 3H17A 4YBRA 4MYTA 3UWDA 4MW1A 2BJHA 2HWUA 3OOEA 4Q1BA 4RUKA 1E3JA 4B34A 4PFQA 4EA7A 1N3LA 1UP6A 3E61A 2QLNA 3WB0A 4B76A 3OZEA 4GMDA 1ECPA 4KO4S 4D4IA 4Q7JB 3T5MA 3V4RA 2YWXA 5REQA 1C9DB 1VIAA 3B6EA 2QP3A 3E53A 1FS5A 1U0JA 4GOJA 5JH7B 2XXJA 4RXTA 4IHKA 4AP9A 4KQ2A 2XZTA 2RC6A 1U3CA 2ZK7A 3AL3A 3EC7A 3GDOA 3PX3A 4YCDA 3UTCA 4J0FA 4B74A 3L4EA 3JZFA 4IDOA 3CTPA 4M0UA 1Z4IA 2QD2A 2ZP1A 4JGBA 2YHSA 3LT4A 3P9ZA 5DGXA 5LBTA 4BPRA 4EHIA 4QM6A 4TUYF 1NF3A 1TEXA 2YFKA 1O6ZA 1HTWA 2I4NA 3DEHA 4QC2A 1Y82A 2RI6A 1JMVA 4PS0A 2BGGA 1U5AA 1Z18A 3QELA 4R0NA 2Q99A 3FKSA 4A5SA 2OLKA 4EAQA 3ZVKA 4PG5A 4OI1A 5HYVA 3JQ8B 4U7GA 5FUMA 5E4TA 4YP6A 2E5LB 1CZUA 2BEVA 2VDKB 3FFTA 2O5CA 3KYDA 1Q44A 3F5MA 2B0JA 2Y66A 5C1BA 2GWRA 2PKXA 2W48A 1I30A 3V7YA 5LQJA 3KWLA 1UBTS 3R6DA 1XZFA 2AWOA 2IEGA 4R7TA 5F52A 4CEIB 1T8WA 4I99A 4ZYZA 2J3LA 4EPXA 1Z6XA 4WZBE 1EFPB 3FOAA 5K0LA 4Z8YA 2QVYX 1M5TA 1H5QA 1KAHA 3A1TA 3LSTA 1AA6A 2H1VA 2O3JA 3G1WA 4COOA 1Q1NA 2C8KA 5FBZA 4Y9SA 4CM9A 1R66A 3ASVA 3KUXA 1XRRA 4UUMA 1QPGA 5G4LA 4JI5B 5JAIA 3HU3A 5KX5A 1W2HA 1MJGM 5FFFA 4MJXA 3RIGA 1I3OA 3WLIA 4PVDA 2C9OA 2OC4A 5C34B 1X7HA 1CR4A 4PTZA 1PEDA 3W5HA 3TS1A 3MJEA 5TSDA 5E7IA 3VSDA 3FYDA 2BBTA 4EZBA 5TR9A 3D8NA 2PZLA 3D02A 1S2LA 4TSFD 5J9FA 5LZ5A 4AUMA 4DEXA 1RQ7A 3T3MB 1Y0BA 2BM8A 2PU7A 2XMCA 3PVCA 1PW5A 1U3WA 5D5PA 1XTUA 5GQSA 1D6SA 3FCEA 1KY4A 2VTDA 1FMLA 1KQFA 4D25A 1BQ3A 1T6XA 4PAQA 1VKHA 3G49A 1G1AA 4DY4A 2BGLA 2BDUA 3KYCB 3CJQA 2DY0A 3DBHA 3DOFA 5CDUA 3A4LA 1HE3A 5BWCA 4IPTA 3I83A 4JAVC 2P2ZA 3VR5D 3PRKE 3I0ZA 4YP7A 4W5RA 1Q91A 3B48A 1W4RA 2WABA 1NKVA 4OFXA 2HNBA 2NX2A 1KAGA 1K7XB 2P6MA 2HZ7A 5AOBA 4DQDA 5B57C 4BY9E 3EVZA 1WQ4A 4GW3A 2Y0BA 4IQGA 4RD1A 4ABYA 1KGDA 2V7EA 4EENA 2AJLI 4KV9A 3AOEC 4TMXA 4D6PA 1XRLA 1AOXA 1TIKA 2HRRA 4EF4A 3SM9A 1NVBA 3BWBA 3I12A 5SYMA 1PJZA 1QYRA 1ZCZA 2QG9A 5EIOA 3O1LA 4XVHA 2ZSFA 2KBFA 2QD5A 3LQFA 1XPOA 1GZ3A 3Q87B 4AJLA 1AV6A 1RPAA 2OV3A 3UICA 4H7DA 1K7YA 3BYZA 3DBRA 2ZDGA 5A2QA 5JBNA 4DV6B 2O20A 4UHKA 3OQMA 1FQWA 1JS1X 1P61B 2FRDC 3SY8A 1ZIOA 2JARA 1O6BA 3D0KA 2B21A 3QLUC 3G17A 1F9AA 4EY4A 5DWQA 2IV7A 3KJEA 2Q0HA 1BWSA 1O0SA 2C5GA 1PS9A 2FMHA 3D3KA 1XL0A 2NTVA 2A84A 2QN8A 1NX9A 5EMLA 2H6EA 3LT0A 2ATVA 2V58A 4XGQA 3IQZA 2PJRA 1G8YA 4MLCA 4OXIA 4QELA 3UY4A 3A4TA 4W8GA 2W2XA 2YWEA 4IR7A 1QLJA 2WD8A 2I22A 2PRZA 3MRTA 1J2EA 4QNMA 4TKLA 2P9CA 2B92A 1JDPA 4QPPA 1LBQA 4KDCA 1NI5A 3EEYA 1EDBA 1G9XA 4IX9A 5SZIA 3MQFA 3C5EA 3OJLA 4WJLA 2C4VA 1RXIA 2PSHA 2HGSA 3ETNA 4AKSA 3GLIE 4Y6RA 5AM5A 2XXAB 2B4YA 4QOIA 1WXXA 4C03A 4E11A 5REQB 2AUMA 2TMYA 3V46A 2CLOB 2KE5A 2QTRA 1PUXA 1TADA 4LY3A 2OHXA 4BXOB 3OHPA 4AKHA 4TZTA 4C29A 1Z0ZA 2H5JA 4TKZA 1HSZA 3VOTA 5MHTA 2CNWD 4MQ5A 3JQEA 1RBQA 5BXQC 2IIPA 1ENOA 3GT0A 3UAOA 3AVXA 3EC2A 1VYHA 1AUOA 1P6UA 1NBHA 4OI0A 3V8NA 4NZZA 2WWWA 1IBLB 1LVUA 1K6MA 2IYZA 3PUYA 4Z7QB 2Z3ZA 3OM8A 1YH3A 2X0RA 2B1RA 3DT8A 3PFNA 4ITVA 4FFWA 1MA3A 1BZYA 1TNDA 3FMGA 1M8JA 5A3SA 4DIFA 2I6XA 2BEVB 3AR5A 3HXPA 4OAOA 3QFFA 4YP1A 3QNMA 3KYDB 3REOA 3V2GA 2I4TA 3GAAA 5B64A 2C3MA 1TXGA 1UFQA 2ZI7A 3DEKA 1VFPA 3NHFA 3CPEA 4FDAA 3AM1A 3IVAA 3EF1A 4BMPB 1HDOA 5BYAA 1XL1A 1WB5A 1NNLA 3ACDA 3BWVA 3OWOA 5FFMA 2J41A 3Q3EA 4JC5A 3DPIA 4PLFA 2W6QA 2DP4E 1E9EA 4R8VA 2PE5A 3IBYA 2DBYA 5IS2A 1QRDA 2XW6A 1QVZA 1UFRA 1R18A 1VGQA 3H83A 2IYNA 4L28A 4PF1A 3ZKAA 4AG5A 2FXIA 3FOEC 4JI1B 3HEAA 5HK8A 2HMAA 1X7WA 1H4TA 3BC1A 4LCJA 2CXOA 4Y6QA 3VC3A 1ZC4A 4L8YA 3QWFA 4TT8A 3VU8A 4EJSC 3M5CA 2P62A 4DCNA 4JT9A 2OG2A 1DC5A 4HLCA 4JY7A 4QO7A 5IWAB 4DRXA 1YMQA 4W1RA 5HMLA 2Y1DA 3WWPA 4EFKA 4LC9A 5B4TA 4QODA 5FOUA 1W4AA 4Z9YA 3EY9A 3JS5A 1KYIA 4HGQA 1PHPA 5HFNA 1N0WA 3BH7A 4KPFC 3DBHB 1PP4A 3GJ8A 5FTMA 1X8LA 5KHOC 2BHTA 1BE1A 1QC5A 1HE8B 4MWSA 4PGAA 5F51A 2IYOA 1JHQA 1XRJA 3CSUA 4NU5A 3E7PA 3HKEA 3R6GA 2C5AA 4NOJA 1F3LA 2Z56A 3DWFA 1W25A 4G07A 2GKSA 4P7JA 3TAHA 3HO1A 3B5JA 5TMBA 3KJXA 3INTA 1B15A 2QDXA 1NW8A 1RNLA 3P71T 3I5XA 2ZR8A 4R1LA 3NRBA 4ZFNA 5JYEA 1J97A 3ET4A 4OM7A 5DHRA 4X0EA 2IEYA 3WKAA 1CJVC 3D5QA 3WJAA 4A8JC 1PT8A 4WFKA 3FUTA 4LK3A 5CPFA 3IPAA 4EGCB 1K08A 5IBCA 5I9TA 2GEKA 1R6BX 2Y1GA 4M8KA 4ZAGA 1R6DA 1QQTA 3DBRB 4NV0A 3UAVA 3U7GA 1V3UA 2OFWA 4JDUA 1IOLA 1JQLB 2PAAA 3D6UA 2X7JA 2VJCA 3G23A 3TCNA 1JE0A 1YR3A 3ES9A 4EX6A 4GWGA 2QVXX 3IUNA 3JYOA 4DV2B 3AXTA 2HJRA 2ATIA 2OBBA 3ASUA 3THSA 3RYIB 2HIAA 3Q8XB 2G5PA 4I5DA 5TS3A 1AJEA 2J3QA 3KKQA 2BM9A 2O57A 1JZSA 1Q1GA 2V9PA 3SYTA 1IH8A 5IXYA 2WKSA 3SFTA 3SE0A 5K03A 2I4RA 5DHTA 2NXWA 3TZLA 5EQTA 1HE2A 3QMPA 4BZWA 5BQFA 2QROA 3AT1A 3T3HA 2V0NA 4BVAA 3EEBA 3AV0B 3HYNA 5K6AA 3S2GA 2BFFB 5K6TA 1YZGA 4QDTA 5B12A 3AEKB 4BV3A 1AIPA 2JVJA 4G0NA 2X6RA 3EDQA 1F12A 2OD7A 3SVLA 2XNSA 1QIMA 1AN0A 1Z26A 1SCDA 1MB9A 2W2QA 1SIOA 1MJHA 4NJOA 1YD7A 3WA6A 4C0QC 4JP1A 4YMTA 1U4NA 3EIXA 3IEUA 3M4XA 1PZNA 2ZIZA 2B4TO 2IW1A 3EGCA 4ZOCA 5GONF 2W70A 1W48A 3P32A 3KWMA 2EJTA 4O33A 4MAFA 1RJ9A 4X8MA 1MEEA 3BQ9A 1RLOA 1IRIA 3A58B 3M4NA 5FUYA 4BQRA 5HFJA 1NXQA 1JU9A 1SB9A 1AKUA 3KBOA 4P4UA 3T4UA 1SMKA 4XLLA 1M6HA 3W4IA 4BEBA 3GNQA 5AKGA 3CLSD 1V5EA 3K1TA 5JSFA 4X1OA 3AUSA 4MULA 1CP3A 1GPUA 1QANA 2QUIA 4NHOA 3N2YA 4YGYA 2YQ4A 5A3VA 3WDKA 4D9BA 1RXSA 3E03A 3BB4A 3K96A 4Q24A 4RFSB 1YRLA 4MVJF 3TMKA 2AC7A 1IZ7A 1HXHA 1NLZA 1E9BA 3N1UA 4L57A 3T54A 1ZC3A 3M9WA 4KXVA 2ETXA 4EHDA 4LNUA 1KQ3A 3BRCA 3PTZA 2OXEA 5DTIA 1FMFA 3H7IA 4TTVA 3SEFA 3KL4A 4NARA 4YJ3A 3IUYA 3II6X 4D82A 9ATCA 2OK7A 5AJYA 4RDHA 5K0CA 1K4MA 3K3PA 2R65A 1IY8A 3EZFA 8GPBA 1B74A 1SUDA 1D4FA 3OSZA 4GLJA 1Q1ZA 1E92A 2L0XA 3NC1C 4NX2A 4O4IA 4RWEA 2F9FA 4KQMA 4QQKA 2NO1A 2X3UA 3L02A 5JFGA 3CXUA 1OH6A 1IULA 4XTRA 3UJ8A 2RCNA 4V03A 1IJEA 4OFZA 3UAXA 3AY6A 3NAMA 3IB6A 1MO2A 1X7WB 2JFQA 2WFZA 3E8XA 1QZTA 3IMEA 3IPXA 4HAYA 4P82A 2VTBA 3VR5A 1NF2A 3WLLA 2ECPA 3WGTA 1ORVA 1R0WA 3CLKA 2WLSA 2DPYA 2QAIA 3L4JA 3DZIA 2CYAA 7REQA 4V02A 1K0UA 2O2HA 1K1EA 4MVWA 4DSNA 5HRAA 5LDDC 1DARA 4J29A 1WUKS 3LRTA 4IEIA 4K5QA 3ZHBA 3GWGA 4DB4A 3LUHA 5IMBA 4ZVNA 4MP6A 3PEFA 4IFBA 1KYTA 5L9AA 4GM4A 1YR2A 3VHLB 4EO4A 4LX0A 1GPDG 5DIZA 2BUAA 1ULSA 3H9EO 1U81A 4JQYA 5AVRA 5KVAA 2QYSA 2B94A 1DO0A 2DFVA 2R5WA 2YC2C 3ZEAA 1LQ2A 2HWXA 3IBCA 3RIHA 4O3MA 1NU6A 4RL6A 2PL3A 4YCJA 2QA5A 4LY9A 3AVWA 2JAPA 3DB1A 3KT6A 1CY1A 1A9OA 2VWPA 4QPNA 3H1GA 2YWGA 3OFVA 1U8TA 5DP1A 5C31A 2V7WA 2WAYA 1Z6YA 4F8JA 5HRUA 2I2FA 3HUFA 3C48A 3KTAA 3FVTA 1N2OA 1TMOA 2CFIA 1EFVA 1VE7A 2BT4A 4RKYA 2XCOA 1UC8A 3QTTA 2DQKA 2C9DA 2ZATA 1JWAB 1PG5A 3ECAA 3DBIA 3CLVA 3QJ5A 4DXDA 5A5GA 3K05A 2AMJA 2C88A 2Q4RA 5IVHA 2VDNB 3KJFA 4CF3A 1MABA 2GVDC 4QGGA 1XWFA 4JI3B 2XR1A 5A3RA 4X1KA 1SVMA 4ZVOA 5KNCH 1XD2B 4LGCA 4HH0A 4V1CA 4MR7A 4IS3A 5CDHA 1E2JA 2PWYA 1HNXB 4JLJA 1CRWG 2W8ZA 3AB8A 4ZQHA 3L0IB 5JALA 4QBKA 3B6MA 3D3EA 4UU7A 2KLHA 2A1UA 1VJ5A 4L0DA 4NWIA 4ZRMA 4DA0A 3BZBA 4IXMA 1WXDA 2UVPB 4YAWA 3Q6MA 1EQ2A 1Z0KA 4UBNA 4YPOA 3MVEA 1T24A 3NWOA 4S3MA 1I7LA 1CUVA 5CPBA 3I6BA 4XDGA 5AOAA 4RVCA 3TOZA 2ZYHA 1NV8A 3UH1A 4FR2A 4S35A 3FJYA 4D8YA 1R0LA 3UXYA 2IEAA 5JS1A 1QTRA 2CUZA 1QUEA 1DC8A 2ZUBA 2FGKA 4MI1A 2LDBA 3BHJA 1VCIA 1L4EA 4XIFA 2Z95A 1ZW6A 1DQYA 4TKUA 2CFCA 3LOQA 3L1UA 4DM3A 4Y2RA 2HW8A 5I45A 1YZTA 5IASA 3JYNA 4I1SA 2XNCA 1NQVA 3AKEA 1P45A 1QDEA 3UMSA 2DE0X 4EATA 4JITA 1SY7A 4MUAA 1FNNA 4KC0A 4RDXA 2QF7A 1L1FA 5TIIA 1HDYA 1WSWA 2V4UA 1A04A 1COWD 1W6RA 1JT2A 3C1TA 4HQ6A 2ZUSA 1CPYA 3KBBA 1N36B 1VB5A 2XUJA 1E3EA 4DANA 4PM4A 2BHRA 4ZMSA 1MC4A 2AEEA 5TY0A 4J0GA 2LKCA 4YFYA 3DZBA 3H5RA 1EQUA 2K2QB 3PYXA 4KWTA 4C7JA 1JL3A 3UATA 5DB4A 1GKYA 3TUJC 4INJA 1I9CA 2HWYA 2ZITA 4R1SA 5LA6A 5K8JB 1XNJA 1VPDA 1RYHA 3FX2A 4E2WA 2VRWA 4TT3D 3TZHA 2ZXUA 3DFFA 3DOHA 4ZQBA 1I36A 2V74B 3A6PC 4R54A 3O8OA 3TGPA 1KC3A 3FCAA 1OW3B 4LNUB 4NEQA 2NG1A 2QT9A 4Z7NB 1PT9A 4XQCA 5A4AA 4B7XA 1TYCA 2XDWA 5GMOA 4RENA 1Y7HA 3L5KA 2GSDA 4YJ3B 5EPOA 5I01A 1X1RA 3GW8A 3LVRE 4ZZ3A 3FCXA 1OAOA 2GYUA 2XCIA 3I04A 4CPDA 5DM2A 4EJ6A 3I37X 4O4IB 4EFMA 1XROA 2JI6A 4FU0A 1N2IA 4ZVKA 1TJPB 1I5OA 2RAUA 1QK3A 1TJYA 1JDUA 3PQDA 4ZDJA 1RIFA 1W44A 1T9DA 2ZBRA 4S05A 2IZ1A 4X65B 2VTBB 2WIKA 2ZRGA 3MCVA 4M54A 4MHOA 2EP8A 2HJWA 3LDAA 3ROFA 4F6RA 2GLTA 4IZOA 4LJ9A 4GPIB 4EP1A 1FUEA 5LOVA 5A9SA 3QRWA 1USKA 1ESNA 4P2GA 3KR9A 1L7EA 3V48A 3DDSA 1GGJA 1PI3A 1V8OA 1Q2UA 2H11A 3LX4A 2VPTA 5DBIA 1PK8A 1X8XA 2OK8A 5E8JA 1GTMA 5LQKA 1DUSA 2D62A 4QPCA 3REGA 4DAOA 4TM8A 4ZVPA