3PACA

Crystal structure of pdut a trimeric bacterial microcompartment protein with 4fe-4s cluster binding site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
183
Chain Sequence
SQAIGILELTSIAKGMEAGDAMLKSANVNLLVSKTICPGKFLLMLGGDVGAVQQAIATGTSLAGDMLVDSLVLPNIHASVLPAISGLNSVDKRQAVGIVETWSVAACICAADRAVKASNVTLVRVHMAFGIGGKCYMVVAGDVSDVNNAVTVASESAGEKGLLVYRSVIPRPHESMWRQMVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shell protein
publication title Structure of PduT, a trimeric bacterial microcompartment protein with a 4Fe-4S cluster-binding site
pubmed doi rcsb
source organism Citrobacter freundii
molecule tags Electron transport
total genus 52
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pacA02
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pacA01
4P7TA 4OX8A 3SSRA 3IA0A 3H8YA 4P2SA 3MPWA 4PPDA 4LIWA 4RBTA 3I96A 3I6PA 3PACA 3SSQA 3CGIA 4QIEA 3N79A 3MPYA 4OLPA 4OLOA 4RBUA 4DDFA 2A18A 4QIVA 4QIFA 4OX6A 4P7VA 4QIGA 2G13A 5L38A 4OX7A 3CIMA 2A1BA 2EWHA 4RBVA 3DN9A 3NGKA 4AXIA 3NWGA 2A10A 5DJBA 3DNCA 3SSSA 3BN4A 3VCDA 4AXJA
chains in the Genus database with same CATH superfamily
4LF8J 3CVKA 1Q8KA 3HHLD 1NBEB 3MMJA 1EETA 4O3NA 4MFBB 3HSDA 1R8BA 4C11A 1XNQF 3AA9A 2YKQA 2EW9A 3AQOA 4YB5A 4CLYA 3T1YF 3D1QA 1GFWB 2I6WA 1KNZA 3C2PA 2ILYA 2E44A 1FJGF 3X1LB 5GAHI 1VRTA 1FEHA 5D15A 1RHUB 3MUMP 4QW8A 4ES2A 4DPWA 4C48A 3BN4A 1WWHA 4EYHB 4YMEA 1R0AB 1FJEB 1RLDA 3QRPA 3A12A 3M8QA 1RBLA 2WVBA 3IMQJ 1RAAB 2CJYB 3I56S 2R8IA 4F3OA 1S1VB 2FHOB 2H65B 2FJDB 2CVIA 4P2MA 3FEYB 3I32A 2ZITA 1HI8A 4G1PA 4E98A 2AX1A 3NCQA 5DQGA 4LF9F 4QWDA 4J9MA 4HKQA 3RW7A 4RWXA 5LSRA 1FWPA 3EGWB 4HDHA 5H1SV 4LBHA 3FMWA 3M8ZA 2R2RA 1H6KX 2E5LF 2CADA 3OL9A 3A4TA 2QLBB 2K3KA 1GEHA 5GADI 5IV4A 1YI2S 1HNVA 4DG1B 3JB9k 1SL2A 2GHPA 3MPUB 3KLFA 1TKXA 2BOPA 3W7BA 4CO2A 1CLFA 3M9NB 2BX6A 5KT3A 2DH8A 1ACMB 3TEGA 2DO4A 3W65A 1IKVB 1NRKA 2L48A 4Y0FA 4U67Q 4IFYA 4EBCA 4C3KA 2HAIA 3GIMA 3SZ2A 3GIIA 1RTJB 4LVOP 1KLMB 4HI1A 3TZXA 3C6TA 1LWXA 4C8YA 2M0GB 3Q22A 1NXIA 2DXFA 1OQ3A 4JI1F 3MECB 2M9KA 4WKYA 4KGKA 5HP1B 3HD2A 4CO0A 2DGTA 3CWJA 2XGPA 4BBYA 1XMBA 2O5DA 2ATCB 4RW9A 2VG6B 2Q6CA 2VFVA 3N6NA 1M1KT 4OYPA 3Q86A 1BUXA 1SQGA 5T7LB 3TI0A 4NYZA 2ZBQA 1RAJA 2SXLA 1RU2A 2KI2A 4LREA 3D54A 3CD6S 1H72C 4DV0J 3I0SB 4F4KA 3C19A 3WHIA 2NSBA 5DDQC 4J90A 4USUA 3HDSA 4NA1A 1FFSB 3IFEA 3DRSB 3G8TA 1TQLA 1S7HA 1FA0A 4GVBA 4TNOA 4DSLA 2G1DA 3BDEA 4CH0S 4TQSA 3K58A 4M5KA 4FPIA 3FBFA 1VQ8S 1EIYB 3ZZYA 1RACB 5CYMB 4DV5J 4KO0A 1D8YA 2J7UA 4HHUA 2VBXA 3AODA 1WI8A 4LFCF 4DQRA 3JTNA 4J9SA 4P75A 4IG0A 4LRBA 4WP3A 4Y3CA 3NRBA 1UVKA 3PIOQ 2OI2A 2X1FA 3M2UA 1JLFA 2QJ3A 1I5OB 2D3ZA 3A3PB 3K57A 4MH8A 4ICLB 1UMJA 1PC4A 2OD6A 1UVJA 4FBTA 3FBEA 4JOUA 3GFHA 1KFDA 4RNHA 1C4AA 1H2UX 4NXMJ 4PG4A 1TAUA 4YFUA 4FYXB 4JV2A 2HSEB 3HT3A 1LWEA 4OI4A 1VQMS 2MSTA 4ZVRB 3R1LA 3HHNB 4A48A 1N0VC 2OPQB 2WBMA 2VPYB 1BQNA 4DN0A 1VQ4S 2RIJA 2AGOA 4JI2F 3CCVS 4OV1A 3AT1B 2JEJA 5HSPA 3DLEB 4Z37A 1QD1A 2RKIB 1X0FA 4DUYF 4ZJQA 3M7VA 1RWUA 2WVFA 3GYGA 4ECXA 2MZQA 2YNGB 3GILA 2FDNA 1CEZA 3OSPA 3K8WA 1HA1A 1XK8A 1N48A 3PR4A 1HWUA 1S9GB 3PFOA 4C8OA 1WUUA 2VFSA 4DUZF 3CJ4A 3HVTA 4DF8A 2VQFJ 2BDPA 4MKAA 2R7OA 4USWA 2ZKUA 3TUIC 2KG1A 3SQGB 1JJ2R 2DHXA 2RSQA 2BV3A 1VCTA 4X62J 2GFFA 4DFMA 1WOPA 1SXLA 3H4BA 2HVHA 1ZA1B 3PYGA 1TVRB 2YX4A 5K9FA 4KJIA 4ZCLA 1E6VB 3KMSA 3R5JB 1QVFR 5ETKA 1NK7A 1M0SA 2ADBA 4NMLA 2P9GA 3LH2S 3BGUA 3WDOA 5LSOA 3ADAC 4NOHA 1XC9A 4RW8B 2MKJA 4LSLA 3HVRA 1U25A 2L08A 3JQKA 2N4CA 4P7VA 3ZZ0A 3VAHA 2MY7A 1HWLA 1JLBA 4OJGA 4G6VB 2XMMA 2YKNB 4Y2AA 1JMTA 5IV3A 5AXKA 2V8GA 2OPSB 2J9DE 4TVAB 2HZAA 3RR7A 1HNWF 1LWCA 4ZMMA 3EVWA 1S1VA 4LFBJ 4FZVA 4W90B 2AEFA 3BQ0A 2Z0GA 1J2VA 1NUEA 3KJVA 2B4OA 2CZ9A 2GAGC 2MQLA 3MMAB 3K59A 4DPYA 1Z4UA 3M2RB 5E3AA 4XDCA 3T6BA 4Q2LA 1SC1B 1VISA 3H90A 4RUHA 5KFPA 3MPWA 3O1LA 3KJQB 2AYMA 2FQQB 3BS9A 4RNNA 2CAJA 4KHRA 4ZKAA 4L3NA 3Q8PB 3CJTA 2FJXA 2HGNA 4PKDB 3V6DB 3C3LA 1NO8A 3D3CJ 4OZ2A 5T14A 4OZ3A 2NXNA 5ETRA 2C3PA 3AOBA 3TAQA 1FNMA 3B4MA 1FRIA 3BH7B 4X4OA 5JXSA 1NSPA 2CQPA 1HNZJ 1RTJA 1RKIA 3AQPA 3BEGB 3CDUA 4WCEQ 1G3OA 4Y2KA 4M1KA 3UR3C 3GFYA 1BWEA 2DHHA 2ZDOA 1WHXA 5HQMA 2NQPA 4CLPA 3QMQA 3HHKA 5HP1A 3QT6A 1B0PA 2FTRA 5J2MA 1WC6A 3FCHA 2VG6A 3RBEA 1Y3KA 2ABYA 2ZBRA 1L3KA 3JTPA 1M1HA 2X1BA 1U45A 3HSJA 4B08A 4PABA 5T7LA 4WU3A 1Y10A 2JVRA 2IM3A 1LEOA 1YRUA 1S6PB 3N6LA 2W2NP 3I0SA 2C2RA 2CQ4A 2HQDA 2BRLA 4XDDA 3THPA 4ECUA 2KYXA 3QNWB 4USMA 3NEKA 2F3JA 3EGNA 1Y5LB 1E6YA 3EXYA 3FRYA 4AXIA 3LTOA 2CDRB 4M8LA 4B3SJ 1JLCB 3NS6A 1O51A 5KG6A 3IWNC 4CM2A 1S0VA 1OJ4A 1EJ7L 2YX7A 2ZE2B 5C25B 4RX6A 3KG1A 2XG8A 3OBIA 2J9DA 4ETXA 4OYMA 1C1BB 4L76A 2FY8A 2W7AA 1TV6A 2LXFA 3RAQA 5LXRA 3WC0A 1NJYA 1VQSA 5AXMA 5F9NA 5D78A 1FHTA 5I4MA 4OI1A 4DV3J 1FKOB 3LALA 5CZVA 3G6ES 3TJAA 4RL1A 2DRDA 3CDWA 1R8HA 3C16B 2Y8YA 3IRXB 2XI3A 2GNKA 5HQLA 1SC4B 3PW2A 4DPOA 4MMOA 1OSCA 2DT9A 4N5SA 4RWWA 2AYEA 3ZC4A 1J5EJ 3THTA 5K14B 3KK2A 3OW2R 4IOCQ 3RW6A 2VPXB 3M6UA 4LQ9A 3NNCA 2DR5A 2AX0A 4OZ0A 4M5HA 3R9LA 4YS2A 1LQ9A 3TJ8A 3C66A 2CJAA 2GA7A 1R3NA 3MMCB 2YNGA 5HROB 2GHVC 2IDLA 2NXUA 2KYZA 2XYHB 1CJVB 1QAYA 5FD1A 3UQSA 3LWMA 5D0RA 2QN6B 3M32B 5LJ3Y 1RT6B 5HK4A 2JFDA 3GCXP 1KVKA 4ZPCA 5M2UA 5J2QB 5D77A 1S6UA 1NEEA 3BGOP 3UVJB 1T94A 1VHFA 2N4DA 4IQMA 4F2RA 1S59A 2DH9A 2D3O1 5SUHA 2V9KA 3LPEA 2EBEA 4C4WA 4B17A 1Y11A 1AFIA 4QQBA 4PPDA 4AQYF 2YH1A 4ZN1A 3TQ1A 4F36A 3QGIA 1TVRA 5C5JA 3VAKA 4JI7J 2L9DA 1E6VA 3R5DA 4DR6F 1GX5A 4E2FB 3CJRA 5A2QU 2FJEB 3H8YA 2UUAF 2PI4A 1CG2A 3ETMA 2NXJA 1DQ8A 1SPBP 1GMVA 4RW8A 3TYTA 1M5SA 4YHHJ 2ALYB 4B3TF 1XBWA 2I0XA 1KHWA 3W8PA 4ZLNA 1VRUB 1RYSA 3QGPA 2MQQA 5ADZA 1MSWD 3HHLB 2NXCA 1GQEA 3AOCA 3I82A 3UD3P 2OPSA 2MDAA 3QRQA 4JV5J 3V4MA 2HKEA 4FNHA 4FKYA 4ELTA 4IRDA 1SIWB 2VZ9A 4MT1A 4ECRA 3MHYA 3ZTQA 2QL9B 3RB3A 3CC4S 3ZO7A 3T1HJ 2W4CA 3H5UA 4NLYA 2A2CA 2V50A 2HQ3A 1HQEA 5GMDA 5F8NA 5AE1A 5KFWA 4X4NA 3K7RA 3TX8A 1CQMA 2E5HA 3VCDA 2XULA 3QPIA 3M2RA 2RS8A 2DH7A 3CD0A 3E3XA 4UOFA 2WOMB 2B6AA 3VR1A 1LV5A 1CC7A 4Y00A 1BLUA 2IM1A 2IA0A 1FRXA 1WSVA 1S1XB 1URRA 3D68A 5F8LA 2WW8A 3S6EA 4LF8F 3IP0A 1IR0A 3W2VB 2WHOA 3FCVA 2DJWA 2FY1A 1YJNS 3TOQA 2V63A 4BS2A 1PGZA 4F4YA 3IGVA 3FC9A 4KR0B 3OSNA 4KGVB 4PWUA 4H4OA 4DL3A 1PO6A 2AU0A 2BUNA 4C3LA 4AYBD 3KHGA 4W98A 3GCWP 3HULA 1HD1A 2GS8A 3I4PA 2X3DA 1M5KC 1HWIA 1VQYA 4CWBA 2QA1A 2RILA 2AP6A 4S0MA 2ZVIA 1FNXH 1FWLA 4IDKB 4K4SA 2H1YA 5RUBA 3D1HA 6FDRA 3G86A 3MR7A 2XWXA 2LDIA 5J1PA 4WBFA 3Q0AA 4J37A 3QIPB 1N5QA 2AMCB 5EN1A 4UF4A 3GG0A 2XMVA 4RNFA 4O23A 4P7TA 3CCSS 4ERDA 2RDJA 1S6PA 1IN0A 1FX4A 3DU6A 5A8KA 3ZZRA 4X66J 4RBVA 4CH1A 2VD3A 1P9QC 1KHVA 4LF5J 2YWKA 4QBUA 4RPFA 2YWWA 4ETZA 2AZ1A 5D4NA 1JLAB 4C98A 2WAQD 3IM8A 4NLRA 1IJFB 4MYUA 4J9QA 1JLCA 1FD8A 1I51B 3AB4B 1RDRA 5FIIA 4MIAA 5IZHA 3LWLA 2ZE2A 3E01B 5C25A 3DOKB 4HTJA 3S7RA 2JSXA 1RABB 4WKRA 4EUVA 3GV8B 1CJTB 1OSDA 4B9VA 1C1BA 5BYQA 4LFAF 3M05A 3KUGA 5DQIA 1WC3A 3DM2B 3MR2A 3M2VB 2QYCA 1PYTA 4KFBB 3OHBA 2R2SA 3BYRA 3EUNA 2GC8A 3G4SS 2IM0A 4B9SA 4B3OA 1K0VA 5KFMA 1GAOA 4J7CA 1FKOA 4YOEA 4L6V3 4K4WA 1VS3A 1GT8A 3IRXA 5H9EK 4C8NA 3DDKA 3DXSX 5LMNF 2CKWA 2KM8C 4HH0A 3FK4A 3PNIA 2P9EA 3JTOA 1TZ0A 3L95X 1HARA 2EXUA 2ZD1A 2HMIA 3GJQB 2UXDJ 2PA8D 3DYAA 2R8KA 2BM1A 2VQEJ 2RQMA 4QW9A 1O0PA 5K14A 4J9VA 3OPKA 4DV7J 2KH9A 2VBZA 2NPIA 3NGUA 1NDLA 4EBEA 1IM4A 4AL5A 4K2XA 2E5IA 3CXCR 4RW6A 1SCJB 2BJEA 4DV5F 5IOLA 2B43A 2GIQA 4CO4A 4TU9A 5KOXA 2IFXA 4ER8A 3MMCA 4DV2J 4A8MP 4HVZA 5HROA 4NXNJ 3W8GA 1QUPA 3RRHA 4NLQA 2EEYA 4LR9A 2V9WA 2PE8A 3M32A 1PBUA 2QMWA 4RKUC 4IH5A 3J80Y 2KT3A 5K8NA 4ES1A 4K5RA 4DSJA 1RT2A 4KC5A 3T6JA 1RHRB 3D0HE 3ZTOA 2LEAA 4IRKA 2IC3A 4UQTA 2CPXA 2IVMA 3W5ZA 2CPDA 2BRKA 1HHQA 4Y2IA 3BSNA 1IJEB 1UZHA 2XBPA 2BXJA 2FYXA 3GONA 1CVJA 3PO4A 2CJ9A 4HI2A 4C7QA 4NCGB 4JUZA 1TFWA 4ZLPA 4DU8A 2WONB 3RAXA 1X4HA 3QGGA 3GJTB 2BA9A 3SSQA 3PW5A 3ZTPA 1Q8LA 3OR2B 1VYAA 4Q45A 3AJ1A 1U49A 2MPUA 2F8HA 2AYBA 1VRUA 1QAJA 3Q2SC 2CPIA 1LFWA 4NEYA 2GHWA 3QSIA 2ZWPA 4HYKA 4B3RJ 2X1GA 4LF6J 1D3WA 4UUXA 1FX2A 4UTGA 4QR2A 1YITS 1HMVB 2Q3PA 2E1MC 3LANA 3PCOB 3JAMY 4ELVA 4ZPAA 3DU5A 3T5KA 1IKXB 3MZIA 4F0KA 2BM0A 2VQFF 4JP8A 1NKBA 1HHTP 3CT9A 1N54B 4ZLJA 1LNQA 1UKUA 3CDBA 2E5JA 1X4FA 2RNEA 2WOMA 2GQQA 4HEA9 4CLFA 3V5RA 4X62F 1QVGR 2Y3YA 1LXNA 3SCJE 3QJLA 4U9RA 2Y1LB 3JSRA 3TANA 3OTOJ 4OHXA 4MKYA 1FI4A 3UFCX 2GJ2A 2CJKA 2J9EA 5A8RA 3SI8A 2ZDPA 5BR8J 2MQMA 4F25A 5CCLA 4ZVHA 1FRLA 2MJUA 3NOGA 4MJKA 2A3JA 2EC0A 5E33A 4A8OA 1IUJA 3WIVA 5A76A 1ZBTA 1WKLA 1B7YB 4P72A 2C1EB 4IDKA 2OH2A 2MKSA 1D9AA 4QYRA 2DPJA 3KWMA 3TUZC 1S6QB 2VH7A 1FXLA 3DRYA 2AF6A 4C8LA 3QIPA 1X4DA 4LFBF 4YY3J 1WG5A 4O0NA 4Y6IA 2J7KA 4X4VA 2OPRB 3GPAA 1HW8A 2HQCA 3MEEA 3E51A 2R7RA 1H2VZ 5AE2A 2XHWA 5KTQA 2BQRA 3MEKA 1FTRA 2A2DA 3PM9A 4YP3A 3G9CA 2Q79A 3FEXB 3V6JA 4KIAA 2JEFA 2OEKA 2JDJA 3VVTA 4IYQA 2IM2A 1KC8T 4G1QB 4TQRA 5IS2A 3B8HA 3NWGA 2AEMA 2NLWA 1CS4B 3LW5C 4AT1B 4FYYB 4DN9A 1U02A 3UD5A 2HK3A 4DX6A 3H5SA 3WBZA 4N47A 4OYZA 5K8PA 2DGOA 1HNZF 3E01A 3DOKA 2AGPA 1S4FA 3MM8B 1HWKA 2XWYA 3H5XA 3M9OB 1S79A 1N5YB 2B9YA 1PIEA 1F6TA 3HO1A 4TLRA 2ZH8A 4CT8A 1JXEA 2R42A 2DNNA 1N32J 3CIMA 4C8KA 2UUBJ 1V5VA 3BDPA 4QU7A 2QMXA 2JVOA 1VQ6S 2H4WB 2V67A 2J0WA 1RHJB 4URSA 2CPFA 3VALA 4FF3A 1U48A 4J9RA 2HS0A 3UD4P 4GKJJ 5I3UA 2R7SA 1EX8A 1JWWA 5CAAA 5KFVA 3KG0A 4WFZA 4I56A 2VU5A 3N5FA 2BMBA 3N28A 2JZ5A 2WB4A 4J9LA 4CLSA 1C4CA 4AL7A 1M5PC 3OL7A 2CPZA 3GG1A 2EFVA 5DG7A 3G8QA 3KK1B 3U1LA 3LP1B 1RT5B 3P4UB 3G82B 5I42A 4B3SF 5IM0B 2ROPA 4J9NA 2NZ4A 2PSZA 4NZ0A 4LSNB 7AT1B 2FIUA 3ENQA 2HWIA 2V8DA 3UDEA 3W5XA 2Z2ZA 2CZ4A 2VA2A 4HR2A 1YJTA 1RT1A 1ZTWA 2YNFA 1UW4A 3R1HA 2RJZA 3CC2S 2CPJA 5BXIA 4CYUA 1TL7A 1C2PA 1EKRA 2RF2B 1TL5A 1TU0B 4PG7A 1RB0A 1Y3JA 3VZIA 2F4VJ 3CC7S 1N33J 4DV3F 3U27A 1H7XA 4IH7A 4JI4J 1TELA 2VUGA 1YSJA 3AH6A 4U96A 2OTLS 2XYPB 2DCUB 4BHQA 1J5OA 2WSFC 1IKYB 2MSSA 2CQ3A 2GO9A 4DR2J 4NCGA 1SB6A 3IC1A 3MEDB 2WONA 2RUSA 4OV6A 3NS7B 2RDIA 2OJ3A 3JYTB 1J5EF 2GMJA 2E1RA 2WBRA 1W2BR 4QPXA 3PDNA 1JJ4A 3OR2A 2H5EA 1IXKA 2VJUA 1CULB 4IRCA 3J7A1 4KHPJ 3UO0A 3NNAA 2KO1A 4IOAQ 3C46A 1ZH5A 3G87A 3IM9A 1KTVA 4C0OC 4GC6A 2W9CB 4QWBA 2QO3A 3QSYB 2V2QA 1SJRA 2FLLA 3CCUS 3KK3A 3CEDA 4DMZA 2MKYA 2MY8A 4YB6A 2HVZA 2W24A 3FMBA 2BEFA 4FVMA 1UEVA 3PJWA 2MQPA 3CMES 1K9MT 2RH3A 4OLPA 4DWIA 2E7XA 1U26A 4RW7B 3EZ5A 2XSJB 2R2UA 2HNDA 2WSEC 3FUYA 4V1Ak 4OZ5A 3Q8SB 1S97A 1U24A 1RWMB 2HFUA 3J7YU 1FD2A 4V19J 2J0SD 2E5GA 2HHVA 4HDGA 1T05B 3OUYA 1SJ3P 5E41A 1O5JA 5KG5A 3I96A 1WOOA 4OYOA 3OLBA 3VAIA 3EWGA 3FNNA 2AHOB 3WX4A 1KN6A 4B02A 4ZCMA 1YJRA 3BH6B 4OZLA 4YN3B 2MQ8A 2HFOA 4DF4A 1S6QA 1RTIB 4RO0A 3OQ2A 2ILZA 3T1HF 1BQMB 2W7OA 5D6GA 1HQUA 3IXQA 4B9UA 4WE1B 5HMXA 4TU8A 3CD7A 4OZ1A 4AUKA 4F50A 3L9ZA 3NP5A 5DDPC 1BGXT 2OSQA 8RUCA 2WVEA 5B09A 2V68A 3ZNJ1 5F8JA 1O6XA 3M8PB 2FPHX 3CJ2A 3EVOA 2W01A 1YVFA 3KNAA 1U1LA 2EVZA 1Y4ZB 2QLJB 2OIHA 2PO4A 3ITHB 2XCPA 1R0CB 2FLOA 3MM8A 2KB2A 2EI5A 1PKUA 1N5YA 1A6LA 2F63A 4RR5A 4F02A 1TL1B 4M5LA 1T95A 2LYVA 1L3SA 1AZSB 3N9UC 2UVVA 1GX6A 3OTEA 4USHA 4EYIB 3ONQA 2DNYA 1ZM3A 2UP1A 5AT1B 3MAAB 1HQ2A 2PC6A 3GP9A 2ASYA 3D4JA 4DEZA 2AYGA 1FKPB 3BO3A 4P2FA 1FESA 3IBWA 2XSFA 3KHLA 1A0OB 5GAEI 1K1QA 4KH0B 4ECTA 3D7SB 4LIRA 4X66F 3I0RA 3K5MA 4Q43A 2CNLB 4KGXB 3RBDA 1FT8A 3JSBA 3PEJA 1U2FA 4NLTA 3GFXA 2K06A 4DR4F 4LF5F 2GGPA 4O3QA 2QSFA 3SYZA 3DXBA 1UZDA 3KK1A 4K5SA 5C2CA 1SVDA 1KDNA 3V6HA 1RT5A 2MHNA 4URQU 3FDSA 2AV5A 2YKMB 3G82A 4JV1A 2ZOMA 2NS1B 4UUWA 1H7WA 2DISA 4YR3A 3CGIA 2GVDB 4JI8J 2K1RA 3QWPA 4LSNA 1JLEA 3EPIA 1KP6A 4DQQA 2BANB 1OY6A 5EX0A 2N7YA 2C42A 2L3MA 2QT7A 3QO9B 2AZ3A 3QT8A 1R8CA 1KLNA 3I9ZA 5CABA 3S8SA 1F9EB 2HK2A 4ECQA 2AT1B 1JLQB 4UZBA 2GMLA 3QT7A 3EXCX 2RDDA 3JSYA 3QATA 4FDFA 4P73A 3U7JA 4G3IA 2XYGB 3QWUA 1CJUA 1IKYA 3A13A 1FRKA 1HYSA 4I69A 2Y8WA 3FSXA 3K17A 2VICA 1S4EA 2K3IA 2MQNA 3PFEA 3JYTA 2YWFA 1VJQA 2VQEF 1NAQA 2MXYA 1B3TA 1CULA 3KUEA 5LSLA 1S9EB 1FTCA 4DXLA 4DOZA 3LO3A 2XLIA 3OFHA 3I5BA 3PX4A 3GV5B 4ZP8A 2O1PA 3QAEA 4FNIA 2B9EA 2F9DA 4UY8T 1S1TA 1WOSA 5M2RA 4DV2F 4KTQA 2IAJA 4NXNF 4NI2A 1CPZA 2X1AA 1APSA 4GKKF 3CB4A 2YQ3A 1WTFA 3KDOA 2C28A 3BV8A 2I2YA 4DFJA 1OQ6A 1DTTB 4ED5A 3J80U 4FPRA 2P6TA 3TX0A 3GYXB 1SUQA 5HL7Q 1HI0P 1B4SA 3MM6A 1AT1B 5CD4A 3PJXA 3NAHA 1VC5A 2YWHA 1YZ7A 1IKWA 2XSJA 1VQ9S 4Q5VA 5KFYA 1RXOB 4PEOA 5ETTA 2KFZA 1QTNB 2DBBA 3FZ2A 1T05A 2HNYA 1N34F 1ICEB 3ISNC 5HANA 2JHEA 1IBKJ 3CO9A 4JI5J 1WG1A 1GMWD 1EKSA 3HX9A 2ZWOA 2G2ZA 1WEXA 5FDLA 3MUVP 2J9CA 4DFPA 1TUWA 4FF1A 5KFTA 4AD6A 4L3KA 4CTAB 4DV4F 4WK3A 4B3RF 2GX8A 4GC7A 5K5MA 8AT1B 4DL0C 3M6XA 1RTIA 4ZVPB 1BE4A 1V6HA 3POTB 3UPFA 2W8LA 5EUHA 1RQ0A 3SFGA 3JAMU 2FD2A 1N5TA 2V8PA 2ZUGA 4ED7A 3DLLQ 1BQMA 3PKYA 2ZC3A 4LQ3A 3R5CA 1ZM9A 3TAPA 2B7CB 3K0JA 2GIRA 2G4BA 3ZTRA 4XO0A 4RW4B 2E9RX 5B0GA 2W9AA 3C6UB 4MIWA 4LIWA 2R7XA 2EFQA 4W92B 4DPTA 4A46A 3MM5B 5LT5A 3QLHB 3A1YG 4OJ3A 3D5MA 2WVCA 3CE8A 3EYZA 3DNCA 4DZDA 3HXMA 1DFDA 1LFPA 5F8MA 1RA6A 1F5CA 5ETPA 4Q0BB 3I6PA 1FK9A 3KTQA 2JRSA 3T9NA 1S49A 5BR8F 2A0FB 4Q8EA 4NZ6A 2UVWA 1TK5A 3IAS9 3CUNA 1OWXA 2Z57B 2D3OR 3EICA 1WELA 1X5OA 3OJSA 1U8WA 2LQ9A 2C2ZB 3PG9A 3AA8A 2DGSA 4Z2XA 2ZH2A 5EWEA 1H38A 5GAEU 2B0GA 1TL1A 3D0IE 1XJWB 3HLUA 3RRKA 3TZWA 4EMDA 1K73T 3R5BA 4I6WA 4NA2A 4I6AA 5DZ6A 1K44A 3W2WB 3EE3A 1XMQJ 1B64A 1SH3A 3VF0B 4YEAA 1IBLF 1UTAA 2HQIA 1FKPA 3WX8A 3K5NA 1UP1A 4HACB 1VQNS 3QJPA 4PAAA 3PW0A 1NDCA 5DO2A 1TL4A 4CLLA 3OFGA 1D8ZA 2CPEA 3OL6A 2FVQA 4UW2A 4ZA1A 3GZ7A 4F0MA 1VQOS 4CH7A 1XNRJ 2HZCA 1RAHB 2IJFA 1VK8A 2BW7A 3FFIB 2WRMA 3MPYA 4TU7A 2GIFA 4WP9A 1ZAVA 1U47A 4CLTA 5HN0A 4LF1A 4CO5A 1KFSA 5ETMA 5THWA 1RA7A 2XZWA 3LUYA 2YKMA 3PHEA 3AD7C 3TA0A 4JB8B 2EKYA 2Y1JA 3JQJA 5CYQB 2Z2LA 5HATA 4NASA 1VIOA 5C24B 1OPIA 2FZKB 3M8WA 5D8HB 1Y5IB 1S0MA 4A8FA 1VBZA 3AOAA 2BANA 1IWAA 2IVYA 3IR5B 2V4JB 2XS5A 3QO9A 3L3CA 4DCOB 2ZNZA 1HI1A 3BR8A 2KXNB 3NNHA 1Q0NA 1N32F 2J7WA 2N3LA 2UUBF 1UEUA 1SIZA 3EGVA 3L7OA 5DJBA 4K4YA 4QR1A 4KV8B 2W9BB 1W26A 1MNEA 2CQ1A 2O66A 2RS2A 2I38A 5HMWA 1Q78A 1REVA 4XPEA 3ENVA 2UVRA 3QGHA 5KT4A 4P74A 3FSIA 3EPGA 1HHSA 3BPSP 2PT0A 5CYJA 2XTJP 3PV8A 4O4RA 5JVGQ 1FRMA 2CNNB 3OVAA 1B7FA 2HFZA 2M88A 2PN6A 2IBOA 2R4FA 2MGZA 2ZM6F 2MMYA 3PYFA 2IJRA 2X51A 2KT2A 3MFIA 4DR7F 3K8VA 4LF4J 4DR1F 4IFVA 2DR9A 2BABA 5ETVA 5E3CA 3R6GB 4KGZB 4IO1A 3DOLB 5KT7A 3HMJG 3KLGB 3SCIE 3PVXA 3UE2A 4WU2A 5GVQA 3DOMA 3KJFB 1MMDA 5A0YB 2QTWA 3LGNA 4L74A 1LWFB 1RTZA 2CQGA 3NG8A 1SKSA 3LP0B 1T9UA 1SC3B 1AROP 2RD5C 2QGFB 2E1AA 3N5BA 5KFZA 3BM7A 5D0HA 3M4XA 3FQKA 3UDVA 5ETQA 2F4VF 3B4DA 5KFQA 3DLHA 4BC7A 1Q7LB 2OP5A 2UXCF 4DUTA 1WF1A 4OYWA 4QIWD 2G0IA 1H98A 4DR2F 1OPZA 2J0QD 2VBYA 3IWXA 3CJ3A 1K8AT 3BKTA 3K5PA 2JX2A 1NZAA 2QLXA 2IRYA 1T03B 2CZVC 1HNIB 3SBMA 4LF7J 1K47A 4I2QA 1UCNA 4H4MB 4CRJA 2IHR1 2OLWA 4F8RA 1KD1T 1BY9A 2RRBA 1JXLA 1MU2A 5KFUA 4ZVGA 1N6QB 4CTAA 1QE1B 4X65J 1YQHA 1IQTA 3H2LA 4K59A 4RUCA 1HKAA 2H5JB 3MXHP 3NGTA 3TO8A 2AQ4A 4ECYA 2CQ0A 3KHHA 4HL9A 3BO4A 3HCXA 4PG6A 4BC9A 5KFGA 3GLJA 3KXDA 4Y65A 1AYEA 2DNPA 4R5PB 3BN7A 4PQAA 2P5VA 2CQBA 1EHWA 3QRRA 3V2UC 3T1YJ 4N41A 1ZZFA 4C2MA 4PXCA 2J6UA 3C6UA 2UV8G 5CH7B 2FJBB 2HNZB 4A8WA 1RHMB 4F4WA 3VAGA 3IS9B 4NLGA 3QLHA 4HH1A 4F0HA 2XZTB 2VKZG 4QWAA 1HIYA 4BCAA 4Q0BA 4FYWB 2CUYA 1MN7A 2GJIA 2YPYA 3FVYA 2MTLA 2DHGA 1QAIA 1UVIA 1LW2A 3D0GE 1NJIT 4O4GB 4WIIA 4K4ZA 4ID5B 2QA4G 3ILIA 4LF9J 1UJ5A 2WW4A 5EGYA 3SCKE 5GAGU 4ZIVA 1D9DA 2HBYB 3ENAA 2C2NA 1SV5B 2RVJA 3P45B 3OV7A 4M95A 1WKJA 3EJMA 4QR0A 1RWNB 1KQFB 1M5OC 4P71A 3AD9C 2YPZA 2ZJRQ 1C0UB 1YK9A 1JNRB 1V5IB 4MYTA 1NCLA 4K0KJ 1QDUB 5B0CA 3PXGa 3S01A 1Y9OA 3UDLA 3QJJA 2MLXA 4NLUA 3MCMA 2DGVA 2ZBPA 2D7SA 4TY8A 1RBOB 2CPHA 1RU1A 1XTZA 2VFRA 2AJQA 1WACA 4J9KA 4C6AA 4B9TA 1S72S 2BJDA 4NEZA 1R8AA 4USIA 4X64J 2IYGA 2KM8B 2XCAA 3C15B 2ADCA 1CBKA 2Q43A 2Y1RI 3FGVA 2V69A 3P96A 2CIMA 3PR5B 2WTFA 4ZPDA 1HBOB 4NYOA 4CLKA 4ZP6A 4DHVA 3LOUA 5EHHA 3GSDA 3G6YA 2UZAA 3KOAA 2JEGA 2G13A 2POKA 4UQGA 4DPXA 4OHYA 3T3FA 3R7NB 1F9HA 2LVWA 1FVSA 1TP7A 3GR0A 2G2YA 2QLFB 1CQNA 3CDEA 2UUCJ 4U7CA 4IQXA 3WIUA 2J6SA 2FUG9 3TUPA 1GNKA 4M5IA 2R7TA 4DL5A 2DY9A 2E9ZA 4WTYA 5A8WA 1CSJA 1DHMA 2B3TB 3MOJB 4NPOA 2UXBF 3MF5A 5L9XA 1Y5NB 3QZ7A 2W4DA 2HLUA 1M90T 3TZYA 5E0OA 2QV6A 1IM6A 2ERRA 1S12A 2CWXA 2FVCA 5E3PA 2V94A 3UNYA 1SJ4P 2V2KA 5JUMA 1YBUA 3NBPA 4PWDA 3H59A 3Q8RB 3VGSA 4M5DB 3LP2B 2YTCA 4NLVA 4DS5A 4IG3B 2EPIA 1ZZNA 3BKFA 3BBFA 3T5HA 2CG4A 3RU0A 3VVUA 4FXVA 4CNYA 2KL8A 4ZLLA 3FKBA 4PZVA 1JXVA 4IKAA 1LWFA 4FXDA 4JI3J 2KKHA 1SJQA 4CQ1A 4ITSA 2Y1IA 2LQJA 4JI2J 4DPUA 2YY3A 1KRPA 1UWBA 2MB0B 4Y2CA 1RUSA 2FGOA 3SIPB 3S1TA 3OTCA 2UV8A 5A6WA 3PX6A 2JH3A 5IWAF 4DUYJ 4MFBA 2DIUA 1PC5A 1S1UB 2I9SA 3ENWA 2W25A 2EFNA 2APOA 2U2FA 2VL1A 1Q7YT 2I5JB 3LQVA 1JKHB 3ISND 4ED1A 3VHQA 3CIZA 2ZC4A 3IAM9 3ZTSA 2K8GA 3M30B 1NMEB 1U6FA 1T03A 1HNIA 1N36J 5C2GA 2GVZB 1R0AA 4H4MA 4ELUA 5KFHA 4WFAQ 1N6QA 1QE1A 1X5SA 2BR0A 4KYZA 5CQGA 3W63A 1X7VA 4OL8A 2GCFA 4DR3J 3D6MB 1D1UA 5KFKA 1U1PA 2XO6A 5KT6A 3DI6B 3NGKA 2KFNA 2BKNA 2PDAA 2J0XA 3I5CA 2BJ8A 2XY7A 4ZPVR 4DG1A 3VQSA 1XIQA 1FJ7A 1BD6A 2VONA 3BPDA 2WB1D 3I4HX 3GIKA 2IVFB 3F41A 4DCJB 3NXZA 1IKVA 2CQDA 2IMOA 4YQWA 3TZZA 3AJ2A 3BSAA 2IIHA 2RAQA 1Q5YA 4NL5A 1KLMA 1NH7A 1BWVA 3R5AA 1TUGB 4A47A 3GR1A 3HD1A 1Q5VA 4O4GA 4O3OA 4X2BA 4CNZA 4ID5A 2C3YA 1OS5A 2L41A 4I68A 4U6PA 2A6OA 1WDDA 3MECA 2L9WA 4ZVTB 2HBRB 4ECSA 3TNVA 1XR7A 4DV6F 5J1EB 2JLGA 3TVYA 5LXYA 1SV5A 2ASDA 3MCSA 2LQBA 2O67A 3J81j 3LA0A 1NKCA 1RT7B 5SZTA 2R8GA 3W61A 3B78A 3ELHA 5D4OA 4KE5A 1C0UA 4ZPWR 3BQ2A 3GIRA 1SL0A 4PR6A 2BJ1A 3ICLA 1LK7A 5E3QA 4DR5J 1U6ZA 2HIQA 4E8UA 3H2VE 4USJC 3DRSA 1YJWS 2BVZA 4ZVOB 2EK6A 4F67A 4RBUA 3LGHA 1EQ0A 2JLEA 2ZHAA 2DR7A 1YZ6A 5CYMA 3W9JA 5JMNA 5DDOC 3P5TL 4FS2A 3VWSA 1RWVB 3M8QB 4DSKA 3UDCA 4RBTA 4WFNQ 4ZVEA 4EO8A 3CCMS 3C15A 1D0EA 3BGFA 1L3UA 1SL1A 1WHVA 2QG9B 3PTWA 1W2IA 5HAOA 2NCKL 4ICLA 2OUGA 1IR2A 3D2WA 4P6QA 2PMWA 3OL8A 1U7LA 2D41A 1NM2A 4FXWA 2OSRA 4U8VA 1FNOA 3KLIB 1BHNA 4ECZA 3FJ2A 2XY5A 3ISZA 1RJJA 1HNVB 3IWLA 1YX2A 2FHMA 3H25A 1XMQF 1S6OA 3KLFB 3Q8VA 2UUWA 2E9TA 2QA2A 2JC0A 2EFOA 3CSKA 1FXRA 3DDIA 2YH0A 4IFYB 5HI7A 4KQZA 2OPQA 2C3OA 4JV0A 3NGSA 4TLQA 1FXDA 3C6TB 2OO4A 3CJ5A 2E1PA 2QLWA 1PCAA 1T9VA 5L8RC 3DLEA 5DM6Q 4R0EA 4L72B 5L1JA 4LRDA 4QYZJ 2RKIA 1A9NB 3PO5A 4NZ7A 4TYAA 4O3RA 1P8GA 2XHCA 2RHSB 1B0TA 3PJ9A 1G1XA 4DBQA 1IBMF 2Y0BB 1U2RA 2KJVA 1S7IA 2X3GA 2HVIA 2CVEA 3U1NA 4KY3A 1RGVA 3CJ0A 4ILRA 3BR9A 2UU9F 1GXLA 1S9GA 5KG1A 3LAKA 4OYAA 1BXNA 3T9ZA 2BW2A 1U1OA 1H2TZ 3QBCA 3CCWA 5A6PA 3SQGA 4XIUA 5DLGA 3ETOA 4JYAF 1X4GA 2A6MA 3GTYX 2VA3A 1UVMA 1TL3B 3HT0A 1SQEA 3GQCA 1RE1B 2E1CA 4PWWA 4F3QA 1KOHA 2RRNA 4FF4A 3J7ZT 5F9LA 1F2GA 3HSGA 2CJXB 2HGLA 4WFYA 2G9OA 2C3UA 1JKHA 1L3TA 3HJFA 3M2UB 3U1MA 1U0HB 4O44B 1JLFB 3M30A 2YKNA 3H5YA 1RT3B 1VQ5S 2GVZA 3ZZZA 2LQ8A 4GO7X 3FBCA 3TUJC 2VJVA 1AB8A 2C2MB 1FCAA 2Z58B 3UCGA 2C22A 5HLFB 3UN3A 4EGLA 4LF4F 3IR7B 5J2NB 1S99A 3TWZA 2D1CA 1VBXA 3MD1A 1SI9A 2DVIA 3J7AN 1LWEB 4AQYJ 1VC0A 1HR0F 1Y7PA 1NJZA 3DLBA 2COLA 2MZ1A 4WF9Q 3OXLA 3F73A 4NLOA 4PQUB 3MMAA 1B70B 3DI6A 1KR4A 4K2JA 1U2CA 2OKQA 2D3UA 3GIJA 3MR6A 1ITPA 3G6VA 1YLXA 4FYVB 2Z4PA 5IFMA 1BQNB 4OI6A 4ED0A 4U8YA 3MCOA 1M1GA 4K4XA 5D0GA 2KRBA 1UJ4A 5KOWA 2DTJA 1VGYA 2LMIA 3V6DA 1DY3A 3OT9A 5HBMB 1MMLA 1G2EA 2PD1A 3KLVA 1D9FA 2QE5A 1EARA 3UW1A 3DCAA 1VJWA 2AEJA 5HVHA 1PSDA 2HYIB 1B0VA 3H7HB 2MZRA 1GXTA 3SQOP 1G4CA 3HVTB 2CDQA 4ES3A 4IUFA 3HHDA 4LSZB 9RUBA 5J1EA 4M5MA 1NJWA 4U7UD 1OY9A 2BE9B 5KG7A 3R8YA 4LBPA 3CNQP 4C9DA 1RT7A 4OX8A 3MAQA 2VDIA 3W9IA 4YR0A 3PACA 1UVNA 3VAMA 3M6WA 5AE3A 1N56A 5KAKA 2EWHA 1PAEX 5BYRA 3VGTA 4A8KA 3KNGA 2JC1A 2XMUA 5DGBA 1NSKL 2M52A 2RQ4A 4IOBA 4LSLB 1S0OA 4IR1A 3BREA 5F3TA 2K7KA 2YX1A 2FHKA 4C8ZA 3CJKB 1JLBB 3ULHA 1I1GA 3PRBA 2DHAA 4LVNP 4DV1J 1VHIA 1AUDA 1EQMA 1Q81T 2DGXA 4O0IA 2O3DA 1LWCB 2I1RA 2R8HA 5HMZA 2LECA 1ZPVA 4P52A 2DNLA 3HVAA 1UETA 4CZCA 3KJVB 4ZN3A 5HVFA 2M5YA 4B3MJ 3H0PA 4E0DA 4J9OA 1S48A 3NS5A 4RNOA 1N0UA 1GTHA 3M6VA 5ITHA 4MKBA 3I87A 1DQ9A 1ZAXA 3PYEA 3GU0A 3KLIA 2HIYA 3ZZTA 5KFJA 5EWFA 2DRBA 1YTYA 1HWJA 1QY7A 2VBWA 4I6YA 5DZ7A 1N52B 2QIFA 1FO1A 4NYPA 4YDXA 5KFLA 3C16A 3RUBL 2DNMA 5B0BA 4DV0F 1PJ6A 7FDRA 4FBUA 5KFCA 3V81B 4RZRA 4ZJLA 3W62A 1R43A 4K0KF 1RAIB 3W60A 4LBIA 2BE2B 5AJ3J 2HHHJ 2XY6A 2F65A 2OGUA 3R7SB 1NK9A 4DX8H 3AXKA 4KBIA 4WJBA 5F8IA 4LFAJ 1P9YA 2N3OA 4R0JA 2YKOA 2KVQE 2BJ9A 4X64F 5J2MB 3N01A 2K7JA 1CJVA 5LOQA 2LQ5A 3D6FB 5ETLA 4QYZK 2KJWA 2ZBCA 2DNKA 3BYPA 4ZS6A 1RT6A 3X3UA 3Q23A 3KJNB 1RAFB 5LMNJ 1U1MA 4OJHA 2HRTA 1RKJA 2WCXA 3J81Y 4M5NA 1NPRA 5J2QA 2ACMA 2H48B 1WF0A 3UVJA 3CD5A 2A18A 4I64A 1GK8A 4OHWA 4NXMF 3MEGB 2F9JA 1SJFA 4PRFA 2UUCF 1E6YB 2J6TA 1TL3A 1VLYA 2FJAB 1QUVA 2V5HG 5D4PA 1NLKL 1H74A 3O2IA 3Q2TC 4HHJA 1HBNB 5CZXA 4J9UE 3V4IB 5MLCV 4Q2MA 2J5AA 4LUBA 4QWEA 5C7PA 3G2XA 1RK8A 3Q83A 4CO1A 3BSOA 5KFDA 3HZGA 2E7VA 2AJ0A 1U0HA 4O44A 2V2ZA 2IMWP 2CFXA 2EC2A 3OTBA 5IT9Y 1NDPA 3KYLA 3K5OA 3HHLA 1RT3A 1TV6B 3JS9A 3F56A 2MKKA 1F1BB 1KQGB 5DS7A 3HFVA 1UJ6A 2M70A 5HLFA 5J2NA 2QYGA 3W64A 3MAHA 4J91A 1G6BA 2ZH6A 2XLKA 2P6SA 3MI7X 3MURP 5HVGA 3GSIA 4C0BA 4PQUA 2DITA 3HKZD 1H0HB 1YJVA 3D9BA 1VFJA 4KH1B 2B8PA 2F8EX 5E7OB 3FRZA 2V4QA 1LK5A 1WG4A 4UOGA 3N79A 4JI3F 4OLOA 5C42B 1Y0HA 2NREA 4WK1A 3KK2B 2BQUA 1S1XA 2KRRA 3C14B 4OX9J 1WEYA 4ZITA 2H3EB 2EK1A 3W2VA 3WC2A 1T0TV 5HBMA 1EB0A 3TQEA 1H73A 4Y2MA 1TTHB 2BKPA 4YR2A 2ZOFA 2KHDA 4C3MA 1WI6A 1X9SA 4KAIA 1FFWB 3I5AA 2VKRA 4HT5A 2DNZA 3J7YI 1N36F 1X8DA 4ILLA 2HS3A 4N7TA 5G4DA 2DGUA 2HHPA 2DXEA 4ED6A 5KG2A 3PW7A 2GJFA 3Q8YA 4ATNA 4DLEA 2HG4A 3O6QA 5GAHU 1NK4A 3ZFVA 4DR3F 2DKOB 4ZCKA 2ZH7A 2WSCC 4YB7A 1YDLA 3GFZA 4ILMA 3HKWA 5KT5A 4MK7A 1URNA 5ETNA 4RUAA 4RUBA 3DGPB 1SKWA 1JLAA 4ECVA 2LEPA 4P10A 2E66A 3R5GA 3CJKA 1EAYC 1CJKB 4EK2A 4B9NA 1ZM4A 3V6KA 2IBKA 1T9TA 2MZJA 2JNJA 4CLZA 2DK2A 1AA1B 4PXDA 5GADU 1UVLA 5IXUA 4KKOB 2ASJA 1CJTA 1LKZA 3JQMA 1HQEB 4OYXA 4QJVA 4ED2A 1TK8A 1VDHA 4ZP7A 2XC9A 4R8UB 3AHPA 1QSSA 3DM2A 2ZZNA 2ZH5A 1VRQC 4ALZA 1GH8A 1EZZB 3M2VA 1HL6A 1DZ5A 4KFBA 4Z7CA 2B6AB 1DBDA 1KEKA 1RWWB 2Z8QA 1VOMA 1Q95G 1PG5B 4RU2A 1VBYA 3RRGA 2GV1A 1OO0B 5LL6d 1KVJA 4H4KA 1HFEL 3V81A 3HPOA 3FEZA 3D6HB 4DSIA 3O5TB 3L4BC 4CI0B 1F5AA 4Q8FA 1JLGB 4H4OB 2DNHA 4ZPBA 1IBCB 2XQCA 4CCHA 4F4XA 1JX4A 4DR5F 2BE2A 4K4VA 3DKDA 3D1OA 4C97A 3MMBB 1WEZA 2D9OA 2AJFE 2JEIA 3DLGB 2VG7B 4ID8A 1NSAA 2YBVA 1R6YA 3Q8UA 4ANDA 3HP6A 2DNGA 4O3PA 3RTVA 3VAFA 4X4UA 3GMGA 4X84A 4DSFA 3L7UA 2Z56B 2H54B 4QPTA 2Q66A 5HJYA 3CJ8A 4ZIWA 4MIBA 4QWCA 1UL3A 2JFKA 4KT0C 4Q7AA 2FHJD 4NCBA 5IQ6A 3MR3A 5A8KB 4W4MA 3N0VA 3E8OA 1BQXA 4N76A 3UCUP 2PEBA 1RTHB 1P27B 3SMZA 3MEGA 1QSYA 2Y0SD 2DCLA 4P9SA 2JL9A 3MCNA 2W2OP 3PIPQ 3P8BB 5L38A 3MM7B 1ROFA 3SSSA 1MLAA 1FE4A 3DRPB 3M1VB 1HBNA 1V3RA 3V4IA 5KFNA 4OYBA 4RNMA 1PJ5A 2F8MA 1FF2A 1FRJA 4OYIA 3HZEA 2PI5A 4IR9A 1TUVA 1FVQA 1YHQS 2XMJA 4CLUA 4RU9A 2M7SA 1VI7A 1WC0A 4WXWA 2MKCA 2QA4S 2FJVA 3AD8C 2PEHA 2HGMA 1XQIA 3BJYA 4PCQA 3L7PA 2KXHA 3P5BP 5H9EJ 3K89A 1RWOB 3FSYA 1MWYA 3CCES 4XK8C 4LJMA 3JXOA 4H54A 1HMVA 4B3OB 2VPZB 1TKTB 1YG0A 4U95A 1IKXA 1TR0A 2CQCA 2WZ1A 2Q6BA 1VQKS 2MHEA 3CCZA 4WYWA 3SXLA 1FFGB 3CTRA 4KHMA 3TVZA 2GQ2A 4QCLA 1IVZA 1HLWA 4F4ZA 1DARA 4I2PB 4DU7A 2R2TA 5F8GA 4OFZA 3NMRA 2ALZA 5C42A 2ZD1B 2HMIB 2D9PA 3DYAB 1VBKA 3AAWB 1MWZA 3F44A 5DGAA 3QT5A 1FERA 3C14A 1RBAA 2MYFA 1VIXA 2DR6A 4RJVA 5FLXU 4RW6B 2W4PA 2GW8A 3R97A 4QIGA 5DQHA 2M2BA 3CCJS 1A7GE 3BB5A 4JI7F 1SH2A 3BBCA 1S10A 3CCRS 3K2YA 2V8VA 2OTJS 2P8IA 1RWKB 1KKHA 2BBEA 2VV5A 2KDOA 4YHHF 3BSCA 4IH6A 2B4VA 3DDNA 3RAMA 3WZ0A 2XMKA 5KG3A 2M8DB 2VODA 4BDPA 2XM3A 1F3FA 1MWQA 1NK5A 1R31A 4QIVA 1RT2B 2YNHB 4JV5F 4NWBA 2IC3B 4M94A 1PYSB 3P6YC 3BF4A 2QSWA 2GQCA 2OPRA 2QMUB 2H9ZA 1YBAA 4NLPA 3UWTA 3ILLA 5LMUJ 2RQKA 1RISA 3CCQS 3US5A 5IT4A 1U1NA 2RU9A 4RLEA 1NNDA 2HZVA 5DG8A 3BGRB 5KFXA 1VR6A 1U0SA 4G1QA 4DX7A 3CJQA 5KG4A 2G0CA 3W1YC 3DGPA 4DL7A 4DL2A 3OFFA 3HK2A 1CS4A 2AW0A 4F4AA 3GE9A 1JNZB 1CJKA 4TY9A 4PG5A 1ZYQA 2H5IB 4ZK7M 3ILOA 1LXJA 2ZEJA 2OMOA 1OY8A 4KKOA 3Q24A 4M5GA 2NPFA 4A4JA 1NHVA 1NJXA 3HJVA 4LRCA 3VQTA 1S77D 2OAUA 1VQPS 2KZMA 4R8UA 1KONA 3D67A 3DLJA 1Q86T 1RCOB 2JJ4D 3CW2C 2HHUA 3HVWA 2DR8A 3HSZA 1GTEA 2OFGX 3KMQA 2CXEA 3FBBA 2I8EA 1AW0A 4WWSA 3R7BB 5A8RB 3UI3A 3A3OB 4K7QA 1T11A 4FVCA 1JLGA 3A8JA 3MPVA 2AJ1A 1SBRA 1SKUB 4QZVB 4UOCA 1RADB 2VOOA 1XR5A 2V8HA 2DY1A 3MMBA 3LP1A 4CIOA 2QFJA 3DLGA 2J8AA 2VG7A 2AJ2A 4DV1F 2B7BB 5IM0A 3B6BA 3PHTA 4OI3A 5B0DA 2E29A 1X4BA 1NU4A 2C2OB 1U1QA 4FKXA 3GV7B 4ANCA 4NCAA 3MEEB 3R2DJ 3TA2A 1UA0A 1QM9A 4EWTA 2G1HA 2V4RA 4B3MF 2C2DA 2VF3A 4WZMA 2HAFA 4OHZA 2PGCA 2RF2A 1RTDB 2KXFA 3MTKA 1RTHA 3EDRB 2CQ2A 3DHXA 3CJSA 1XR6A 2HVEA 4K4UA 4DR4J 3NOCA 3PX0A 2IDEA 5MAOA 2LU1A 2W1BA 3HI9A 2HURA 2FVPA 1KWMA 4ZVSB 1PJ7A 3MM7A 4UY85 2QRRA 1X0PA 2XLJA 4NLXA 3DRPA 3M1VA 3MEDA 5EX3A 2CPYA 3HFKA 5B0EA 4EZ6A 1FDNA 5AJ3F 1N4LA 2UXDF 2FC8A 1B99A 2B4UA 2HFSA 2R7QA 2HHHF 1R27B 3THVA 4DV7F 2B8QA 1MROB 4FF2A 1NH8A 1UFWA 2B56A 4WIQA 4AE5A 3TW0A 2CNKB 5H9FJ 3A3NB 1X5PA 2W9CA 2DD8S 3JSMB 1XERA 1FDBA 3DHWC 2PMZD 2KU7A 4G1IA 4X4QA 3ET6B 5DETA 3CMQA 3OXGA 3OLAA 1OMSA 1TKTA 2FC9A 5I3UB 3VV2B 5B7WA 4OX6A 4EO6A 1RYRA 5D4LA 2IA6A 1K0TA 1S9FA 5K8MA 3J81U 2MLZA 3BBBA 2EFPA 4I2PA 1V3SA 2VC1A 1UAWA 1VQLS 4RW7A 2A1BA 1WORA 4F7VA 5B0AA 5CD4H 1S76D 2NYHA 5EDWA 4X4PA 3AFGA 3OD2A 4WPAA 5I42B 3SDEB 2M4MA 3I31A 3H2UB 1V3ZA 1RHKB 1Z2LA 2IYIA 3QQCD 3NLCA 1SKRA 1TFYA 1S57A 4JI0J 2LEBA 3EX7B 3PRDA 1X60A 4GKKJ 2QL5B 8ATCB 2GAHC 3GJSB 1RT1B 2XEXA 3MD3A 5IT9U 2YNFB 3PY8A 1HNXJ 1DRZA 4WFXA 4CYUB 1L5UA 3NAIA 4LF6F 4FYDA 1TL7B 2LLZA 2J76E 2YNHA 4JBCA 3U02A 1FKAF 1N88A 3MFHA 4JI6J 4ZOSA 1JB0C 3T5JA 4EI2A 1RWPB 1I6JA 1J5OB 2KTQA 2ZKTA 4WE1A 3HFZB 1X4AA 9ATCB 2D69A 3D6TB 3VTIA 4DX5A 4LR7A 1N34J 6FD1A 3ZZPA 1C0TB 3KUHA 1W25A 3BGRA 3CCLS 1RLCL 1Q8IA 3VGVA 2OEJA 4OMFG 1DURA 1SH0A 3M8PA 4GVLA 4U7UK 1T9YA 2AIRB 4OX9F 5KG0A 3TVKA 1KVIA 3OTOF 5DM7Q 1J27A 5CXTA 3CPWR 4DV4J 1Q82T 3KK3B 2ZUAA 2RT3A 2LA4A 2V6AA 3T5LA 2NUUG 3ITHA 1NPKA 1WTBA 4PXEA 2JLFA 1QAXA 3PRVA 3I55S 3R6LB 3Q8QB 4MK9A 1XEZA 2KG0A 3GJRB 2FGCA 5KFFA 1AZSA 2RE1A 4V19X 2FZGB 1P6TA 3IRWP 1WNEA 3MAAA 3DFEA 2OFHX 3RZAA 4QU6A 2BJ7A 2OMLA 2U1AA 2HNDB 5G0RB 4YY3F 5J2PB 1UEKA 1Q53A 4GRSA 5L39A 1X5TA 5GAGI 1UPMB 2HFNA 2FZCB 3LF0A 1U1RA 1GXUA 5L9NA 4I4BA 2HRUA 4NX9A 4DFKA 2CRLA 1S1WB 5HQ8A 3OUYB 4N8OA 3L09A 2HBQB 5ETSA 4LRFA 2DNQA 2XB2D 1R8PA 2M8HA 2F1FA 1KS2A 4GO5X 4Z7YA 4KB7A 4TYBA 3EGZA 2ACYA 2F5GA 2LFVA 1R0BG 2BQ3A 1FE0A 3MDFA 3GYNA 1JJCB 5E2QA 1ZM2A 3R3TA 2OD4A 5BYSA 1ULRA 2HW3A 2C2EA 1RI7A 1M5HA 1PYOB 2GVDA 1IBLJ 2DRAA 2XMTA 1I94J 1IWGA 4DI6A 2RU3A 4LMZA 1QJHA 4WYLA 1I3OB 1QSLA 2VB6A 4ZVQB 3D3BJ 2FJWA 1HQUB 2MKIA 3DRRB 1TMJA 1HPZB 4OI0A 3ILJA 1F2HA 3EDQB 1JLQA 4NRTA 4OZJA 2YQ0A 1RTDA 4AXJA 4CO3A 1NB7A 2RQCA 3OVBA 1XMOJ 3MOZA 3OHAA 4OZNA 4TN2A 2KHCA 3TJ9A 2HWHA 4GKJF 4ED3A 3ZZOA 1KSPA 2XMWA 4WFBQ 2YQ1A 2XNQA 1RAEB 4CM0A 1CC8A 3DGVA 1Z1ZA 2HRYA 4ANEA 5HMYA 3IO1A 3UNGC 2ASLA 1RHQB 1NSQA 1ZA2B 2BJ3A 3TA1A 4PUOB 3AXMA 1YWXA 2IJNA 1MROA 3I9V9 1S9EA 3EZOA 3VZHA 1WD6A 1MMNA 1TKDA 2HWTA 2VASA 3JSMA 2FB0A 2DO0A 3ET6A 3A8KA 5LM7E 4FN5A 4J9PA 5H9FK 2DPIA 3W3SA 2YKAA 1NK8A 1DTTA 1U8SA 3FCWA 4NMXA 1T3NA 1UWAA 1WDTA 5F3ZA 3I0RB 3LPYA 2EKNA 2PFDA 4A8YA 1FEEA 3P49B 1LW0B 4ZVUB 1EP4B 3FQLA 4MAKA 1N33F 2GGPB 2N82B 4ED4A 4JI4F 2ZM6J 1TK0A 1DTQB 4NE9C 2CA9A 5KFRA 3O8WA 4C0HA 3HF5A 2VC0A 3DN9A 4DR7J 3SDEA 2KVIA 4BLGA 4DR1J 5GMKa 2YWEA 1U4BA 1YGYA 2XS7A 1FWKA 3NCPA 4MTPA 2NZCA 2K1RB 3TEHB 1JLEB 1ZOTA 3MR5A 3CDAA 3K5LA 2QL7B 4KHPF 2IRUA 4G65A 1N5VA 1NK6A 4NLDA 5IC4B 5JJBA 3UR0A 2RMLA 3WQPA 3H40A 5K8OA 4I1TA 4HLBA 4XAKA 1C1CB 1YIJS 3CMAS 4F04B 3KLEB 3POTA 3H98A 3UCZP 2KZZA 2ZH4A 1LOUA 2QZ8A 1CJUB 2UXCJ 2VOPA 1XNQJ 1G7CB 4X4SA 2D74B 4YB1P 1HYSB 3TAMB 3R2CJ 3SSRA 4A8SA 4RW4A 5JVHQ 4DL4A 1VK3A 1PBAA 3F0NA 2P2CB 1WJ9A 2ZZMA 3KLHB 4CDIA 1C0TA 1FJGJ 1N5SA 3UN2A 4DL6A 3EMTA 2NR0A 3MM5A 3AJDA 4O3SA 2RHQB 4PYAA 1NB2A 2CQHA 2VFTA 3A8EA 1YJ9S 3MGJA 2BOAA 3M8SA 4Q44A 4N56A 1T7PA 4Y34A 2VIHA 4URGA 2PFFB 3ZXWA 5KFOA 5E5NA 2H4YB 1S1TB 5DDRC 3T41A 2HS4A 1Q79A 2IAJB 1YRXA 4NI2B 3IBCB 2GMHA 3P3DA 1NPPA 5D0EA 5J1NA 2HHWA 4ZPTR 2B5JB 1HW9A 2B9XA 1L3VA 3IA0A 2MJNA 2E5LJ 1T9WA 1HBMB 4DQPA 4WZQA 1X9WA 4EEYA 3BZQA 1SUQB 4CLWA 4DCPB 1M5VC 3N4WA 3MM6B 3W2WA 1U6BA 3O3LA 1SJ1A 3TR5A 2QFIA 1U09A 1IKWB 1P1TA 5G0RA 3HHLC 2ZVSA 5J2PA 2BZ2A 3PYDA 1S5ZA 2ROGA 4HACA 2F7VA 2HHSA 1FDDA 2BACA 4C8MA 4K50A 1VLOA 3BO2A 1S1WA 5LMUF 1S0NA 2HNYB 1FRHA 2PMHA 5F0UA 2HHXA 3G71S 3NKYA 3H4DA 1WHWA 5AXNA 3NMAA 3M8YA 3FFIA 2V0NA 4JI1J 1TKZB 2CG8A 1X9MA 3D66A 2OPPB 5FDLB 2X7IA 4AL6A 2Q1LA 4J5OA 3RYLA 5CA5A 3HM9A 4BWMA 5CYQA 3QAUA 5C24A 4P2XA 1T02A 2MZTA 3MWBA 4GMKA 3HHEA 3W66A 1KTQA 5BJRA 4BWJA 4PXBA 1DQAA 2NYIA 4QIEA 2V4JA 4YUDA 3DRRA 3GWCA 3RBXA 3TARA 1HPZA 5GMEA 4KPYA 2KT5A 1DAXA 2DB1A 3R27A 1FJCA 2DGQA 1NHUA 2DYAA 3CCTA 4KV8A 2W9BA 1VQ7S 1U1KA 2R9LA 2FLPA 1ZS6A 1RAOA 2QX0A 2ZH1A 3SEOA 2M3DA 1R6VA 2HVDA 4LFCJ 2DGWA 1WC1A 1FK9B 4M5JA 3OJUA 2FHJA 4CT9A 2W7PA 4R25A 4HHHA 5M2PA 4KGMA 2W8KA 4USKA 2GZOA 2KN4A 5IC6B 3T1AA 1T9XA 2XI2A 4PUOA 5KFEA 2PA3A 2C3MA 2ATLA 3B54A 4XTTA 1MN9A 6AT1B 2OEMA 1FDAA 3NGDA 2ZH3A 4LRAA 5U47A 1RSCA 2IPOB 1NKEA 2BYCA 2R8JA 2J8SA 4ZP9A 1Q1KA 3DOLA 4JI8F 2DEIA 4WXOA 1DLOB 3KLGA 4A8XA 3SV3A 4X4TA 5B08A 4KSEB 2VPWB 3FZBA 5A0YA 5IT0A 3O44A 2UXBJ 1Q4RA 3AY0A 3SCLE 3LP0A 3DLKB 1WKKA 3C8YA 2JOQA 1JJHA 3CO0P 3RGIA 2XMAA 1F3VA 1LW0A 4LT6A 1EP4A 2ZJPQ 4L73A 1QTMA 3MM9B 2QEXS 4EFAC 2KFYA 1DTQA 2B4PA 1UFLA 4CP5A 4EBDA 1X4CA 2DHSA 4NRUA 1X4EA 3DMJB 3EM1A 4DLGA 1Y00A 3ZNUA 3IG1B 3SFUA 4OIXA 4H4KC 4UT4A 2W2MP 1RZMA 2CNOB 2DXDA 3MUTP 4DUZJ 5KFBA 5FJ4A 5CHCB 1F60B 4XPCA 5I3PA 4I0WA 3IGNA 2EBGA 2LU2A 1RWXB 2UVUA 3W5YA 2ZHBA 4ZHRB 2Z30B 2ZZTA 3QFWA 4NLSA 1C1CA 3MTJA 2E7WA 3KLEA 2NUHA 5D3GB 1UFKA 4DDFA 1ZPWX 2Z2YB 4EU0A 1IR1A 2DIVA 2VG5B 5IWAJ 1REVB 1Z2ZA 3OR1B 4R5PA 1OYEA 4K4TA 1NZ8A 3G8SA 3TAMA 1HBUB 1KBRA 4I7FB 2QC3A 2MEWA 3BQ1A 5B0FA 2B9WA 3PKMA 3H20A 3KLHA 3CF5Q 2N7CA 4N8NA 2HNZA 4ZCIA 2C2KB 3IS9A 1XWLA 3IBFB 4F2SA 4P2SA 2XGQA 3DC2A 1PILA 2MGZB 5DLFA 4WTOB 4IO9Q 1SQFA 4OJ1A 1HNWJ 4IFVB 3RB0A 1PAUB 2LXUA 2FLNA 3PZPA 1IBKF 2R7VA 4JI5F 5AXLA 4TKTA 5DG9A 3NY0A 2VDHA 2MKHA 1WF2A 1MG7A 3OFEA 3NCRA 4JI0F 4DS4A 5E3RA 1AXQA 3DOMB 3ZZUA 4A8QA 3OVSA 2B5JA 2CYYA 2YNIB 3M9MB 5T41A 2EG2A 2XNRA 1HNXF 3RB6A 1BMQB 2LXIA 5F8HA 4NA3A 1HBMA 1TAQA 1RT4B 3GB0A 2EG1A 3LAMA 2Z2MA 2MLYA 5CCMA 4HTIA 4JI6F 3NWRA 3UN5A 5ETOA 1UPPA 1EETB 3BGLA 2PIIA 5LJ5Y 2YWGA 2AGQA 4C11B 2XS2A 1TMMA 2WK4A 2F4FA 2LKZA 1UA1A 4DJBA 1KQKA 4OX7A 1NK0A 2NXEA 2RUGA 2ZH9A 4F26A 1YJ7A 2FVRA 1WC4A 3VAJA 3T19A 4ZVFA 1VRTB 2R7WA 1WHYA 1TKZA 4DQIA 2ZJQQ 3NGRA 2OPPA 4I2QB 3W9HA 2AJ4A 4DV6J 1P1LA 1BC6A 5DRKA 4LF2A 1YRTA 3AB2B 4MK8A 1MU2B 1R7IA 3QYYA 2WVDA 4OQJA 1Q8BA 1GMUA 4B9LA 5L1LA 1HBOA 3EVMA 3A8IA 2VHGA 2DNOA 3PEHA 1YKWA 2AKWB 2CJBA 3IN5A 1AUSL 5F41A 2ZBIA 2HQGA 4FS1A 4X4RA 1ZAWA 1F0XA 2DEJA 4ZDNA 2HFVA 1K1SA 2DNRA 4NLWA 1T3OA 2ZOGA 1SC6A 4PPZA 4D3GA 1F9FA 1NDKA 2P9CA 3LGMA 2OELA 2HQFA 1TKXB 5HO4A 2HLTA 3RJMB 4N77A 2JWNA 4WP8A 2BE7D 7FD1A 4FP9A 1V9OA 3VGUA 3M8RA 3E2EA 4ZJOA 1XN9A 4ENOA 2CQIA 2BKOA 1F5BA 2B51A 1XNRF 3QIDA 4USTA 1LW2B 2A10A 2YVSA 1D09B 3B82A 1WSRA 1VC6A 4UZCA 2AWZA 2CWKA 4ECWA 2AD9A 2HBZB 1Q16B 4F3MA 4RW9B 4M63A 4PG8A 4M5DA 3LP2A 4HT7A 3EZUA 2OHDA 3QZ8A 1AFJA 4IG3A 5I3QA 2LCWA 1W7WA 2LDYA 1ZETA 1DLOA 2HHTA 1I94F 4B9MA 4AFFA 3TP2A 3J7Z5 5KFIA 3PW4A 1JQGA 5K20B 2ZHOA 1MW7A 3IR6B 2YXLA 3DLKA 2LP4A 4YDDB 3DRXA 4GVBB 3RG6A 1XMOF 1X31C 4TY8B 1IQZA 1UW9A 5FLXY 1JK9B 5KFSA 5L1KA 3CULA 1H3DA 2MZSA 3MM9A 4OHVA 4DZ6A 3KFWX 1OYDA 3RR8A 5F0WA 2CJQA 4KO0B 4DQSA 3OXFA 3H42A 3KKFA 2IY5B 1S1UA 2G2OA 1YJUA 3DMJA 1T8EA 1IBMJ 3TRGA 3MPDA 4IG0B 2EFGA 4USVA 4KPCA 2I5JA 3G96A 2R7UA 2NSCA 2RB7A 3G6XA 2O01C 1N8RT 1RCXB 3IG1A 5L1IA 2XZDB 2UU9J 5KT2A 1QLNA 2HEKA 4DSEA 3OTDA 2VFUA 2ZNYA 3RB4A 4OI2A 5L46A 2G0JA 1YBTA 4L75A 1REGX 4ZHRA 5EWGA 1ELOA 1R89A 3BKUA 1RAGB 2W2PP 4MKVA 4JYAJ 1HD0A 4LR8A 2Y9HA 1VMBA 2K2PA 4QOTA 4KRWA 1GMWA 5D3GA 2V2VA 3D28A 3N6MA 2L9NA 2XO7A 2HHQA 3RBZA 2VG5A 1RP5A 3OR1A 4DR6J 5A8WB 5A2QY 2UUAJ 3NL0A 3KDNA 5IQQA 1HBUA 4I7FA 2RRAA 5HJXA 1NHKL 4B3TJ 2ROEA 2H51B 5KFAA 3QFHA 1OIAA 4K8RA 4ED8A 2V34A 3NBPB 4PWDB 4UOHA 2ZFHA 3SV4A 4D3HA 2LA6A 3Q89A 1KQSR 3KHRA 4TXSA 2FVSA 1DJ0A 4PYDA 1HR0J 4Y28C 2R3VA 4I67A 4LF7F 2HPUA 2UUTA 4EZ9A 1ZTTA 3KG4A 2YNIA 1KOOA 1JIHA 2W2QP 2YKPA 2F40A 2GO8A 1WC5A 4QIFA 2IRXA 4X65F 2MQOA 1O8BA 1RT4A 1UWBB
chains in the Genus database with same CATH topology
3KG0A 4WFZA 4I56A 2CQ2A 2PDAA 3CVKA 3DHXA 2J0XA 3N5FA 1XR6A 3N28A 4K4UA 3HHLD 3MMJA 3I5CA 2XY7A 2JZ5A 1EETA 3PX0A 4ZPVR 4DG1A 2WB4A 4O3NA 4MFBB 5MAOA 1R8BA 2LU1A 3VQSA 4C11A 1XNQF 3AA9A 3HI9A 2YKQA 4J9LA 1FJ7A 1BD6A 2EW9A 2FVPA 1C4CA 2VONA 3AQOA 4YB5A 2WB1D 3I4HX 3MM7A 3T1YF 3D1QA 3GIKA 4UY85 4AL7A 2IVFB 3F41A 2QRRA 1M5PC 1X0PA 3OL7A 2XLJA 2CPZA 3GG1A 1KNZA 3C2PA 1IKVA 4NLXA 3DRPA 3M1VA 3MEDA 2ILYA 2EFVA 3G8QA 5DG7A 3KK1B 5EX3A 3U1LA 2CPYA 2E44A 2CQDA 1FJGF 2IMOA 3X1LB 5GAHI 3LP1B 1RT5B 3HFKA 5B0EA 4YQWA 4EZ6A 1VRTA 3AJ2A 1FEHA 1FDNA 5AJ3F 5I42A 1N4LA 2FC8A 2UXDF 3BSAA 3MUMP 2HHHF 2B4UA 2R7QA 4QW8A 4ES2A 4B3SF 3BN4A 1R27B 3THVA 5IM0B 4NL5A 1KLMA 4DV7F 1MROB 1NH7A 1WWHA 3R5AA 4A47A 4YMEA 4EYHB 1R0AB 2ROPA 1FJEB 1NH8A 3GR1A 4J9NA 4FF2A 2NZ4A 4O4GA 3M8QA 4O3OA 1UFWA 4X2BA 2B56A 2PSZA 4NZ0A 4AE5A 4CNZA 4ID5A 2C3YA 4LSNB 1OS5A 3TW0A 3I56S 5H9FJ 4I68A 2L41A 1X5PA 4U6PA 2FIUA 3ENQA 2L9WA 2HWIA 3MECA 2R8IA 1S1VB 2FHOB 4F3OA 2FJDB 2W9CA 2DD8S 2V8DA 3JSMB 2CVIA 4ECSA 1XERA 3FEYB 2ZITA 1FDBA 2CZ4A 3I32A 3TNVA 3DHWC 1XR7A 4DV6F 2PMZD 2VA2A 1HI8A 4G1PA 5J1EB 2KU7A 4G1IA 2JLGA 4E98A 1YJTA 1RT1A 2AX1A 3TVYA 1ZTWA 3NCQA 4X4QA 5DQGA 5LXYA 1SV5A 1UW4A 2YNFA 5DETA 3R1HA 4LF9F 2RJZA 2ASDA 3OXGA 3OLAA 3CC2S 3MCSA 2CPJA 1TKTA 2FC9A 2LQBA 2O67A 5I3UB 4QWDA 4J9MA 5B7WA 4HKQA 4OX6A 4EO6A 3RW7A 1C2PA 4RWXA 2RF2B 5D4LA 1TL5A 5LSRA 1RYRA 1NKCA 2IA6A 1RT7B 5SZTA 2R8GA 3EGWB 4HDHA 3B78A 4PG7A 5H1SV 5D4OA 3FMWA 1Y3JA 4KE5A 3VZIA 1H6KX 2R2RA 2E5LF 1K0TA 3CC7S 1S9FA 5K8MA 3OL9A 4DV3F 2K3KA 1C0UA 4ZPWR 3U27A 1H7XA 5GADI 3BQ2A 1YI2S 1HNVA 2EFPA 4DG1B 3JB9k 4IH7A 1SL2A 4I2PA 1V3SA 1SL0A 2VUGA 1YSJA 3AH6A 4PR6A 2GHPA 2VC1A 1LK7A 2DCUB 1UAWA 3ICLA 4BHQA 1J5OA 2OTLS 2WSFC 3KLFA 1VQLS 4RW7A 2A1BA 1IKYB 2MSSA 1TKXA 2CQ3A 2GO9A 5E3QA 3W7BA 2BOPA 4CO2A 1CLFA 5B0AA 5CD4H 1S76D 1U6ZA 2HIQA 3M9NB 4E8UA 3H2VE 4USJC 5KT3A 3DRSA 2DH8A 4NCGA 1SB6A 5EDWA 1YJWS 2BVZA 2DO4A 3IC1A 1IKVB 1NRKA 2EK6A 2L48A 4Y0FA 4X4PA 3MEDB 2WONA 4U67Q 4F67A 4IFYA 2RDIA 2OJ3A 4RBUA 4EBCA 3JYTB 1J5EF 2GMJA 2E1RA 2WBRA 2HAIA 4C3KA 3GIMA 3SZ2A 1W2BR 5I42B 4QPXA 3SDEB 3PDNA 1JJ4A 2M4MA 3I31A 3OR2A 3H2UB 3GIIA 2JLEA 2H5EA 1V3ZA 1RTJB 4LVOP 1IXKA 1Z2LA 2ZHAA 2DR7A 1KLMB 5CYMA 4IRCA 4HI1A 2IYIA 3C6TA 3P5TL 5DDOC 3J7A1 4FS2A 3VWSA 4C8YA 2M0GB 3NLCA 3NNAA 2KO1A 3Q22A 3M8QB 1SKRA 4DSKA 4IOAQ 3C46A 3UDCA 4RBTA 1ZH5A 1OQ3A 4WFNQ 1TFYA 1KTVA 4C0OC 4ZVEA 2LEBA 4EO8A 3CCMS 4JI1F 3MECB 3EX7B 4GC6A 3PRDA 2M9KA 4WKYA 2W9CB 4QWBA 2QO3A 4KGKA 1SJRA 5HP1B 1D0EA 3BGFA 4CO0A 3CCUS 2FLLA 2DGTA 3CWJA 3KK3A 1L3UA 1SL1A 3CEDA 1WHVA 2XGPA 4DMZA 4BBYA 1XMBA 1RT1B 2XEXA 3MD3A 1W2IA 2YNFB 2O5DA 2MY8A 3PY8A 4RW9A 4YB6A 2VG6B 2Q6CA 2VFVA 3N6NA 4ICLA 2HVZA 1DRZA 2W24A 1M1KT 3D2WA 3FMBA 4P6QA 4WFXA 1L5UA 3NAIA 4LF6F 3OL8A 1U7LA 4FYDA 2D41A 2LLZA 5T7LB 4FXWA 3TI0A 2OSRA 2J76E 4NYZA 2YNHA 1RAJA 2SXLA 4JBCA 3U02A 2KI2A 1FNOA 3D54A 3KLIB 1FKAF 3CD6S 4ECZA 4FVMA 1N88A 3MFHA 4ZOSA 1UEVA 3PJWA 3I0SB 3FJ2A 2MQPA 3ISZA 2XY5A 1JB0C 1RJJA 4F4KA 1HNVB 3IWLA 3CMES 1K9MT 3T5JA 2RH3A 4OLPA 1I6JA 2FHMA 4DWIA 1J5OB 2KTQA 2E7XA 2NSBA 1U26A 2ZKTA 3H25A 1S6OA 3KLFB 5DDQC 1XMQF 4RW7B 4WE1A 3EZ5A 2UUWA 2E9TA 3HDSA 4NA1A 1X4AA 2QA2A 2JC0A 2XSJB 3VTIA 3IFEA 2R2UA 2EFOA 2HNDA 2WSEC 3DRSB 3G8TA 1TQLA 3CSKA 1S7HA 1FXRA 1FA0A 4OZ5A 2YH0A 4IFYB 6FD1A 5HI7A 3ZZPA 4TNOA 1C0TB 3Q8SB 1S97A 4DSLA 4KQZA 1W25A 1U24A 2G1DA 2OPQA 3BGRA 3CCLS 3BDEA 4CH0S 4TQSA 1Q8IA 3K58A 3J7YU 1FD2A 4V19J 2J0SD 1VQ8S 2E5GA 3ZZYA 2C3OA 4JV0A 2HHVA 4OMFG 4HDGA 1DURA 1SH0A 1T05B 5CYMB 4TLQA 4KO0A 1FXDA 3C6TB 3M8PA 3OUYA 1D8YA 4U7UK 2J7UA 2OO4A 3CJ5A 2VBXA 4OX9F 5KG0A 3TVKA 1WI8A 1KVIA 2QLWA 3OTOF 4LFCF 1SJ3P 5E41A 4DQRA 5L8RC 3JTNA 3DLEA 4J9SA 5DM7Q 5DM6Q 1O5JA 5KG5A 3I96A 4IG0A 4R0EA 4L72B 5L1JA 5CXTA 4Y3CA 3CPWR 2RKIA 4QYZJ 1A9NB 3PO5A 3NRBA 1Q82T 4NZ7A 4TYAA 4O3RA 3OLBA 1UVKA 1P8GA 3KK3B 3VAIA 3PIOQ 2RT3A 3FNNA 1B0TA 3M2UA 2X1FA 1JLFA 3WX4A 1KN6A 2LA4A 2D3ZA 1G1XA 4DBQA 1IBMF 3K57A 4B02A 4MH8A 4ZCMA 1U2RA 2KJVA 2NUUG 1YJRA 3ITHA 4ICLB 3T5LA 1UMJA 2X3GA 2HVIA 4OZLA 1PC4A 2CVEA 2OD6A 2HFOA 1UVJA 1WTBA 3U1NA 4PXEA 4FBTA 4DF4A 2JLFA 1QAXA 3I55S 1RGVA 3CJ0A 1S6QA 3BR9A 3GFHA 4ILRA 1KFDA 1RTIB 4JOUA 3Q8QB 2UU9F 1GXLA 4RNHA 1C4AA 1H2UX 1S9GA 5KG1A 1TAUA 4MK9A 1XEZA 4PG4A 4YFUA 2KG0A 3LAKA 3OQ2A 2FGCA 2ILZA 3T9ZA 5KFFA 4JV2A 2RE1A 4V19X 3T1HF 2BW2A 1U1OA 3HT3A 1P6TA 1H2TZ 3IRWP 1BQMB 2W7OA 1LWEA 5D6GA 1WNEA 1HQUA 3IXQA 4B9UA 3CCWA 5A6PA 3DFEA 2OFHX 3SQGA 4OI4A 4WE1B 1VQMS 3RZAA 4XIUA 4QU6A 5HMXA 5DLGA 2OMLA 2U1AA 3ETOA 2HNDB 5G0RB 4YY3F 4TU8A 3CD7A 4OZ1A 4AUKA 4F50A 5J2PB 1Q53A 5L39A 2MSTA 1X5TA 5GAGI 4JYAF 3NP5A 3R1LA 5DDPC 2HFNA 1X4GA 1BGXT 2OSQA 3LF0A 1U1RA 3HHNB 2VA3A 4A48A 1UVMA 1GXUA 1TL3B 1N0VC 2OPQB 5L9NA 4I4BA 1SQEA 2VPYB 2WBMA 5B09A 1BQNA 4DN0A 2HRUA 3GQCA 1VQ4S 2RIJA 4NX9A 4DFKA 2CRLA 1S1WB 2E1CA 2AGOA 4JI2F 5F8JA 4F3QA 3CCVS 3M8PB 5HQ8A 3OUYB 4N8OA 2FPHX 1KOHA 4OV1A 3L09A 2RRNA 2JEJA 3CJ2A 3J7ZT 4FF4A 3DLEB 5F9LA 1F2GA 4Z37A 2DNQA 2HGLA 2XB2D 4WFYA 1R8PA 1YVFA 2RKIB 2G9OA 1X0FA 2M8HA 2C3UA 2F1FA 3KNAA 1JKHA 1KS2A 4DUYF 1U1LA 4GO5X 4KB7A 1RWUA 4TYBA 1L3TA 3HJFA 3EGZA 3M2UB 2ACYA 3U1MA 2EVZA 4O44B 1JLFB 1Y4ZB 4ECXA 2BQ3A 3M30A 2OIHA 1FE0A 2MZQA 2PO4A 2YNGB 3GILA 3MDFA 3ITHB 3GYNA 2YKNA 3H5YA 2XCPA 2FDNA 5E2QA 1ZM2A 2FLOA 3OSPA 3K8WA 1RT3B 1VQ5S 1CEZA 3MM8A 2KB2A 2EI5A 3R3TA 1HA1A 2OD4A 5BYSA 1N5YA 1XK8A 1ULRA 3ZZZA 1A6LA 2HW3A 4GO7X 1N48A 3PR4A 1HWUA 1RI7A 2C2EA 4F02A 1M5HA 3TUJC 1FCAA 2C22A 1S9GB 3UCGA 1TL1B 3PFOA 5HLFB 4C8OA 4EGLA 4LF4F 1T95A 3IR7B 5J2NB 2LYVA 1S99A 2DRAA 2XMTA 2D1CA 1VBXA 2VFSA 2RU3A 1L3SA 3MD1A 4DUZF 4LMZA 3CJ4A 1QJHA 3HVTA 4WYLA 4DF8A 2BDPA 4MKAA 2R7OA 3N9UC 2UVVA 1GX6A 1SI9A 3OTEA 4USHA 1QSLA 2DVIA 2VB6A 4EYIB 3ONQA 2FJWA 1LWEB 1ZM3A 2DNYA 2ZKUA 2UP1A 1HQUB 2MKIA 3TUIC 2KG1A 2PC6A 3DRRB 1VC0A 1HR0F 1Y7PA 3SQGB 2ASYA 1NJZA 3DLBA 1JJ2R 2DHXA 2RSQA 2COLA 4DEZA 2BV3A 2MZ1A 4WF9Q 1HPZB 3OXLA 3F73A 4OI0A 4NLOA 4PQUB 2AYGA 1JLQA 1FKPB 4NRTA 4OZJA 3MMAA 3BO3A 3DI6A 1KR4A 1FESA 2GFFA 1RTDA 4AXJA 2OKQA 4CO3A 3IBWA 2D3UA 1NB7A 2XSFA 3KHLA 3GIJA 2RQCA 3MR6A 5GAEI 3OVBA 4DFMA 3G6VA 1K1QA 2Z4PA 3MOZA 3OHAA 4OZNA 1SXLA 5IFMA 4TN2A 1BQNB 2KHCA 3H4BA 4OI6A 4ECTA 2HVHA 2HWHA 4GKJF 4ED3A 3ZZOA 1KSPA 4ED0A 1TVRB 2XMWA 2YX4A 5K9FA 4KJIA 4ZCLA 4LIRA 4WFBQ 4X66F 1E6VB 3I0RA 4Q43A 3K5MA 2XNQA 4K4XA 3RBDA 2KRBA 3KMSA 1UJ4A 1FT8A 3JSBA 1QVFR 5KOWA 1NK7A 1M0SA 3PEJA 2DTJA 1VGYA 2LMIA 3V6DA 2ADBA 4NMLA 1CC8A 2P9GA 3LH2S 3BGUA 1U2FA 4NLTA 3GFXA 1Z1ZA 5HBMB 2HRYA 3WDOA 5LSOA 1MMLA 4DR4F 4NOHA 4LF5F 2GGPA 4O3QA 1XC9A 2QSFA 4RW8B 1G2EA 3SYZA 2PD1A 5HMYA 3DXBA 2MKJA 4LSLA 4K5SA 3KLVA 3KK1A 3HVRA 1U25A 2QE5A 1D9FA 2L08A 2N4CA 4P7VA 3V6HA 1RT5A 3IO1A 3UNGC 3UW1A 2MHNA 3ZZ0A 3VAHA 2ASLA 3DCAA 4URQU 2MY7A 3FDSA 2AV5A 1VJWA 2YKMB 1HWLA 1JLBA 4OJGA 4G6VB 4JV1A 2XMMA 2YKNB 3TA1A 4Y2AA 4PUOB 1YWXA 2ZOMA 2IJNA 1JMTA 1PSDA 2NS1B 2HYIB 1MROA 3I9V9 5AXKA 4UUWA 1H7WA 1S9EA 2DISA 3VZHA 4YR3A 2V8GA 2OPSB 3CGIA 1WD6A 2J9DE 1B0VA 1MMNA 2K1RA 3QWPA 4LSNA 1TKDA 2MZRA 1GXTA 3RR7A 1JLEA 1HNWF 1LWCA 3EPIA 4ZMMA 2HWTA 2VASA 4DQQA 1S1VA 4ES3A 3HVTB 2CDQA 4FZVA 4IUFA 3JSMA 4W90B 3HHDA 2BANB 5EX0A 3BQ0A 2Z0GA 2N7YA 1J2VA 5J1EA 2C42A 2FB0A 2DO0A 2L3MA 2QT7A 3QO9B 3KJVA 1NJWA 1R8CA 2B4OA 1KLNA 3I9ZA 2MQLA 3S8SA 4ECQA 5KG7A 4FN5A 4J9PA 1JLQB 3MMAB 3K59A 4C9DA 2GMLA 1RT7A 1Z4UA 2DPIA 3M2RB 3W3SA 2YKAA 5E3AA 4XDCA 3T6BA 4Q2LA 4RUHA 1NK8A 1DTTA 1U8SA 4OX8A 5KFPA 3EXCX 3MAQA 3MPWA 3O1LA 1T3NA 3JSYA 2AYMA 4YR0A 3PACA 1UVNA 3BS9A 4RNNA 4KHRA 4ZKAA 3U7JA 3VAMA 4G3IA 4L3NA 3M6WA 5AE3A 5F3ZA 3I0RB 5KAKA 3Q8PB 3QWUA 3LPYA 1N56A 2FJXA 2EWHA 2HGNA 4PKDB 3V6DB 1IKYA 4A8YA 1FEEA 5BYRA 1NO8A 1LW0B 3C3LA 3P49B 1EP4B 3FQLA 4MAKA 4A8KA 1FRKA 3KNGA 1HYSA 1N33F 2JC1A 4I69A 2GGPB 2XMUA 2N82B 5DGBA 5T14A 2M52A 3FSXA 2RQ4A 4IOBA 4JI4F 4LSLB 1S0OA 2C3PA 4IR1A 1TK0A 1DTQB 2K3IA 3BREA 5F3TA 2K7KA 3TAQA 2MQNA 2YX1A 3PFEA 2FHKA 5KFRA 3JYTA 3O8WA 2YWFA 4C8ZA 1FNMA 3B4MA 4C0HA 1FRIA 3HF5A 2VC0A 3CJKB 1JLBB 3DN9A 4X4OA 3SDEA 3ULHA 2KVIA 2VQEF 1NAQA 5JXSA 1I1GA 2CQPA 5GMKa 2YWEA 1RTJA 1RKIA 3AQPA 3BEGB 3PRBA 2DHAA 3CDUA 1YGYA 4LVNP 2MXYA 1U4BA 2XS7A 5LSLA 3NCPA 4MTPA 1AUDA 1S9EB 4WCEQ 1FTCA 1Q81T 1G3OA 4DOZA 3LO3A 4Y2KA 2XLIA 2DGXA 4M1KA 3UR3C 4O0IA 3OFHA 2K1RB 3I5BA 3PX4A 3GFYA 1BWEA 3GV5B 2O3DA 1JLEB 1LWCB 2ZDOA 1ZOTA 1WHXA 2I1RA 2R8H<