3PAEA

Crystal structure of the k84d mutant of oxa-24/40 in complex with doripenem
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
244
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFDMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structures of the Class D Carbapenemase OXA-24 from Acinetobacter baumannii in Complex with Doripenem.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/antibiotic
total genus 79
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3paeA00
2A3UA 3A3FA 3DTMA 5EE8A 5KSHA 2H0YA 1PI5A 2JC7A 2Z2LB 2WGVA 2ZQ7A 1XKZA 3UE3A 1EWZA 4X55A 2QPNA 1FQGA 2ZC7A 3S4XA 4EBLA 1PZOA 4MBKA 4JF4A 3Q7ZA 4E6XA 2WK0A 3GRJA 5FATA 1NRFA 1E4DA 3SH7A 1BSGA 2XFSA 1KE0A 3DWKA 4K0XA 3ITAA 1C3BA 3UDFA 4N92A 5HAQA 3MXSA 3O87A 4GD6A 5FQIA 4BD1A 1CEFA 3HLFA 4GD8A 1ALQA 4S2KA 4OLDA 4MBHA 5JYPA 1NZOA 3BLSA 2EXBA 4RX2A 3IXGA 5JYOA 3VP4A 2Q9MA 3A3EA 1PZPA 5CHUA 1W79A 2GDNA 1K38A 4E3NA 1FOFA 1YLWA 2OLVA 4A5RA 3Q7VA 3UE1A 1MBLA 3FZCA 1L0GA 3DWZA 3N8SA 3V50A 1JWVA 1QMFA 5M18A 4CPKA 1K55C 4E6WA 3LCEA 2J9OA 3BM6A 1YMXA 4KG5A 4KQOA 4DKIA 5FDHA 3CG5A 3ITBA 4OP5A 3G34A 1TVFA 2ZJ9A 2IWCA 4X69A 4BL2A 1Z6FA 2WAEA 4KZ8A 5EUAA 1NJ4A 4GNUA 4OPZA 1MWSA 1H5XA 5BOHA 1XGIA 3NC8A 3NBLA 1GHPA 3SH9A 2C5WB 3GTCA 1NYYA 1L2SA 3ISGA 3IH8A 1BTLA 3BFGA 5CEDA 5HL1A 4NK3A 2XDMA 1TDLA 5F83A 4C3QA 1DJCA 3G32A 4JLFA 5FAPA 1IYSA 5FAQA 4EV4A 3C4OA 4PPRA 4X68A 4QHCA 5EVIC 1KDSA 5CTNA 3UO9A 3O3VA 4PM5A 1BLHA 3ZG9B 2JBFA 5EVIB 5F1GA 3SOIA 2CC1A 4E3JA 3IH9A 4IVKA 1YM1A 2FFYA 4EQIA 1ESUA 2ZQDA 4KQRA 5HAPA 2XD1A 5TR7A 3FKVA 3OCLA 3Q1FA 5FQJA 3OPHA 1ERQA 4HBUA 3ZNYA 2EFUA 1ONHA 4MEZA 5FI6A 1MKIA 5CTMA 2ZC3B 2JE5A 1MXOA 4XUXA 1FR6A 3HLGA 3V3SA 4N1XA 3N6IA 4ZAMA 4IBXA 1LI0A 1RCJA 1DY6A 2BG1A 4BENA 2J9PA 2XEPA 1ES2A 1O07A 3MZDA 4QD4A 1KGFA 4YFMA 4GKUA 5D3OA 5AQ7A 3SH8A 1MY8A 4OH0A 2Y2LA 3UY6A 2Y2GA 1G6AA 3HLCA 3V5MA 2EXAA 3MKFA 3W4PA 4DE3A 4WELA 2V2FF 3RXXA 5E2EA 4UA6A 4U3TA 5FQMA 3VP1A 3QHYA 3CJMA 2Y4AA 1IYPA 2X02A 1IELA 1YQSA 4P0MA 5GLCA 2EX6A 2VGJA 3PAGA 3VP2A 4GDBA 3WWXA 4KZ6A 1E3UA 3E2LA 3WS1A 3UPNA 3GV9A 2ZQAA 3ZNTA 3PBSA 4U0XA 3C5AA 4LV2A 4O7DA 2XR0A 1PI4A 3BECA 4OONA 4DDYA 2ZD8A 4EUZA 5HARA 1YLTA 2WUQA 4E3OA 2B5RA 3PBQA 2XFTA 4QU3A 4XXRA 5GLDA 1KDWA 1W5DA 4WM9A 3G31A 5AQ9A 4B4XA 2OSUA 4N9KA 1YT4A 3A3IA 3SS3A 1CI9A 4R23A 3ZDJA 2UWXA 3CZDA 3MBZA 2H10A 5KSCA 5E2HA 3HUMA 3IQAA 1K54C 1MWUA 2ZMAA 3MXRA 3IF5A 4BD0A 2JCHA 5F1FA 3M6BA 1IEMA 4FH2A 5TFQA 3C7VA 3IT9A 4WZ5C 3N8RA 4LCMA 4RX3A 1MWTA 4C75A 3AGFA 3WRTA 3Q7VB 3UPPA 3OPLA 4GDNA 3HL9A 3UE0A 2QZ6A 1H8YA 2HP6A 3PBRA 5CECA 3D4FA 3HUNA 4B4ZA 5CGWA 4OVDA 4MLLA 1SDEA 3GMWA 4JBFA 1LL5A 4KZ7A 4R0QA 4WYYA 1NZUA 4PM8A 3LEZA 3OCNA 5HW3A 4X56A 1QMEA 1K54A 2XF3A 5A92A 2Y2KA 3NIAA 2OV5A 4R4SA 4B88A 5FQ9A 3IF6C 3W8KA 2Y2MA 4WZ5A 5FQQA 3G35A 4ZBEA 2ZM8A 1LHYA 1K4EA 1IYOA 2PU2A 1SDNA 3A3JA 3IHAA 1YLYA 3FV7A 1GA0A 1K4FA 3UNWA 1PWDA 4OOMA 5GHYA 1YMSA 4EWFA 5GHZA 3LY4A 1DJAA 4EBNA 1EROA 5A93A 3IXDA 3HLBA 3CMZA 2PBYA 3IWQA 4DE2A 1YLJA 3ZG5A 1KVMA 5AQBA 2J7VA 3LY3A 1RGZA 5DF7A 1I2WA 4JXWA 1J9MA 2ZQCA 4P85A 2RCXA 3N8LA 2WKIA 1BT5A 2ZM2A 5FASA 1XX2A 2HDSA 2WADA 3IF6A 4KZAA 1MPLA 3E2KA 2WZZA 4LV3A 3Q07A 2XLNA 2ZC5B 3N7WA 1I5QA 2HP5A 4UAAA 4DE1A 1GHIA 1JTGA 3M2JA 4LV0A 4JXGA 4OQHA 4JF5A 3EQUA 4S2JA 4IVIA 2WGIA 2WGWA 4U0TA 5DF9A 4JPMA 4DRTA 2WKEA 5M1AA 4KQQA 3P98A 3BFCA 1U60A 4IEDA 3SS4A 1KGEA 3BEBA 3BFDA 5EOOA 4P87A 1BZAA 3MZFA 3O88A 3NCKA 4GN2A 3HREA 2VGKA 5EVID 3V3RA 3N4IA 5TGFA 1PYYA 4WMCD 5J8XA 4BQMA 5DVAA 5E2FA 4BJPA 3UDXA 3O86A 1K57A 4OP8A 1K6RA 2Y59A 1XA1A 1JWZA 5FAOA 3RXWA 3IWOA 4OQGA 4ZJ3A 2Y2JA 3NDGA 2Y2PA 4R3JA 4D2OA 2RL3A 5L2FA 2V20A 4RVAA 1AXBA 1JTDA 3UPOA 5A90A 1S0WA 4DF6A 4JKTA 1KGGA 1Y54A 2ZC4B 4LCLA 4ZJ2A 3WS5A 3VSLA 4CJNA 1L0FA 2HDQA 3PBOA 1PIOA 1XA7A 4KG2A 4R4RA 4WBGA 2X01A 1BUEA 1FCMA 2EX8A 2WZXA 3VP3A 1M6KA 4KENB 5HAIA 3BYDA 1I2SA 3W4QA 1K56D 2Y2HA 4YINA 1FR1A 3WRZA 3BRMA 4JXVA 4MBFA 1IYQA 3ZG7B 4S2NC 4HBTA 5CHJA 3HLWA 1W7FA 1GA9A 1LI9A 5I94A 1BLSA 4LENA 4QY6A 3V39A 4QJGA 4N9LA 4ZDXA 4E3KA 1ESIA 1JVJA 2X71A 4RYEA 4KZ3A 3PBTA 3G30A 4HESA 4QB8A 4Z9QA 4H8RA 4WZ4A 1TEMA 2HPBA 1DJBA 1W8QA 2HP9A 2J8YA 4JF6A 3VMAA 2QMIA 4WEJA 4NETA 5M19A 2P9VA 5CEBA 2WAFA 3ZFZA 2PU4A 4S2NA 4Q8IA 3AGEA 1IKGA 2XH9A 4OLGA 2XGNA 5CGSA 1FSWA 3G2ZA 4E3LA 4N1HA 4PM6A 1NY0A 4KG6A 3QNCA 3TOIA 4GB7A 1Q2QA 4S2MA 4BLMA 4K91A 2ZQ8A 2ZQ9A 1HD8A 4OOYA 2R9WA 4S2LA 5GL9A 1MWRA 1TDGA 3MFDA 1H8ZA 5KZHA 4OQIA 1BLCA 2Y2OA 5AQAA 1M40A 5FI7A 3ZG8B 1BULA 3G4PA 4PMAA 4S2PA 5CHMA 4DE0A 2Y2QA 4OKPA 1N9BA 1PW1A 5CRFA 1KVLA 3HUOA 3NDEA 1PWCA 1XGJA 4P6BA 5G18A 3OC2A 3VFHA 3A3DA 4BL3A 2HDUA 2XK1A 1O7EA 2DNSA 2V1ZA 5FSRA 3IF6B 4Y0UA 1ZG4A 1SHVA 3RJUA 1JWPA 2XD5A 3MZEA 4M3KA 1FCOA 5IHVA 2OLUA 1G68A 1RP5A 3PBNA 5GLAA 4KZ4A 3OPPA 2DRWA 4ID4A 1N4OA 3Q81A 2Q9NA 2IWBA 3VOZA 2WGWB 2EX2A 5EECA 3PAEA 2Y91A 3HBRA 5FQKA 1VQQA 1FSYA 2P74A 1ZKJA 1WYBA 3DW0A 1XPBA 4UA7A 4UA9A 3UN7A 3Q82A 4OPRA 3LO7A 1IKIA 3FWLA 3S22A 1VM1A 2Z2MB 4IBRA 1W8YA 5DTSA 3W4OA 4ZJ1A 1ES4A 2WYXA 1K57C 3ZG0A 3OPRA 1WE4A 3TG9A 2EX9A 3B3XA 1L0EA 3PTEA 2G2WA 3ZHHA 1KE4A 3ZCZA 2IWDA 1ONGA 2Y2NA 4GZBA 3NI9A 4ZTKA 1K6SA 1SKFA 3FKWA 4GOGA 3HLDA 3BFEA 4KZ5A 4KZBA 2R9XA 4X6TA 1ES5A 3BLMA 4C6YA 3JYIA 3TSGA 3VSKA 3NY4A 2I72A 3P09A 4FH4A 3IHBA 3ZVWA 2XQZA 1K55A 5DF8A 4F94A 1K25A 4E3IA 1ERMA 1HZOA 4E3MA 1GHMA 1NXYA 4FSFA 3OZHA 1YLPA 4DXCA 1CEGA 1XP4A 5DTTA 3FYZA 3C7UA 2DCFA 1HTZA 3ZVTA 5EOEA 3G2YA 3QNBA 4RA7A 3HVFA 5GHXA 3AGDA 5F82A 4FCFA 1GCEA 2ZM0A 4OPYA 4QY5A 1XXMA 2C6WB 2H5SA 4K0WA 3M6HA 5DTKA 4UHUA 5EPHA 5FA7A 1LLBA 1E3UD 3S1YA 4FD8A 3IWIA 2ZC6B 4Y7PA 3EQVA 4WEKA 1L0DA 2HDRA 1S6RA 5E2GA 3C4PA 1PWGA 3I7JA 1CK3A 3GSGA 5HX9A 3ZGAB 2E8IA 2G2UA 1BLPA 2P9VB 4PM7A 5CERA 5EVIA 2H0TA 5CXWA 4Y0OA 1Q2PA 4KZ9A 4L0LA 4WMCA 4OPQA 3SS5A 3HLEA 4S2OA 3WS0A 3IXBA 3IXHA 5FI2A 1E25A 1WYCA 5KMWA 1YLZA 1HVBA 2BLSA 2ZLYA 4MNRA 2Y55A 2FFFB 4XUZA 1KE3A 2EFXA 5CGXA 3WS2A 1PW8A 1ZG6A 1FCNA 2Y2IA 5HFOA 4LV1A 4PM9A 1EI5A 4HEFA 3BFFA 1SCWA 3VP0A 4R1GA 4R3BA 3WS4A 4OQ0A 3GQZA 3VOYA 5E43A 1LL9A 2A49A 4OOLA 4S2IA 3UDIA 1OMEA 5GLBA 1NYMA 4EBPA 3GVBA 4Y0TA 1K56A 4JXSA 1ES3A 5A91A 4X53A 4DDSA 1CI8A 2WKHA 3VFFA 4DXBA 3M2KA 1ZC2A 1RGYA 3MKEA 5U47A 3GR2A 5EVLA
chains in the Genus database with same CATH superfamily
3DTMA 5EE8A 3LR0A 4X55A 2QPNA 2ZC7A 1UGUA 3S4XA 4EBLA 3Q7ZA 4E6XA 2W1TB 4GLQA 1LSVA 1KE0A 5J4EA 5HL6A 2NUPC 3UDFA 3MXSA 4HH3A 1CEFA 3MQ0A 4YOFA 2ACGA 5HDDA 5HZHA 3UB6A 3VP4A 2Q9MA 1W79A 1K38A 1YLWA 2XROA 1L0GA 3FZCA 3N8SA 5M18A 4E6WA 4MN7A 1Y4OA 4KQOA 4DKIA 3CG5A 3ITBA 3G34A 2ZJ9A 2IWCA 4X69A 1G6OA 3D72A 4I3JA 1Z6FA 2WAEA 4BL2A 4KZ8A 3HJKA 4X25A 4Q0JA 1XGIA 3MF0A 3CLOA 1L2SA 3IH8A 1BTLA 3BFGA 4HH2A 5CEDA 4MN6A 2HGVA 5HWVA 3FC7A 5FAPA 5FAQA 4EV4A 4X68A 2VKSA 4HJ3A 3O3VA 1BLHA 2P08A 1T1AA 2JBFA 2FFYA 2Y8HA 4JGRA 1ESUA 1PFLA 3OCLA 2EFUA 3CWFA 3LEQA 1ONHA 3MR0A 3UE6A 2ZMFA 1SKOB 1MXOA 4HIAA 4QPRA 5AVEA 4IBXA 3P7NA 1LI0A 1RCJA 2BG1A 2OOLA 2V8CA 1KGFA 3BW6A 3SH8A 3MKFA 3RXXA 2V2FF 3TW8A 1IYPA 2J3WA 1YQSA 2EX6A 3WWXA 4GDBA 1E3UA 3UPNA 1IOUA 3BECA 1PI4A 4OONA 4CLCD 2B5RA 2XFTA 4LPZA 3CUEA 5EM1A 1W5DA 4WM9A 4Q0IA 5AQ9A 4B4XA 2OSUA 3DAVA 4R23A 2OAP1 3QP6A 3S7OA 1MWUA 1IEMA 2JKFA 1OT6A 4FH2A 3VE3A 4C75A 4LCMA 5K5BA 3L9KA 3OPLA 4AFIA 3BJNA 2V0WA 4OVDA 4G3KA 3T1SA 4KZ7A 4PM8A 3LEZA 3OCNA 3NIAA 5DKKA 5F69A 3IF6C 3F1NB 4WZ5A 3EGDC 5FQQA 3G35A 3DTEA 1K4EA 1MC0A 1IYOA 2PU2A 4F94A 1PWDA 1OJGA 4NXEA 3JVVA 3KO6A 2W3FA 2J7VA 5AQBA 5DF7A 4JXWA 1S1ZA 1YSPA 4P85A 2RCXA 3N8LA 4PKYA 2WKIA 1BT5A 4KZAA 4LV3A 2ZC5B 2PD7A 3N7WA 4I3AA 3UB9A 4U0TA 4DRTA 3BFCA 4IEDA 3T12B 3MZFA 4GN2A 3V3RA 5EVID 5HD3A 4I5SA 5J8XA 4BQMA 4BJPA 4NG2A 2Y59A 1XA1A 2PT7A 1OTDA 4OQGA 5FL3A 5A90A 4DF6A 3MXQA 3OLOA 1KGGA 3VSLA 4BBTA 2OAQ1 4CJNA 2JN7A 4R4RA 2L4RA 4WBGA 2J3TC 2X01A 2B18A 1BUEA 2VGLS 5IU1A 4BWIA 5HAIA 4YINA 4JXVA 4MBFA 1IYQA 3ZG7B 1ODVA 2WKRA 1BLSA 4QJGA 3PBTA 4Z9QA 4H8RA 3VMAA 5M19A 2P9VA 5CEBA 5EM0A 3ZFZA 3KYQA 2PU4A 4S2NA 1F5MA 4CLCC 3AGEA 4OLGA 2XA7M 2XGNA 5DFYA 1NY0A 4JGPA 4S2MA 3E0YA 2PAVP 1X0OA 1HD8A 4UQIM 3LR5A 2A24A 5KZHA 1BLCA 1T19A 5FI7A 4S2PA 5IS1A 4OKPA 3PHYA 4EETB 3NDEA 4ETXA 5AVFA 4BL3A 5FSRA 1HLUP 3E4PA 1FCOA 1RP5A 1S4RA 3IBJA 3OPPA 2DRWA 3T50A 4ID4A 2W1TA 3VOZA 3PAEA 5FQKA 4UA7A 1MZUA 4UA9A 1XFNA 2VLGA 3EWKA 3LO7A 1IKIA 1J3WA 2QWSA 3FWLA 3W4OA 5DTSA 4BMWA 3ZG0A 1WE4A 3G6OA 2EX9A 1VEUA 1ONGA 3NI9A 4ZTKA 1SKFA 3FKWA 4GOGA 2R9XA 1ES5A 3TSGA 3VSKA 2W1RA 3CITA 4I39A 4FH4A 2XQZA 2VV8A 4E3IA 1SZVA 3HCYA 4FSFA 1CEGA 3C7UA 3QNBA 5L09A 2K31A 1PRQA 3NOUC 1GCEA 2ZM0A 4LRZE 4K0WA 3UMEA 4UHUA 1E3UD 3EQVA 1L0DA 1Y28A 3GSGA 3ZGAB 2H0TA 1Q2PA 1WYCA 5KMWA 1YLZA 4DN0A 2ZLYA 2FFFB 5CGXA 4P6ZM 4K08A 1ZG6A 5KIZA 2UV0E 4OQ0A 5E43A 1AWIA 1OMEA 3C2WA 3GVBA 4JXSA 5A91A 5J7EA 3H7WB 2V9AA 3OBFA 3GR2A 3A3FA 2JC7A 2WGVA 2ZQ7A 1XKZA 3UE3A 2V1BA 3EEAA 1PZOA 4MBKA 4WLAA 1OTBA 3GRJA 5FATA 3CPTA 1NRFA 2XFSA 4R6LA 4K0XA 3LIEA 3QP8A 3O87A 1YKDA 3HLFA 4XT2B 4MBHA 3BLSA 2EXBA 1DP9A 4RX2A 2ZOHA 5JYOA 1PZPA 3B42A 2GDNA 5HWWA 4E3NA 1S4SA 2OLVA 2QYBA 1XFQA 3LCEA 3BM6A 1K0KA 1YMXA 4KG5A 4GS9B 2O9AA 2JKTM 2M7UA 1MWSA 1H5XA 1GHPA 3F1NA 4L9GA 3SH9A 2C5WB 3T4QA 1NYYA 5CX7A 4L9EA 5HL1A 1TDLA 4C3QA 2PBDP 1IYSA 4PM5A 4LRYC 3ZG9B 3SOIA 2D01A 4KQRA 2JKRI 5TR7A 3FKVA 3S7PA 3Q1FA 5FQJA 5FI6A 5CTMA 2HZ5A 1XJ2A 2JE5A 4XUXA 3V3SA 4N1XA 1NWZA 4BENA 2XEPA 5HDSA 3T4OA 3CUEC 5AQ7A 4FUWA 2JHEA 3V5MA 4DE3A 4WELA 4UA6A 3VP1A 4HP9A 3CJMA 1V9YA 2A24B 3D3OA 3MS6A 3GV9A 1P9RA 2ZQAA 3ZNTA 4EUZA 4DDYA 2ZD8A 4E3OA 3TJZC 4QU3A 4XXRA 3G31A 1YT4A 3A3IA 1CI9A 4F3LB 2UWXA 2H10A 5F5YA 2W0NA 1A0KA 5G4YA 4BD0A 3IF5A 1G5UA 1OT9A 2JCHA 4PHTA 5TFQA 4PAUA 1TS0A 3A0SA 4WZ5C 2PYRA 3E4QA 3N8RA 4RX3A 3AGFA 3Q7VB 3HL9A 3UE0A 2MJ6A 3CI6A 2HJ9C 4B4ZA 5CGWA 4EU0A 4JBFA 4WYYA 3UB5P 1VEUB 4X56A 5L10A 2XF3A 1K54A 2Y2KA 1N9LA 4L9FA 4B88A 2Y2MA 4ZBEA 1SDNA 1YLYA 2B95A 1GA0A 1K4FA 3T4JA 5GHYA 1YMSA 3LY4A 3C30A 5J3WA 5A93A 3IXDA 1KVMA 3EEHA 4B93A 2ZQCA 1Z09A 3VV4A 2ZM2A 5C5KA 2HDSA 2E8JA 3E2KA 1OTIA 4UAAA 1GHIA 4LV0A 4JXGA 4EXOA 4MN5A 3FG8A 3EQUA 2WGIA 3PR6A 3P98A 4HY8A 3SS4A 1P97A 1KGEA 3BFDA 5EOOA 3O88A 4WUJA 3N4IA 1PYYA 5E2FA 2VX8A 3O86A 1K57A 3C8CA 5FAOA 3IWOA 4ZJ3A 4CLCE 4R3JA 4D2OA 4RVAA 3UPOA 1Y54A 4LCLA 2GNXA 1PIOA 1XA7A 2WZXA 4MCWA 4KENB 2HF6A 2KLIA 3WRZA 4S2NC 3HLWA 1W7FA 5I94A 4QY6A 1G28A 3V39A 4E3KA 3CPTB 3G30A 1DJBA 4MMNA 4JF6A 3ULFA 2QMIA 4NETA 3BY8A 1IKGA 3G2ZA 4N1HA 3QNCA 3KYEA 1Q2QA 1DP6A 1DP8A 2KX6A 5GL9A 5I5LA 2R9WA 3O5YA 2YKFA 5AQAA 1BULA 4DE0A 2Y2QA 5CRFA 2VJWA 3HUOA 5G18A 3OC2A 3VFHA 3H7WA 2XRNA 3BWLA 2XK1A 1O7EA 2V1ZA 3JVUA 1SHVA 1JWPA 2WKPA 2OLUA 1N9NA 1G68A 3VOLA 1LSXA 5GLAA 1N4OA 2A2LA 1D06A 4FTXA 2EX2A 2M1CA 3HBRA 5EVEA 4ESPA 1XPBA 3S22A 1LL8A 1GSVA 2WYXA 4XT2A 4LGWA 3TG9A 3PTEA 1VETA 2G2WA 1KE4A 3BFEA 2L1MA 4KZ5A 1CJFA 4KZBA 4X6TA 3BLMA 4C6YA 2W27A 3HJIA 3NY4A 2P7JA 3ZVWA 4GS9A 5F6AA 1K25A 4E3MA 1GHMA 1NXYA 3OZHA 5DTTA 2ZMVA 2D02A 5EOEA 3HVFA 4BBUA 5GHXA 4LFUA 5F82A 5TBMA 1XXMA 4PKYG 2O9BA 1N9OA 5DTKA 3M6HA 1LLBA 3U2AA 3TE8A 4RQ9A 2BTFP 2HDRA 1S6RA 5E2GA 3I7JA 1ZTUA 1CK3A 4YWZA 2E8IA 4PM7A 5CXWA 4Y0OA 4WMCA 3IXBA 4Q0HA 4ETZA 4KQDA 3F1PB 3WS2A 3DTKA 1PW8A 1FCNA 5HFOA 4LV1A 1EI5A 1T1CA 4HEFA 3VP0A 3BQ8A 1TS8A 3GDIA 1FILA 3KSGA 1GSXA 1NYMA 2ZOIA 4Y0TA 4X53A 2WKHA 3M2KA 1W8YA 2A3UA 1PI5A 1IFQA 2H28A 1EWZA 2O99A 2W3HA 4Y3IA 2VGLM 3CHWP 4JF4A 4DJ2A 1S67L 2WK0A 3SH7A 1ACFA 2VV6A 3LYXA 4N92A 5HAQA 4BD1A 4GD8A 4F3LA 1ALQA 4S2KA 1TF1A 2P04A 3A3EA 4ZRRA 5CHUA 1OJ5A 2G7UA 3CAXA 2J80A 3Q7VA 4Y15A 3UE1A 5HPFA 1VB6A 3DWZA 3V50A 1JWVA 4CPKA 1K55C 3MSHA 1YPRA 5FDHA 4IUKA 1TVFA 3NHQA 4GNUA 4OPZA 1S66L 4EERA 3NBLA 2EWVA 4ME4A 4NK3A 2O9CA 5F83A 1LSWA 4JLFA 3LFVA 4PPRA 5EVIC 3QP4A 3UO9A 2GZAA 2CC1A 4IVKA 1YM1A 2V8FA 3MJQA 3LR4A 2XD1A 3FPWA 3OPHA 1ERQA 3ZNYA 4MEZA 3DBAA 5DJTA 4ZAMA 3H9WA 3H82B 2FZ0A 1DY6A 2ZL1B 2J9PA 1ES2A 1O07A 2B02A 4NKPA 1XJ3A 1MY8A 4OH0A 2Y2LA 2Y2GA 1G6AA 3W4PA 5FQMA 3QHYA 2Y4AA 1IELA 3A0VA 4Y17A 3VP2A 1TD5A 3NOTC 4EEPA 4JGQA 3PBSA 3T1RA 3BQAA 3C5AA 4LV2A 4O01A 4O7DA 1H0MA 1YLTA 3IS2A 3PBQA 5GLDA 4O8GA 3ICYA 4N9KA 2PD8A 3ZDJA 1F9IA 3MBZA 3HUMA 3IQAA 1K54C 2ZMAA 5DFXA 4LLOB 2W3EA 1GSWA 3C7VA 3IT9A 1MWTA 3WRTA 3UPPA 3KX0X 4GDNA 3PBRA 3LI9A 3D4FA 4MLLA 1SDEA 1VETB 1LL5A 2QJ5A 5HW3A 5FQ9A 3S7NA 2ZM8A 1BYWA 4E3LA 4ARZA 3UNWA 4EWFA 5GHZA 3SZTA 4EBNA 1EROA 4NXGA 4H6JA 2PBYA 1YLJA 3C38A 3U4LP 4I3IA 2K7SA 5FASA 1XX2A 1MPLA 5TBMB 2WZZA 2PR6A 3T4SA 1OTEA 4DE1A 3DTIA 1JTGA 3M2JA 3T4LA 4OQHA 4JF5A 4S2JA 1U60A 4M4XA 3BEBA 4P87A 2VGKA 2NUTC 5TGFA 4WMCD 5DVAA 3UDXA 1NLYA 4EESA 3NECA 3RXWA 3TRCA 2Y2JA 2RL3A 5L2FA 1D1JA 1AXBA 2PDRA 2QKPA 2HDQA 1UWPX 4WF0A 3VP3A 1M6KA 3BYDA 1I2SA 3W4QA 1FR1A 3BRMA 4HBTA 5DKLA 5CHJA 3EOIA 1LI9A 4LENA 4QWOA 2HV1A 1KOUA 4GW9A 4Z1WA 4ZDXA 1JVJA 4RYEA 2DMWA 2BASA 4HP4A 3LGOA 3T4KA 1L3LA 4QB8A 1TEMA 4WEJA 2WAFA 2VK3A 2XH9A 5CGSA 4KG6A 3F1PA 3TOIA 2PYPA 2V0UA 2KOIA 4BLMA 2Y79A 4K91A 2ZQ8A 2ZQ9A 4OOYA 2PRFA 3IX3A 1MWRA 4DJ3A 2Y2OA 3LIDA 3ZG8B 4PMAA 4P6BA 1PWCA 1XGJA 2HDUA 2VZWA 3IF6B 4D60A 4Y0UA 3MZEA 2Z6CA 4G3WA 4M3KA 5FEFA 3PBNA 3VE4A 4KZ4A 3R7WB 3Q81A 2Q9NA 2WGWB 2PHYA 2Y91A 5IT5A 1EW0A 3NJAA 1ZKJA 1F2KA 1WYBA 3UN7A 4OPRA 4FOFA 4IBRA 3IX8A 4ZJ1A 1UWNX 2LB5A 5L07A 1T18A 3OPRA 3QP2A 5DJUA 1L0EA 4IJGA 3ZHHA 1MKMA 2IWDA 2Y2NA 4NXBA 2INWA 3A0RA 3R4KA 1YSQA 2I72A 4HJ6A 2FH5A 4R38A 5DF8A 3MQQA 1ERMA 1HZOA 4DXCA 2DCFA 4IHQA 1HTZA 3G2YA 4RA7A 2VEAA 4QY5A 2C6WB 5FA7A 3IS2B 3IWIA 2JKTI 2EA9A 1PWGA 5HX9A 2G2UA 4HNBA 1BLPA 5CERA 2J3TD 3B33A 3WS0A 3HLEA 1CQAA 5FI2A 5FEGA 5EFWA 1HVBA 4MNRA 2Y55A 3UB7A 4XUZA 3L7HA 2Y2IA 1WA9A 1XJ6A 3BFFA 3H82A 3PXPA 4CLCB 2ZL1A 2A49A 3UDIA 5GLBA 4EBPA 1K56A 3LIFA 1ES3A 4DDSA 3VFFA 2GJ3A 1RGYA 3MKEA 5U47A 5EVLA 4R70A 4KUKA 4ARZB 5KSHA 2H0YA 2I9VA 2Z2LB 4X1MA 1FQGA 4H6JB 2AVXA 3OOVA 1E4DA 1BSGA 2O0YA 3DWKA 4HOIA 3ITAA 1C3BA 4X1LA 5HD5A 5F68A 5FQIA 4GD6A 5HWTA 4OLDA 5JYPA 1NZOA 3IXGA 1OPXA 1FOFA 4A5RA 4R3AA 1MBLA 4LRXC 1QMFA 2QJ7A 2J9OA 2IA2A 4OP5A 3T1QB 5EUAA 1NJ4A 5BOHA 3NC8A 4CQHA 1YAXA 3GTCA 4II7A 3K3CA 3ISGA 3BY9A 2XDMA 3KSFA 3T4TA 1DJCA 3G32A 3IX4A 4YNRA 3C4OA 4BBVA 4QHCA 4G3VA 1KDSA 5CTNA 5EVIB 5F1GA 4EUVA 4E3JA 3IH9A 3F1OB 4EQIA 2ZQDA 3B47A 5HAPA 3UMDA 1P0ZA 2L0WA 1JNUA 4EW7A 2XA7S 4HBUA 1PNEA 1MKIA 3K3DA 2ZC3B 5FDSA 2YKHA 1FR6A 3HLGA 3N6IA 3LUQA 4NEED 4UQIS 3RTYA 5HSQA 3MZDA 4QD4A 4WL9A 4GJ4A 4YFMA 1VHMA 4GKUA 4GHIB 5D3OA 1H8MA 3UY6A 4NXFA 3HLCA 2EXAA 2Q0OA 5E2EA 4U3TA 2X02A 4P0MA 5GLCA 3UB8A 2VGJA 3PAGA 4KZ6A 2PR5A 3E2LA 3WS1A 4U0XA 2XR0A 3LR3A 5HARA 2WUQA 4E04A 3E98A 3QP5A 1KDWA 3ZYTA 1NRJA 3SS3A 2VV7A 4MDZA 3CZDA 5KSCA 5E2HA 1LT0A 3MXRA 5F1FA 3M6BA 1XJ4A 2QZ6A 1H8YA 2HP6A 2R78A 2WKQA 5CECA 3HUNA 4HQAA 3GMWA 4R0QA 1NZUA 4KUOA 1QMEA 5A92A 4B9OA 2OV5A 3P01A 4R4SA 5TJJA 3W8KA 2OWHA 3RH8B 1LHYA 3A3JA 3IHAA 3FV7A 4OOMA 2JKRM 1DJAA 3HLBA 3CMZA 3IWQA 4DE2A 3ZG5A 3LY3A 1RGZA 1I2WA 1J9MA 3KSIA 2WADA 3IF6A 1V9ZA 3Q07A 2XLNA 1STZA 3GECA 1ZHHB 1I5QA 2HP5A 5AJGA 3R7WA 4Y13A 4IVIA 4UEYA 2WGWA 5DF9A 4JPMA 2WKEA 5M1AA 4KQQA 3K2NA 4P6ZS 1W63Q 5MC7A 1BZAA 1S1YA 3MMHA 2OWJA 3NCKA 3HREA 4OP8A 1K6RA 1JWZA 3V67A 3NDGA 2Y2PA 2V20A 5HDCA 5HPIA 1JTDA 1S0WA 4JKTA 2ZC4B 4ZJ2A 3WS5A 2QHKA 4EEUA 1L0FA 3PBOA 4KG2A 2EX8A 1FCMA 2XSSA 4HJ4A 4WN5A 1K56D 2Y2HA 3D9YA 1GA9A 4N9LA 1ESIA 3E4OA 2X71A 3SW1A 4KZ3A 3QP1A 4HESA 4Y2FA 3MQOA 4WZ4A 2HPBA 2HP9A 1W8QA 2J8YA 1SKOA 2ZBBA 1OTAA 4Y5FA 4Q8IA 1FSWA 2K2NA 2V1AA 3LICA 4PM6A 1DRMA 4GB7A 5A8BA 2M7VA 4S2LA 3MFDA 1TDGA 1H8ZA 4OQIA 2GX5A 2JKGA 4CLCA 1M40A 3G4PA 5CHMA 3MFXA 1N9BA 1PW1A 1KVLA 4IUHA 2CMNA 3A3DA 2DNSA 1ZG4A 3RJUA 2XD5A 5IHVA 3NULA 2IWBA 1W63M 5EECA 2W3GA 1VQQA 1FSYA 3IBRA 2P74A 3DW0A 3Q82A 1F98A 1VM1A 2Z2MB 3KSHA 1ES4A 1K57C 3B3XA 3ZCZA 1NLZA 4GZBA 3LIBA 1K6SA 1TS6A 2HJEA 3LIAA 3HLDA 3JYIA 4GCZA 1H3QA 3P09A 1P9WA 3IHBA 1K55A 4EQ1A 4DMZA 2W3DA 3LI8A 3S7QA 1T1BA 3PYPA 1YLPA 1XP4A 3FYZA 4I38A 3KYZA 2KDKA 4O0PA 4HHDA 3ZVTA 4JGOA 1D7EA 3AGDA 4FCFA 4OPYA 1FIKA 5LBRA 3JPUA 2H5SA 5EPHA 3S1YA 4FD8A 2ZC6B 4Y7PA 4WEKA 3EGXC 1CF0A 3C4PA 2P9VB 4HI4A 5EVIA 3T1XA 3NOPC 4KZ9A 2LB9A 4L0LA 5L8MA 4OPQA 3SS5A 4S2OA 3IXHA 3F1OA 3W2ZA 1E25A 2BLSA 2EWWA 3RFBA 1KE3A 2EFXA 2VA0A 4PM9A 5EV0A 5G4ZA 1SCWA 4R1GA 4R3BA 1TS7A 3WS4A 3FPVA 3GQZA 3VOYA 1LL9A 4OOLA 4S2IA 2Z6DA 4GHIA 4DXBA 1CI8A 3ZQ5A 1ZC2A
chains in the Genus database with same CATH topology
2A3UA 3A3FA 3DTMA 5EE8A 5KSHA 2H0YA 1PI5A 2JC7A 2Z2LB 2WGVA 2ZQ7A 1XKZA 3UE3A 1EWZA 4X55A 2QPNA 1FQGA 2ZC7A 3S4XA 4EBLA 1PZOA 4MBKA 4JF4A 3Q7ZA 4E6XA 2WK0A 3GRJA 5FATA 1NRFA 1E4DA 3SH7A 1BSGA 2XFSA 1KE0A 3DWKA 4K0XA 3ITAA 1C3BA 3UDFA 4N92A 5HAQA 3MXSA 3O87A 4GD6A 5FQIA 4BD1A 1CEFA 3HLFA 4GD8A 1ALQA 4S2KA 4OLDA 4MBHA 5JYPA 1NZOA 3BLSA 2EXBA 4RX2A 3IXGA 5JYOA 3VP4A 2Q9MA 3A3EA 1PZPA 5CHUA 1W79A 2GDNA 1K38A 4E3NA 1FOFA 1YLWA 2OLVA 4A5RA 3Q7VA 3UE1A 1MBLA 3FZCA 1L0GA 3DWZA 3N8SA 3V50A 1JWVA 1QMFA 5M18A 4CPKA 1K55C 4E6WA 3LCEA 2J9OA 3BM6A 1YMXA 4KG5A 4KQOA 4DKIA 5FDHA 3CG5A 3ITBA 4OP5A 3G34A 1TVFA 2ZJ9A 2IWCA 4X69A 4BL2A 1Z6FA 2WAEA 4KZ8A 5EUAA 1NJ4A 4GNUA 4OPZA 1MWSA 1H5XA 5BOHA 1XGIA 3NC8A 3NBLA 1GHPA 3SH9A 2C5WB 3GTCA 1NYYA 1L2SA 3ISGA 3IH8A 1BTLA 3BFGA 5CEDA 5HL1A 4NK3A 2XDMA 1TDLA 5F83A 4C3QA 1DJCA 3G32A 4JLFA 5FAPA 1IYSA 5FAQA 4EV4A 3C4OA 4PPRA 4X68A 4QHCA 5EVIC 1KDSA 5CTNA 3UO9A 3O3VA 4PM5A 1BLHA 3ZG9B 2JBFA 5EVIB 5F1GA 3SOIA 2CC1A 4E3JA 3IH9A 4IVKA 1YM1A 2FFYA 4EQIA 1ESUA 2ZQDA 4KQRA 5HAPA 2XD1A 5TR7A 3FKVA 3OCLA 3Q1FA 5FQJA 3OPHA 1ERQA 4HBUA 3ZNYA 2EFUA 1ONHA 4MEZA 5FI6A 1MKIA 5CTMA 2ZC3B 2JE5A 1MXOA 4XUXA 1FR6A 3HLGA 3V3SA 4N1XA 3N6IA 4ZAMA 4IBXA 1LI0A 1RCJA 1DY6A 2BG1A 4BENA 2J9PA 2XEPA 1ES2A 1O07A 3MZDA 4QD4A 1KGFA 4YFMA 4GKUA 5D3OA 5AQ7A 3SH8A 1MY8A 4OH0A 2Y2LA 3UY6A 2Y2GA 1G6AA 3HLCA 3V5MA 2EXAA 3MKFA 3W4PA 4DE3A 4WELA 2V2FF 3RXXA 5E2EA 4UA6A 4U3TA 5FQMA 3VP1A 3QHYA 3CJMA 2Y4AA 1IYPA 2X02A 1IELA 1YQSA 4P0MA 5GLCA 2EX6A 2VGJA 3PAGA 3VP2A 4GDBA 3WWXA 4KZ6A 1E3UA 3E2LA 3WS1A 3UPNA 3GV9A 2ZQAA 3ZNTA 3PBSA 4U0XA 3C5AA 4LV2A 4O7DA 2XR0A 1PI4A 3BECA 4OONA 4DDYA 2ZD8A 4EUZA 5HARA 1YLTA 2WUQA 4E3OA 2B5RA 3PBQA 2XFTA 4QU3A 4XXRA 5GLDA 1KDWA 1W5DA 4WM9A 3G31A 5AQ9A 4B4XA 2OSUA 4N9KA 1YT4A 3A3IA 3SS3A 1CI9A 4R23A 3ZDJA 2UWXA 3CZDA 3MBZA 2H10A 5KSCA 5E2HA 3HUMA 3IQAA 1K54C 1MWUA 2ZMAA 3MXRA 3IF5A 4BD0A 2JCHA 5F1FA 3M6BA 1IEMA 4FH2A 5TFQA 3C7VA 3IT9A 4WZ5C 3N8RA 4LCMA 4RX3A 1MWTA 4C75A 3AGFA 3WRTA 3Q7VB 3UPPA 3OPLA 4GDNA 3HL9A 3UE0A 2QZ6A 1H8YA 2HP6A 3PBRA 5CECA 3D4FA 3HUNA 4B4ZA 5CGWA 4OVDA 4MLLA 1SDEA 3GMWA 4JBFA 1LL5A 4KZ7A 4R0QA 4WYYA 1NZUA 4PM8A 3LEZA 3OCNA 5HW3A 4X56A 1QMEA 1K54A 2XF3A 5A92A 2Y2KA 3NIAA 2OV5A 4R4SA 4B88A 5FQ9A 3IF6C 3W8KA 2Y2MA 4WZ5A 5FQQA 3G35A 4ZBEA 2ZM8A 1LHYA 1K4EA 1IYOA 2PU2A 1SDNA 3A3JA 3IHAA 1YLYA 3FV7A 1GA0A 1K4FA 3UNWA 1PWDA 4OOMA 5GHYA 1YMSA 4EWFA 5GHZA 3LY4A 1DJAA 4EBNA 1EROA 5A93A 3IXDA 3HLBA 3CMZA 2PBYA 3IWQA 4DE2A 1YLJA 3ZG5A 1KVMA 5AQBA 2J7VA 3LY3A 1RGZA 5DF7A 1I2WA 4JXWA 1J9MA 2ZQCA 4P85A 2RCXA 3N8LA 2WKIA 1BT5A 2ZM2A 5FASA 1XX2A 2HDSA 2WADA 3IF6A 4KZAA 1MPLA 3E2KA 2WZZA 4LV3A 3Q07A 2XLNA 2ZC5B 3N7WA 1I5QA 2HP5A 4UAAA 4DE1A 1GHIA 1JTGA 3M2JA 4LV0A 4JXGA 4OQHA 4JF5A 3EQUA 4S2JA 4IVIA 2WGIA 2WGWA 4U0TA 5DF9A 4JPMA 4DRTA 2WKEA 5M1AA 4KQQA 3P98A 3BFCA 1U60A 4IEDA 3SS4A 1KGEA 3BEBA 3BFDA 5EOOA 4P87A 1BZAA 3MZFA 3O88A 3NCKA 4GN2A 3HREA 2VGKA 5EVID 3V3RA 3N4IA 5TGFA 1PYYA 4WMCD 5J8XA 4BQMA 5DVAA 5E2FA 4BJPA 3UDXA 3O86A 1K57A 4OP8A 1K6RA 2Y59A 1XA1A 1JWZA 5FAOA 3RXWA 3IWOA 4OQGA 4ZJ3A 2Y2JA 3NDGA 2Y2PA 4R3JA 4D2OA 2RL3A 5L2FA 2V20A 4RVAA 1AXBA 1JTDA 3UPOA 5A90A 1S0WA 4DF6A 4JKTA 1KGGA 1Y54A 2ZC4B 4LCLA 4ZJ2A 3WS5A 3VSLA 4CJNA 1L0FA 2HDQA 3PBOA 1PIOA 1XA7A 4KG2A 4R4RA 4WBGA 2X01A 1BUEA 1FCMA 2EX8A 2WZXA 3VP3A 1M6KA 4KENB 5HAIA 3BYDA 1I2SA 3W4QA 1K56D 2Y2HA 4YINA 1FR1A 3WRZA 3BRMA 4JXVA 4MBFA 1IYQA 3ZG7B 4S2NC 4HBTA 5CHJA 3HLWA 1W7FA 1GA9A 1LI9A 5I94A 1BLSA 4LENA 4QY6A 3V39A 4QJGA 4N9LA 4ZDXA 4E3KA 1ESIA 1JVJA 2X71A 4RYEA 4KZ3A 3PBTA 3G30A 4HESA 4QB8A 4Z9QA 4H8RA 4WZ4A 1TEMA 2HPBA 1DJBA 1W8QA 2HP9A 2J8YA 4JF6A 3VMAA 2QMIA 4WEJA 4NETA 5M19A 2P9VA 5CEBA 2WAFA 3ZFZA 2PU4A 4S2NA 4Q8IA 3AGEA 1IKGA 2XH9A 4OLGA 2XGNA 5CGSA 1FSWA 3G2ZA 4E3LA 4N1HA 4PM6A 1NY0A 4KG6A 3QNCA 3TOIA 4GB7A 1Q2QA 4S2MA 4BLMA 4K91A 2ZQ8A 2ZQ9A 1HD8A 4OOYA 2R9WA 4S2LA 5GL9A 1MWRA 1TDGA 3MFDA 1H8ZA 5KZHA 4OQIA 1BLCA 2Y2OA 5AQAA 1M40A 5FI7A 3ZG8B 1BULA 3G4PA 4PMAA 4S2PA 5CHMA 4DE0A 2Y2QA 4OKPA 1N9BA 1PW1A 5CRFA 1KVLA 3HUOA 3NDEA 1PWCA 1XGJA 4P6BA 5G18A 3OC2A 3VFHA 3A3DA 4BL3A 2HDUA 2XK1A 1O7EA 2DNSA 2V1ZA 5FSRA 3IF6B 4Y0UA 1ZG4A 1SHVA 3RJUA 1JWPA 2XD5A 3MZEA 4M3KA 1FCOA 5IHVA 2OLUA 1G68A 1RP5A 3PBNA 5GLAA 4KZ4A 3OPPA 2DRWA 4ID4A 1N4OA 3Q81A 2Q9NA 2IWBA 3VOZA 2WGWB 2EX2A 5EECA 3PAEA 2Y91A 3HBRA 5FQKA 1VQQA 1FSYA 2P74A 1ZKJA 1WYBA 3DW0A 1XPBA 4UA7A 4UA9A 3UN7A 3Q82A 4OPRA 3LO7A 1IKIA 3FWLA 3S22A 1VM1A 2Z2MB 4IBRA 1W8YA 5DTSA 3W4OA 4ZJ1A 1ES4A 2WYXA 1K57C 3ZG0A 3OPRA 1WE4A 3TG9A 2EX9A 3B3XA 1L0EA 3PTEA 2G2WA 3ZHHA 1KE4A 3ZCZA 2IWDA 1ONGA 2Y2NA 4GZBA 3NI9A 4ZTKA 1K6SA 1SKFA 3FKWA 4GOGA 3HLDA 3BFEA 4KZ5A 4KZBA 2R9XA 4X6TA 1ES5A 3BLMA 4C6YA 3JYIA 3TSGA 3VSKA 3NY4A 2I72A 3P09A 4FH4A 3IHBA 3ZVWA 2XQZA 1K55A 5DF8A 4F94A 1K25A 4E3IA 1ERMA 1HZOA 4E3MA 1GHMA 1NXYA 4FSFA 3OZHA 1YLPA 4DXCA 1CEGA 1XP4A 5DTTA 3FYZA 3C7UA 2DCFA 1HTZA 3ZVTA 5EOEA 3G2YA 3QNBA 4RA7A 3HVFA 5GHXA 3AGDA 5F82A 4FCFA 1GCEA 2ZM0A 4OPYA 4QY5A 1XXMA 2C6WB 2H5SA 4K0WA 3M6HA 5DTKA 4UHUA 5EPHA 5FA7A 1LLBA 1E3UD 3S1YA 4FD8A 3IWIA 2ZC6B 4Y7PA 3EQVA 4WEKA 1L0DA 2HDRA 1S6RA 5E2GA 3C4PA 1PWGA 3I7JA 1CK3A 3GSGA 5HX9A 3ZGAB 2E8IA 2G2UA 1BLPA 2P9VB 4PM7A 5CERA 5EVIA 2H0TA 5CXWA 4Y0OA 1Q2PA 4KZ9A 4L0LA 4WMCA 4OPQA 3SS5A 3HLEA 4S2OA 3WS0A 3IXBA 3IXHA 5FI2A 1E25A 1WYCA 5KMWA 1YLZA 1HVBA 2BLSA 2ZLYA 4MNRA 2Y55A 2FFFB 4XUZA 1KE3A 2EFXA 5CGXA 3WS2A 1PW8A 1ZG6A 1FCNA 2Y2IA 5HFOA 4LV1A 4PM9A 1EI5A 4HEFA 3BFFA 1SCWA 3VP0A 4R1GA 4R3BA 3WS4A 4OQ0A 3GQZA 3VOYA 5E43A 1LL9A 2A49A 4OOLA 4S2IA 3UDIA 1OMEA 5GLBA 1NYMA 4EBPA 3GVBA 4Y0TA 1K56A 4JXSA 1ES3A 5A91A 4X53A 4DDSA 1CI8A 2WKHA 3VFFA 4DXBA 3M2KA 1ZC2A 1RGYA 3MKEA 5U47A 3GR2A 5EVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3U A;  3A3F A;  3DTM A;  5EE8 A;  5KSH A;  2H0Y A;  1PI5 A;  2JC7 A;  2Z2L B;  2WGV A;  2ZQ7 A;  1XKZ A;  3UE3 A;  1EWZ A;  4X55 A;  2QPN A;  1FQG A;  2ZC7 A;  3S4X A;  4EBL A;  1PZO A;  4MBK A;  4JF4 A;  3Q7Z A;  4E6X A;  2WK0 A;  3GRJ A;  5FAT A;  1NRF A;  1E4D A;  3SH7 A;  1BSG A;  2XFS A;  1KE0 A;  3DWK A;  4K0X A;  3ITA A;  1C3B A;  3UDF A;  4N92 A;  5HAQ A;  3MXS A;  3O87 A;  4GD6 A;  5FQI A;  4BD1 A;  1CEF A;  3HLF A;  4GD8 A;  1ALQ A;  4S2K A;  4OLD A;  4MBH A;  5JYP A;  1NZO A;  3BLS A;  2EXB A;  4RX2 A;  3IXG A;  5JYO A;  3VP4 A;  2Q9M A;  3A3E A;  1PZP A;  5CHU A;  1W79 A;  2GDN A;  1K38 A;  4E3N A;  1FOF A;  1YLW A;  2OLV A;  4A5R A;  3Q7V A;  3UE1 A;  1MBL A;  3FZC A;  1L0G A;  3DWZ A;  3N8S A;  3V50 A;  1JWV A;  1QMF A;  5M18 A;  4CPK A;  1K55 C;  4E6W A;  3LCE A;  2J9O A;  3BM6 A;  1YMX A;  4KG5 A;  4KQO A;  4DKI A;  5FDH A;  3CG5 A;  3ITB A;  4OP5 A;  3G34 A;  1TVF A;  2ZJ9 A;  2IWC A;  4X69 A;  4BL2 A;  1Z6F A;  2WAE A;  4KZ8 A;  5EUA A;  1NJ4 A;  4GNU A;  4OPZ A;  1MWS A;  1H5X A;  5BOH A;  1XGI A;  3NC8 A;  3NBL A;  1GHP A;  3SH9 A;  2C5W B;  3GTC A;  1NYY A;  1L2S A;  3ISG A;  3IH8 A;  1BTL A;  3BFG A;  5CED A;  5HL1 A;  4NK3 A;  2XDM A;  1TDL A;  5F83 A;  4C3Q A;  1DJC A;  3G32 A;  4JLF A;  5FAP A;  1IYS A;  5FAQ A;  4EV4 A;  3C4O A;  4PPR A;  4X68 A;  4QHC A;  5EVI C;  1KDS A;  5CTN A;  3UO9 A;  3O3V A;  4PM5 A;  1BLH A;  3ZG9 B;  2JBF A;  5EVI B;  5F1G A;  3SOI A;  2CC1 A;  4E3J A;  3IH9 A;  4IVK A;  1YM1 A;  2FFY A;  4EQI A;  1ESU A;  2ZQD A;  4KQR A;  5HAP A;  2XD1 A;  5TR7 A;  3FKV A;  3OCL A;  3Q1F A;  5FQJ A;  3OPH A;  1ERQ A;  4HBU A;  3ZNY A;  2EFU A;  1ONH A;  4MEZ A;  5FI6 A;  1MKI A;  5CTM A;  2ZC3 B;  2JE5 A;  1MXO A;  4XUX A;  1FR6 A;  3HLG A;  3V3S A;  4N1X A;  3N6I A;  4ZAM A;  4IBX A;  1LI0 A;  1RCJ A;  1DY6 A;  2BG1 A;  4BEN A;  2J9P A;  2XEP A;  1ES2 A;  1O07 A;  3MZD A;  4QD4 A;  1KGF A;  4YFM A;  4GKU A;  5D3O A;  5AQ7 A;  3SH8 A;  1MY8 A;  4OH0 A;  2Y2L A;  3UY6 A;  2Y2G A;  1G6A A;  3HLC A;  3V5M A;  2EXA A;  3MKF A;  3W4P A;  4DE3 A;  4WEL A;  2V2F F;  3RXX A;  5E2E A;  4UA6 A;  4U3T A;  5FQM A;  3VP1 A;  3QHY A;  3CJM A;  2Y4A A;  1IYP A;  2X02 A;  1IEL A;  1YQS A;  4P0M A;  5GLC A;  2EX6 A;  2VGJ A;  3PAG A;  3VP2 A;  4GDB A;  3WWX A;  4KZ6 A;  1E3U A;  3E2L A;  3WS1 A;  3UPN A;  3GV9 A;  2ZQA A;  3ZNT A;  3PBS A;  4U0X A;  3C5A A;  4LV2 A;  4O7D A;  2XR0 A;  1PI4 A;  3BEC A;  4OON A;  4DDY A;  2ZD8 A;  4EUZ A;  5HAR A;  1YLT A;  2WUQ A;  4E3O A;  2B5R A;  3PBQ A;  2XFT A;  4QU3 A;  4XXR A;  5GLD A;  1KDW A;  1W5D A;  4WM9 A;  3G31 A;  5AQ9 A;  4B4X A;  2OSU A;  4N9K A;  1YT4 A;  3A3I A;  3SS3 A;  1CI9 A;  4R23 A;  3ZDJ A;  2UWX A;  3CZD A;  3MBZ A;  2H10 A;  5KSC A;  5E2H A;  3HUM A;  3IQA A;  1K54 C;  1MWU A;  2ZMA A;  3MXR A;  3IF5 A;  4BD0 A;  2JCH A;  5F1F A;  3M6B A;  1IEM A;  4FH2 A;  5TFQ A;  3C7V A;  3IT9 A;  4WZ5 C;  3N8R A;  4LCM A;  4RX3 A;  1MWT A;  4C75 A;  3AGF A;  3WRT A;  3Q7V B;  3UPP A;  3OPL A;  4GDN A;  3HL9 A;  3UE0 A;  2QZ6 A;  1H8Y A;  2HP6 A;  3PBR A;  5CEC A;  3D4F A;  3HUN A;  4B4Z A;  5CGW A;  4OVD A;  4MLL A;  1SDE A;  3GMW A;  4JBF A;  1LL5 A;  4KZ7 A;  4R0Q A;  4WYY A;  1NZU A;  4PM8 A;  3LEZ A;  3OCN A;  5HW3 A;  4X56 A;  1QME A;  1K54 A;  2XF3 A;  5A92 A;  2Y2K A;  3NIA A;  2OV5 A;  4R4S A;  4B88 A;  5FQ9 A;  3IF6 C;  3W8K A;  2Y2M A;  4WZ5 A;  5FQQ A;  3G35 A;  4ZBE A;  2ZM8 A;  1LHY A;  1K4E A;  1IYO A;  2PU2 A;  1SDN A;  3A3J A;  3IHA A;  1YLY A;  3FV7 A;  1GA0 A;  1K4F A;  3UNW A;  1PWD A;  4OOM A;  5GHY A;  1YMS A;  4EWF A;  5GHZ A;  3LY4 A;  1DJA A;  4EBN A;  1ERO A;  5A93 A;  3IXD A;  3HLB A;  3CMZ A;  2PBY A;  3IWQ A;  4DE2 A;  1YLJ A;  3ZG5 A;  1KVM A;  5AQB A;  2J7V A;  3LY3 A;  1RGZ A;  5DF7 A;  1I2W A;  4JXW A;  1J9M A;  2ZQC A;  4P85 A;  2RCX A;  3N8L A;  2WKI A;  1BT5 A;  2ZM2 A;  5FAS A;  1XX2 A;  2HDS A;  2WAD A;  3IF6 A;  4KZA A;  1MPL A;  3E2K A;  2WZZ A;  4LV3 A;  3Q07 A;  2XLN A;  2ZC5 B;  3N7W A;  1I5Q A;  2HP5 A;  4UAA A;  4DE1 A;  1GHI A;  1JTG A;  3M2J A;  4LV0 A;  4JXG A;  4OQH A;  4JF5 A;  3EQU A;  4S2J A;  4IVI A;  2WGI A;  2WGW A;  4U0T A;  5DF9 A;  4JPM A;  4DRT A;  2WKE A;  5M1A A;  4KQQ A;  3P98 A;  3BFC A;  1U60 A;  4IED A;  3SS4 A;  1KGE A;  3BEB A;  3BFD A;  5EOO A;  4P87 A;  1BZA A;  3MZF A;  3O88 A;  3NCK A;  4GN2 A;  3HRE A;  2VGK A;  5EVI D;  3V3R A;  3N4I A;  5TGF A;  1PYY A;  4WMC D;  5J8X A;  4BQM A;  5DVA A;  5E2F A;  4BJP A;  3UDX A;  3O86 A;  1K57 A;  4OP8 A;  1K6R A;  2Y59 A;  1XA1 A;  1JWZ A;  5FAO A;  3RXW A;  3IWO A;  4OQG A;  4ZJ3 A;  2Y2J A;  3NDG A;  2Y2P A;  4R3J A;  4D2O A;  2RL3 A;  5L2F A;  2V20 A;  4RVA A;  1AXB A;  1JTD A;  3UPO A;  5A90 A;  1S0W A;  4DF6 A;  4JKT A;  1KGG A;  1Y54 A;  2ZC4 B;  4LCL A;  4ZJ2 A;  3WS5 A;  3VSL A;  4CJN A;  1L0F A;  2HDQ A;  3PBO A;  1PIO A;  1XA7 A;  4KG2 A;  4R4R A;  4WBG A;  2X01 A;  1BUE A;  1FCM A;  2EX8 A;  2WZX A;  3VP3 A;  1M6K A;  4KEN B;  5HAI A;  3BYD A;  1I2S A;  3W4Q A;  1K56 D;  2Y2H A;  4YIN A;  1FR1 A;  3WRZ A;  3BRM A;  4JXV A;  4MBF A;  1IYQ A;  3ZG7 B;  4S2N C;  4HBT A;  5CHJ A;  3HLW A;  1W7F A;  1GA9 A;  1LI9 A;  5I94 A;  1BLS A;  4LEN A;  4QY6 A;  3V39 A;  4QJG A;  4N9L A;  4ZDX A;  4E3K A;  1ESI A;  1JVJ A;  2X71 A;  4RYE A;  4KZ3 A;  3PBT A;  3G30 A;  4HES A;  4QB8 A;  4Z9Q A;  4H8R A;  4WZ4 A;  1TEM A;  2HPB A;  1DJB A;  1W8Q A;  2HP9 A;  2J8Y A;  4JF6 A;  3VMA A;  2QMI A;  4WEJ A;  4NET A;  5M19 A;  2P9V A;  5CEB A;  2WAF A;  3ZFZ A;  2PU4 A;  4S2N A;  4Q8I A;  3AGE A;  1IKG A;  2XH9 A;  4OLG A;  2XGN A;  5CGS A;  1FSW A;  3G2Z A;  4E3L A;  4N1H A;  4PM6 A;  1NY0 A;  4KG6 A;  3QNC A;  3TOI A;  4GB7 A;  1Q2Q A;  4S2M A;  4BLM A;  4K91 A;  2ZQ8 A;  2ZQ9 A;  1HD8 A;  4OOY A;  2R9W A;  4S2L A;  5GL9 A;  1MWR A;  1TDG A;  3MFD A;  1H8Z A;  5KZH A;  4OQI A;  1BLC A;  2Y2O A;  5AQA A;  1M40 A;  5FI7 A;  3ZG8 B;  1BUL A;  3G4P A;  4PMA A;  4S2P A;  5CHM A;  4DE0 A;  2Y2Q A;  4OKP A;  1N9B A;  1PW1 A;  5CRF A;  1KVL A;  3HUO A;  3NDE A;  1PWC A;  1XGJ A;  4P6B A;  5G18 A;  3OC2 A;  3VFH A;  3A3D A;  4BL3 A;  2HDU A;  2XK1 A;  1O7E A;  2DNS A;  2V1Z A;  5FSR A;  3IF6 B;  4Y0U A;  1ZG4 A;  1SHV A;  3RJU A;  1JWP A;  2XD5 A;  3MZE A;  4M3K A;  1FCO A;  5IHV A;  2OLU A;  1G68 A;  1RP5 A;  3PBN A;  5GLA A;  4KZ4 A;  3OPP A;  2DRW A;  4ID4 A;  1N4O A;  3Q81 A;  2Q9N A;  2IWB A;  3VOZ A;  2WGW B;  2EX2 A;  5EEC A;  3PAE A;  2Y91 A;  3HBR A;  5FQK A;  1VQQ A;  1FSY A;  2P74 A;  1ZKJ A;  1WYB A;  3DW0 A;  1XPB A;  4UA7 A;  4UA9 A;  3UN7 A;  3Q82 A;  4OPR A;  3LO7 A;  1IKI A;  3FWL A;  3S22 A;  1VM1 A;  2Z2M B;  4IBR A;  1W8Y A;  5DTS A;  3W4O A;  4ZJ1 A;  1ES4 A;  2WYX A;  1K57 C;  3ZG0 A;  3OPR A;  1WE4 A;  3TG9 A;  2EX9 A;  3B3X A;  1L0E A;  3PTE A;  2G2W A;  3ZHH A;  1KE4 A;  3ZCZ A;  2IWD A;  1ONG A;  2Y2N A;  4GZB A;  3NI9 A;  4ZTK A;  1K6S A;  1SKF A;  3FKW A;  4GOG A;  3HLD A;  3BFE A;  4KZ5 A;  4KZB A;  2R9X A;  4X6T A;  1ES5 A;  3BLM A;  4C6Y A;  3JYI A;  3TSG A;  3VSK A;  3NY4 A;  2I72 A;  3P09 A;  4FH4 A;  3IHB A;  3ZVW A;  2XQZ A;  1K55 A;  5DF8 A;  4F94 A;  1K25 A;  4E3I A;  1ERM A;  1HZO A;  4E3M A;  1GHM A;  1NXY A;  4FSF A;  3OZH A;  1YLP A;  4DXC A;  1CEG A;  1XP4 A;  5DTT A;  3FYZ A;  3C7U A;  2DCF A;  1HTZ A;  3ZVT A;  5EOE A;  3G2Y A;  3QNB A;  4RA7 A;  3HVF A;  5GHX A;  3AGD A;  5F82 A;  4FCF A;  1GCE A;  2ZM0 A;  4OPY A;  4QY5 A;  1XXM A;  2C6W B;  2H5S A;  4K0W A;  3M6H A;  5DTK A;  4UHU A;  5EPH A;  5FA7 A;  1LLB A;  1E3U D;  3S1Y A;  4FD8 A;  3IWI A;  2ZC6 B;  4Y7P A;  3EQV A;  4WEK A;  1L0D A;  2HDR A;  1S6R A;  5E2G A;  3C4P A;  1PWG A;  3I7J A;  1CK3 A;  3GSG A;  5HX9 A;  3ZGA B;  2E8I A;  2G2U A;  1BLP A;  2P9V B;  4PM7 A;  5CER A;  5EVI A;  2H0T A;  5CXW A;  4Y0O A;  1Q2P A;  4KZ9 A;  4L0L A;  4WMC A;  4OPQ A;  3SS5 A;  3HLE A;  4S2O A;  3WS0 A;  3IXB A;  3IXH A;  5FI2 A;  1E25 A;  1WYC A;  5KMW A;  1YLZ A;  1HVB A;  2BLS A;  2ZLY A;  4MNR A;  2Y55 A;  2FFF B;  4XUZ A;  1KE3 A;  2EFX A;  5CGX A;  3WS2 A;  1PW8 A;  1ZG6 A;  1FCN A;  2Y2I A;  5HFO A;  4LV1 A;  4PM9 A;  1EI5 A;  4HEF A;  3BFF A;  1SCW A;  3VP0 A;  4R1G A;  4R3B A;  3WS4 A;  4OQ0 A;  3GQZ A;  3VOY A;  5E43 A;  1LL9 A;  2A49 A;  4OOL A;  4S2I A;  3UDI A;  1OME A;  5GLB A;  1NYM A;  4EBP A;  3GVB A;  4Y0T A;  1K56 A;  4JXS A;  1ES3 A;  5A91 A;  4X53 A;  4DDS A;  1CI8 A;  2WKH A;  3VFF A;  4DXB A;  3M2K A;  1ZC2 A;  1RGY A;  3MKE A;  5U47 A;  3GR2 A;  5EVL A; 
#chains in the Genus database with same CATH topology
 3DTM A;  5EE8 A;  3LR0 A;  4X55 A;  2QPN A;  2ZC7 A;  1UGU A;  3S4X A;  4EBL A;  3Q7Z A;  4E6X A;  2W1T B;  4GLQ A;  1LSV A;  1KE0 A;  5J4E A;  5HL6 A;  2NUP C;  3UDF A;  3MXS A;  4HH3 A;  1CEF A;  3MQ0 A;  4YOF A;  2ACG A;  5HDD A;  5HZH A;  3UB6 A;  3VP4 A;  2Q9M A;  1W79 A;  1K38 A;  1YLW A;  2XRO A;  1L0G A;  3FZC A;  3N8S A;  5M18 A;  4E6W A;  4MN7 A;  1Y4O A;  4KQO A;  4DKI A;  3CG5 A;  3ITB A;  3G34 A;  2ZJ9 A;  2IWC A;  4X69 A;  1G6O A;  3D72 A;  4I3J A;  1Z6F A;  2WAE A;  4BL2 A;  4KZ8 A;  3HJK A;  4X25 A;  4Q0J A;  1XGI A;  3MF0 A;  3CLO A;  1L2S A;  3IH8 A;  1BTL A;  3BFG A;  4HH2 A;  5CED A;  4MN6 A;  2HGV A;  5HWV A;  3FC7 A;  5FAP A;  5FAQ A;  4EV4 A;  4X68 A;  2VKS A;  4HJ3 A;  3O3V A;  1BLH A;  2P08 A;  1T1A A;  2JBF A;  2FFY A;  2Y8H A;  4JGR A;  1ESU A;  1PFL A;  3OCL A;  2EFU A;  3CWF A;  3LEQ A;  1ONH A;  3MR0 A;  3UE6 A;  2ZMF A;  1SKO B;  1MXO A;  4HIA A;  4QPR A;  5AVE A;  4IBX A;  3P7N A;  1LI0 A;  1RCJ A;  2BG1 A;  2OOL A;  2V8C A;  1KGF A;  3BW6 A;  3SH8 A;  3MKF A;  3RXX A;  2V2F F;  3TW8 A;  1IYP A;  2J3W A;  1YQS A;  2EX6 A;  3WWX A;  4GDB A;  1E3U A;  3UPN A;  1IOU A;  3BEC A;  1PI4 A;  4OON A;  4CLC D;  2B5R A;  2XFT A;  4LPZ A;  3CUE A;  5EM1 A;  1W5D A;  4WM9 A;  4Q0I A;  5AQ9 A;  4B4X A;  2OSU A;  3DAV A;  4R23 A;  2OAP 1;  3QP6 A;  3S7O A;  1MWU A;  1IEM A;  2JKF A;  1OT6 A;  4FH2 A;  3VE3 A;  4C75 A;  4LCM A;  5K5B A;  3L9K A;  3OPL A;  4AFI A;  3BJN A;  2V0W A;  4OVD A;  4G3K A;  3T1S A;  4KZ7 A;  4PM8 A;  3LEZ A;  3OCN A;  3NIA A;  5DKK A;  5F69 A;  3IF6 C;  3F1N B;  4WZ5 A;  3EGD C;  5FQQ A;  3G35 A;  3DTE A;  1K4E A;  1MC0 A;  1IYO A;  2PU2 A;  4F94 A;  1PWD A;  1OJG A;  4NXE A;  3JVV A;  3KO6 A;  2W3F A;  2J7V A;  5AQB A;  5DF7 A;  4JXW A;  1S1Z A;  1YSP A;  4P85 A;  2RCX A;  3N8L A;  4PKY A;  2WKI A;  1BT5 A;  4KZA A;  4LV3 A;  2ZC5 B;  2PD7 A;  3N7W A;  4I3A A;  3UB9 A;  4U0T A;  4DRT A;  3BFC A;  4IED A;  3T12 B;  3MZF A;  4GN2 A;  3V3R A;  5EVI D;  5HD3 A;  4I5S A;  5J8X A;  4BQM A;  4BJP A;  4NG2 A;  2Y59 A;  1XA1 A;  2PT7 A;  1OTD A;  4OQG A;  5FL3 A;  5A90 A;  4DF6 A;  3MXQ A;  3OLO A;  1KGG A;  3VSL A;  4BBT A;  2OAQ 1;  4CJN A;  2JN7 A;  4R4R A;  2L4R A;  4WBG A;  2J3T C;  2X01 A;  2B18 A;  1BUE A;  2VGL S;  5IU1 A;  4BWI A;  5HAI A;  4YIN A;  4JXV A;  4MBF A;  1IYQ A;  3ZG7 B;  1ODV A;  2WKR A;  1BLS A;  4QJG A;  3PBT A;  4Z9Q A;  4H8R A;  3VMA A;  5M19 A;  2P9V A;  5CEB A;  5EM0 A;  3ZFZ A;  3KYQ A;  2PU4 A;  4S2N A;  1F5M A;  4CLC C;  3AGE A;  4OLG A;  2XA7 M;  2XGN A;  5DFY A;  1NY0 A;  4JGP A;  4S2M A;  3E0Y A;  2PAV P;  1X0O A;  1HD8 A;  4UQI M;  3LR5 A;  2A24 A;  5KZH A;  1BLC A;  1T19 A;  5FI7 A;  4S2P A;  5IS1 A;  4OKP A;  3PHY A;  4EET B;  3NDE A;  4ETX A;  5AVF A;  4BL3 A;  5FSR A;  1HLU P;  3E4P A;  1FCO A;  1RP5 A;  1S4R A;  3IBJ A;  3OPP A;  2DRW A;  3T50 A;  4ID4 A;  2W1T A;  3VOZ A;  3PAE A;  5FQK A;  4UA7 A;  1MZU A;  4UA9 A;  1XFN A;  2VLG A;  3EWK A;  3LO7 A;  1IKI A;  1J3W A;  2QWS A;  3FWL A;  3W4O A;  5DTS A;  4BMW A;  3ZG0 A;  1WE4 A;  3G6O A;  2EX9 A;  1VEU A;  1ONG A;  3NI9 A;  4ZTK A;  1SKF A;  3FKW A;  4GOG A;  2R9X A;  1ES5 A;  3TSG A;  3VSK A;  2W1R A;  3CIT A;  4I39 A;  4FH4 A;  2XQZ A;  2VV8 A;  4E3I A;  1SZV A;  3HCY A;  4FSF A;  1CEG A;  3C7U A;  3QNB A;  5L09 A;  2K31 A;  1PRQ A;  3NOU C;  1GCE A;  2ZM0 A;  4LRZ E;  4K0W A;  3UME A;  4UHU A;  1E3U D;  3EQV A;  1L0D A;  1Y28 A;  3GSG A;  3ZGA B;  2H0T A;  1Q2P A;  1WYC A;  5KMW A;  1YLZ A;  4DN0 A;  2ZLY A;  2FFF B;  5CGX A;  4P6Z M;  4K08 A;  1ZG6 A;  5KIZ A;  2UV0 E;  4OQ0 A;  5E43 A;  1AWI A;  1OME A;  3C2W A;  3GVB A;  4JXS A;  5A91 A;  5J7E A;  3H7W B;  2V9A A;  3OBF A;  3GR2 A;  3A3F A;  2JC7 A;  2WGV A;  2ZQ7 A;  1XKZ A;  3UE3 A;  2V1B A;  3EEA A;  1PZO A;  4MBK A;  4WLA A;  1OTB A;  3GRJ A;  5FAT A;  3CPT A;  1NRF A;  2XFS A;  4R6L A;  4K0X A;  3LIE A;  3QP8 A;  3O87 A;  1YKD A;  3HLF A;  4XT2 B;  4MBH A;  3BLS A;  2EXB A;  1DP9 A;  4RX2 A;  2ZOH A;  5JYO A;  1PZP A;  3B42 A;  2GDN A;  5HWW A;  4E3N A;  1S4S A;  2OLV A;  2QYB A;  1XFQ A;  3LCE A;  3BM6 A;  1K0K A;  1YMX A;  4KG5 A;  4GS9 B;  2O9A A;  2JKT M;  2M7U A;  1MWS A;  1H5X A;  1GHP A;  3F1N A;  4L9G A;  3SH9 A;  2C5W B;  3T4Q A;  1NYY A;  5CX7 A;  4L9E A;  5HL1 A;  1TDL A;  4C3Q A;  2PBD P;  1IYS A;  4PM5 A;  4LRY C;  3ZG9 B;  3SOI A;  2D01 A;  4KQR A;  2JKR I;  5TR7 A;  3FKV A;  3S7P A;  3Q1F A;  5FQJ A;  5FI6 A;  5CTM A;  2HZ5 A;  1XJ2 A;  2JE5 A;  4XUX A;  3V3S A;  4N1X A;  1NWZ A;  4BEN A;  2XEP A;  5HDS A;  3T4O A;  3CUE C;  5AQ7 A;  4FUW A;  2JHE A;  3V5M A;  4DE3 A;  4WEL A;  4UA6 A;  3VP1 A;  4HP9 A;  3CJM A;  1V9Y A;  2A24 B;  3D3O A;  3MS6 A;  3GV9 A;  1P9R A;  2ZQA A;  3ZNT A;  4EUZ A;  4DDY A;  2ZD8 A;  4E3O A;  3TJZ C;  4QU3 A;  4XXR A;  3G31 A;  1YT4 A;  3A3I A;  1CI9 A;  4F3L B;  2UWX A;  2H10 A;  5F5Y A;  2W0N A;  1A0K A;  5G4Y A;  4BD0 A;  3IF5 A;  1G5U A;  1OT9 A;  2JCH A;  4PHT A;  5TFQ A;  4PAU A;  1TS0 A;  3A0S A;  4WZ5 C;  2PYR A;  3E4Q A;  3N8R A;  4RX3 A;  3AGF A;  3Q7V B;  3HL9 A;  3UE0 A;  2MJ6 A;  3CI6 A;  2HJ9 C;  4B4Z A;  5CGW A;  4EU0 A;  4JBF A;  4WYY A;  3UB5 P;  1VEU B;  4X56 A;  5L10 A;  2XF3 A;  1K54 A;  2Y2K A;  1N9L A;  4L9F A;  4B88 A;  2Y2M A;  4ZBE A;  1SDN A;  1YLY A;  2B95 A;  1GA0 A;  1K4F A;  3T4J A;  5GHY A;  1YMS A;  3LY4 A;  3C30 A;  5J3W A;  5A93 A;  3IXD A;  1KVM A;  3EEH A;  4B93 A;  2ZQC A;  1Z09 A;  3VV4 A;  2ZM2 A;  5C5K A;  2HDS A;  2E8J A;  3E2K A;  1OTI A;  4UAA A;  1GHI A;  4LV0 A;  4JXG A;  4EXO A;  4MN5 A;  3FG8 A;  3EQU A;  2WGI A;  3PR6 A;  3P98 A;  4HY8 A;  3SS4 A;  1P97 A;  1KGE A;  3BFD A;  5EOO A;  3O88 A;  4WUJ A;  3N4I A;  1PYY A;  5E2F A;  2VX8 A;  3O86 A;  1K57 A;  3C8C A;  5FAO A;  3IWO A;  4ZJ3 A;  4CLC E;  4R3J A;  4D2O A;  4RVA A;  3UPO A;  1Y54 A;  4LCL A;  2GNX A;  1PIO A;  1XA7 A;  2WZX A;  4MCW A;  4KEN B;  2HF6 A;  2KLI A;  3WRZ A;  4S2N C;  3HLW A;  1W7F A;  5I94 A;  4QY6 A;  1G28 A;  3V39 A;  4E3K A;  3CPT B;  3G30 A;  1DJB A;  4MMN A;  4JF6 A;  3ULF A;  2QMI A;  4NET A;  3BY8 A;  1IKG A;  3G2Z A;  4N1H A;  3QNC A;  3KYE A;  1Q2Q A;  1DP6 A;  1DP8 A;  2KX6 A;  5GL9 A;  5I5L A;  2R9W A;  3O5Y A;  2YKF A;  5AQA A;  1BUL A;  4DE0 A;  2Y2Q A;  5CRF A;  2VJW A;  3HUO A;  5G18 A;  3OC2 A;  3VFH A;  3H7W A;  2XRN A;  3BWL A;  2XK1 A;  1O7E A;  2V1Z A;  3JVU A;  1SHV A;  1JWP A;  2WKP A;  2OLU A;  1N9N A;  1G68 A;  3VOL A;  1LSX A;  5GLA A;  1N4O A;  2A2L A;  1D06 A;  4FTX A;  2EX2 A;  2M1C A;  3HBR A;  5EVE A;  4ESP A;  1XPB A;  3S22 A;  1LL8 A;  1GSV A;  2WYX A;  4XT2 A;  4LGW A;  3TG9 A;  3PTE A;  1VET A;  2G2W A;  1KE4 A;  3BFE A;  2L1M A;  4KZ5 A;  1CJF A;  4KZB A;  4X6T A;  3BLM A;  4C6Y A;  2W27 A;  3HJI A;  3NY4 A;  2P7J A;  3ZVW A;  4GS9 A;  5F6A A;  1K25 A;  4E3M A;  1GHM A;  1NXY A;  3OZH A;  5DTT A;  2ZMV A;  2D02 A;  5EOE A;  3HVF A;  4BBU A;  5GHX A;  4LFU A;  5F82 A;  5TBM A;  1XXM A;  4PKY G;  2O9B A;  1N9O A;  5DTK A;  3M6H A;  1LLB A;  3U2A A;  3TE8 A;  4RQ9 A;  2BTF P;  2HDR A;  1S6R A;  5E2G A;  3I7J A;  1ZTU A;  1CK3 A;  4YWZ A;  2E8I A;  4PM7 A;  5CXW A;  4Y0O A;  4WMC A;  3IXB A;  4Q0H A;  4ETZ A;  4KQD A;  3F1P B;  3WS2 A;  3DTK A;  1PW8 A;  1FCN A;  5HFO A;  4LV1 A;  1EI5 A;  1T1C A;  4HEF A;  3VP0 A;  3BQ8 A;  1TS8 A;  3GDI A;  1FIL A;  3KSG A;  1GSX A;  1NYM A;  2ZOI A;  4Y0T A;  4X53 A;  2WKH A;  3M2K A;  1W8Y A;  2A3U A;  1PI5 A;  1IFQ A;  2H28 A;  1EWZ A;  2O99 A;  2W3H A;  4Y3I A;  2VGL M;  3CHW P;  4JF4 A;  4DJ2 A;  1S67 L;  2WK0 A;  3SH7 A;  1ACF A;  2VV6 A;  3LYX A;  4N92 A;  5HAQ A;  4BD1 A;  4GD8 A;  4F3L A;  1ALQ A;  4S2K A;  1TF1 A;  2P04 A;  3A3E A;  4ZRR A;  5CHU A;  1OJ5 A;  2G7U A;  3CAX A;  2J80 A;  3Q7V A;  4Y15 A;  3UE1 A;  5HPF A;  1VB6 A;  3DWZ A;  3V50 A;  1JWV A;  4CPK A;  1K55 C;  3MSH A;  1YPR A;  5FDH A;  4IUK A;  1TVF A;  3NHQ A;  4GNU A;  4OPZ A;  1S66 L;  4EER A;  3NBL A;  2EWV A;  4ME4 A;  4NK3 A;  2O9C A;  5F83 A;  1LSW A;  4JLF A;  3LFV A;  4PPR A;  5EVI C;  3QP4 A;  3UO9 A;  2GZA A;  2CC1 A;  4IVK A;  1YM1 A;  2V8F A;  3MJQ A;  3LR4 A;  2XD1 A;  3FPW A;  3OPH A;  1ERQ A;  3ZNY A;  4MEZ A;  3DBA A;  5DJT A;  4ZAM A;  3H9W A;  3H82 B;  2FZ0 A;  1DY6 A;  2ZL1 B;  2J9P A;  1ES2 A;  1O07 A;  2B02 A;  4NKP A;  1XJ3 A;  1MY8 A;  4OH0 A;  2Y2L A;  2Y2G A;  1G6A A;  3W4P A;  5FQM A;  3QHY A;  2Y4A A;  1IEL A;  3A0V A;  4Y17 A;  3VP2 A;  1TD5 A;  3NOT C;  4EEP A;  4JGQ A;  3PBS A;  3T1R A;  3BQA A;  3C5A A;  4LV2 A;  4O01 A;  4O7D A;  1H0M A;  1YLT A;  3IS2 A;  3PBQ A;  5GLD A;  4O8G A;  3ICY A;  4N9K A;  2PD8 A;  3ZDJ A;  1F9I A;  3MBZ A;  3HUM A;  3IQA A;  1K54 C;  2ZMA A;  5DFX A;  4LLO B;  2W3E A;  1GSW A;  3C7V A;  3IT9 A;  1MWT A;  3WRT A;  3UPP A;  3KX0 X;  4GDN A;  3PBR A;  3LI9 A;  3D4F A;  4MLL A;  1SDE A;  1VET B;  1LL5 A;  2QJ5 A;  5HW3 A;  5FQ9 A;  3S7N A;  2ZM8 A;  1BYW A;  4E3L A;  4ARZ A;  3UNW A;  4EWF A;  5GHZ A;  3SZT A;  4EBN A;  1ERO A;  4NXG A;  4H6J A;  2PBY A;  1YLJ A;  3C38 A;  3U4L P;  4I3I A;  2K7S A;  5FAS A;  1XX2 A;  1MPL A;  5TBM B;  2WZZ A;  2PR6 A;  3T4S A;  1OTE A;  4DE1 A;  3DTI A;  1JTG A;  3M2J A;  3T4L A;  4OQH A;  4JF5 A;  4S2J A;  1U60 A;  4M4X A;  3BEB A;  4P87 A;  2VGK A;  2NUT C;  5TGF A;  4WMC D;  5DVA A;  3UDX A;  1NLY A;  4EES A;  3NEC A;  3RXW A;  3TRC A;  2Y2J A;  2RL3 A;  5L2F A;  1D1J A;  1AXB A;  2PDR A;  2QKP A;  2HDQ A;  1UWP X;  4WF0 A;  3VP3 A;  1M6K A;  3BYD A;  1I2S A;  3W4Q A;  1FR1 A;  3BRM A;  4HBT A;  5DKL A;  5CHJ A;  3EOI A;  1LI9 A;  4LEN A;  4QWO A;  2HV1 A;  1KOU A;  4GW9 A;  4Z1W A;  4ZDX A;  1JVJ A;  4RYE A;  2DMW A;  2BAS A;  4HP4 A;  3LGO A;  3T4K A;  1L3L A;  4QB8 A;  1TEM A;  4WEJ A;  2WAF A;  2VK3 A;  2XH9 A;  5CGS A;  4KG6 A;  3F1P A;  3TOI A;  2PYP A;  2V0U A;  2KOI A;  4BLM A;  2Y79 A;  4K91 A;  2ZQ8 A;  2ZQ9 A;  4OOY A;  2PRF A;  3IX3 A;  1MWR A;  4DJ3 A;  2Y2O A;  3LID A;  3ZG8 B;  4PMA A;  4P6B A;  1PWC A;  1XGJ A;  2HDU A;  2VZW A;  3IF6 B;  4D60 A;  4Y0U A;  3MZE A;  2Z6C A;  4G3W A;  4M3K A;  5FEF A;  3PBN A;  3VE4 A;  4KZ4 A;  3R7W B;  3Q81 A;  2Q9N A;  2WGW B;  2PHY A;  2Y91 A;  5IT5 A;  1EW0 A;  3NJA A;  1ZKJ A;  1F2K A;  1WYB A;  3UN7 A;  4OPR A;  4FOF A;  4IBR A;  3IX8 A;  4ZJ1 A;  1UWN X;  2LB5 A;  5L07 A;  1T18 A;  3OPR A;  3QP2 A;  5DJU A;  1L0E A;  4IJG A;  3ZHH A;  1MKM A;  2IWD A;  2Y2N A;  4NXB A;  2INW A;  3A0R A;  3R4K A;  1YSQ A;  2I72 A;  4HJ6 A;  2FH5 A;  4R38 A;  5DF8 A;  3MQQ A;  1ERM A;  1HZO A;  4DXC A;  2DCF A;  4IHQ A;  1HTZ A;  3G2Y A;  4RA7 A;  2VEA A;  4QY5 A;  2C6W B;  5FA7 A;  3IS2 B;  3IWI A;  2JKT I;  2EA9 A;  1PWG A;  5HX9 A;  2G2U A;  4HNB A;  1BLP A;  5CER A;  2J3T D;  3B33 A;  3WS0 A;  3HLE A;  1CQA A;  5FI2 A;  5FEG A;  5EFW A;  1HVB A;  4MNR A;  2Y55 A;  3UB7 A;  4XUZ A;  3L7H A;  2Y2I A;  1WA9 A;  1XJ6 A;  3BFF A;  3H82 A;  3PXP A;  4CLC B;  2ZL1 A;  2A49 A;  3UDI A;  5GLB A;  4EBP A;  1K56 A;  3LIF A;  1ES3 A;  4DDS A;  3VFF A;  2GJ3 A;  1RGY A;  3MKE A;  5U47 A;  5EVL A;  4R70 A;  4KUK A;  4ARZ B;  5KSH A;  2H0Y A;  2I9V A;  2Z2L B;  4X1M A;  1FQG A;  4H6J B;  2AVX A;  3OOV A;  1E4D A;  1BSG A;  2O0Y A;  3DWK A;  4HOI A;  3ITA A;  1C3B A;  4X1L A;  5HD5 A;  5F68 A;  5FQI A;  4GD6 A;  5HWT A;  4OLD A;  5JYP A;  1NZO A;  3IXG A;  1OPX A;  1FOF A;  4A5R A;  4R3A A;  1MBL A;  4LRX C;  1QMF A;  2QJ7 A;  2J9O A;  2IA2 A;  4OP5 A;  3T1Q B;  5EUA A;  1NJ4 A;  5BOH A;  3NC8 A;  4CQH A;  1YAX A;  3GTC A;  4II7 A;  3K3C A;  3ISG A;  3BY9 A;  2XDM A;  3KSF A;  3T4T A;  1DJC A;  3G32 A;  3IX4 A;  4YNR A;  3C4O A;  4BBV A;  4QHC A;  4G3V A;  1KDS A;  5CTN A;  5EVI B;  5F1G A;  4EUV A;  4E3J A;  3IH9 A;  3F1O B;  4EQI A;  2ZQD A;  3B47 A;  5HAP A;  3UMD A;  1P0Z A;  2L0W A;  1JNU A;  4EW7 A;  2XA7 S;  4HBU A;  1PNE A;  1MKI A;  3K3D A;  2ZC3 B;  5FDS A;  2YKH A;  1FR6 A;  3HLG A;  3N6I A;  3LUQ A;  4NEE D;  4UQI S;  3RTY A;  5HSQ A;  3MZD A;  4QD4 A;  4WL9 A;  4GJ4 A;  4YFM A;  1VHM A;  4GKU A;  4GHI B;  5D3O A;  1H8M A;  3UY6 A;  4NXF A;  3HLC A;  2EXA A;  2Q0O A;  5E2E A;  4U3T A;  2X02 A;  4P0M A;  5GLC A;  3UB8 A;  2VGJ A;  3PAG A;  4KZ6 A;  2PR5 A;  3E2L A;  3WS1 A;  4U0X A;  2XR0 A;  3LR3 A;  5HAR A;  2WUQ A;  4E04 A;  3E98 A;  3QP5 A;  1KDW A;  3ZYT A;  1NRJ A;  3SS3 A;  2VV7 A;  4MDZ A;  3CZD A;  5KSC A;  5E2H A;  1LT0 A;  3MXR A;  5F1F A;  3M6B A;  1XJ4 A;  2QZ6 A;  1H8Y A;  2HP6 A;  2R78 A;  2WKQ A;  5CEC A;  3HUN A;  4HQA A;  3GMW A;  4R0Q A;  1NZU A;  4KUO A;  1QME A;  5A92 A;  4B9O A;  2OV5 A;  3P01 A;  4R4S A;  5TJJ A;  3W8K A;  2OWH A;  3RH8 B;  1LHY A;  3A3J A;  3IHA A;  3FV7 A;  4OOM A;  2JKR M;  1DJA A;  3HLB A;  3CMZ A;  3IWQ A;  4DE2 A;  3ZG5 A;  3LY3 A;  1RGZ A;  1I2W A;  1J9M A;  3KSI A;  2WAD A;  3IF6 A;  1V9Z A;  3Q07 A;  2XLN A;  1STZ A;  3GEC A;  1ZHH B;  1I5Q A;  2HP5 A;  5AJG A;  3R7W A;  4Y13 A;  4IVI A;  4UEY A;  2WGW A;  5DF9 A;  4JPM A;  2WKE A;  5M1A A;  4KQQ A;  3K2N A;  4P6Z S;  1W63 Q;  5MC7 A;  1BZA A;  1S1Y A;  3MMH A;  2OWJ A;  3NCK A;  3HRE A;  4OP8 A;  1K6R A;  1JWZ A;  3V67 A;  3NDG A;  2Y2P A;  2V20 A;  5HDC A;  5HPI A;  1JTD A;  1S0W A;  4JKT A;  2ZC4 B;  4ZJ2 A;  3WS5 A;  2QHK A;  4EEU A;  1L0F A;  3PBO A;  4KG2 A;  2EX8 A;  1FCM A;  2XSS A;  4HJ4 A;  4WN5 A;  1K56 D;  2Y2H A;  3D9Y A;  1GA9 A;  4N9L A;  1ESI A;  3E4O A;  2X71 A;  3SW1 A;  4KZ3 A;  3QP1 A;  4HES A;  4Y2F A;  3MQO A;  4WZ4 A;  2HPB A;  2HP9 A;  1W8Q A;  2J8Y A;  1SKO A;  2ZBB A;  1OTA A;  4Y5F A;  4Q8I A;  1FSW A;  2K2N A;  2V1A A;  3LIC A;  4PM6 A;  1DRM A;  4GB7 A;  5A8B A;  2M7V A;  4S2L A;  3MFD A;  1TDG A;  1H8Z A;  4OQI A;  2GX5 A;  2JKG A;  4CLC A;  1M40 A;  3G4P A;  5CHM A;  3MFX A;  1N9B A;  1PW1 A;  1KVL A;  4IUH A;  2CMN A;  3A3D A;  2DNS A;  1ZG4 A;  3RJU A;  2XD5 A;  5IHV A;  3NUL A;  2IWB A;  1W63 M;  5EEC A;  2W3G A;  1VQQ A;  1FSY A;  3IBR A;  2P74 A;  3DW0 A;  3Q82 A;  1F98 A;  1VM1 A;  2Z2M B;  3KSH A;  1ES4 A;  1K57 C;  3B3X A;  3ZCZ A;  1NLZ A;  4GZB A;  3LIB A;  1K6S A;  1TS6 A;  2HJE A;  3LIA A;  3HLD A;  3JYI A;  4GCZ A;  1H3Q A;  3P09 A;  1P9W A;  3IHB A;  1K55 A;  4EQ1 A;  4DMZ A;  2W3D A;  3LI8 A;  3S7Q A;  1T1B A;  3PYP A;  1YLP A;  1XP4 A;  3FYZ A;  4I38 A;  3KYZ A;  2KDK A;  4O0P A;  4HHD A;  3ZVT A;  4JGO A;  1D7E A;  3AGD A;  4FCF A;  4OPY A;  1FIK A;  5LBR A;  3JPU A;  2H5S A;  5EPH A;  3S1Y A;  4FD8 A;  2ZC6 B;  4Y7P A;  4WEK A;  3EGX C;  1CF0 A;  3C4P A;  2P9V B;  4HI4 A;  5EVI A;  3T1X A;  3NOP C;  4KZ9 A;  2LB9 A;  4L0L A;  5L8M A;  4OPQ A;  3SS5 A;  4S2O A;  3IXH A;  3F1O A;  3W2Z A;  1E25 A;  2BLS A;  2EWW A;  3RFB A;  1KE3 A;  2EFX A;  2VA0 A;  4PM9 A;  5EV0 A;  5G4Z A;  1SCW A;  4R1G A;  4R3B A;  1TS7 A;  3WS4 A;  3FPV A;  3GQZ A;  3VOY A;  1LL9 A;  4OOL A;  4S2I A;  2Z6D A;  4GHI A;  4DXB A;  1CI8 A;  3ZQ5 A;  1ZC2 A; 
#chains in the Genus database with same CATH homology
 2A3U A;  3A3F A;  3DTM A;  5EE8 A;  5KSH A;  2H0Y A;  1PI5 A;  2JC7 A;  2Z2L B;  2WGV A;  2ZQ7 A;  1XKZ A;  3UE3 A;  1EWZ A;  4X55 A;  2QPN A;  1FQG A;  2ZC7 A;  3S4X A;  4EBL A;  1PZO A;  4MBK A;  4JF4 A;  3Q7Z A;  4E6X A;  2WK0 A;  3GRJ A;  5FAT A;  1NRF A;  1E4D A;  3SH7 A;  1BSG A;  2XFS A;  1KE0 A;  3DWK A;  4K0X A;  3ITA A;  1C3B A;  3UDF A;  4N92 A;  5HAQ A;  3MXS A;  3O87 A;  4GD6 A;  5FQI A;  4BD1 A;  1CEF A;  3HLF A;  4GD8 A;  1ALQ A;  4S2K A;  4OLD A;  4MBH A;  5JYP A;  1NZO A;  3BLS A;  2EXB A;  4RX2 A;  3IXG A;  5JYO A;  3VP4 A;  2Q9M A;  3A3E A;  1PZP A;  5CHU A;  1W79 A;  2GDN A;  1K38 A;  4E3N A;  1FOF A;  1YLW A;  2OLV A;  4A5R A;  3Q7V A;  3UE1 A;  1MBL A;  3FZC A;  1L0G A;  3DWZ A;  3N8S A;  3V50 A;  1JWV A;  1QMF A;  5M18 A;  4CPK A;  1K55 C;  4E6W A;  3LCE A;  2J9O A;  3BM6 A;  1YMX A;  4KG5 A;  4KQO A;  4DKI A;  5FDH A;  3CG5 A;  3ITB A;  4OP5 A;  3G34 A;  1TVF A;  2ZJ9 A;  2IWC A;  4X69 A;  4BL2 A;  1Z6F A;  2WAE A;  4KZ8 A;  5EUA A;  1NJ4 A;  4GNU A;  4OPZ A;  1MWS A;  1H5X A;  5BOH A;  1XGI A;  3NC8 A;  3NBL A;  1GHP A;  3SH9 A;  2C5W B;  3GTC A;  1NYY A;  1L2S A;  3ISG A;  3IH8 A;  1BTL A;  3BFG A;  5CED A;  5HL1 A;  4NK3 A;  2XDM A;  1TDL A;  5F83 A;  4C3Q A;  1DJC A;  3G32 A;  4JLF A;  5FAP A;  1IYS A;  5FAQ A;  4EV4 A;  3C4O A;  4PPR A;  4X68 A;  4QHC A;  5EVI C;  1KDS A;  5CTN A;  3UO9 A;  3O3V A;  4PM5 A;  1BLH A;  3ZG9 B;  2JBF A;  5EVI B;  5F1G A;  3SOI A;  2CC1 A;  4E3J A;  3IH9 A;  4IVK A;  1YM1 A;  2FFY A;  4EQI A;  1ESU A;  2ZQD A;  4KQR A;  5HAP A;  2XD1 A;  5TR7 A;  3FKV A;  3OCL A;  3Q1F A;  5FQJ A;  3OPH A;  1ERQ A;  4HBU A;  3ZNY A;  2EFU A;  1ONH A;  4MEZ A;  5FI6 A;  1MKI A;  5CTM A;  2ZC3 B;  2JE5 A;  1MXO A;  4XUX A;  1FR6 A;  3HLG A;  3V3S A;  4N1X A;  3N6I A;  4ZAM A;  4IBX A;  1LI0 A;  1RCJ A;  1DY6 A;  2BG1 A;  4BEN A;  2J9P A;  2XEP A;  1ES2 A;  1O07 A;  3MZD A;  4QD4 A;  1KGF A;  4YFM A;  4GKU A;  5D3O A;  5AQ7 A;  3SH8 A;  1MY8 A;  4OH0 A;  2Y2L A;  3UY6 A;  2Y2G A;  1G6A A;  3HLC A;  3V5M A;  2EXA A;  3MKF A;  3W4P A;  4DE3 A;  4WEL A;  2V2F F;  3RXX A;  5E2E A;  4UA6 A;  4U3T A;  5FQM A;  3VP1 A;  3QHY A;  3CJM A;  2Y4A A;  1IYP A;  2X02 A;  1IEL A;  1YQS A;  4P0M A;  5GLC A;  2EX6 A;  2VGJ A;  3PAG A;  3VP2 A;  4GDB A;  3WWX A;  4KZ6 A;  1E3U A;  3E2L A;  3WS1 A;  3UPN A;  3GV9 A;  2ZQA A;  3ZNT A;  3PBS A;  4U0X A;  3C5A A;  4LV2 A;  4O7D A;  2XR0 A;  1PI4 A;  3BEC A;  4OON A;  4DDY A;  2ZD8 A;  4EUZ A;  5HAR A;  1YLT A;  2WUQ A;  4E3O A;  2B5R A;  3PBQ A;  2XFT A;  4QU3 A;  4XXR A;  5GLD A;  1KDW A;  1W5D A;  4WM9 A;  3G31 A;  5AQ9 A;  4B4X A;  2OSU A;  4N9K A;  1YT4 A;  3A3I A;  3SS3 A;  1CI9 A;  4R23 A;  3ZDJ A;  2UWX A;  3CZD A;  3MBZ A;  2H10 A;  5KSC A;  5E2H A;  3HUM A;  3IQA A;  1K54 C;  1MWU A;  2ZMA A;  3MXR A;  3IF5 A;  4BD0 A;  2JCH A;  5F1F A;  3M6B A;  1IEM A;  4FH2 A;  5TFQ A;  3C7V A;  3IT9 A;  4WZ5 C;  3N8R A;  4LCM A;  4RX3 A;  1MWT A;  4C75 A;  3AGF A;  3WRT A;  3Q7V B;  3UPP A;  3OPL A;  4GDN A;  3HL9 A;  3UE0 A;  2QZ6 A;  1H8Y A;  2HP6 A;  3PBR A;  5CEC A;  3D4F A;  3HUN A;  4B4Z A;  5CGW A;  4OVD A;  4MLL A;  1SDE A;  3GMW A;  4JBF A;  1LL5 A;  4KZ7 A;  4R0Q A;  4WYY A;  1NZU A;  4PM8 A;  3LEZ A;  3OCN A;  5HW3 A;  4X56 A;  1QME A;  1K54 A;  2XF3 A;  5A92 A;  2Y2K A;  3NIA A;  2OV5 A;  4R4S A;  4B88 A;  5FQ9 A;  3IF6 C;  3W8K A;  2Y2M A;  4WZ5 A;  5FQQ A;  3G35 A;  4ZBE A;  2ZM8 A;  1LHY A;  1K4E A;  1IYO A;  2PU2 A;  1SDN A;  3A3J A;  3IHA A;  1YLY A;  3FV7 A;  1GA0 A;  1K4F A;  3UNW A;  1PWD A;  4OOM A;  5GHY A;  1YMS A;  4EWF A;  5GHZ A;  3LY4 A;  1DJA A;  4EBN A;  1ERO A;  5A93 A;  3IXD A;  3HLB A;  3CMZ A;  2PBY A;  3IWQ A;  4DE2 A;  1YLJ A;  3ZG5 A;  1KVM A;  5AQB A;  2J7V A;  3LY3 A;  1RGZ A;  5DF7 A;  1I2W A;  4JXW A;  1J9M A;  2ZQC A;  4P85 A;  2RCX A;  3N8L A;  2WKI A;  1BT5 A;  2ZM2 A;  5FAS A;  1XX2 A;  2HDS A;  2WAD A;  3IF6 A;  4KZA A;  1MPL A;  3E2K A;  2WZZ A;  4LV3 A;  3Q07 A;  2XLN A;  2ZC5 B;  3N7W A;  1I5Q A;  2HP5 A;  4UAA A;  4DE1 A;  1GHI A;  1JTG A;  3M2J A;  4LV0 A;  4JXG A;  4OQH A;  4JF5 A;  3EQU A;  4S2J A;  4IVI A;  2WGI A;  2WGW A;  4U0T A;  5DF9 A;  4JPM A;  4DRT A;  2WKE A;  5M1A A;  4KQQ A;  3P98 A;  3BFC A;  1U60 A;  4IED A;  3SS4 A;  1KGE A;  3BEB A;  3BFD A;  5EOO A;  4P87 A;  1BZA A;  3MZF A;  3O88 A;  3NCK A;  4GN2 A;  3HRE A;  2VGK A;  5EVI D;  3V3R A;  3N4I A;  5TGF A;  1PYY A;  4WMC D;  5J8X A;  4BQM A;  5DVA A;  5E2F A;  4BJP A;  3UDX A;  3O86 A;  1K57 A;  4OP8 A;  1K6R A;  2Y59 A;  1XA1 A;  1JWZ A;  5FAO A;  3RXW A;  3IWO A;  4OQG A;  4ZJ3 A;  2Y2J A;  3NDG A;  2Y2P A;  4R3J A;  4D2O A;  2RL3 A;  5L2F A;  2V20 A;  4RVA A;  1AXB A;  1JTD A;  3UPO A;  5A90 A;  1S0W A;  4DF6 A;  4JKT A;  1KGG A;  1Y54 A;  2ZC4 B;  4LCL A;  4ZJ2 A;  3WS5 A;  3VSL A;  4CJN A;  1L0F A;  2HDQ A;  3PBO A;  1PIO A;  1XA7 A;  4KG2 A;  4R4R A;  4WBG A;  2X01 A;  1BUE A;  1FCM A;  2EX8 A;  2WZX A;  3VP3 A;  1M6K A;  4KEN B;  5HAI A;  3BYD A;  1I2S A;  3W4Q A;  1K56 D;  2Y2H A;  4YIN A;  1FR1 A;  3WRZ A;  3BRM A;  4JXV A;  4MBF A;  1IYQ A;  3ZG7 B;  4S2N C;  4HBT A;  5CHJ A;  3HLW A;  1W7F A;  1GA9 A;  1LI9 A;  5I94 A;  1BLS A;  4LEN A;  4QY6 A;  3V39 A;  4QJG A;  4N9L A;  4ZDX A;  4E3K A;  1ESI A;  1JVJ A;  2X71 A;  4RYE A;  4KZ3 A;  3PBT A;  3G30 A;  4HES A;  4QB8 A;  4Z9Q A;  4H8R A;  4WZ4 A;  1TEM A;  2HPB A;  1DJB A;  1W8Q A;  2HP9 A;  2J8Y A;  4JF6 A;  3VMA A;  2QMI A;  4WEJ A;  4NET A;  5M19 A;  2P9V A;  5CEB A;  2WAF A;  3ZFZ A;  2PU4 A;  4S2N A;  4Q8I A;  3AGE A;  1IKG A;  2XH9 A;  4OLG A;  2XGN A;  5CGS A;  1FSW A;  3G2Z A;  4E3L A;  4N1H A;  4PM6 A;  1NY0 A;  4KG6 A;  3QNC A;  3TOI A;  4GB7 A;  1Q2Q A;  4S2M A;  4BLM A;  4K91 A;  2ZQ8 A;  2ZQ9 A;  1HD8 A;  4OOY A;  2R9W A;  4S2L A;  5GL9 A;  1MWR A;  1TDG A;  3MFD A;  1H8Z A;  5KZH A;  4OQI A;  1BLC A;  2Y2O A;  5AQA A;  1M40 A;  5FI7 A;  3ZG8 B;  1BUL A;  3G4P A;  4PMA A;  4S2P A;  5CHM A;  4DE0 A;  2Y2Q A;  4OKP A;  1N9B A;  1PW1 A;  5CRF A;  1KVL A;  3HUO A;  3NDE A;  1PWC A;  1XGJ A;  4P6B A;  5G18 A;  3OC2 A;  3VFH A;  3A3D A;  4BL3 A;  2HDU A;  2XK1 A;  1O7E A;  2DNS A;  2V1Z A;  5FSR A;  3IF6 B;  4Y0U A;  1ZG4 A;  1SHV A;  3RJU A;  1JWP A;  2XD5 A;  3MZE A;  4M3K A;  1FCO A;  5IHV A;  2OLU A;  1G68 A;  1RP5 A;  3PBN A;  5GLA A;  4KZ4 A;  3OPP A;  2DRW A;  4ID4 A;  1N4O A;  3Q81 A;  2Q9N A;  2IWB A;  3VOZ A;  2WGW B;  2EX2 A;  5EEC A;  3PAE A;  2Y91 A;  3HBR A;  5FQK A;  1VQQ A;  1FSY A;  2P74 A;  1ZKJ A;  1WYB A;  3DW0 A;  1XPB A;  4UA7 A;  4UA9 A;  3UN7 A;  3Q82 A;  4OPR A;  3LO7 A;  1IKI A;  3FWL A;  3S22 A;  1VM1 A;  2Z2M B;  4IBR A;  1W8Y A;  5DTS A;  3W4O A;  4ZJ1 A;  1ES4 A;  2WYX A;  1K57 C;  3ZG0 A;  3OPR A;  1WE4 A;  3TG9 A;  2EX9 A;  3B3X A;  1L0E A;  3PTE A;  2G2W A;  3ZHH A;  1KE4 A;  3ZCZ A;  2IWD A;  1ONG A;  2Y2N A;  4GZB A;  3NI9 A;  4ZTK A;  1K6S A;  1SKF A;  3FKW A;  4GOG A;  3HLD A;  3BFE A;  4KZ5 A;  4KZB A;  2R9X A;  4X6T A;  1ES5 A;  3BLM A;  4C6Y A;  3JYI A;  3TSG A;  3VSK A;  3NY4 A;  2I72 A;  3P09 A;  4FH4 A;  3IHB A;  3ZVW A;  2XQZ A;  1K55 A;  5DF8 A;  4F94 A;  1K25 A;  4E3I A;  1ERM A;  1HZO A;  4E3M A;  1GHM A;  1NXY A;  4FSF A;  3OZH A;  1YLP A;  4DXC A;  1CEG A;  1XP4 A;  5DTT A;  3FYZ A;  3C7U A;  2DCF A;  1HTZ A;  3ZVT A;  5EOE A;  3G2Y A;  3QNB A;  4RA7 A;  3HVF A;  5GHX A;  3AGD A;  5F82 A;  4FCF A;  1GCE A;  2ZM0 A;  4OPY A;  4QY5 A;  1XXM A;  2C6W B;  2H5S A;  4K0W A;  3M6H A;  5DTK A;  4UHU A;  5EPH A;  5FA7 A;  1LLB A;  1E3U D;  3S1Y A;  4FD8 A;  3IWI A;  2ZC6 B;  4Y7P A;  3EQV A;  4WEK A;  1L0D A;  2HDR A;  1S6R A;  5E2G A;  3C4P A;  1PWG A;  3I7J A;  1CK3 A;  3GSG A;  5HX9 A;  3ZGA B;  2E8I A;  2G2U A;  1BLP A;  2P9V B;  4PM7 A;  5CER A;  5EVI A;  2H0T A;  5CXW A;  4Y0O A;  1Q2P A;  4KZ9 A;  4L0L A;  4WMC A;  4OPQ A;  3SS5 A;  3HLE A;  4S2O A;  3WS0 A;  3IXB A;  3IXH A;  5FI2 A;  1E25 A;  1WYC A;  5KMW A;  1YLZ A;  1HVB A;  2BLS A;  2ZLY A;  4MNR A;  2Y55 A;  2FFF B;  4XUZ A;  1KE3 A;  2EFX A;  5CGX A;  3WS2 A;  1PW8 A;  1ZG6 A;  1FCN A;  2Y2I A;  5HFO A;  4LV1 A;  4PM9 A;  1EI5 A;  4HEF A;  3BFF A;  1SCW A;  3VP0 A;  4R1G A;  4R3B A;  3WS4 A;  4OQ0 A;  3GQZ A;  3VOY A;  5E43 A;  1LL9 A;  2A49 A;  4OOL A;  4S2I A;  3UDI A;  1OME A;  5GLB A;  1NYM A;  4EBP A;  3GVB A;  4Y0T A;  1K56 A;  4JXS A;  1ES3 A;  5A91 A;  4X53 A;  4DDS A;  1CI8 A;  2WKH A;  3VFF A;  4DXB A;  3M2K A;  1ZC2 A;  1RGY A;  3MKE A;  5U47 A;  3GR2 A;  5EVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...