3PACA

Crystal structure of pdut a trimeric bacterial microcompartment protein with 4fe-4s cluster binding site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
SQAIGILELTSIAKGMEAGDAMLKSANVNLLVSKTICPGKFLLMLGGDVGAVQQAIATGTSLAGDMLVDSLVLPNIHASVLPAISGLNSVDKRQAVGIVETWSVAACICAADRAVKASNVTLVRVHMAFGIGGKCYMVVAGDVSDVNNAVTVASESAGEKGLLVYRSVIPRPHESMWRQMVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shell protein
publication title Structure of PduT, a trimeric bacterial microcompartment protein with a 4Fe-4S cluster-binding site
pubmed doi rcsb
source organism Citrobacter freundii
molecule tags Electron transport
total genus 52
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pacA02
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pacA01
3MPWA 3NGKA 3SSQA 3MPYA 4OLPA 3CIMA 4P2SA 4AXJA 2A10A 4PPDA 4AXIA 2EWHA 3DNCA 3I6PA 3NWGA 4OX7A 3N79A 2A18A 3I96A 3VCDA 4OX8A 5L38A 4OX6A 4RBVA 5DJBA 2G13A 3CGIA 3SSSA 3BN4A 4DDFA 4QIGA 4RBUA 2A1BA 4QIVA 3SSRA 3IA0A 3H8YA 3PACA 4QIFA 4QIEA 4P7VA 4LIWA 3DN9A 4OLOA 4RBTA 4P7TA
chains in the Genus database with same CATH superfamily
5C5JA 2RS8A 1FI4A 3JAMY 2BA9A 3T5KA 4A8MP 4FNHA 4NEYA 1TR0A 3SQOP 5U47A 3K5NA 2QV6A 5D0RA 2UU9F 4XO0A 1R6YA 2GAHC 2CA9A 2R7SA 1VQYA 1DURA 4ECXA 3LP2B 3GV5B 1URRA 3EVOA 4OHYA 4M1KA 3TZWA 2B9WA 5IM0A 1DJ0A 1KR4A 5I3UA 1TKZB 1S9GA 3EUNA 3OTDA 1B3TA 2R7XA 1JLCB 3PJ9A 2A3JA 4LF4F 1UPPA 4HKQA 3I82A 1QDUB 3UR0A 4B9NA 1M0SA 4A8FA 3OR1B 3SQGB 5F41A 5AE1A 5IC4B 2W9CB 3TQ1A 2RB7A 4OJHA 1N34F 5F8NA 1MMNA 5EWEA 1XMOJ 5C24B 1TK0A 2UUWA 3LWLA 3CWJA 4RNHA 3BO3A 5K9FA 4J91A 2LU2A 1TMJA 2B8PA 5HVHA 1MN7A 1XN9A 4OX7A 1RI7A 3HULA 4KYZA 3KMSA 2PE8A 4EBEA 1HMVA 1FJGJ 1N0UA 4DPXA 2VPXB 4D3HA 3VZHA 1XNQF 5J2QB 3K7RA 2NR0A 2HKEA 1IR0A 3R5CA 4JI8J 1FHTA 3IRXB 1JJ4A 2Q3PA 5DG8A 2H5JB 1FT8A 1JLFB 1WEYA 2MGZA 2W8KA 2A18A 2DGXA 3POTA 1H72C 3OR2B 1WTFA 3X3UA 2EPIA 3HFZB 3NXZA 3NEKA 4PPZA 4B3OA 1IUJA 5DDOC 1OY6A 1ELOA 2GAGC 2IIHA 2B7BB 2DNLA 2MYFA 2V5HG 3PACA 4QOTA 5DG9A 1SC4B 2CQIA 1FRHA 1W26A 2EI5A 2OI2A 4UW2A 4IO1A 3M8PB 2XMKA 4ANCA 1ZM2A 4U9RA 5KG7A 1S97A 4C8ZA 2RIJA 4ZPWR 2BKNA 1OQ6A 3FUYA 4U7UD 5AE2A 4K0KJ 2K7JA 1HW8A 3OQ2A 1SI9A 1SJ1A 3QQCD 2W1BA 1FKAF 4J7CA 1U02A 4LREA 1ZZNA 1R8HA 3M9OB 5AJ3J 2ILYA 3D1QA 4P2SA 2RKIB 2HBZB 2OPRB 1KWMA 2E9TA 3BDPA 3AY0A 4FS2A 2CQGA 3KLVA 1O8BA 2Y1IA 1CQNA 5EWGA 2AP6A 2YH1A 1S1TA 1E6VA 2YKAA 2B4VA 3CC4S 4DI6A 5HQMA 2DHXA 2DEIA 3BPSP 2DPJA 3M2VB 1LXJA 1UPMB 4ILLA 4EO6A 3QWPA 3KLHA 3DLHA 3N5FA 3BYPA 3VQTA 2NPIA 4K8RA 2BABA 3QWUA 5KFSA 4WFAQ 4C8YA 2IVMA 4HACA 2JJ4D 3E3XA 5K8PA 3KUHA 1BWVA 3C15B 4WYWA 1J5OB 3M8QB 1IWGA 2BEFA 3HHKA 2ASYA 3I4HX 1N36F 1R0CB 1JJ2R 2A2DA 2XZTB 3J7YI 3CT9A 3M2UA 2EBEA 2G2YA 4OI3A 1PO6A 3HDSA 1Q86T 1YBAA 1L3VA 1F2GA 4ZP9A 1NSPA 4IFYA 2M52A 2AYEA 2N4DA 3NMRA 1ULRA 3FVYA 4NLGA 4NI2B 4DX5A 2HWHA 2F9DA 1SV5A 2B5JB 1NPRA 3GV8B 2W4DA 3TAPA 3ETMA 5KFMA 1HR0J 1HD0A 2GHWA 3CPWR 4P2FA 3RGIA 5J1PA 3FEYB 4HI2A 2UV8G 2XHWA 4OYMA 1N33F 3QLHB 3DXSX 3N6MA 4LIRA 1FFWB 3PIPQ 2N82B 2EKYA 3ILIA 1AXQA 2UXBF 1IM6A 2RF2A 4OZNA 4CH1A 1TUWA 3K5MA 5A76A 2R8HA 3OL6A 2MB0B 2D3O1 1Y7PA 1RA6A 3M8WA 2PI4A 4ZDNA 2KXNB 2CNOB 3AJDA 5A6PA 1VQ9S 3I87A 4DV3F 4ZOSA 2UP1A 3RR7A 1JKHB 2DR5A 3W60A 3VAKA 1TFYA 3E01B 1YJWS 1TVRB 3PW5A 1IR2A 3PV8A 3OV7A 3H42A 1RT4A 3HFVA 2GX8A 2CDQA 1XQIA 5KFPA 1YK9A 2KL8A 5KFZA 2QFJA 2MMYA 3BGRB 2HNDB 2MJNA 1X7VA 4LF4J 4RBUA 5DLFA 1PJ5A 3IR7B 2JVRA 4DX8H 1VBZA 3PO4A 2ZH7A 3BH7B 2J0SD 2HHWA 4KO0A 4USJC 2IDLA 5KT5A 2V4QA 4ED5A 1U6BA 1N34J 1KBRA 4ZHRA 1U8WA 5HLFA 2I5JB 4DQPA 3Q22A 2FZCB 3TRGA 2VDIA 1T11A 1T7PA 1KQGB 2ADCA 4HTJA 2VG6B 1HBOA 4XPEA 2VKZG 5ETKA 3D9BA 3GU0A 2R7TA 1ZOTA 1NK6A 3SV4A 3CD5A 3VAIA 3CDWA 5FDLA 3IM9A 1RDRA 1HQUB 1XNQJ 3MPYA 6AT1B 3OSPA 2UVRA 1KS2A 4IQMA 1HNVA 1T9WA 2ZITA 4LMZA 4BBYA 1NPPA 4K4TA 2AKWB 4RU9A 5L9NA 3F41A 3M8SA 2DO4A 1NDPA 2EWHA 3UN5A 1FRMA 2BANB 3D4JA 2OPPA 4ETXA 3DLEB 2OMOA 1OY8A 1RHKB 3OVSA 2QYCA 2DO0A 4LFCJ 2OELA 4F36A 1O6XA 3NAHA 3ILOA 3TZXA 3KLIB 2ACYA 2MZTA 2MLXA 1YI2S 2QN6B 3SEOA 4NX9A 3LP1A 4A46A 5JXSA 2YKMB 5F9NA 2OD4A 4OX8A 5GAEU 3PVXA 2F40A 2V4JB 3H59A 3MECB 1PKUA 2HWIA 2ZH2A 3DYAA 2RDDA 5AXNA 3V6DB 3MMCB 2IBKA 3T41A 5IXUA 3G82A 3A8KA 2PFFB 3NWRA 1HA1A 4NOHA 3BGOP 3OJSA 1QJHA 3NBPA 2WBMA 2HFZA 1QD1A 3A4TA 3I56S 3KHHA 3OTBA 4JV5F 1VMBA 4FYDA 5KFYA 2FC8A 3T1YJ 1HWJA 3K59A 2VBZA 1FERA 2OP5A 1RTIA 1SH2A 4USUA 2R7RA 3R7BB 1HWLA 3LPYA 1SIWB 3EXYA 1F9HA 2D1CA 4WYLA 2WVBA 1LWCB 2XY5A 2OJ3A 2HNYB 4KHMA 1AYEA 3P3DA 4JI2F 3AH6A 4Z7CA 2VUGA 1CULB 2BJ8A 1F60B 2OEKA 3ICLA 5HMXA 2AYGA 3KJVB 1N36J 1YQHA 1GNKA 3ETOA 1Q7LB 3TP2A 5BYRA 3U1NA 4YMEA 5CA5A 4I64A 2J9DE 4HEA9 1R8AA 1XR7A 3DN9A 4KJIA 3WZ0A 2XMJA 4JI7F 2XMVA 3CIMA 2L9NA 5K8OA 3HO1A 4JI5F 1ROFA 1NK5A 5ITHA 3MM5B 4ZPBA 3FCHA 1VR6A 2VF3A 2VU5A 1V5VA 1PJ7A 1R31A 2ATLA 4H4KA 1YRUA 2B4PA 4AXIA 2QLWA 2FVQA 1U0HA 1L3UA 1N33J 1T8EA 4OYAA 1F0XA 3QPIA 2M8HA 2UXBJ 4WZQA 1F3VA 3IG1A 4DN9A 2RVJA 4FKYA 2E1MC 2E7WA 5ETOA 4Q0BA 1KNZA 4Z37A 3TVZA 1JXLA 4RW8B 1HNIA 4DS5A 5HBMA 2K1RA 4U95A 2GVZA 4QCLA 2V6AA 4L73A 3PNIA 2CNLB 2D7SA 2HPUA 2DTJA 2NXJA 4YDDB 4DL2A 1JLGA 2ROEA 4Y34A 4UT4A 1AUSL 1JWWA 3NAIA 1UW9A 3A3PB 1BQNA 1SL2A 5KG3A 1UJ4A 1UAWA 3KFWX 2BE2A 3KLGA 2BOPA 2BDPA 2V2ZA 3JSMA 2XGPA 4HL9A 4FXVA 3HHLB 1XJWB 1WKLA 1VDHA 3CDUA 1SJQA 2HGLA 2FGOA 2PMZD 4AT1B 3GSDA 3LF0A 3MM7B 2ZZNA 1CBKA 3TOQA 2BRLA 3BJYA 3MCOA 2PMHA 4RW6B 2ZC4A 3PYEA 4PPDA 1KKHA 4C0HA 4WCEQ 2P9GA 4ICLB 3KDOA 2IMWP 1SC6A 2MY7A 4EZ6A 3W62A 1WACA 5LJ3Y 5KT2A 3SDEA 4FYXB 5CYMB 1FFSB 3FMWA 1UWBB 2BJ7A 3THPA 2JLGA 3OPKA 3JXOA 2HFNA 3TUPA 2DRBA 1YRXA 3TEGA 4CH7A 1WC0A 4F02A 2QMWA 4OZ3A 4GKKF 2CPIA 3LP0B 3I5AA 3H40A 1NCLA 4B3SF 3BSOA 4ZP6A 4DLGA 3C3LA 1VQLS 3HD2A 2KT2A 4YDXA 2XGQA 2EFOA 1YJUA 3TO8A 3NOCA 1U2FA 3ILLA 1NXIA 3CCVS 1CJTA 2RQ4A 4DG1B 3S7RA 4D3GA 3UE2A 1KQFB 5HJYA 4DCJB 1YBUA 2UUBF 3NS5A 3ISND 3FBBA 2DB1A 1RTZA 1OPIA 2PA8D 5HP1A 1VJWA 2FGCA 4DBQA 2JL9A 5A8RA 2CAJA 3N4WA 4J9KA 5DS7A 2M70A 4J9MA 1CJVA 1D0EA 4UY8T 3GYGA 3NMAA 4RWXA 1Q78A 4U96A 1UVIA 1C1CA 1NAQA 2KG0A 2V4RA 1LNQA 1TAQA 4WE1B 4HHHA 4DFKA 4YHHF 3K5OA 5J2MB 4NXNF 2GIQA 2JH3A 2I2YA 4X4UA 1B0PA 2LU1A 1ZTWA 1R0AB 4G6VB 1ACMB 1EETB 1MW7A 2OPSB 2QL7B 3OL8A 2ZBPA 1U0SA 4C8KA 4DXLA 2R7QA 3DGPA 4FBTA 5LMUF 5ETMA 3D6FB 5C42B 5J2NB 2E7VA 4MK8A 3IC1A 4FZVA 3MR7A 3Q8UA 1IKYA 4MT1A 4DR6F 1SPBP 2IA6A 4C8MA 2RRBA 1HFEL 2AX1A 2BXJA 1Y9OA 1VJQA 3H4DA 3B4MA 5AXLA 2BRKA 2H1YA 3DMJA 8RUCA 4RNNA 2GVDA 4JI2J 3FZ2A 2CZ9A 1IKWA 3QGGA 1UEKA 3M1VB 4I56A 4WF9Q 5HK4A 1LWFA 2YWFA 1XK8A 3W2VB 3S8SA 2XWYA 4ZCKA 5BYQA 3TR5A 2XS5A 1YLXA 3H2UB 5DM7Q 1RHMB 2EFVA 3CSKA 2Y3YA 3CGIA 1I5OB 1TKTA 4PXBA 2V9KA 4CYUB 5E0OA 2MEWA 2RDJA 4JI7J 5LOQA 4MYUA 2AJFE 2HQGA 3OHBA 3MUVP 1Q0NA 4JI5J 4ZPTR 2ASLA 4HR2A 1T3OA 1HI0P 4KBIA 4BWMA 1RHUB 2CG8A 3MM8B 3OXLA 3R1LA 3RJMB 1FK9A 2FHKA 4U67Q 3IAS9 2YBVA 2MKCA 4OX9F 3ZTRA 5B09A 4NLPA 4F3QA 2M9KA 4URSA 3BS9A 4B9VA 2DNOA 2GIRA 4WFBQ 4LSNA 4NXMF 3PTWA 2HHSA 3WQPA 4TKTA 1RXOB 1XTZA 2DH8A 4PWDA 3QNWB 2M0GB 1JLQB 3T3FA 3CCES 4ELVA 4ZCMA 1NUEA 3H8YA 4V1Ak 1NJYA 3GB0A 2FVPA 4KGZB 4I7FB 5GADI 2ZH6A 4R0JA 3UN3A 3VALA 4QPXA 1S7IA 1RTJB 3PRDA 1KOHA 4JUZA 3LW5C 2WONB 2VICA 4NZ0A 4IUFA 3CD6S 4MIBA 2FHJD 2BM1A 3THVA 2HBRB 2YVSA 2GGPB 1JLEA 1NPKA 1R8CA 5B0BA 3P96A 1REVA 4WXWA 1Z1ZA 2UXDF 4NLRA 4RR5A 4YB6A 2BOAA 4B9SA 2BUNA 1Q79A 2VOOA 4JOUA 5C25B 3QAUA 4HHJA 4K2JA 2XLIA 4NLOA 1NDKA 3EVWA 4KHRA 3TX0A 3J7A1 4C8LA 1FKOB 3FSXA 1FXLA 2AV5A 1E6YA 4UOGA 2W9BB 3H25A 1U1QA 1VLOA 4GKKJ 2XULA 2GA7A 1GK8A 4B3SJ 1Q53A 3R6LB 1JK9B 4NLWA 2BVZA 3L7UA 4YY3F 2G1HA 1TKZA 4LR7A 1WF1A 1JLCA 2YNGA 2X51A 2PEBA 1AA1B 4DPYA 3CJKA 3BQ1A 3Q2TC 3W3SA 3KK1B 4RU2A 2DNQA 1HLWA 2FVRA 4TYAA 4W90B 3C14B 3PIOQ 3OR1A 5E5NA 2W9CA 3VQSA 2B8QA 2F5GA 3A3NB 1VOMA 2V2KA 2VJUA 2XMTA 1FKPA 5BR8J 2AEMA 1FD2A 3I9ZA 4A8KA 2ACMA 2DRAA 5HSPA 2DNZA 4I2PB 3V5RA 1GEHA 4RBVA 3CCRS 4X4NA 4BCAA 3P8BB 2BJDA 2F65A 5C2GA 3AD9C 2FJWA 3DOKB 1VI7A 3L7PA 2PMWA 2XSJB 2HRYA 2G2ZA 2MQMA 1XMBA 3E2EA 5A8KB 4YHHJ 3PRBA 3M6VA 4DL7A 3ISNC 4P73A 5D0HA 4WBFA 1QY7A 5DGAA 1KVKA 4DSLA 1QAYA 1WKJA 1JLFA 1P1TA 3T6JA 5KFJA 4DU8A 5LMUJ 1QAIA 3GFYA 2FLPA 5FLXY 1DZ5A 3QJPA 1AUDA 2FLOA 3KHRA 1IVZA 1S57A 3CCSS 3EGWB 2MKYA 2E29A 4GVBB 3OR2A 3D3CJ 3LQVA 1N32J 2M5YA 4DR6J 1QAJA 4OIXA 5HQLA 2ZJRQ 2KHDA 2JFDA 1K73T 3HVTB 4J9OA 1FX2A 4KY3A 2XBPA 2NUUG 4DU7A 4ZS6A 3TZZA 1C0UB 1HNWF 3A8IA 5D15A 3M8PA 3K58A 2DNMA 4R0EA 2J7UA 4XAKA 1WC6A 2C22A 3I9V9 4DR7F 5KFDA 2KTQA 4C9DA 2VL1A 2HFVA 1K0VA 3EMTA 4LFBF 1U24A 3CCTA 4EUVA 3DOLB 2I8EA 1LW2B 3UCUP 1XMQJ 4C48A 1V9OA 1P9YA 4MKVA 3SFGA 1MROB 1NSAA 1FCAA 2BJ9A 2H51B 5T7LB 3L4BC 1QE1B 1FDAA 4O4GB 3QSYB 5A8WA 1B4SA 4J9NA 1OO0B 2EFGA 2RKIA 4F4YA 2OPRA 2E9ZA 4ECUA 3DRSA 3KJFB 4ZIVA 1Q1KA 4ZVRB 3GFHA 3ITHB 4C0OC 2BW7A 4PYDA 1FNMA 3KNGA 2J9DA 4OX9J 1F2HA 2V9WA 1X9MA 3M2VA 1R6VA 3QFHA 2B9YA 4P10A 4USKA 2HAFA 4DSEA 2MZSA 4QPTA 3QBCA 1TTHB 3CO9A 1NU4A 3PEJA 1MMDA 1SJFA 1Q7YT 4NXMJ 1M5HA 3C15A 1J5OA 3M8QA 4OYIA 3J81Y 3MOJB 1S5ZA 1XEZA 1UCNA 1S48A 1TUGB 1KLNA 2C3YA 5HVGA 2R2RA 3KK2B 2A6OA 2VA3A 1BE4A 4JYAJ 3UDLA 4DF8A 2VFRA 2LXFA 2IVFB 4ZCIA 2DXEA 1V3SA 4Y00A 2MXYA 1S59A 2XYGB 5H9EK 1LK7A 3H5YA 4NI2A 3CB4A 1DQ8A 3ZXWA 1NZAA 2B5JA 2LA4A 4OHVA 1UVNA 1RBAA 2OFHX 2Y9HA 4DR2F 2ZDPA 4OV6A 3NGTA 2O3DA 5DQIA 4HLBA 1NDLA 2DGWA 1IWAA 2IM0A 4DZ6A 1DARA 3RAQA 3DFEA 3GSIA 3QLHA 4FPRA 3RR8A 3PRVA 1ZH5A 1R89A 3H2LA 2W2MP 2QEXS 3NS7B 2YQ0A 1FJCA 2NCKL 3W5ZA 1X4BA 2VONA 2B4UA 3BO4A 4USMA 1UFLA 1K1SA 5KFVA 4AL6A 1KTVA 4ZLLA 4ZKAA 1VC5A 3GJQB 1IKXB 4LVOP 1IKVB 4DV7F 4IOAQ 1X31C 2AGPA 3HHDA 4XTTA 4DN0A 3AA8A 2H65B 4JI3F 3LGMA 1V3RA 5KOXA 3PZPA 4P2MA 3M9MB 3E01A 3KK3A 1TVRA 1S0OA 3ZZRA 1WG4A 1YWXA 3O6QA 2ZH3A 1FXRA 3TEHB 4TQRA 1YITS 2ZOFA 4YY3J 4N76A 2DJWA 2RDIA 4LBIA 2CPJA 2HNDA 4IG3B 2DKOB 2BQUA 2UUAJ 2QGFB 2APOA 1FF2A 1NKEA 1Q95G 2YQ1A 3AFGA 1B70B 1SL1A 1QSSA 3IP0A 2WVEA 4FXDA 3KDNA 4PEOA 4QIWD 4OZ2A 4X84A 1LW0B 4OYBA 1X4HA 1H74A 2KDOA 2QZ8A 1RTHB 5F8MA 2I5JA 3IGNA 4K4XA 1RBLA 4CCHA 3N5BA 4KGXB 1T03B 3RRHA 1U6FA 2VG6A 3I31A 2D3OR 4IO9Q 2V0NA 3GLJA 2IY5B 4PKDB 4USTA 1MU2B 2VC0A 3LANA 1XC9A 3CW2C 5RUBA 1HQUA 1DY3A 2DY1A 2C2OB 2E5LF 2ROPA 2QE5A 1N48A 5GAHU 2MTLA 4I2QB 1JNRB 4O44A 1QSLA 3D6TB 3J7Z5 1RA7A 2NSBA 4PYAA 4FS1A 5K8NA 2OSRA 4RL1A 2BANA 2VQEJ 4LF6F 4WK3A 1IBMJ 4CLPA 2XEXA 4QQBA 4UQGA 4QR2A 1UVMA 3CCQS 3GQCA 3EZUA 3SCJE 3DGVA 1NEEA 1RT5A 2D69A 4EO8A 1G2EA 2PA3A 5KFIA 2CNNB 4QIVA 2HBQB 1TKXA 1VK8A 2AJ2A 1S0VA 3NGKA 1WORA 2H3EB 4F4KA 1HNWJ 2YKMA 3HHEA 4WP8A 2HK3A 2KVQE 1JJCB 3DRRB 2Q6BA 4QYZK 3RUBL 2W7OA 3W5YA 3MECA 1P1LA 1NB7A 2VFTA 2KJWA 4LFBJ 1JQGA 1RT2B 3OSNA 1TQLA 4LR9A 3B78A 2FC9A 4ECYA 1NNDA 2QG9B 3MMCA 3B54A 1HL6A 1UFWA 2DNKA 2YPZA 3NNAA 4J9QA 4NLYA 3C2PA 1J2VA 4N77A 1DHMA 1UP1A 1RCXB 1XNRJ 1K8AT 1R43A 1VQMS 3GJTB 1SH3A 3V6JA 3MCSA 4IH7A 1YJ9S 4AFFA 4N5SA 3CMAS 4K4VA 1FFGB 2LDYA 1SIZA 3DLLQ 3ONQA 4X2BA 4TU8A 3FCWA 1KRPA 5DDRC 2W4CA 4Q2LA 2UVWA 4B9UA 4KIAA 5HATA 2HNYA 3AD8C 2CVEA 1IJFB 1WC5A 1H73A 2JDJA 1WC1A 1RGVA 4H54A 1CULA 3GTYX 5KFEA 4IH5A 4CLUA 3MMBB 1YVFA 4F4WA 4OZLA 4OYWA 3CXCR 3DOMB 1B7YB 1VQPS 3OTEA 2YY3A 4EK2A 3NS6A 1MWZA 3GIMA 1U1NA 5EGYA 2NS1B 3FGVA 3RB6A 2CJKA 4FYVB 4QWCA 3PW0A 5B0CA 5HMZA 1LFWA 1OYDA 4DQIA 2YWGA 2UUCF 4DDFA 5SZTA 3T9ZA 3HT0A 3MM5A 1SUQB 3CULA 4DCPB 3MR6A 2RILA 2CPDA 4RLEA 3T1HJ 3VAJA 2CJYB 2G0CA 4DR2J 1MLAA 4G1QB 1S6QB 2PGCA 1RWKB 4PG8A 1WF2A 1GAOA 5J1EA 3PYGA 1VYAA 2Z2MA 1SBRA 3O44A 5D8HB 3CCWA 3JS9A 3U7JA 3P4UB 5GMDA 4DUZF 1Q5YA 3QGIA 1Z4UA 4YEAA 2O01C 4U7CA 1MSWD 3R5BA 3G4SS 1H6KX 4DV7J 2ZOGA 2C2MB 5I4MA 3G8QA 1YGYA 4Y0FA 1S6UA 5E7OB 5IQQA 4DL5A 5IS2A 2JLFA 5K14B 4ZCLA 3PX0A 4CH0S 4Q44A 1D3WA 3QRPA 1BUXA 3HD1A 2WK4A 2DNPA 7FDRA 1JLAB 5F8JA 4J9PA 3C8YA 1X9SA 3IAM9 4LR8A 3D1HA 2E5IA 2MKHA 3CIZA 2IA0A 3HHLA 1NJZA 1MWYA 1PJ6A 5LT5A 5F8GA 2DVIA 3KLEB 2C1EB 2WW4A 3PXGa 3K0JA 3R5GA 4A8WA 1HBMB 4L74A 2U2FA 1XERA 4NWBA 4LRBA 5LXRA 4OZ5A 3NGSA 3T19A 2HWTA 4CO0A 3TNVA 4RW6A 3R6GB 4DSKA 2U1AA 3C6TB 1FD8A 2HHPA 1RT1B 2ZNZA 4IRKA 1RWXB 4GC7A 3R7NB 4GC6A 4PRFA 1DAXA 1NSQA 2MQQA 4DV0F 5A6WA 3IBFB 1UWBA 5DLGA 3JYTA 1P9QC 2EEYA 1RT6A 3KNAA 3IWNC 1X60A 3F0NA 1HHTP 1YJ7A 1A0OB 5I42B 1B99A 3LP0A 4LT6A 3ENQA 1K47A 1M1GA 3MCMA 3FBCA 5KFOA 4ANEA 3SCKE 3T9NA 2A6MA 2E1AA 3CD7A 4F67A 5I3PA 5CYQA 1KVIA 5KFAA 1D9AA 5E3PA 4NRUA 2HIQA 4LF6J 1RP5A 1DQAA 1N5TA 3WHIA 1UMJA 2LQJA 3A13A 3B82A 4FBUA 1RWUA 2GV1A 3D0IE 3SMZA 2J8AA 2RD5C 3NP5A 3RB0A 1Q8KA 4OV1A 3IN5A 5T14A 1NRKA 1QTNB 2RE1A 4ZP7A 4H4MA 1KTQA 3VGSA 2ZWPA 2QLBB 3J81U 1RT7B 1JMTA 5DO2A 1CVJA 3ADAC 4NASA 3FDSA 3MEKA 4WE1A 1RBOB 5KFCA 3F56A 4DHVA 2QLJB 3P45B 3OL7A 3Q23A 3CO0P 5J2MA 2KJVA 3J7AN 3NOGA 4TXSA 1X0FA 2HZVA 1R0AA 3RB4A 1TFWA 1KHVA 2BE7D 1EETA 2OPSA 4NYOA 1FNOA 2W7PA 2OEJA 3CJRA 3MZIA 5LSRA 1RAHB 2J6TA 2D3UA 4RW9B 5F8HA 5HROA 1XMOF 3DI6A 3VVUA 5C42A 4CLKA 3GPAA 5J2NA 1KQKA 2NPFA 2E1PA 2IRUA 1UJ6A 3J7ZT 2EFNA 3BR9A 1SKWA 2WVCA 1B64A 2VJVA 1UA0A 4KV8B 4E98A 3QZ8A 1FJGF 4CO4A 3PY8A 2A0FB 5AE3A 5G0RB 2VBYA 2AF6A 3L95X 5A0YB 4KGKA 3ZZYA 3NG8A 3CDBA 1HQEB 2HGNA 3CJTA 1RKIA 4Q8FA 3W2VA 4ECSA 5SUHA 4ECTA 2YNFB 3MXHP 4USIA 1Z2ZA 1NBEB 1T02A 2LQ5A 1W2IA 1WOPA 1FVSA 4YP3A 5IT4A 2R7VA 2EFPA 4XDCA 1LXNA 1NM2A 2CQ0A 4KPCA 3BSCA 2WHOA 3H98A 3GIIA 4AXJA 1S1XA 4QR1A 5EWFA 3EZ5A 1XIQA 2CQCA 1VQ8S 3Q8QB 1GX5A 5DG7A 2XB2D 2HBYB 3GYNA 1RABB 4NMXA 3PCOB 1JNZB 1ZTTA 5I3UB 2XCPA 1S9GB 5ETRA 1WI6A 3CJ2A 2XHCA 4E0DA 1KQSR 3SI8A 2CXEA 2LKZA 4K0KF 3I5BA 4RW4B 3PHTA 4QBUA 2VBXA 2RSQA 3HX9A 5KT4A 7AT1B 5AJ3F 3RAMA 2CJXB 1FWKA 2Q1LA 1IBCB 5F0WA 2CNKB 1UVJA 4RJVA 1JLQA 4KE5A 3BYRA 2G13A 2C3PA 4PXEA 2LEAA 4Y2CA 4DQSA 2NSCA 3U02A 3QJJA 2CPZA 3BGLA 2V2VA 4CTAB 2XI2A 4NLVA 4I7FA 6FDRA 1LEOA 2C2KB 3V81A 2CYYA 2ZHOA 4ZN1A 1M5KC 1RTJA 1S1UB 3CJQA 2WONA 2NYIA 5ETPA 2AJ4A 3QYYA 3UCGA 3HHNB 1S1VA 1WSVA 2GGPA 3POTB 1GT8A 1PGZA 2L3MA 2IYGA 4CI0B 1U47A 5KFXA 4Q2MA 4WU2A 3AAWB 4YR3A 1WHYA 2KB2A 3U1MA 2BKOA 1NB2A 4O3RA 1TAUA 4J9SA 2P8IA 1MNEA 3HVAA 5HVFA 2CPYA 1HYSA 5EN1A 4DV0J 1IBLF 1FKOA 4IOBA 2IVYA 2W9BA 3W61A 4NZ7A 2MY8A 2F1FA 3VVTA 3Q8PB 4CLLA 4RUCA 3D68A 2GJFA 3SXLA 1N5VA 4WWSA 4J37A 1DBDA 2VFUA 4DSIA 4LQ3A 2P9CA 4O3SA 2EG1A 3CDEA 3MI7X 1LWEA 5IQ6A 4U7UK 2KVIA 5K8MA 3KK1A 1RT3B 3GFZA 3GONA 1Y5LB 2C28A 1IM4A 3LAKA 1KC8T 1WOOA 1WKKA 1RSCA 3EDQB 5GMEA 3H5XA 4EU0A 3U27A 4DPUA 4TNOA 3IA0A 4GMKA 1S1TB 4DV4F 4IG0A 3HSZA 5L46A 3KOAA 3X1LB 2QL5B 4DS4A 2HVZA 1OQ3A 2W24A 1S99A 2YNHA 4ZVGA 3BDEA 1U49A 1BMQB 4C3KA 3AJ1A 3DCAA 3DLKA 4I2PA 4QIGA 1BLUA 1BHNA 3KLHB 3WC2A 2F8HA 3DOKA 2JEIA 2ILZA 2XSJA 4HACB 4P72A 1NHUA 3BKFA 5A8KA 4ED3A 3OFGA 1OPZA 1S77D 2GS8A 2DT9A 2AWZA 3K2YA 2RQMA 1X4FA 3H4BA 1V3ZA 4K4SA 1Q4RA 2ZZMA 3M2UB 1L5UA 2FY1A 1U48A 3O8WA 1NK7A 4LBPA 2FPHX 5KG4A 2C2NA 2HLUA 3HSDA 4GVBA 3SSQA 1RISA 1Q82T 4WPAA 3L9ZA 1CJUB 1C1BB 3QT8A 2C42A 2DNYA 2YPYA 4O3QA 2E44A 2GC8A 3THTA 3ET6A 2HVHA 4RUAA 3LTOA 3QAEA 2LA6A 3VF0B 2I6WA 1RYSA 4KKOA 2DHHA 2BYCA 1S9EB 2DBBA 2C2EA 3EGVA 1JX4A 2E66A 1PAUB 1IQZA 2N7YA 5GVQA 4KAIA 2F63A 1LFPA 1MROA 1RAIB 1HBNB 4LFCF 3ENAA 1QE1A 1ZZFA 1ZAWA 4DJBA 2Z58B 1N4LA 4TYBA 2HFSA 3BKUA 3QZ7A 1S4FA 2AU0A 2XI3A 3MURP 1RADB 1FRLA 2DGQA 4P74A 4P7VA 3RBDA 4MKYA 2XO6A 4F0HA 4F7VA 1U1KA 2LLZA 4DQQA 3AJ2A 2HW3A 1Q16B 5KG1A 4JB8B 4M63A 1NH8A 4DMZA 3H2VE 2JWNA 3HFKA 2GJ2A 2VASA 1SJ3P 5KTQA 3S6EA 1VQ6S 2CIMA 1YX2A 4ZVFA 2ZH5A 2AJ0A 1JXVA 3NKYA 2HNZB 2G0IA 1DRZA 2Z2ZA 2XG8A 2CADA 2V68A 4QIEA 3UVJA 4HT5A 4CLTA 2AEFA 4EYHB 1U26A 2GW8A 4YB7A 3BBCA 4DL6A 3OD2A 3R5DA 3B6BA 1M5PC 3MEGA 3T1YF 3CCUS 3KK2A 4M94A 3GJRB 4M5IA 4Y2MA 2GCFA 2QA4S 2ASJA 1HNVB 5KG2A 1U1MA 2MQLA 5ADZA 3QIDA 1I6JA 1RAAB 2IJFA 2DK2A 4GKJF 3SSSA 3BSAA 4J9UE 1RZMA 2VOPA 4RBTA 4ECQA 2NXEA 4DUYF 4IDKA 5JMNA 2IRYA 4X64J 1AFIA 4AQYJ 3MTJA 1RYRA 2PEHA 1Z2LA 2W2NP 2VBWA 2MPUA 4FN5A 3M7VA 1NKBA 3K8VA 5D0EA 3KYLA 3MR2A 1K0TA 4LRCA 3C66A 2NLWA 4CLZA 3VAGA 3H5UA 3UO0A 2HQDA 2FB0A 3PKYA 2HQCA 4FXWA 3W66A 2VPWB 4B3MF 3VGVA 2ZC3A 1IKVA 2WSCC 4ECVA 2IYIA 1IBLJ 1WG1A 3ISZA 4F4XA 4DFMA 1MMLA 1TV6B 3DYAB 2V94A 4U8VA 1EAYC 1PILA 2VQFF 2DCLA 1ZAVA 1YDLA 3RU0A 4I6AA 2VIHA 4IG3A 2IMOA 1X5TA 3M30B 2Z2LA 1PYSB 1LKZA 5B08A 4A8QA 1UA1A 2X7IA 1LW0A 2XNRA 1C4AA 3TARA 9RUBA 2CVIA 2QSWA 2B51A 4QZVB 1RTHA 3AT1B 4KT0C 2V67A 3HKZD 2IBOA 4AD6A 4DV4J 4C11A 5LXYA 5M2PA 2OTLS 4OJGA 1T03A 1DLOA 4FPIA 3HLUA 4PWWA 3DDNA 5FIIA 2UV8A 3N01A 3SBMA 1T3NA 2JC1A 1RWNB 4TVAB 5KG5A 2BJ1A 2OH2A 4P6QA 1YJNS 3CF5Q 4ERDA 2MZJA 4M5HA 2OAUA 4NEZA 3KG0A 1EP4A 2FVCA 3EGNA 4U8YA 2GHVC 4I2QA 2XCAA 1GMVA 4N56A 2PDAA 1FO1A 1S49A 3ZZOA 2X3GA 4UY85 1CJKB 2AZ1A 4ILRA 4RUBA 4GRSA 1RAEB 2FJAB 3DM2B 1RLDA 3T5LA 2JHEA 3VAMA 4K4ZA 4ZPAA 3AHPA 2HS3A 4CLWA 2W2OP 4KC5A 1WC4A 5IT9U 1TZ0A 3OXGA 3MPVA 3HVWA 4CQ1A 2PSZA 3PYDA 1D9DA 2WOMA 2OTJS 2DNHA 3GJSB 5IT0A 1XR6A 3PX4A 3UFCX 4WKYA 4KH0B 1PG5B 4P2XA 1QLNA 3BQ2A 3GYXB 4OX6A 2LCWA 3AQPA 3FBFA 2YH0A 4ID5B 4FF2A 4WK1A 1SH0A 2CPEA 2L9WA 3DRRA 2KH9A 2R8IA 2KKHA 3B4DA 5D3GB 1RU1A 3CE8A 5GAHI 1RT2A 5E41A 1M5VC 4ED7A 4MYTA 2MQNA 4C7QA 2ZE2B 4DF4A 3O2IA 4ZJOA 3NL0A 4HT7A 2K1RB 2FVSA 1VRQC 4A8SA 1PC4A 4WU3A 1GXUA 2XS2A 1H2TZ 2G4BA 1ZM9A 2ZVIA 1K1QA 3ELHA 1EJ7L 1JLGB 3KXDA 5KT7A 4J9RA 3TANA 2IRXA 2GJIA 2QC3A 1TELA 4YB5A 2ATCB 3AOAA 1FE4A 3EZOA 4Q5VA 2UZAA 4X4OA 4FF4A 2CQDA 1BQMB 5KFRA 2Y8WA 3NGUA 3NWGA 4UOFA 3G6YA 4LF8J 2IM3A 2H4YB 3LALA 3MEEB 3JSMB 3KG4A 5L1KA 1X5SA 3Q8YA 1G7CB 3BM7A 2B9XA 3FBEA 2G1DA 5DZ7A 4IQXA 3RYLA 5KFUA 4UZBA 2GZOA 2G9OA 3BB5A 5JUMA 3MMBA 2PC6A 5B0GA 2HMIA 5EUHA 2DGUA 1T0TV 1NZ8A 1QUVA 3FCVA 2Q79A 3M05A 1W2BR 2H48B 3N6LA 3RB3A 4EEYA 1S6PB 3MWBA 5DM6Q 3V4IB 1UL3A 3OBIA 2MKSA 3JSRA 4ENOA 1M5OC 2ZD1B 3HPOA 2KO1A 4GKJJ 2ZM6F 3VGUA 1SUQA 2Q43A 4KFBB 4W98A 2H5IB 4DUYJ 4GO7X 1UTAA 2NREA 2F4VF 2RJZA 2Z0GA 4G1QA 3CJSA 3D7SB 2OUGA 2YX7A 2V8VA 3BO2A 1R8PA 2HSEB 4OHWA 4DSFA 4EZ9A 5KFHA 4LFAF 1YZ6A 4NRTA 2N7CA 3VR1A 3TAQA 5EHHA 3GZ7A 2MJUA 2QFIA 2OSQA 1DQ9A 1JB0C 5CYJA 3IWLA 1BD6A 1EQ0A 5A8RB 2CZVC 2AYBA 4B3MJ 3W63A 4ZVPB 2MZRA 2YKPA 2OKQA 2W7AA 2DCUB 1Y5NB 4MKBA 4J5OA 1JIHA 4PWUA 1R3NA 2I1RA 3LAMA 3GMGA 5CHCB 2DH7A 2W01A 4ZVEA 2RHSB 2E5HA 2VQFJ 3K17A 1L3SA 2IFXA 1TK5A 2DRDA 2Z56B 2RUSA 4HTIA 3W1YC 1SL0A 3G87A 5THWA 3LWMA 3KLEA 4LRAA 4URQU 2QJ3A 1HBMA 1U45A 2VHGA 1JLBA 3IMQJ 4P7TA 4ZIWA 3RBZA 5AXMA 4JI4J 4KGVB 2BBEA 3R1HA 2RAQA 3C6TA 4O3PA 1RT1A 2EC2A 4DEZA 4PG4A 3AODA 1K44A 2RS2A 3DMJB 2RU3A 5FJ4A 4I4BA 1QAXA 1EZZB 1SJRA 1KVJA 1IN0A 4QJVA 1LWFB 3VWSA 1SQFA 5I42A 2EVZA 2YXLA 2R4FA 4LF5F 1RHJB 3VV2B 3BBBA 1PCAA 2B43A 2HVEA 3IS9A 3E8OA 3JTPA 2GQQA 1H3DA 1L3KA 2CQBA 2FHMA 4ZLPA 2I38A 2VPZB 3TI0A 4I6YA 1Y00A 2NXUA 3DC2A 4ELUA 2MKIA 5ETTA 2YKNB 4K4WA 2C2RA 3BSNA 5GADU 1VQ7S 2WB1D 1RACB 1FK9B 4QWAA 2KN4A 3OVBA 1HKAA 1RUSA 1FESA 2FUG9 1RT7A 3I6PA 2IM1A 4EBDA 4EYIB 1VCTA 2LVWA 2HHUA 1T95A 4BC9A 5F9LA 3FNNA 3V4MA 1ITPA 4FF1A 4A8YA 2DR6A 3D6HB 3LOUA 4X4RA 2V8PA 4YN3B 5KFBA 3ZO7A 5HMYA 4IH6A 4OQJA 2XYPB 2FJVA 4MIWA 4LSNB 4WFZA 4NLXA 2HZCA 1EHWA 3DRXA 4V19J 4F25A 3G6ES 1U4BA 1UJ5A 2M2BA 4X65J 1ZAXA 2M3DA 2MKJA 3CC2S 3V6HA 4TU7A 4OI4A 1DFDA 4RW9A 3OFFA 2ZH1A 3S1TA 5D6GA 4H4OA 2EG2A 4E2FB 5BR8F 3Q0AA 1KN6A 4Z7YA 2V50A 1VIOA 4LF2A 3P6YC 1GXTA 2YX4A 2KYZA 1RWVB 2MQ8A 4KV8A 1ZM4A 4DV6J 2A2CA 2QYGA 2DHAA 3D6MB 5A0YA 1X4AA 3BH6B 1OY9A 4TY9A 3G71S 1HQEA 2QRRA 5EX3A 4PZVA 1H2VZ 4MH8A 5HQ8A 2R8KA 2XC9A 4NA3A 3PM9A 1U1RA 2ZDOA 4C0BA 3G9CA 2HIYA 4ZN3A 3NCQA 2VV5A 1SJ4P 3SYZA 2YNFA 4MIAA 1N56A 1V6HA 2BJEA 3HI9A 1VFJA 4M8LA 2HVIA 1NK0A 5KFQA 2WVDA 2J76E 3AD7C 3UD3P 4ZJLA 1VIXA 2IJRA 3VHQA 1N32F 5IZHA 1E6YB 1PAEX 3TZYA 2C3UA 4WTOB 3G96A 3Q8VA 3VTIA 3GG1A 1VRTB 2E7XA 1AW0A 4U6PA 3HMJG 2Z8QA 2ZM6J 1T9TA 1N6QB 3T5JA 3MR5A 5DZ6A 4DLEA 3IR6B 1BQXA 1EARA 1TL3B 4K7QA 4JV1A 3DLGB 1GXLA 4YR2A 2F4VJ 3FQLA 1YIJS 1G4CA 4JV2A 3IBWA 2YNGB 4Y65A 3C6UB 3CJKB 3W8GA 3CMES 4ITSA 1HWUA 3G6VA 2Y0SD 2CZ4A 2HQFA 4LFAJ 4CZCA 3M32B 4RW4A 1XMQF 4ZPCA 1HNZF 1VC0A 3PYFA 3Q89A 1I94J 1F9EB 3ZTQA 2QTWA 2N4CA 3O5TB 5BXIA 2Y1JA 1PYTA 4M5DB 4K4YA 2ZH9A 1FKPB 1HW9A 2P5VA 5JVHQ 3DU5A 4RPFA 2XZDB 4BLGA 1TL4A 1U2CA 3PFOA 4OJ1A 3R27A 3CNQP 2FYXA 4G1PA 4JI1F 3ILJA 4CTAA 2CPXA 1HNXJ 1B7FA 3GWCA 4J9VA 3ZZZA 1QTMA 3L09A 2LYVA 4JI6F 1UEUA 1S1UA 4OJ3A 1T05B 4NL5A 2UXCJ 5A2QU 3IGVA 3FRYA 1OIAA 2NQPA 2E9RX 2AGOA 3PDNA 4ES3A 3C16B 3IWXA 4Q8EA 4CP5A 4F4ZA 4X4QA 1WUUA 5E33A 2W9AA 3MGJA 4G1IA 3UPFA 4JYAF 3IXQA 3HZEA 1RCOB 1X9WA 4C3MA 1GTEA 1LQ9A 2KT5A 4C97A 2J0XA 3NRBA 2J7KA 3QO9A 1EX8A 4CO5A 1T9XA 2CJ9A 2KRBA 4ED0A 4LIWA 5DDPC 1NK4A 2MLZA 3MAAB 4LF5J 4NYPA 2DGSA 1WTBA 3QIPB 1YTYA 3HF5A 4KH1B 4OZ0A 2J7WA 3TJAA 3DRPB 4B9MA 3CTRA 1NK8A 2F4FA 2YNIB 4YR0A 4L3NA 5DRKA 2W4PA 5A8WB 1RT3A 1TL7B 2RT3A 2R2SA 2UVUA 3KG1A 1W25A 1WOSA 1K9MT 3DRSB 4ED4A 1DTQB 5HI7A 1TL1B 1M1HA 3W7BA 2KT3A 4Q43A 3S01A 3DU6A 3RBXA 4DCOB 3LP2A 4ZVSB 1MWQA 2A1BA 2EC0A 4F04B 3QJLA 5D4LA 4I6WA 4OL8A 3F44A 2GIFA 3UN2A 3R2DJ 4Y2AA 2Y0BB 1RE1B 3G86A 4LQ9A 2UUAF 2BJ3A 2R9LA 4UOHA 2B7CB 1HIYA 2DIUA 4C2MA 3SQGA 3VAHA 2DH9A 2BX6A 4MFBB 4B9LA 2E1CA 2LEBA 4A4JA 3PJXA 5C24A 5H9EJ 2DISA 4LUBA 1B0VA 2PO4A 3V6KA 4GO5X 2GMLA 2WCXA 2BR0A 4DPOA 3MCNA 2K3IA 2VFVA 4IOCQ 1CJUA 1C1BA 1KDNA 1TP7A 4CIOA 4LF9J 2GFFA 4DSJA 2VC1A 4JP8A 1I3OB 4RO0A 2LMIA 1FDBA 1H2UX 1H7WA 5J2QA 5T41A 1HI8A 3AA9A 3M2RB 2GHPA 2HS4A 2RHQB 3IRXA 1AZSB 3OTOF 9ATCB 4Q7AA 2BV3A 2N3LA 1S9EA 1YSJA 4JBCA 3DXBA 3KHLA 2ZBRA 4ZVTB 4ES2A 1T9VA 3TW0A 1GH8A 3N79A 2YWHA 3TJ9A 3GE9A 1U1LA 2VQEF 2MQOA 2AIRB 1IBMF 3KTQA 4OLOA 1NHVA 1S7HA 1HBNA 2UU9J 4PAAA 2K3KA 3DDKA 3GIRA 2Z4PA 4F3OA 2CQ1A 2Q6CA 3KK3B 3LGHA 2DGTA 1WWHA 4ECWA 4UTGA 1IBKF 2YKOA 3FFIB 1VGYA 1Y4ZB 1R0BG 1FWPA 4KTQA 3OW2R 2ZKTA 2RUGA 2KZMA 3G8SA 3IM8A 3HSGA 1FEHA 3TA1A 5IFMA 1HHQA 5GMKa 1R27B 3JQMA 3ZTPA 4X4VA 2AT1B 2V34A 1U7LA 2G2OA 2BW2A 4OYXA 4RKUC 3MM9B 4I69A 1WEZA 2HNZA 1HNZJ 3M6XA 4LRDA 4OMFG 4RX6A 3ZTOA 3UD5A 2OLWA 4F4AA 2DNGA 2HG4A 4ZJQA 1IJEB 4XIUA 2ALYB 1XNRF 2RU9A 2D41A 3WDOA 4DR3F 1F5CA 4ZLJA 2PIIA 4IYQA 2HHQA 3RAXA 4BWJA 2VD3A 4DL0C 4JI1J 4MMOA 1ZPWX 2BQ3A 3D5MA 1EB0A 3I5CA 4OI1A 3UDVA 4ED6A 2DEJA 1CG2A 2F3JA 3DLJA 2B4OA 1RWMB 4JI6J 1HWKA 1X4DA 4TN2A 1CC7A 4MJKA 4O44B 4F8RA 5CCMA 4DV5F 4NLTA 3LPEA 5KFKA 3ENVA 2M4MA 4N8OA 1NDCA 2VG7B 2ZZTA 1IR1A 4M95A 3CVKA 3H20A 4K4UA 5J2PB 2YWKA 1RAJA 2QLFB 1RT5B 1NSKL 2XS7A 1KLMB 2FHJA 4OI0A 1TKXB 3AOCA 3M6UA 3BGUA 4F3MA 2P9EA 2YTCA 4PCQA 5ETNA 3UNYA 3JQJA 4QYZJ 2QA2A 3MM6B 2LXIA 4IR1A 1F5AA 3BN7A 3TAMB 3T1HF 2KZZA 3R97A 4NLDA 1TV6A 4ZVHA 2FD2A 2EK1A 3CDAA 3WBZA 3J80Y 3MEDB 5D0GA 3EDRB 2HVDA 4L76A 1GTHA 2ZH4A 3TQEA 3ZFVA 1VHFA 3TYTA 4DV1F 4CO1A 3EM1A 3DNCA 3M30A 3N6NA 5HANA 3FRZA 1UETA 2KRRA 2MLYA 3BBFA 3JQKA 3D1OA 1SKSA 1CS4B 3AB4B 1RHQB 2UUTA 3OUYB 1EKRA 1ZA1B 3FSYA 2CRLA 4ZK7M 3A8EA 3Q2SC 5LL6d 3JAMU 1JKHA 5DJBA 1KEKA 2DIVA 2OO4A 3BZQA 3WX4A 1N88A 4O0NA 3EGZA 1X4GA 5M2UA 3NCPA 3ZTSA 4Y2IA 4TLQA 2VPYB 2W2QP 3BGRA 1TMMA 4Q45A 1VISA 2KXHA 2L41A 3CJ5A 4OYOA 4ID8A 3PO5A 1TL5A 2R7OA 2JC0A 4NCGB 4ZITA 4NYZA 2DPIA 2MSSA 1CJKA 4M5KA 2ZHAA 5LSOA 3DM2A 5ETVA 4R25A 2N3OA 1WELA 2C2ZB 3EJMA 1OSCA 2DD8S 2CPHA 4IR9A 4PQUB 2LQ8A 3RZAA 3GFXA 2LXUA 1VBYA 2E1RA 1VQNS 1RAFB 4W92B 4IFVB 1VS3A 1XBWA 2W25A 4ZP8A 3EVMA 1LK5A 1NHKL 4ZVUB 1WHVA 2B0GA 3D67A 5J1EB 4KR0B 5LSLA 4BC7A 1OJ4A 2ZUGA 2OPQB 2HHHF 3OTOJ 1S0NA 2IAJB 4ID5A 2B56A 3P5TL 4RNFA 5HAOA 4G3IA 1VQ5S 5D3GA 5H9FJ 2PFDA 1CLFA 3LGNA 2XMWA 1R7IA 2JNJA 4J9LA 4QW9A 3J81j 2BZ2A 2ZE2A 3MDFA 3DLEA 2LQBA 2KYXA 3NLCA 3M4XA 2HHXA 4K5RA 4R8UB 1F1BB 3CD0A 4DV3J 2QT7A 4LSLB 4MK9A 5ETSA 4NA1A 3OLAA 3CCLS 1RAGB 3I0SB 3PR5B 2XMAA 3KLIA 4TU9A 1IBKJ 2ZH8A 3FKBA 4HH1A 1ZYQA 5E2QA 3JTOA 3K5LA 3NNHA 3KJNB 2F8EX 1BQMA 4H4KC 2IC3B 2HK2A 2V4JA 1BGXT 2DNNA 4DV2F 3MEEA 1C2PA 1WD6A 4L6V3 3PW2A 1X8DA 3V6DA 4MTPA 2WSEC 5I3QA 5HN0A 1F5BA 3A3OB 2LEPA 5E3AA 3O3LA 4HH0A 2JLEA 3UNGC 2MKKA 3L7OA 2HURA 4X4PA 1KFSA 3CEDA 5DQHA 1VC6A 4DR3J 3SZ2A 2CDRB 2CPFA 1FA0A 1U2RA 1JXEA 1S6PA 2DHGA 4C6AA 4M5LA 3V4IA 5D4NA 3JYTB 1RT6B 5KFNA 2NUHA 2VG5B 4M5GA 3T5HA 1QVFR 1CPZA 3KUGA 2ZD1A 2XLJA 4CRJA 5GAEI 7FD1A 1U25A 4ED8A 2F8MA 2D9OA 2RMLA 1W7WA 4KFBA 2PT0A 1FDNA 1LWCA 4PXDA 2ABYA 5CYQB 1AROP 2AEJA 4S0MA 4DV5J 3TWZA 1A6LA 2J0QD 2VKRA 1FWLA 2HFUA 2QX0A 2MDAA 4KSEB 3DHWC 3HM9A 3TVYA 1C0TB 3KJVA 3BQ0A 1Y3KA 4TQSA 1FNXH 3VAFA 4XK8C 5CABA 1Q8LA 2X3DA 1NJXA 3H90A 3CC7S 2QO3A 2SXLA 3BF4A 4H4MB 2KM8C 3RRGA 3HVRA 2R7UA 5M2RA 2KFZA 4IRCA 3PJWA 1Q81T 3RTVA 2ZOMA 3N28A 5DGBA 4FDFA 4O23A 2K06A 1UKUA 4O3NA 3MOZA 1FRIA 4KPYA 5LMNF 2O5DA 2DXFA 4DL4A 5CZXA 4DPWA 1I1GA 3Q24A 1N5QA 3BGFA 3GCXP 1WDDA 3I0RB 5AT1B 3MMAB 2VZ9A 2XYHB 4RZRA 1U8SA 3H5SA 4DV1J 3M6WA 5KFLA 4RW7B 5HROB 3DI6B 4RW8A 4JV5J 4F0MA 3LUYA 2XNQA 3ZC4A 2RRAA 1O0PA 1Y10A 4X62F 4PUOB 2DR7A 1YJRA 2DITA 3MFHA 3R2CJ 3OTCA 4I67A 3MFIA 2P6TA 1A9NB 1Y5IB 2DR8A 4RWWA 5KT6A 1IQTA 4NLQA 5DETA 2AX0A 2R7WA 3SCIE 3JSBA 4QWDA 1AB8A 1H0HB 5KOWA 3MUTP 1RKJA 2M88A 3W65A 3M9NB 2LQ9A 3FMBA 3FSIA 2AZ3A 3OHAA 3SCLE 3MM7A 2WRMA 1TK8A 4EFAC 3CJ0A 4FVCA 3ZNUA 2VODA 3OT9A 1S1XB 3G8TA 2P6SA 3NGRA 4V19X 1UZHA 4ICLA 4MAKA 1FXDA 2K2PA 4E8UA 3BN4A 3HJFA 4UF4A 1PBUA 2QMUB 2YKNA 5CYMA 3HZGA 5LM7E 3RBEA 4ER8A 3MAHA 4TY8B 4P9SA 5IWAF 3Q8RB 3US5A 3V2UC 1VRUB 2HHHJ 3DRYA 2FJEB 5IC6B 3PEHA 1OMSA 1VLYA 2AMCB 4DOZA 1NLKL 2JSXA 1HHSA 2KU7A 4A47A 2J5AA 1X4CA 4DG1A 4L3KA 1DTTB 2HAIA 4DUTA 2VB6A 1GFWB 2RQKA 1NKCA 1GMUA 4X66F 4LJMA 3D3BJ 1ZA2B 2BE9B 2B6AB 4N41A 3W2WB 1HPZB 1L3TA 3M8YA 3V81B 4URGA 1KD1T 1PYOB 3OFEA 1S4EA 1UVLA 3OLBA 1NJIT 1FTRA 2O1PA 1MG7A 4K2XA 5H1SV 5GAGU 2GO8A 4DV2J 1S79A 1N5YB 3BV8A 4BDPA 5BJRA 3LA0A 1S1VB 1SC1B 4DQRA 1TU0B 1S1WB 3GIKA 1V5IB 3TVKA 3KHGA 3AOBA 3GR1A 4XPCA 2D3ZA 1LOUA 4LF1A 4DX7A 3W9IA 3U1LA 2JOQA 5KFGA 4YUDA 3J80U 4Y3CA 3KLFB 1X4EA 2WB4A 3MUMP 2F9JA 4CDIA 2BACA 3JTNA 1PSDA 1KONA 1HYSB 3BREA 4R5PB 4PR6A 4NLSA 1N0VC 2DXDA 3Q83A 4I68A 3Q86A 2OIHA 3MD1A 1RTDB 2R3VA 3K57A 1H7XA 3R5JB 1VRTA 4PG7A 2KI2A 1N6QA 1M5SA 2GMHA 4DL3A 3MHYA 4I0WA 3KKFA 2CFXA 1HD1A 2I9SA 1TL3A 3DLGA 4OYPA 5HJXA 2QSFA 3AQOA 3EE3A 2HEKA 3M1VA 4HDGA 1RJJA 5HL7Q 1HBUB 2AHOB 1LWEB 3C6UA 3OXFA 4P71A 2V8DA 3I55S 1S10A 2J6UA 4LF7F 4B17A 4KHPF 2JRSA 4L75A 4NPOA 3MF5A 3GG0A 3NGDA 4OZJA 5CH7B 3R7SB 3VCDA 3M32A 2UUBJ 3QRQA 4DFPA 1YZ7A 1NJWA 1LV5A 1VQKS 1YBTA 4IG0B 1WF0A 4M5DA 2J0WA 4CYUA 1N54B 4EMDA 4IRDA 2KXFA 3FEXB 2YNHB 3FK4A 3W5XA 3DLKB 3PR4A 2CJBA 3EX7B 3TUZC 5IM0B 3MM8A 5CQGA 5AXKA 4CNZA 1GX6A 1UZDA 3BR8A 1UFKA 5E3CA 5LMNJ 1HI1A 2ZVSA 2ASDA 2UVVA 4NXNJ 4WFXA 1OYEA 4J90A 1UEVA 3ZZPA 1T05A 4B3TF 3EWGA 5IT9Y 3MPUB 1LWXA 3DHXA 1X5PA 2DY9A 2IDEA 4Y6IA 1N5SA 3PX6A 1SQGA 5K20B 3I32A 4K5SA 3C16A 4X62J 2JFKA 4FYYB 1HMVB 5JJBA 3H0PA 2MSTA 2OD6A 3ET6B 3T6BA 4LSZB 2BQRA 4ALZA 4M5NA 1WJ9A 2DGVA 1EKSA 2ZWOA 2ZUAA 4OZ1A 3TA0A 3RRKA 3D2WA 4OHXA 2AJ1A 4KKOB 4DR4F 3MTKA 1FJ7A 2J9CA 4N7TA 5CZVA 2ZHBA 2HHTA 5JVGQ 2FHOB 2OMLA 1WC3A 3WC0A 2MGZB 3MAAA 4X64F 2IJNA 4X4SA 3UDEA 1UW4A 4MK7A 3QIPA 4AQYF 2YQ3A 4DR5F 4LBHA 3DRPA 3HKWA 1YHQS 2OHDA 1NMEB 4QW8A 4ZPVR 2YNIA 3D28A 1O51A 4B3OB 3PG9A 4P75A 4ZVOB 4A8OA 1TL7A 1VQOS 5C25A 3WX8A 1YKWA 2X1FA 2HHVA 2XY7A 1T94A 4USHA 1SB6A 1FRXA 2MZQA 3VZIA 2ALZA 3FQKA 4HI1A 4PXCA 1DTQA 3C19A 1TL1A 4DX6A 1RWWB 2F7VA 4IKAA 4YOEA 1BWEA 3DKDA 5IWAJ 2J8SA 2KHCA 3W9JA 1AFJA 3MAQA 4PABA 3QMQA 2FDNA 4UOCA 3UWTA 2QMXA 2CQPA 2R2TA 3DDIA 4O3OA 2YWEA 1RQ0A 4ANDA 1CQMA 3UVJB 2WSFC 4B02A 1R8BA 4UUWA 1N52B 2XTJP 2L9DA 3HP6A 3J7YU 4K59A 8ATCB 4F2SA 1S0MA 3C14A 5MLCV 2AJQA 4B9TA 4BS2A 4MFBA 4X66J 3MEGB 1RWOB 3QT7A 4RNOA 4OYZA 2X1AA 3QGHA 5ETQA 1E6VB 5IV4A 2X1GA 3C46A 5K5MA 3P49B 2D74B 3BKTA 5L1LA 3CCJS 1REGX 1IXKA 2MHEA 5LJ5Y 3UW1A 2EK6A 4HVZA 4ZA1A 3OFHA 3R5AA 2R42A 4ED1A 3KMQA 2LP4A 5EX0A 4PG5A 3IO1A 2CG4A 4IDKB 5FD1A 5CAAA 3W8PA 5E3RA 4EGLA 4FP9A 4B08A 4ZLNA 3M2RA 3T1AA 2ZBCA 4AL7A 1AZSA 4YQWA 2E5JA 2UXDJ 3UQSA 1HWIA 3FZBA 3F73A 1EQMA 4JV0A 1D9FA 3AB2B 2NYHA 2MQPA 3PW7A 1PC5A 4NE9C 4IFYB 3RG6A 3A8JA 3FC9A 3R3TA 2K8GA 5B0DA 2CUYA 3P5BP 3Q8SB 2QA4G 1GMWA 1SV5B 3GR0A 4HDHA 3HVTA 1FE0A 2DR9A 1RAOA 4KGMA 4FF3A 1FX4A 4ZMMA 1C0UA 3FFIA 3D0HE 4DPTA 5L1IA 2QIFA 3NY0A 4DR1F 3O1LA 3ZZUA 3BPDA 3TA2A 2CWKA 1URNA 2RF2B 4KQZA 4W4MA 2FJDB 3GP9A 4LF7J 5G4DA 1VQ4S 4KHPJ 3L3CA 2JEFA 3DOLA 1FRKA 3MM9A 1LW2A 1CC8A 2ZKUA 4HYKA 4WTYA 4EWTA 5T7LA 2VH7A 2MZ1A 3TJ8A 4C11B 4O4GA 1DLOB 3HHLD 1C4CA 2WTFA 1ZM3A 2AGQA 1EIYB 1NO8A 4YB1P 3UD4P 1RT4B 4C3LA 1FTCA 2ERRA 1Q8IA 4LRFA 2POKA 2WVFA 3ITHA 4LF8F 1G1XA 2V2QA 1OWXA 3QFWA 3QT5A 5L9XA 3GILA 4F2RA 1EP4B 1QUPA 2IHR1 4C98A 4CO2A 1VHIA 4YS2A 2CKWA 4KO0B 2HYIB 2CJAA 3ZZ0A 4B3TJ 3SV3A 1JJHA 1KOOA 3KWMA 4ZHRB 5HLFB 3BEGB 3KJQB 1WHWA 2VG7A 2V63A 4OFZA 1HBOB 5J2PA 1WDTA 2FLLA 2O66A 4N47A 4WIQA 5F3TA 1HARA 1QSYA 1M90T 1UWAA 5FDLB 3IBCB 2WOMB 1KLMA 1ZPVA 1QVGR 4G65A 2NZCA 4ECZA 2CJQA 4DR4J 4JI0F 4ATNA 1XWLA 3MM6A 2FJBB 4DR7J 4ETZA 4NA2A 4UZCA 3TAMA 4GVLA 2PD1A 4LVNP 2OPPB 3NNCA 3MEDA 3I96A 3K89A 4P52A 1XR5A 4X4TA 6FD1A 3KUEA 5KFFA 4DR5J 4EBCA 3IRWP 1TUVA 5L8RC 4B3RF 5DDQC 1RB0A 2L08A 3IFEA 2RQCA 1RHRB 3CJ8A 1S76D 2KFYA 4Y2KA 3CCMS 4NZ6A 2OGUA 4CT8A 1IKXA 1YRTA 1CS4A 5F8LA 3LP1B 1P6TA 3OUYA 1U09A 2A10A 2JZ5A 4O4RA 3GIJA 1SKRA 2Y1LB 3OVAA 2J6SA 4QYRA 2W8LA 4Z2XA 5F8IA 1J27A 2IM2A 3GV7B 3G82B 4F26A 2Y1RI 3TUJC 2L48A 3NBPB 1J5EF 2HMIB 3HSJA 4A8XA 3AXKA 4F0KA 3E51A 2YX1A 4WIIA 2AW0A 1F6TA 1G3OA 1SXLA 4NCGA 4HHUA 4TLRA 4UQTA 3H7HB 1RTIB 5ETLA 2C3MA 3D54A 4JI4F 5HMWA 4M5JA 5MAOA 4PQUA 3RW6A 1H98A 3HT3A 2HGMA 1MU2A 1VQSA 2CWXA 4WP9A 4OLPA 2WAQD 4IFVA 2Z57B 2ZEJA 1YJVA 2GO9A 3UCZP 3UDCA 4ES1A 1NK9A 2BM0A 2NXCA 5L38A 3ULHA 1S72S 3TX8A 4RUHA 2EKNA 2OPQA 2LDIA 2QLXA 4K50A 1KP6A 3DLBA 2IAJA 2J9EA 3RW7A 4QU6A 5KT3A 3K8WA 2ADBA 4PG6A 3EXCX 5H9FK 4RNMA 1T9UA 2Q66A 1D1UA 5C7PA 4R8UA 2EXUA 2MHNA 4JI3J 2NXNA 4MKAA 3PHEA 4LSLA 4DWIA 3QATA 4AL5A 5FLXU 3PKMA 3I0SA 2FIUA 2FY8A 1S9FA 5D4OA 3D0GE 2GQCA 1ICEB 5A2QY 4UUXA 2DHSA 1U0HB 4ZVQB 1H38A 4NCAA 2XSFA 5BYSA 4DR1J 2H9ZA 2IC3A 1OSDA 4WKRA 3SFUA 1FEEA 2EFQA 1WEXA 4WXOA 2I0XA 1BC6A 5F3ZA 3IG1B 3EICA 3NCRA 4Q0BB 1MN9A 1HNIB 5HBMB 2GVZB 4CT9A 4DFJA 1JLBB 2D9PA 3PW4A 5CD4H 2FZKB 1HQ2A 4X65F 3ZNJ1 5KFWA 2HQ3A 3B8HA 3FEZA 1BQNB 2XO7A 2OFGX 2HLTA 5IOLA 1WSRA 2CQ3A 1M1KT 2ROGA 2JVOA 1PIEA 1FDDA 5EDWA 1SCJB 2BE2B 4OI6A 3KLGB 5DQGA 3JB9k 3MPDA 2VG5A 4CLSA 1FRJA 1WI8A 4DV6F 2XWXA 3G6XA 2E5LJ 1N8RT 4QWBA 2B3TB 5B0EA 1FJEB 2BMBA 1SKUB 2Z2YB 2FQQB 4ZPDA 3QRRA 1D8ZA 3A12A 1VBXA 3IS9B 1UVKA 1D09B 2QA1A 3HHLC 1BY9A 1A7GE 3K5PA 2JX2A 4USVA 3I4PA 4A48A 1QM9A 1TKDA 2DGOA 4CM2A 4AYBD 1C0TA 4WJBA 4CO3A 2KM8B 1ZBTA 4PQAA 3DOMA 1WG5A 2JEGA 3MD3A 3SDEB 1G6BA 2C2DA 3SSRA 3VGTA 3W9HA 4QU7A 2H54B 2VFSA 2CQHA 4NCBA 2ZBIA 3AXMA 5CD4A 3R8YA 3OJUA 4JI0J 1FVQA 2HRUA 4CLFA 2AD9A 3CMQA 1Y3JA 2AYMA 4YFUA 2FJXA 4NLUA 1S6QA 3HCXA 1CJTB 1NH7A 1SVDA 2HS0A 3CUNA 4BHQA 2H4WB 2YWWA 3I0RA 4CM0A 4B3RJ 1T9YA 3MMAA 4WZMA 2XM3A 3QSIA 4DZDA 2C3OA 1I94F 4RW7A 2XMUA 5HP1B 1B0TA 4WP3A 4H4OB 2GQ2A 2XLKA 2V8HA 1CJVB 4OHZA 5CXTA 2DYAA 4PUOA 1Y11A 1C1CB 1KHWA 5KAKA 2ZNYA 5K14A 3MMJA 1GQEA 3QT6A 5B0AA 3LH2S 1RU2A 3EYZA 1HNXF 2W2PP 4C8NA 1VK3A 2AQ4A 4OI2A 4ILMA 4JI8F 2G0JA 2ZJPQ 5J1NA 5F0UA 4CLYA 1GMWD 4F50A 1RWPB 5D4PA 2VDHA 1JLAA 2PI5A 2VA2A 2GNKA 4WFYA 2K7KA 3GCWP 2H5EA 2BKPA 2WBRA 4QIFA 1KFDA 1J5EJ 2UXCF 4ECRA 2O67A 3DGPB 1S12A 4AUKA 3FJ2A 2ZBQA 3R9LA 5D77A 2YKQA 5D78A 8AT1B 3M8ZA 1S6OA 2V69A 2CQ4A 2FLNA 1IKYB 3N0VA 2XMMA 1Q5VA 3OL9A 1YG0A 2ZFHA 2ZJQQ 3CCZA 1CEZA 5CCLA 2QL9B 1CSJA 1SC3B 2UUCJ 2P2CB 4CNYA 5B7WA 4QWEA 4C8OA 2EW9A 2GVDB 3ZZTA 1IKWB 2B9EA 1I51B 2XZWA 4KB7A 5B0FA 3CJ4A 4AE5A 4TY8A 1U6ZA 1YJTA 3EPGA 1VRUA 3HK2A 1BXNA 3M8RA 2XQCA 1O5JA 2CQ2A 1D8YA 4USWA 4O0IA 4DUZJ 4I1TA 1PBAA 1TKTB 3D66A 2IPOB 2COLA 3A1YG 1U1OA 4ED2A 2GMJA 2JEJA 1DTTA 5E3QA 4C4WA 4Y28C 3CJ3A 2RNEA 5L39A 2RRNA 2B6AA 2KFNA 4CWBA 1SQEA 3W2WA 1HPZA 2HZAA 1U1PA 2RH3A 2WW8A 2LECA 2R8JA 2PN6A 1X0PA 2E5GA 2Z30B 5C2CA 1P27B 2HFOA 3G2XA 3HXMA 3WIUA 1X5OA 2Y8YA 1F9FA 1N5YA 1KSPA 4EI2A 4FKXA 2WZ1A 3PFEA 3JSYA 4FYWB 2KG1A 1S1WA 4XDDA 2XY6A 1Y0HA 3HJVA 2R8GA 4PWDB 3EPIA 5L1JA 4WFNQ 4KRWA 2DNRA 4FNIA 1F3FA 2X1BA 2M7SA 1Q8BA 3KLFA 3ENWA 5KG6A 1WNEA 1VBKA 3MPWA 4R5PA 1APSA 2FZGB 1P8GA 2V8GA 1OS5A 2FTRA 1ZETA 1AT1B 3W64A 4NMLA 2R2UA 4L72B 3SIPB 5KG0A 3QO9B 4LF9F 3LO3A 4M5MA 4ELTA 2EBGA 1RTDA 1HR0F 2LFVA 3MR3A 3UR3C 3N9UC 3TUIC 2NZ4A 5G0RA 1ZS6A 5IV3A 5GAGI 1JLEB 1RLCL 4FVMA 3IR5B 4QR0A 2HQIA 1RK8A 5KFTA 1REVB 3QGPA 2M8DB 1WHXA 2HRTA 4N8NA 2OEMA 3WIVA 1HBUA 5HO4A 3UI3A
chains in the Genus database with same CATH topology
5C5JA 3PX4A 1O0PA 3UFCX 4WKYA 2RS8A 4X62F 3JAMY 2BA9A 4DSEA 3T5KA 1QLNA 2MZSA 4A8MP 4FNHA 4PUOB 3BQ2A 4QPTA 1TR0A 2DR7A 3CO9A 3GYXB 4OX6A 1YJRA 1NU4A 2DITA 2LCWA 1MMDA 3PEJA 5U47A 3AQPA 3MFHA 3OTCA 3K5NA 4I67A 2QV6A 1SJFA 1Q7YT 3MFIA 2P6TA 1A9NB 2YH0A 4ID5B 4FF2A 1Y5IB 1M5HA 2DR8A 4WK1A 4RWWA 1SH0A 5KT6A 1J5OA 2CPEA 2L9WA 1IQTA 3DRRA 2UU9F 4NLQA 4XO0A 3M8QA 2KH9A 2R8IA 2KKHA 3B4DA 5D3GB 3J81Y 3MOJB 5DETA 2AX0A 2R7WA 1R6YA 3SCIE 3CE8A 5GAHI 3JSBA 2R7SA 4QWDA 1XEZA 1S48A 1VQYA 1DURA 1RT2A 4ECXA 3LP2B 5E41A 1M5VC 4ED7A 1H0HB 3GV5B 1KLNA 2C3YA 1URRA 2R2RA 4MYTA 2MQNA 4C7QA 3KK2B 2ZE2B 4DF4A 3O2IA 2VA3A 3NL0A 4HT7A 2K1RB 5KOWA 4M1KA 3UDLA 2VFRA 2LXFA 4DF8A 2FVSA 4OHYA 3MUTP 1RKJA 2M88A 2IVFB 2B9WA 4A8SA 4ZCIA 5IM0A 1DJ0A 1PC4A 4WU3A 1V3SA 4Y00A 2MXYA 1GXUA 1KR4A 2XS2A 1H2TZ 3M9NB 5I3UA 1TKZB 2G4BA 1S9GA 1ZM9A 1LK7A 3EUNA 2LQ9A 3FMBA 3OTDA 3H5YA 3CB4A 3FSIA 1DQ8A 2R7XA 1JLCB 1K1QA 4J9RA 1JLGB 5KT7A 3TANA 2IRXA 1NZAA 2A3JA 2GJIA 2B5JA 4LF4F 2LA4A 4OHVA 3OHAA 4YB5A 3SCLE 1FE4A 1UVNA 3MM7A 2WRMA 1TK8A 4HKQA 3I82A 4EFAC 2OFHX 3CJ0A 4Q5VA 2UZAA 4FVCA 3UR0A 2VODA 4B9NA 1M0SA 4A8FA 4X4OA 4FF4A 3OR1B 2CQDA 1S1XB 5F41A 3SQGB 5AE1A 3G8TA 2ZDPA 4DR2F 2P6SA 1BQMB 2W9CB 3TQ1A 5KFRA 2RB7A 4V19X 3NWGA 2O3DA 5DQIA 4HLBA 2DGWA 2IM0A 3G6YA 4ICLA 4MAKA 2IM3A 1DARA 4OJHA 1FXDA 2K2PA 3DFEA 3RAQA 1N34F 3QLHA 4FPRA 4E8UA 5F8NA 3BN4A 3RR8A 3HJFA 1MMNA 1ZH5A 5EWEA 1R89A 3LALA 3MEEB 3JSMB 3H2LA 5C24B 2YKNA 1TK0A 2UUWA 3KG4A 5L1KA 1X5SA 5CYMA 2QEXS 1G7CB 3HZGA 3LWLA 3BM7A 3CWJA 2B9XA 4RNHA 1FJCA 2G1DA 3BO3A 4IQXA 1X4BA 5K9FA 2LU2A 2VONA 2B4UA 3RYLA 3BO4A 1XN9A 3RBEA 4OX7A 1RI7A 3MAHA 4TY8B 5KFUA 3KMSA 5IWAF 3Q8RB 2PE8A 3US5A 4EBEA 1UFLA 1K1SA 5KFVA 3V2UC 1HMVA 4AL6A 1VRUB 1KTVA 4ZKAA 1VC5A 1N0UA 3DRYA 1IKXB 4LVOP 2G9OA 2VPXB 1IKVB 4D3HA 3VZHA 3BB5A 4DV7F 2AGPA 4IOAQ 2FJEB 3HHDA 4DN0A 5JUMA 1XNQF 3MMBA 3PEHA 2PC6A 1VLYA 3AA8A 5B0GA 2HMIA 5EUHA 4DOZA 5J2QB 2DGUA 4JI3F 3K7RA 2NR0A 3LGMA 1IR0A 3R5CA 1QUVA 2Q79A 1V3RA 5KOXA 1FHTA 3M05A 1W2BR 3IRXB 2JSXA 1HHSA 3PZPA 2KU7A 3M9MB 3N6LA 3RB3A 1JJ4A 4A47A 2Q3PA 3E01A 3KK3A 4EEYA 1TVRA 1S0OA 2J5AA 3ZZRA 1S6PB 1X4CA 1WG4A 4DG1A 3MWBA 1YWXA 3O6QA 1DTTB 2HAIA 5DG8A 5DM6Q 2ZH3A 1FT8A 2VB6A 3V4IB 1UL3A 2RQKA 3OBIA 1JLFB 2MKSA 3JSRA 1M5OC 1NKCA 1FXRA 4TQRA 1YITS 2ZOFA 1WEYA 2MGZA 2W8KA 2A18A 2ZD1B 2DGXA 3HPOA 4X66F 4N76A 2KO1A 2DJWA 4LJMA 3POTA 2RDIA 2ZM6F 2CPJA 2B6AB 2HNDA 4IG3B 2BQUA 4N41A 3W2WB 1HPZB 1SUQA 2APOA 2Q43A 1FF2A 3OR2B 4KFBB 1NKEA 1L3TA 1WTFA 1SL1A 3X3UA 1QSSA 3V81B 4GO7X 4FXDA 2NREA 2F4VF 2EPIA 4URGA 2RJZA 2Z0GA 4QIWD 4PPZA 4X84A 1KD1T 1LW0B 1IUJA 3OFEA 4G1QA 4B3OA 5DDOC 1UVLA 3OLBA 1ELOA 2YX7A 1X4HA 2V8VA 1FTRA 1NJIT 3BO2A 2B7BB 2DNLA 2KDOA 2O1PA 2MYFA 1RTHB 2QZ8A 1R8PA 2V5HG 3PACA 4QOTA 4K2XA 5F8MA 5H1SV 2I5JA 5DG9A 3IGNA 5GAGU 2GO8A 2CQIA 4K4XA 1S79A 1N5YB 4OHWA 1FRHA 2EI5A 4CCHA 3N5BA 4UW2A 5KFHA 4IO1A 4DSFA 4EZ9A 4LFAF 4NRTA 1T03B 4BDPA 3M8PB 2N7CA 5BJRA 2XMKA 3VR1A 3TAQA 5EHHA 1S1VB 3GZ7A 3RRHA 4DQRA 1S1WB 2MJUA 3GIKA 1U6FA 2VG6A 1ZM2A 3I31A 2OSQA 1DQ9A 4U9RA 5KG7A 2D3OR 1S97A 4IO9Q 2V0NA 1JB0C 5CYJA 4C8ZA 3TVKA 3KHGA 3GR1A 3IWLA 4PKDB 1MU2B 2RIJA 4XPCA 4ZPWR 1BD6A 2D3ZA 1OQ6A 2VC0A 3LANA 1LOUA 5A8RB 2CZVC 2AYBA 1XC9A 5AE2A 2K7JA 1HW8A 2MZRA 1HQUA 2JOQA 2OKQA 2YKPA 3OQ2A 3U1LA 2W7AA 2DCUB 5KFGA 4YUDA 4Y3CA 3KLFB 1Y5NB 4MKBA 1SI9A 1SJ1A 1X4EA 4J5OA 1JIHA 4PWUA 2WB4A 2E5LF 3MUMP 2F9JA 2BACA 1FKAF 3JTNA 1PSDA 1R3NA 1ZZNA 1KONA 2QE5A 1R8HA 2ROPA 1HYSB 3M9OB 3BREA 2I1RA 1N48A 5GAHU 4R5PB 2ILYA 3LAMA 3D1QA 4NLSA 4PR6A 4I2QB 1JNRB 1N0VC 4O44A 3GMGA 4P2SA 1QSLA 3J7Z5 5CHCB 4I68A 2DH7A 2RKIB 1RA7A 2NSBA 4ZVEA 2OIHA 3MD1A 1RTDB 4FS1A 2E5HA 2OPRB 5K8NA 2OSRA 3BDPA 2BANA 2E9TA 3K57A 1L3SA 2IFXA 1H7XA 4LF6F 1TK5A 3AY0A 4FS2A 1VRTA 2CQGA 3KLVA 4PG7A 1O8BA 2Y1IA 4WK3A 2KI2A 1CQNA 5EWGA 1N6QA 2XEXA 4QQBA 1M5SA 2AP6A 2GMHA 1S1TA 3MHYA 4I0WA 4QR2A 4UQGA 1E6VA 4DL3A 2YKAA 2B4VA 3KKFA 2CFXA 3CCQS 1UVMA 3CC4S 2DHXA 4HTIA 1HD1A 2I9SA 1TL3A 3DLGA 1SL0A 3GQCA 3EZUA 3SCJE 2QSFA 3AQOA 2DPJA 5THWA 3LWMA 1NEEA 3M2VB 1LXJA 4ILLA 1RT5A 3M1VA 4HDGA 4EO8A 1RJJA 5HL7Q 3KLEA 1G2EA 1HBUB 4EO6A 2PA3A 4URQU 1LWEB 1HBMA 5KFIA 1U45A 4QIVA 3C6UA 3OXFA 1TKXA 2V8DA 3QWPA 3KLHA 1JLBA 1VK8A 3I55S 3DLHA 3N5FA 1S10A 2J6UA 4P7TA 1S0VA 3NGKA 3VQTA 2NPIA 2BABA 3QWUA 5KFSA 4WFAQ 4LF7F 4B17A 4F4KA 4KHPF 2JRSA 4NPOA 3MF5A 4C8YA 3GG0A 5AXMA 3NGDA 4OZJA 5CH7B 2IVMA 3VCDA 2JJ4D 3E3XA 3M32A 2YKMA 3HHEA 5K8PA 4DFPA 1NJWA 2BBEA 3R1HA 1LV5A 3C6TA 4WYWA 4O3PA 1J5OB 3DRRB 2Q6BA 1VQKS 1RT1A 3M8QB 4DEZA 3HHKA 4IG0B 2W7OA 1WF0A 2ASYA 3I4HX 4PG4A 3MECA 1P1LA 2RS2A 4M5DA 3DMJB 1N36F 2J0WA 1NB7A 1N54B 2VFTA 1JJ2R 2RU3A 2KJWA 4IRDA 2KXFA 3FEXB 5FJ4A 2A2DA 1RT2B 4I4BA 1TQLA 3OSNA 1QAXA 2YNHB 1SJRA 3B78A 1KVJA 2FC9A 3J7YI 4ECYA 1NNDA 3CT9A 1IN0A 3M2UA 3MMCA 2EBEA 3DLKB 4OI3A 3PR4A 2CJBA 3EX7B 4QJVA 1HL6A 1PO6A 1LWFB 3VWSA 1UFWA 3HDSA 3TUZC 1Q86T 1YBAA 2DNKA 1L3VA 5I42A 2EVZA 5IM0B 1F2GA 3MM8A 5CQGA 3NNAA 4ZP9A 5AXKA 4IFYA 4J9QA 2M52A 4NLYA 2AYEA 4CNZA 1GX6A 2N4DA 3NMRA 1ULRA 3FVYA 2R4FA 3C2PA 4NLGA 4LF5F 3BR8A 1J2VA 4N77A 1DHMA 1HI1A 5E3CA 2HWHA 2F9DA 2ZVSA 1SV5A 1UP1A 2B5JB 2B43A 2ASDA 2UVVA 3IS9A 1K8AT 3GV8B 1R43A 1VQMS 3E8OA 2W4DA 3TAPA 3JTPA 5KFMA 2GQQA 1HD0A 1SH3A 3V6JA 2GHWA 3MCSA 4IH7A 1H3DA 3CPWR 1L3KA 2CQBA 2FHMA 4WFXA 5J1PA 3FEYB 4HI2A 1UEVA 1YJ9S 3ZZPA 1T05A 4AFFA 4ZLPA 4N5SA 3CMAS 4B3TF 4K4VA 2LDYA 2I38A 2VPZB 5IT9Y 1SIZA 2UV8G 3DLLQ 3ONQA 3TI0A 2XHWA 1N33F 4X2BA 3QLHB 3DXSX 4I6YA 4TU8A 1Y00A 3N6MA 2NXUA 3DC2A 3DHXA 4LIRA 4ELUA 2MKIA 1KRPA 5DDRC 3PIPQ 2N82B 2YKNB 4K4WA 2W4CA 2EKYA 1AXQA 1X5PA 2C2RA 2UXBF 4Y6IA 1N5SA 3BSNA 3PX6A 5GADU 1VQ7S 2WB1D 1FK9B 2RF2A 4Q2LA 4QWAA 4OZNA 2UVWA 3I32A 4CH1A 4K5SA 4B9UA 2KN4A 3K5MA 4KIAA 3OVBA 2JFKA 2HNYA 1FESA 2CVEA 2FUG9 1RT7A 3I6PA 2R8HA 3OL6A 2IM1A 1IJFB 2MB0B 4EBDA 4EYIB 1Y7PA 1HMVB 5JJBA 1RA6A 2JDJA 2LVWA 2HHUA 1T95A 4BC9A 5F9LA 2MSTA 1RGVA 2OD6A 3FNNA 4H54A 3V4MA 3T6BA 5KFEA 2BQRA 4IH5A 4ALZA 4FF1A 2PI4A 3MMBB 4ZDNA 2KXNB 4A8YA 1YVFA 3LOUA 4F4WA 4OZLA 5A6PA 1VQ9S 2DGVA 4X4RA 3I87A 4OZ1A 5KFBA 4DV3F 3TA0A 5HMYA 3CXCR 3RRKA 4ZOSA 3D2WA 4IH6A 1VQPS 4OHXA 3OTEA 4OQJA 2UP1A 2AJ1A 3RR7A 1JKHB 4KKOB 2YY3A 2DR5A 4DR4F 3MTKA 1FJ7A 2J9CA 3VAKA 2FJVA 1TFYA 3NS6A 3E01B 4LSNB 4MIWA 1YJWS 1TVRB 1MWZA 4WFZA 5CZVA 3GIMA 3PW5A 4NLXA 1U1NA 5EGYA 2HZCA 2NS1B 2ZHBA 3DRXA 3FGVA 3PV8A 3OV7A 4V19J 4F25A 2HHTA 5JVGQ 1RT4A 3G6ES 1U4BA 3RB6A 2CJKA 1UJ5A 2FHOB 2GX8A 2OMLA 4QWCA 3WC0A 2M2BA 3PW0A 2MGZB 2CDQA 5B0CA 1ZAXA 4X64F 2IJNA 2M3DA 2MKJA 5KFPA 4X4SA 3CC2S 3V6HA 1UW4A 5HMZA 4MK7A 4TU7A 1LFWA 5KFZA 3QIPA 2QFJA 2MMYA 3BGRB 2HNDB 2MJNA 1X7VA 2YWGA 4OI4A 2YQ3A 4DDFA 4AQYF 2UUCF 4DQIA 4RBUA 1DFDA 3T9ZA 5SZTA 4DR5F 3MM5A 3IR7B 5DLFA 1SUQB 4RW9A 3OFFA 3DRPA 3CULA 2JVRA 4DX8H 3MR6A 3HKWA 2ZH1A 1VBZA 3PO4A 3S1TA 5D6GA 1YHQS 4H4OA 4QW8A 2ZH7A 4ZPVR 2RILA 2EG2A 2CPDA 4RLEA 2J0SD 2YNIA 2HHWA 5BR8F 3VAJA 4KO0A 2G0CA 3Q0AA 4USJC 3D28A 1O51A 4B3OB 4G1QB 1S6QB 1KN6A 5KT5A 1VIOA 2V4QA 2PGCA 4A8OA 4PG8A 1VQOS 5C25A 1WF2A 1GAOA 5J1EA 3P6YC 4ED5A 1U6BA 1GXTA 2X1FA 2YX4A 2KYZA 2Z2MA 1SBRA 2HHVA 4ZHRA 3O44A 4KV8A 2XY7A 5D8HB 1T94A 1ZM4A 3CCWA 2I5JB 4USHA 5HLFA 4DQPA 1SB6A 3Q22A 1FRXA 2MZQA 3VZIA 2ALZA 3FQKA 4HI1A 4PXCA 3TRGA 1DTQA 1TL1A 2F7VA 1T7PA 3U7JA 1KQGB 2A2CA 2DHAA 4IKAA 2ADCA 5A0YA 1X4AA 4HTJA 4DUZF 4TY9A 4YOEA 2VG6B 1HBOA 4XPEA 3G71S 2VKZG 1BWEA 1HQEA 2QRRA 5EX3A 2R7TA 1ZOTA 1H2VZ 2KHCA 3QGIA 1Z4UA 4MH8A 1NK6A 4YEAA 5HQ8A 2O01C 4U7CA 3SV4A 1MSWD 3CD5A 3VAIA 2R8KA 3R5BA 2XC9A 3CDWA 4NA3A 5FDLA 1RDRA 1AFJA 3MAQA 3PM9A 3G4SS 1U1RA 1H6KX 2ZDOA 2ZOGA 4C0BA 3G9CA 3QMQA 2FDNA 1HQUB 4UOCA 3MPYA 5I4MA 3OSPA 3NCQA 2VV5A 3UWTA 2QMXA 2UVRA 2CQPA 3G8QA 1YGYA 1SJ4P 1KS2A 3SYZA 4Y0FA 2YNFA 4MIAA 1S6UA 1N56A 1V6HA 4IQMA 1HNVA 2R2TA 2BJEA 3HI9A 1VFJA 2ZITA 4M8LA 2HVIA 5E7OB 4O3OA 5IQQA 2YWEA 4BBYA 1RQ0A 1NK0A 4LMZA 4DL5A 5KFQA 5IS2A 4K4TA 2J76E 2JLFA 5K14B 4ZCLA 4RU9A 1CQMA 3UD3P 2WSFC 4B02A 1R8BA 4UUWA 5L9NA 1N52B 3F41A 3PX0A 1VIXA 3M8SA 1N32F 4CH0S 2L9DA 5IZHA 2DO4A 4Q44A 3HP6A 1D3WA 3J7YU 1E6YB 4K59A 4F2SA 1S0MA 5MLCV 2C3UA 2EWHA 2WK4A 2DNPA 4B9TA 2AJQA 3G96A 1FRMA 2BANB 2OPPA 4BS2A 7FDRA 3VTIA 4MFBA 1JLAB 3GG1A 1VRTB 2E7XA 3MEGB 1AW0A 5F8JA 4U6PA 3HMJG 2Z8QA 4ETXA 4RNOA 2X1AA 3QGHA 3DLEB 1N6QB 3T5JA 4J9PA 2OMOA 3MR5A 3C8YA 1E6VB 1X9SA 4DLEA 3IAM9 3IR6<