3PAEA

Crystal structure of the k84d mutant of oxa-24/40 in complex with doripenem
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
244
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFDMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Class D Carbapenemase OXA-24 from Acinetobacter baumannii in Complex with Doripenem.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
total genus 79
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3paeA00
5EVIA 1XP4A 3PAEA 1K57A 1BLCA 5CERA 3FWLA 4B4XA 4KG2A 1L0DA 5U47A 4KZ6A 3HLFA 5HAPA 2Y2JA 3VP1A 1ZG6A 1IKIA 4BD0A 2ZC3B 3DTMA 3ZVTA 4N9KA 5L2FA 4DXBA 1PI5A 4E3OA 1K54C 2RCXA 3PBOA 3NIAA 4LV0A 2IWBA 1PW8A 3M2JA 4WMCA 1E4DA 2HDRA 3WWXA 3I7JA 3OC2A 5FASA 2H5SA 1FSYA 4OPYA 2XFTA 3MZEA 5GLDA 1PI4A 5E2EA 3P98A 1YLZA 1XKZA 4JXSA 4KZ4A 2XFSA 3NCKA 3EQUA 4GOGA 4ZJ3A 3VP0A 3G30A 1BSGA 1LHYA 4QJGA 1DY6A 4QB8A 2QPNA 2Y91A 4LV1A 1BZAA 3E2LA 4R0QA 2HP5A 1RGZA 3ZHHA 1MWSA 3UDIA 2G2WA 5HL1A 4XXRA 1QMFA 2XK1A 1PWGA 4MLLA 4RA7A 3MZFA 5TR7A 1I2SA 3ZG9B 2IWCA 2G2UA 4QD4A 1MKIA 1BLSA 3BFEA 1CI8A 3PBTA 2GDNA 2Y59A 4ZBEA 2ZM8A 1TVFA 3VFHA 4CJNA 2WUQA 1VM1A 3UDXA 4IVKA 4OP8A 4S2NA 1GHMA 1I2WA 1OMEA 4MBHA 2ZQ7A 5M19A 3WRZA 3Q07A 1EROA 3A3FA 3GV9A 5CXWA 2EX6A 1FR6A 1YT4A 3SS5A 4BJPA 1L0FA 5GHXA 5DTTA 2V1ZA 1S0WA 3GVBA 1JWPA 3MZDA 5DF7A 5F1GA 2P74A 3PBSA 3WS1A 3BYDA 1NYYA 1BLPA 2VGJA 4ZJ2A 3WS5A 1YLYA 3N8LA 3WS2A 5CEDA 1KGGA 1PWDA 1Y54A 4HESA 3A3JA 1MY8A 2HP6A 3HLGA 4N1HA 3N4IA 4KQOA 2Z2LB 4X6TA 5CGWA 4FCFA 5IHVA 4KZ8A 1XXMA 3PTEA 5EVIB 5HAIA 4DDSA 4HBUA 4E3KA 1KVLA 3HVFA 4KENB 1FOFA 1N9BA 4P0MA 3OPHA 1ES5A 1FCOA 4WZ5A 5BOHA 3ZDJA 4EBPA 1FCNA 1E25A 5DTKA 5AQAA 2WGWB 2JC7A 1L0EA 1FCMA 1WYBA 4X69A 1Z6FA 3IH9A 1K4EA 4KZ5A 4R4RA 5HX9A 4IVIA 3LO7A 2PU2A 2Y4AA 5GLAA 4R23A 5EVID 1SHVA 5E2GA 4DE3A 1EI5A 5EVIC 3S22A 3VOYA 5CTMA 1HTZA 2XD5A 4EUZA 4B88A 5E2FA 5FSRA 4H8RA 4FH4A 4C6YA 4UA6A 3UE0A 2VGKA 4C75A 1ALQA 2EXBA 3MXRA 3HREA 5CTNA 4Y0TA 4OQIA 3LCEA 2R9WA 1KDSA 3IF6C 3M6BA 3HUNA 3S1YA 5A93A 3QNCA 4HBTA 4OQGA 4OOLA 1YQSA 3VSLA 3C4OA 1C3BA 2RL3A 1BULA 2EFXA 4JXVA 4S2LA 1HVBA 3UPOA 1NZUA 4DE0A 4N1XA 1K54A 5FDHA 2Y2IA 5FI6A 4PM7A 1JWZA 1GA9A 3ZG7B 3OPLA 2XD1A 3C7UA 4ZJ1A 5FATA 2ZC4B 3Q7VA 1KVMA 3IF6A 5HARA 1K56A 3ITBA 4XUXA 4M3KA 2UWXA 4ID4A 1TDGA 1H8ZA 2V20A 3O88A 4EQIA 1S6RA 1EWZA 1XA1A 2PBYA 2ZC6B 1ONGA 3BFDA 4DDYA 5A90A 3HLDA 3BM6A 4E6WA 2J9PA 4JF6A 2WGIA 4MNRA 3BFFA 4OPZA 3ZGAB 1PYYA 2Y2GA 5EECA 4JF5A 1KE4A 1PIOA 1L0GA 4EBLA 4EWFA 4DE1A 4GD6A 4GDNA 1LI9A 5A92A 1J9MA 3OZHA 4UA9A 2DRWA 4E3IA 3O3VA 3V3RA 2WAEA 3G35A 4O7DA 1LLBA 1E3UD 5FAOA 4N9LA 2A49A 3UE1A 5E2HA 1MWRA 3BLMA 1ERMA 1GA0A 3UY6A 4JBFA 2WYXA 1WYCA 3O87A 3BFCA 2XQZA 4E3JA 4NK3A 3UDFA 4HEFA 3ZFZA 4FH2A 4U0XA 1IYPA 4FD8A 2X02A 1H5XA 3MKEA 3N8RA 4S2JA 3HLWA 5FI2A 1XA7A 4KZ3A 1TDLA 5F82A 5CECA 5I94A 3ZVWA 2EX8A 1IELA 5GHZA 1CK3A 4MBFA 2WGVA 5GL9A 2ZM0A 3NDGA 4K0WA 3IXHA 3W4OA 4OKPA 1K38A 1YMSA 2BLSA 4WEJA 3IWIA 4P85A 3EQVA 4OONA 1M40A 2ZQDA 5JYOA 4JXWA 1NRFA 1PZPA 4ZTKA 3GRJA 1GCEA 4L0LA 5G18A 2QMIA 4U0TA 1FQGA 4U3TA 4UA7A 3OCLA 1ESUA 3G34A 1LL5A 1Q2PA 4S2NC 4P87A 3ZNYA 3FV7A 2E8IA 4ZAMA 5EOEA 2WK0A 4PM5A 5CHMA 4YINA 4LV2A 3CZDA 4X56A 4BENA 1ZKJA 1SDEA 3MBZA 1G6AA 2Y2NA 3NBLA 1YLTA 3SS4A 2A3UA 4OVDA 3VFFA 3VP2A 3GMWA 2IWDA 3FKWA 3SH9A 2H0TA 1YLWA 3ISGA 2WAFA 1XPBA 3CMZA 3VP4A 1U60A 4R1GA 4WEKA 4LV3A 1K6SA 4QHCA 4GZBA 3PBRA 4OPQA 2EFUA 3G32A 4KZ9A 2WADA 4MBKA 4LCLA 3HUMA 5DVAA 3QNBA 2X71A 5TFQA 3V50A 2X01A 3FYZA 2Y2PA 5KMWA 1K55C 3D4FA 1KE0A 5FAQA 2H10A 2HDQA 4Y0UA 5EE8A 4C3QA 4KG6A 3IH8A 3ZCZA 1Q2QA 2Y2OA 4QY5A 2WZZA 4X68A 4XUZA 1XGIA 1MWTA 5AQBA 1YMXA 4KG5A 3FZCA 4QU3A 3E2KA 4E6XA 4IEDA 3IXGA 3NDEA 5HAQA 1ES2A 3PBNA 2HDSA 4OOMA 5FA7A 4GKUA 1MBLA 3HL9A 1RGYA 4JKTA 3NY4A 1G68A 5CRFA 2EXAA 3IQAA 4OPRA 1NY0A 3MFDA 2ZMAA 3HLCA 3LY3A 5GHYA 3ZG8B 3MKFA 3AGDA 4OP5A 4X53A 1DJCA 3HBRA 3NI9A 1ESIA 1L2SA 2BG1A 5EVLA 2XF3A 1NZOA 1K57C 2ZLYA 1W8QA 2XEPA 3B3XA 1LI0A 2XGNA 3G4PA 4IBRA 5AQ7A 1K6RA 2OLUA 3AGFA 2Y2MA 5F83A 3G31A 1JWVA 1ZC2A 1XX2A 2JBFA 1RP5A 1DJBA 1CEFA 3BRMA 4K0XA 3SOIA 3JYIA 2PU4A 3Q1FA 5FQQA 3FKVA 1BLHA 2XDMA 5CEBA 2OV5A 4DKIA 1JTDA 4LENA 4UHUA 3ZG0A 3IXDA 3LY4A 3A3IA 4DF6A 4S2MA 1HZOA 4Y0OA 5FAPA 4WELA 5JYPA 4KZ7A 3C4PA 4DXCA 4WMCD 3G2YA 4DRTA 3IHBA 1O7EA 4KQQA 3HLBA 4Y7PA 5HW3A 3HUOA 5GLCA 3P09A 1XGJA 2R9XA 1SKFA 1DJAA 2J7VA 4S2IA 3VMAA 2P9VB 2WKIA 3IHAA 1W79A 2Q9NA 3C5AA 3UPNA 4PM9A 5DF8A 3RXWA 4R4SA 5FQKA 3SH7A 3N6IA 4K91A 4OQ0A 4JLFA 2OLVA 5FQJA 5FQMA 1IYQA 3IWQA 4FSFA 4BLMA 1AXBA 1W7FA 4ZDXA 4E3NA 1M6KA 1PWCA 4R3BA 1KDWA 4D2OA 3BLSA 3N8SA 3ZNTA 5EPHA 3ITAA 3LEZA 3N7WA 4OQHA 1N4OA 3ZG5A 3PBQA 1JVJA 1QMEA 3PAGA 1FSWA 1SCWA 1YLPA 5CHJA 4JXGA 2ZD8A 4RX2A 4QY6A 5J8XA 1K55A 2ZQ9A 2C5WB 3WS4A 2I72A 5CHUA 5AQ9A 1LL9A 1IYSA 2DNSA 5EUAA 5TGFA 3IT9A 3Q7ZA 2CC1A 4PMAA 4R3JA 1TEMA 1PZOA 3DW0A 2XR0A 2Y2LA 3GR2A 1JTGA 1O07A 2WZXA 3GQZA 4B4ZA 5FI7A 3W4PA 1GHIA 4PM6A 1HD8A 1ZG4A 3UNWA 5KZHA 4S2KA 2ZJ9A 1RCJA 3Q82A 4GD8A 1GHPA 2Y2HA 2FFFB 3BFGA 3OPRA 3OPPA 1IEMA 3AGEA 5D3OA 2ZC5B 1K25A 1KE3A 4GN2A 1W8YA 5DTSA 3GTCA 5EOOA 4WBGA 3A3DA 1MWUA 2OSUA 1KGFA 4NETA 3UO9A 2V2FF 3TSGA 3WRTA 1WE4A 2EX9A 2Y55A 3GSGA 3IXBA 1IKGA 3BECA 1NJ4A 2WKHA 1BTLA 2XLNA 5F1FA 4N92A 4Z9QA 3IF6B 2EX2A 4BL3A 3Q7VB 3UE3A 1BUEA 1FR1A 3QHYA 3V3SA 4S2PA 3HLEA 3A3EA 1ERQA 2ZQ8A 3RXXA 4KZBA 4WZ4A 3S4XA 4WM9A 5FQIA 3TG9A 2HDUA 2DCFA 2C6WB 3IWOA 2ZM2A 4GNUA 4LCMA 4PPRA 4P6BA 2J9OA 3W4QA 3G2ZA 4PM8A 1YM1A 5M1AA 4RYEA 3C7VA 3SS3A 4GDBA 4GB7A 1BT5A 4BL2A 1W5DA 3WS0A 5HFOA 2JE5A 2JCHA 5A91A 1CEGA 2Y2QA 4A5RA 3CG5A 3W8KA 4CPKA 5CGXA 1K4FA 3NC8A 4OLGA 1ONHA 1PW1A 3DWZA 3OCNA 3CJMA 4BQMA 3VSKA 1H8YA 2Q9MA 1ES3A 2HPBA 1I5QA 4WZ5C 3UN7A 2HP9A 3VOZA 4BD1A 4Q8IA 5M18A 3DWKA 1NYMA 4KQRA 4OH0A 2Z2MB 2Y2KA 4YFMA 3IF5A 5KSHA 2QZ6A 3V5MA 1K56D 4RX3A 4OLDA 1ES4A 3BEBA 2FFYA 5FQ9A 2ZQAA 4S2OA 4OOYA 4EV4A 4KZAA 3UPPA 1IYOA 2XH9A 4X55A 4DE2A 5CGSA 5GLBA 4F94A 2WKEA 1MXOA 1YLJA 3Q81A 5DF9A 3RJUA 4WYYA 5E43A 3SH8A 3TOIA 1SDNA 4E3MA 4E3LA 4JF4A 5KSCA 2P9VA 3VP3A 4EBNA 2B5RA 3M6HA 3MXSA 4UAAA 2ZC7A 1NXYA 2WGWA 1KGEA 1MPLA 3M2KA 2J8YA 1E3UA 2H0YA 3O86A 4JPMA 4MEZA 4RVAA 3V39A 1VQQA 4IBXA 2ZQCA 1CI9A
chains in the Genus database with same CATH superfamily
3PAEA 3H7WA 3LR3A 5U47A 3NJAA 2ZMVA 2Y2JA 1ZG6A 3BY8A 4BD0A 3ZVTA 4N9KA 1PI5A 2PR5A 2IWBA 4WMCA 4GHIB 1FSYA 2XFTA 2WKQA 1YLZA 1XKZA 2XFSA 3NCKA 4M4XA 3VP0A 1LHYA 3QP6A 3LYXA 2Y91A 5HL1A 2XK1A 2XRNA 4MLLA 1P9WA 4GCZA 1V9ZA 2IWCA 3NOPC 3BFEA 5HSQA 4PAUA 1TVFA 1IOUA 1TS8A 4S2NA 1I2WA 3E98A 4MBHA 5M19A 2J80A 1S4SA 5GHXA 2JKRM 5DTTA 3WS1A 1JWPA 3PBSA 3BYDA 3KSHA 3WS2A 2EWWA 3D9YA 5CEDA 5HPIA 4BWIA 4HESA 3ZQ5A 2B02A 3N4IA 2PT7A 2E8JA 4KZ8A 3PTEA 1N9NA 5EVIB 5HAIA 4DDSA 4HBUA 5KIZA 4WZ5A 1FOFA 3OPHA 4EBPA 1DP8A 1WYBA 5EV0A 3IH9A 5IT5A 4IVIA 1T1CA 1P9RA 3T1XA 3VE3A 5E2FA 3UB7A 2EXBA 4OQIA 2HF6A 5A93A 4OOLA 5FEFA 1C3BA 2RL3A 3KYZA 4JXVA 4S2LA 3MS6A 1NZUA 2VV6A 1FILA 3PHYA 1JWZA 3MQQA 3OPLA 1OT9A 2G7UA 4IHQA 3BWLA 4ID4A 1TDGA 1PFLA 1XJ6A 2QJ7A 1S6RA 3LR5A 1XA1A 3BM6A 4E6WA 3RTYA 4XT2A 2WGIA 4Y5FA 2V8CA 3LIBA 1L0GA 4EBLA 2VV8A 1LI9A 3OZHA 2DRWA 2ZMFA 3IX3A 5L10A 2VJWA 4P6ZM 1MWRA 1IYPA 2X02A 3MKEA 4S2JA 3C30A 4KZ3A 1TDLA 5I94A 4MBFA 5DKLA 4IUHA 2W3DA 3IXHA 4NXEA 4WEJA 2HJ9C 3EQVA 4G3WA 1YSQA 1M40A 4JXWA 4ESPA 3GRJA 2QMIA 4X1MA 2M7VA 5IS1A 2JKRI 3ZNYA 2CMNA 4ZAMA 2LB9A 4YINA 4WL9A 3CZDA 3VP2A 4L9FA 3FKWA 1D7EA 3LR0A 1U60A 1P0ZA 1K6SA 3PBRA 4LCLA 2X71A 2X01A 3FYZA 1K55C 3E4PA 4Y0UA 4ME4A 4C3QA 3ZCZA 2WZZA 1MWTA 4E6XA 4IEDA 3IXGA 3NDEA 3R4KA 5HAQA 4Q0IA 3PBNA 3TRCA 4OOMA 5A8BA 1GSVA 1NLYA 1G68A 4LRYC 2B95A 2ZMAA 5GHYA 3HBRA 1ESIA 1GSWA 1NZOA 1K57C 2ZLYA 1LI0A 2Y2MA 1JWVA 1ZC2A 1CEFA 3QP8A 4I39A 2K2NA 3KYEA 2MJ6A 4UHUA 3UB6A 4Y0OA 5FAPA 2XROA 4DRTA 3ZYTA 4KQQA 1PRQA 4LGWA 5GLCA 2P9VB 2WKIA 1W79A 3C5AA 3UPNA 3H7WB 4X25A 5FQKA 3T1SA 4JLFA 1T1AA 3IX8A 1H8MA 4FSFA 4ZDXA 2W3EA 3N8SA 3ITAA 4OQHA 1N4OA 4ARZA 4BBUA 5CHJA 1K55A 5AVFA 4HJ6A 3WS4A 1LL9A 2EWVA 2INWA 1TEMA 2Y2LA 3GR2A 4B4ZA 4Y3IA 1ZG4A 3K3DA 4GD8A 1GHPA 2PYRA 3BFGA 3OPRA 3S7PA 1MWUA 4EEPA 4R38A 1L3LA 2V2FF 3WRTA 1WE4A 2ZL1A 4GS9B 3S7QA 3BECA 4CLCC 1LSXA 4N92A 3Q7VB 1BUEA 4EEUA 3V3SA 1SKOA 5DFYA 3A3EA 5HWTA 2K31A 1FIKA 2C6WB 3IWOA 4P6BA 3W4QA 4PM8A 3MQOA 3OOVA 3WS0A 4A5RA 4DMZA 3W8KA 5CGXA 1K4FA 3OCNA 1PW1A 3VSKA 1I5QA 4BD1A 2Z2MB 3IF5A 1S1YA 3FG8A 1JNUA 5KSHA 2QZ6A 2KDKA 1LSVA 2P04A 3BEBA 2FFYA 1S67L 3UPPA 3JVUA 2XH9A 3P01A 3NECA 4F94A 1MXOA 3Q81A 5EM1A 3D72A 3KSIA 5E43A 2V1BA 4E3LA 2P9VA 1OJ5A 2L0WA 3VP3A 1NXYA 3M2KA 4MEZA 1E3UA 2H0YA 2ZQCA 1CI9A 2Y8HA 5CERA 1ZHHB 2LB5A 3FWLA 4B4XA 1L0DA 3HLFA 5HAPA 2Q0OA 4HQAA 3T50A 2VEAA 2W3HA 4DXBA 2ZOIA 2GNXA 2RCXA 3PBOA 4LV0A 1PW8A 3M2JA 2HDRA 4I38A 2VLGA 2GJ3A 3FPVA 5I5LA 5E2EA 3O5YA 3EQUA 2PBDP 4ZJ3A 3G30A 5J4EA 4QB8A 1T19A 2QPNA 4R0QA 3LICA 4O0PA 1MWSA 3UDIA 2G2WA 4XXRA 1PWGA 4YWZA 3MZFA 2L1MA 5TR7A 1CI8A 2W3FA 4ZBEA 2ZM8A 1OT6A 1VM1A 4OP8A 5L09A 1OMEA 3WRZA 3Q07A 1N9OA 3A3FA 3SS5A 1L0FA 1YSPA 3DTKA 4II7A 3GVBA 5F1GA 1NYYA 4Y17A 3HJKA 3KSGA 5FL3A 1MY8A 4HY8A 5CGWA 4FCFA 3GECA 2PRFA 3C8CA 2DMWA 3UMEA 1N9BA 2V8FA 4MN6A 1E25A 3LEQA 2JC7A 1L0EA 4X69A 1K4EA 5HX9A 3LO7A 1STZA 5GLAA 4R23A 1A0KA 1EI5A 4K08A 5TJJA 4NKPA 4EUZA 5LBRA 2JHEA 4C75A 1ALQA 4Y0TA 3C38A 2R9WA 1KDSA 4OQGA 3VSLA 3C4OA 4H6JB 3MJQA 2HV1A 2ACGA 3ITBA 4R3AA 4M3KA 2UWXA 2V20A 2YKHA 3O88A 5J3WA 3BFDA 4DDYA 5A90A 3HCYA 2J9PA 4JF6A 4PKYA 4UEYA 1PYYA 2O9BA 4HHDA 4GD6A 4GDNA 4ETXA 1J9MA 4UA9A 3O3VA 5G4ZA 1YAXA 3BQ8A 5FAOA 2A49A 3UE1A 4HP9A 3BLMA 2EA9A 1GA0A 2XA7S 4BMWA 4JBFA 2WYXA 3UDFA 4HEFA 5HL6A 3N8RA 5CECA 4I5SA 5GHZA 2WGVA 5GL9A 2ZM0A 3NDGA 4ARZB 3LIFA 3F1PB 5JYOA 1NRFA 4ZTKA 4EERA 3DBAA 1VETB 4U3TA 3OCLA 1LL5A 4S2NC 1D1JA 4P87A 3FV7A 4EXOA 2E8IA 4PM5A 4LV2A 1SDEA 2YKFA 1G6AA 3LR4A 2Y2NA 4L9EA 3NBLA 3SS4A 4GLQA 3ISGA 3MMHA 4O8GA 2QHKA 4WEKA 4LV3A 4QHCA 4MBKA 3HUMA 3QNBA 5TFQA 1WA9A 2Y2PA 4WUJA 3D4FA 1KE0A 5FAQA 4KG6A 1XFNA 3IH8A 2Y2OA 5AQBA 4QU3A 1W63Q 3T1RA 5F69A 4EU0A 4KQDA 4Y2FA 2HDSA 4HH2A 3HL9A 1MZUA 1SZVA 1RGYA 3NY4A 2PHYA 3HLCA 4Q0HA 4OP5A 2P7JA 5DJUA 3H82A 3U4LP 4IUKA 3B3XA 2XGNA 2W1TB 3EGDC 3KYQA 2JBFA 4ZRRA 1RP5A 1DJBA 5HDDA 3BRMA 4K0XA 3JYIA 1OTIA 2VA0A 4FUWA 1JTDA 2WKRA 3LY4A 4DF6A 2GX5A 1HZOA 4WELA 4GHIA 5JYPA 4UQIS 3T4LA 3IHBA 5FDSA 4Y7PA 5HW3A 1CF0A 3HUOA 3ULFA 2R9XA 2J7VA 4S2IA 1OTDA 3UE6A 3IHAA 3U2AA 4PM9A 3SH7A 3N6IA 4K91A 4MN7A 3IWQA 1M6KA 4MMNA 1PWCA 1KDWA 2HGVA 3BLSA 3MF0A 4I3JA 1Y4OA 3LEZA 5F68A 3PBQA 1Y28A 2ZD8A 2PD8A 2C5WB 3K3CA 5AQ9A 2DNSA 1IYSA 5TGFA 2Y79A 3Q7ZA 1PZOA 3DW0A 3MSHA 2W27A 3W4PA 1GHIA 5KZHA 2ZJ9A 1RCJA 1S66L 3Q82A 2FFFB 4HH3A 5D3OA 3AGEA 2ZC5B 5DTSA 1GSXA 5EOOA 4WBGA 3F1NA 3LUQA 3TSGA 2EX9A 3V67A 3LGOA 2Y55A 3IXBA 1IKGA 1NJ4A 2WKHA 1T18A 2XLNA 3IF6B 1VB6A 1FR1A 4GW9A 4S2PA 3UB9A 3RXXA 4KZBA 3T4SA 5HPFA 2HDUA 3FC7A 2ZM2A 4PPRA 2R78A 4WF0A 3G2ZA 3SS3A 3EGXC 5HFOA 2Y2QA 4HJ3A 3DTEA 2V9AA 4OLGA 4HI4A 1ONHA 3UN7A 2HP9A 3DWKA 4OH0A 1LL8A 2J3TD 4RX3A 4OLDA 1ES4A 1H0MA 4S2OA 3CLOA 4DE2A 4MCWA 5GLBA 2WKEA 2QWSA 3RJUA 4WYYA 1CJFA 5KSCA 4E3IA 1VQQA 5TBMB 4R6LA 4HNBA 1VEUA 2BASA 1XJ2A 5EVIA 1XP4A 2KLIA 3KO6A 2H28A 3T4KA 4KG2A 4KZ6A 3VV4A 1IKIA 3CAXA 3B47A 4E3OA 1X0OA 3S7NA 1E4DA 5L8MA 3SZTA 3E4OA 3OC2A 3MFXA 1EW0A 4OPYA 5GLDA 1PI4A 4WLAA 3T12B 4JXSA 4GOGA 4G3VA 4QJGA 1DY6A 1BZAA 3R7WB 3E2LA 3ZHHA 4NXGA 1ODVA 4AFIA 1I2SA 3R7WA 4NXBA 3ZG9B 3CI6A 2G2UA 4QD4A 1MKIA 3PBTA 2GDNA 2Y59A 3VFHA 3EEAA 3UDXA 4R70A 1GHMA 1XJ4A 1EROA 3GV9A 5CXWA 2Z6DA 1G6OA 1FR6A 1YT4A 3T4QA 3MZDA 5DF7A 2WKPA 2VGJA 4ZJ2A 3WS5A 3P7NA 5DFXA 1Y54A 2PAVP 3K2NA 3A3JA 4JGQA 2HP6A 3HLGA 5IHVA 1XXMA 3G6OA 3HVFA 4KENB 4P0MA 5TBMA 1F5MA 5DTKA 2WGWB 2PYPA 1FCMA 1TS7A 3OBFA 1Z6FA 5HDSA 4KZ5A 4R4RA 2Y4AA 2JKTI 5EVID 1SHVA 3S22A 2XD5A 3NOUC 4B88A 4C6YA 4UA6A 3KX0X 3LI8A 3JVVA 5CTNA 3SW1A 3M6BA 1OTEA 2FZ0A 3DTIA 1OTBA 2A24A 1J3WA 1BULA 2EFXA 4D60A 3IS2B 1HVBA 2J3TC 3QP4A 4N1XA 1K54A 4KUOA 2Y2IA 2V0UA 4PM7A 5F6AA 2XD1A 5FATA 3Q7VA 3IF6A 1K56A 1H8ZA 2ZC6B 1ACFA 2PD7A 1NRJA 4MNRA 4PKYG 4EUVA 3BFFA 4OPZA 3ZGAB 4HP4A 1UWPX 4JF5A 1KE4A 4DE1A 5A92A 3TJZC 2I9VA 1TS6A 3G35A 4N9LA 4MDZA 5HWVA 2ZL1B 3UY6A 2QJ5A 1WYCA 3BFCA 4E3JA 4NG2A 1H5XA 3HLWA 1XA7A 1YKDA 1CK3A 4K0WA 3W4OA 1K38A 1Z09A 2BLSA 2QKPA 3IWIA 1TD5A 2ZQDA 1GCEA 4L0LA 5G18A 4U0TA 4UA7A 4F3LB 1ESUA 3G34A 1Q2PA 3NHQA 5EOEA 1ZKJA 1YLTA 2H0TA 3CMZA 3VP4A 1G28A 2V0WA 4OPQA 5MC7A 2EFUA 3G32A 2JKFA 5DVAA 3V50A 5KMWA 2OOLA 3JPUA 2VK3A 3A0VA 4FOFA 1Q2QA 4QY5A 4B93A 1XGIA 3FZCA 3H82B 4P6ZS 5L07A 3E2KA 5AVEA 4CLCE 4GKUA 4JKTA 1G5UA 5CRFA 2EXAA 5HDCA 3MFDA 3VE4A 4Y13A 3ZG8B 3MKFA 4X53A 1DJCA 1L2SA 5EVLA 2XF3A 1W8QA 3KSFA 4IBRA 3F1OB 1XX2A 2PU4A 5FQQA 1BLHA 2OV5A 2V1AA 4CLCD 4S2MA 4WN5A 4DXCA 2AVXA 3G2YA 1O7EA 3PXPA 1XGJA 3RH8B 1SKFA 1DJAA 2P08A 3VMAA 1UGUA 5DF8A 1T1BA 1TS0A 3LIAA 5FQJA 3CITA 1IYQA 1BYWA 4X1LA 4BLMA 3UB5P 1W7FA 1VEUB 4E3NA 3H9WA 4R3BA 1H3QA 3T1QB 3F1PA 3ZG5A 1JVJA 1QMEA 1YLPA 5J8XA 2ZQ9A 2UV0E 2CC1A 2W1RA 1CQAA 1JTGA 3GQZA 1HD8A 2VV7A 2Y2HA 1IEMA 1K25A 4GN2A 4YNRA 4I3IA 2OSUA 2HZ5A 3EWKA 4NETA 3UO9A 4YOFA 5J7EA 2Z6CA 4HOIA 1OTAA 3TW8A 4GS9A 4BL3A 1ERQA 4JGOA 4H6JA 4WZ4A 3S4XA 3CUEC 3L9KA 4WM9A 4GNUA 3NULA 4UQIM 4B9OA 2J9OA 4EESA 1W63M 1YM1A 5M1AA 4NXFA 3MQ0A 2GZAA 1CEGA 1K0KA 4LPZA 3HJIA 3DWZA 4BQMA 2JKGA 3IS2A 1H8YA 2Q9MA 4Q8IA 5HD3A 4I3AA 1NYMA 4DJ3A 4KQRA 2O9AA 4YFMA 3V5MA 1K56D 5FQ9A 2ZQAA 4EV4A 3FPWA 3BW6A 4KZAA 1DP6A 5EM0A 3T4JA 5DF9A 3SH8A 4EBNA 2B5RA 3M6HA 3MXSA 2WGWA 1KOUA 4Q0JA 2J8YA 3O86A 1IFQA 4JGPA 5AJGA 1K57A 1BLCA 4GJ4A 3A0RA 3VP1A 2O0YA 4O01A 2ZC3B 3DTMA 5L2FA 1K54C 4EW7A 3NIAA 1YPRA 3WWXA 3I7JA 5FASA 1OPXA 2H5SA 3IX4A 3MZEA 4IJGA 3LI9A 3P98A 4KZ4A 3D3OA 3B42A 4HIAA 1BSGA 4LV1A 2HP5A 1RGZA 2OWHA 1QMFA 4RA7A 1BLSA 1MC0A 3E0YA 3MR0A 4CJNA 2WUQA 4QPRA 4IVKA 2VKSA 3EOIA 2ZQ7A 2VX8A 2J3WA 2EX6A 1LT0A 4BJPA 2V1ZA 1S0WA 1D06A 2P74A 2BTFP 2JKTM 3PR6A 1BLPA 3B33A 1YLYA 3N8LA 1KGGA 1PWDA 4N1HA 4KQOA 2Z2LB 4X6TA 4Z1WA 4E3KA 1KVLA 5BOHA 4Y15A 1ES5A 1FCOA 3ZDJA 1FCNA 3T4TA 5AQAA 2FH5A 2PU2A 4EQ1A 5E2GA 1UWNX 4DE3A 5EVIC 3VOYA 5CTMA 5IU1A 1HTZA 5FSRA 2NUPC 4H8RA 4FH4A 3UE0A 2VGKA 4CLCA 3MXRA 2IA2A 2O99A 3CPTB 3HREA 3LCEA 3IF6C 3S1YA 3HUNA 3QNCA 1MKMA 4HBTA 1YQSA 2O9CA 3UPOA 4DE0A 5FDHA 5FI6A 1GA9A 3ZG7B 3GDIA 1SKOB 3C7UA 4ZJ1A 2ZC4B 1KVMA 5HARA 4XUXA 1VHMA 1XJ3A 2M7UA 4EQIA 2PBYA 1EWZA 1ONGA 3OLOA 3HLDA 2Y2GA 5EECA 5EVEA 5F5YA 1PIOA 4EWFA 4XT2B 3QP2A 3V3RA 2WAEA 3ICYA 3CHWP 4O7DA 1LLBA 1E3UD 5E2HA 1F98A 1ERMA 3C2WA 3CPTA 4RQ9A 4DJ2A 4CLCB 3O87A 4JGRA 2A2LA 3BY9A 2XQZA 4NK3A 2OAQ1 3ZFZA 4FH2A 4U0XA 4FD8A 5FI2A 5F82A 3ZVWA 3LFVA 2EX8A 4PHTA 1IELA 1P97A 4OKPA 1YMSA 4HJ4A 3VOLA 3E4QA 2VGLM 4P85A 4OONA 1PZPA 1FQGA 1DP9A 3L7HA 2WK0A 5CHMA 2ZOHA 2QYBA 4X56A 4BENA 3MBZA 2A3UA 4OVDA 2PR6A 3BQAA 3GMWA 2IWDA 3VFFA 3SH9A 1YLWA 2WAFA 1XPBA 4R1GA 2JN7A 3UB8A 4GZBA 4KZ9A 2WADA 5C5KA 2H10A 2HDQA 5EE8A 2D01A 4XUZA 4X68A 1YMXA 4KG5A 4NEED 5G4YA 2XA7M 1ES2A 4LFUA 5FA7A 1OJGA 3PYPA 1MBLA 3TE8A 3IQAA 4OPRA 1NY0A 3LY3A 3AGDA 2W1TA 3F1OA 3NI9A 4KUKA 2BG1A 2VZWA 2XEPA 5AQ7A 3G4PA 2OWJA 1K6RA 2OLUA 3AGFA 5F83A 2PDRA 3G31A 1XFQA 2B18A 3QP1A 3SOIA 3Q1FA 2K7SA 3FKVA 2XDMA 5CEBA 2L4RA 3A0SA 3BJNA 4LENA 3ZG0A 4DKIA 3IXDA 3A3IA 3LIDA 4KZ7A 3LIEA 2KX6A 3C4PA 4WMCD 3HLBA 3P09A 5DJTA 5CX7A 2Q9NA 3CWFA 3S7OA 3RXWA 1NLZA 4R4SA 4LRZE 4OQ0A 4F3LA 2OLVA 5FQMA 3DAVA 1AXBA 5HZHA 3EEHA 4BBVA 4D2OA 3ZNTA 5EPHA 3N7WA 2VGLS 1N9LA 3PAGA 1FSWA 1SCWA 4JXGA 4RX2A 4QY6A 5HD5A 2I72A 5CHUA 5EUAA 1PNEA 5EFWA 1VETA 3IT9A 4PMAA 3CUEA 4R3JA 2M1CA 2XR0A 3UMDA 1O07A 2WZXA 5FI7A 3T4OA 4PM6A 1NWZA 5FEGA 4FTXA 3W2ZA 3UNWA 2W0NA 4S2KA 4L9GA 3OPPA 1KE3A 1W8YA 3GTCA 3A3DA 3IBRA 1KGFA 1F9IA 4EETB 1AWIA 4LLOB 3GSGA 1BTLA 5F1FA 4Z9QA 2KOIA 2EX2A 3UE3A 2HJEA 3QHYA 4LRXC 2XSSA 3QP5A 3HLEA 1V9YA 3F1NB 4BBTA 2ZQ8A 5HWWA 3NOTC 5FQIA 3TG9A 2OAP1 2DCFA 4CQHA 4LCMA 1HLUP 4RYEA 3C7VA 4QWOA 4GDBA 4GB7A 1BT5A 4DN0A 4BL2A 1W5DA 2JE5A 2JCHA 5A91A 1S4RA 1DRMA 3CG5A 4CPKA 1LSWA 3NC8A 3CJMA 3VOZA 1ES3A 2HPBA 4WZ5C 5M18A 2A24B 4ETZA 2ZBBA 2Y2KA 2D02A 2W3GA 1F2KA 5K5BA 4OOYA 1IYOA 1S1ZA 4MN5A 4X55A 5CGSA 2NUTC 3MXQA 3IBJA 4E04A 1YLJA 5DKKA 3TOIA 1SDNA 4E3MA 4JF4A 3RFBA 4UAAA 2ZC7A 1KGEA 1MPLA 1TF1A 4JPMA 4RVAA 1ZTUA 3V39A 4G3KA 4IBXA
chains in the Genus database with same CATH topology
5EVIA 1XP4A 3PAEA 1K57A 1BLCA 5CERA 3FWLA 4B4XA 4KG2A 1L0DA 5U47A 4KZ6A 3HLFA 5HAPA 2Y2JA 3VP1A 1ZG6A 1IKIA 4BD0A 2ZC3B 3DTMA 3ZVTA 4N9KA 5L2FA 4DXBA 1PI5A 4E3OA 1K54C 2RCXA 3PBOA 3NIAA 4LV0A 2IWBA 1PW8A 3M2JA 4WMCA 1E4DA 2HDRA 3WWXA 3I7JA 3OC2A 5FASA 2H5SA 1FSYA 4OPYA 2XFTA 3MZEA 5GLDA 1PI4A 5E2EA 3P98A 1YLZA 1XKZA 4JXSA 4KZ4A 2XFSA 3NCKA 3EQUA 4GOGA 4ZJ3A 3VP0A 3G30A 1BSGA 1LHYA 4QJGA 1DY6A 4QB8A 2QPNA 2Y91A 4LV1A 1BZAA 3E2LA 4R0QA 2HP5A 1RGZA 3ZHHA 1MWSA 3UDIA 2G2WA 5HL1A 4XXRA 1QMFA 2XK1A 1PWGA 4MLLA 4RA7A 3MZFA 5TR7A 1I2SA 3ZG9B 2IWCA 2G2UA 4QD4A 1MKIA 1BLSA 3BFEA 1CI8A 3PBTA 2GDNA 2Y59A 4ZBEA 2ZM8A 1TVFA 3VFHA 4CJNA 2WUQA 1VM1A 3UDXA 4IVKA 4OP8A 4S2NA 1GHMA 1I2WA 1OMEA 4MBHA 2ZQ7A 5M19A 3WRZA 3Q07A 1EROA 3A3FA 3GV9A 5CXWA 2EX6A 1FR6A 1YT4A 3SS5A 4BJPA 1L0FA 5GHXA 5DTTA 2V1ZA 1S0WA 3GVBA 1JWPA 3MZDA 5DF7A 5F1GA 2P74A 3PBSA 3WS1A 3BYDA 1NYYA 1BLPA 2VGJA 4ZJ2A 3WS5A 1YLYA 3N8LA 3WS2A 5CEDA 1KGGA 1PWDA 1Y54A 4HESA 3A3JA 1MY8A 2HP6A 3HLGA 4N1HA 3N4IA 4KQOA 2Z2LB 4X6TA 5CGWA 4FCFA 5IHVA 4KZ8A 1XXMA 3PTEA 5EVIB 5HAIA 4DDSA 4HBUA 4E3KA 1KVLA 3HVFA 4KENB 1FOFA 1N9BA 4P0MA 3OPHA 1ES5A 1FCOA 4WZ5A 5BOHA 3ZDJA 4EBPA 1FCNA 1E25A 5DTKA 5AQAA 2WGWB 2JC7A 1L0EA 1FCMA 1WYBA 4X69A 1Z6FA 3IH9A 1K4EA 4KZ5A 4R4RA 5HX9A 4IVIA 3LO7A 2PU2A 2Y4AA 5GLAA 4R23A 5EVID 1SHVA 5E2GA 4DE3A 1EI5A 5EVIC 3S22A 3VOYA 5CTMA 1HTZA 2XD5A 4EUZA 4B88A 5E2FA 5FSRA 4H8RA 4FH4A 4C6YA 4UA6A 3UE0A 2VGKA 4C75A 1ALQA 2EXBA 3MXRA 3HREA 5CTNA 4Y0TA 4OQIA 3LCEA 2R9WA 1KDSA 3IF6C 3M6BA 3HUNA 3S1YA 5A93A 3QNCA 4HBTA 4OQGA 4OOLA 1YQSA 3VSLA 3C4OA 1C3BA 2RL3A 1BULA 2EFXA 4JXVA 4S2LA 1HVBA 3UPOA 1NZUA 4DE0A 4N1XA 1K54A 5FDHA 2Y2IA 5FI6A 4PM7A 1JWZA 1GA9A 3ZG7B 3OPLA 2XD1A 3C7UA 4ZJ1A 5FATA 2ZC4B 3Q7VA 1KVMA 3IF6A 5HARA 1K56A 3ITBA 4XUXA 4M3KA 2UWXA 4ID4A 1TDGA 1H8ZA 2V20A 3O88A 4EQIA 1S6RA 1EWZA 1XA1A 2PBYA 2ZC6B 1ONGA 3BFDA 4DDYA 5A90A 3HLDA 3BM6A 4E6WA 2J9PA 4JF6A 2WGIA 4MNRA 3BFFA 4OPZA 3ZGAB 1PYYA 2Y2GA 5EECA 4JF5A 1KE4A 1PIOA 1L0GA 4EBLA 4EWFA 4DE1A 4GD6A 4GDNA 1LI9A 5A92A 1J9MA 3OZHA 4UA9A 2DRWA 4E3IA 3O3VA 3V3RA 2WAEA 3G35A 4O7DA 1LLBA 1E3UD 5FAOA 4N9LA 2A49A 3UE1A 5E2HA 1MWRA 3BLMA 1ERMA 1GA0A 3UY6A 4JBFA 2WYXA 1WYCA 3O87A 3BFCA 2XQZA 4E3JA 4NK3A 3UDFA 4HEFA 3ZFZA 4FH2A 4U0XA 1IYPA 4FD8A 2X02A 1H5XA 3MKEA 3N8RA 4S2JA 3HLWA 5FI2A 1XA7A 4KZ3A 1TDLA 5F82A 5CECA 5I94A 3ZVWA 2EX8A 1IELA 5GHZA 1CK3A 4MBFA 2WGVA 5GL9A 2ZM0A 3NDGA 4K0WA 3IXHA 3W4OA 4OKPA 1K38A 1YMSA 2BLSA 4WEJA 3IWIA 4P85A 3EQVA 4OONA 1M40A 2ZQDA 5JYOA 4JXWA 1NRFA 1PZPA 4ZTKA 3GRJA 1GCEA 4L0LA 5G18A 2QMIA 4U0TA 1FQGA 4U3TA 4UA7A 3OCLA 1ESUA 3G34A 1LL5A 1Q2PA 4S2NC 4P87A 3ZNYA 3FV7A 2E8IA 4ZAMA 5EOEA 2WK0A 4PM5A 5CHMA 4YINA 4LV2A 3CZDA 4X56A 4BENA 1ZKJA 1SDEA 3MBZA 1G6AA 2Y2NA 3NBLA 1YLTA 3SS4A 2A3UA 4OVDA 3VFFA 3VP2A 3GMWA 2IWDA 3FKWA 3SH9A 2H0TA 1YLWA 3ISGA 2WAFA 1XPBA 3CMZA 3VP4A 1U60A 4R1GA 4WEKA 4LV3A 1K6SA 4QHCA 4GZBA 3PBRA 4OPQA 2EFUA 3G32A 4KZ9A 2WADA 4MBKA 4LCLA 3HUMA 5DVAA 3QNBA 2X71A 5TFQA 3V50A 2X01A 3FYZA 2Y2PA 5KMWA 1K55C 3D4FA 1KE0A 5FAQA 2H10A 2HDQA 4Y0UA 5EE8A 4C3QA 4KG6A 3IH8A 3ZCZA 1Q2QA 2Y2OA 4QY5A 2WZZA 4X68A 4XUZA 1XGIA 1MWTA 5AQBA 1YMXA 4KG5A 3FZCA 4QU3A 3E2KA 4E6XA 4IEDA 3IXGA 3NDEA 5HAQA 1ES2A 3PBNA 2HDSA 4OOMA 5FA7A 4GKUA 1MBLA 3HL9A 1RGYA 4JKTA 3NY4A 1G68A 5CRFA 2EXAA 3IQAA 4OPRA 1NY0A 3MFDA 2ZMAA 3HLCA 3LY3A 5GHYA 3ZG8B 3MKFA 3AGDA 4OP5A 4X53A 1DJCA 3HBRA 3NI9A 1ESIA 1L2SA 2BG1A 5EVLA 2XF3A 1NZOA 1K57C 2ZLYA 1W8QA 2XEPA 3B3XA 1LI0A 2XGNA 3G4PA 4IBRA 5AQ7A 1K6RA 2OLUA 3AGFA 2Y2MA 5F83A 3G31A 1JWVA 1ZC2A 1XX2A 2JBFA 1RP5A 1DJBA 1CEFA 3BRMA 4K0XA 3SOIA 3JYIA 2PU4A 3Q1FA 5FQQA 3FKVA 1BLHA 2XDMA 5CEBA 2OV5A 4DKIA 1JTDA 4LENA 4UHUA 3ZG0A 3IXDA 3LY4A 3A3IA 4DF6A 4S2MA 1HZOA 4Y0OA 5FAPA 4WELA 5JYPA 4KZ7A 3C4PA 4DXCA 4WMCD 3G2YA 4DRTA 3IHBA 1O7EA 4KQQA 3HLBA 4Y7PA 5HW3A 3HUOA 5GLCA 3P09A 1XGJA 2R9XA 1SKFA 1DJAA 2J7VA 4S2IA 3VMAA 2P9VB 2WKIA 3IHAA 1W79A 2Q9NA 3C5AA 3UPNA 4PM9A 5DF8A 3RXWA 4R4SA 5FQKA 3SH7A 3N6IA 4K91A 4OQ0A 4JLFA 2OLVA 5FQJA 5FQMA 1IYQA 3IWQA 4FSFA 4BLMA 1AXBA 1W7FA 4ZDXA 4E3NA 1M6KA 1PWCA 4R3BA 1KDWA 4D2OA 3BLSA 3N8SA 3ZNTA 5EPHA 3ITAA 3LEZA 3N7WA 4OQHA 1N4OA 3ZG5A 3PBQA 1JVJA 1QMEA 3PAGA 1FSWA 1SCWA 1YLPA 5CHJA 4JXGA 2ZD8A 4RX2A 4QY6A 5J8XA 1K55A 2ZQ9A 2C5WB 3WS4A 2I72A 5CHUA 5AQ9A 1LL9A 1IYSA 2DNSA 5EUAA 5TGFA 3IT9A 3Q7ZA 2CC1A 4PMAA 4R3JA 1TEMA 1PZOA 3DW0A 2XR0A 2Y2LA 3GR2A 1JTGA 1O07A 2WZXA 3GQZA 4B4ZA 5FI7A 3W4PA 1GHIA 4PM6A 1HD8A 1ZG4A 3UNWA 5KZHA 4S2KA 2ZJ9A 1RCJA 3Q82A 4GD8A 1GHPA 2Y2HA 2FFFB 3BFGA 3OPRA 3OPPA 1IEMA 3AGEA 5D3OA 2ZC5B 1K25A 1KE3A 4GN2A 1W8YA 5DTSA 3GTCA 5EOOA 4WBGA 3A3DA 1MWUA 2OSUA 1KGFA 4NETA 3UO9A 2V2FF 3TSGA 3WRTA 1WE4A 2EX9A 2Y55A 3GSGA 3IXBA 1IKGA 3BECA 1NJ4A 2WKHA 1BTLA 2XLNA 5F1FA 4N92A 4Z9QA 3IF6B 2EX2A 4BL3A 3Q7VB 3UE3A 1BUEA 1FR1A 3QHYA 3V3SA 4S2PA 3HLEA 3A3EA 1ERQA 2ZQ8A 3RXXA 4KZBA 4WZ4A 3S4XA 4WM9A 5FQIA 3TG9A 2HDUA 2DCFA 2C6WB 3IWOA 2ZM2A 4GNUA 4LCMA 4PPRA 4P6BA 2J9OA 3W4QA 3G2ZA 4PM8A 1YM1A 5M1AA 4RYEA 3C7VA 3SS3A 4GDBA 4GB7A 1BT5A 4BL2A 1W5DA 3WS0A 5HFOA 2JE5A 2JCHA 5A91A 1CEGA 2Y2QA 4A5RA 3CG5A 3W8KA 4CPKA 5CGXA 1K4FA 3NC8A 4OLGA 1ONHA 1PW1A 3DWZA 3OCNA 3CJMA 4BQMA 3VSKA 1H8YA 2Q9MA 1ES3A 2HPBA 1I5QA 4WZ5C 3UN7A 2HP9A 3VOZA 4BD1A 4Q8IA 5M18A 3DWKA 1NYMA 4KQRA 4OH0A 2Z2MB 2Y2KA 4YFMA 3IF5A 5KSHA 2QZ6A 3V5MA 1K56D 4RX3A 4OLDA 1ES4A 3BEBA 2FFYA 5FQ9A 2ZQAA 4S2OA 4OOYA 4EV4A 4KZAA 3UPPA 1IYOA 2XH9A 4X55A 4DE2A 5CGSA 5GLBA 4F94A 2WKEA 1MXOA 1YLJA 3Q81A 5DF9A 3RJUA 4WYYA 5E43A 3SH8A 3TOIA 1SDNA 4E3MA 4E3LA 4JF4A 5KSCA 2P9VA 3VP3A 4EBNA 2B5RA 3M6HA 3MXSA 4UAAA 2ZC7A 1NXYA 2WGWA 1KGEA 1MPLA 3M2KA 2J8YA 1E3UA 2H0YA 3O86A 4JPMA 4MEZA 4RVAA 3V39A 1VQQA 4IBXA 2ZQCA 1CI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI A;  1XP4 A;  3PAE A;  1K57 A;  1BLC A;  5CER A;  3FWL A;  4B4X A;  4KG2 A;  1L0D A;  5U47 A;  4KZ6 A;  3HLF A;  5HAP A;  2Y2J A;  3VP1 A;  1ZG6 A;  1IKI A;  4BD0 A;  2ZC3 B;  3DTM A;  3ZVT A;  4N9K A;  5L2F A;  4DXB A;  1PI5 A;  4E3O A;  1K54 C;  2RCX A;  3PBO A;  3NIA A;  4LV0 A;  2IWB A;  1PW8 A;  3M2J A;  4WMC A;  1E4D A;  2HDR A;  3WWX A;  3I7J A;  3OC2 A;  5FAS A;  2H5S A;  1FSY A;  4OPY A;  2XFT A;  3MZE A;  5GLD A;  1PI4 A;  5E2E A;  3P98 A;  1YLZ A;  1XKZ A;  4JXS A;  4KZ4 A;  2XFS A;  3NCK A;  3EQU A;  4GOG A;  4ZJ3 A;  3VP0 A;  3G30 A;  1BSG A;  1LHY A;  4QJG A;  1DY6 A;  4QB8 A;  2QPN A;  2Y91 A;  4LV1 A;  1BZA A;  3E2L A;  4R0Q A;  2HP5 A;  1RGZ A;  3ZHH A;  1MWS A;  3UDI A;  2G2W A;  5HL1 A;  4XXR A;  1QMF A;  2XK1 A;  1PWG A;  4MLL A;  4RA7 A;  3MZF A;  5TR7 A;  1I2S A;  3ZG9 B;  2IWC A;  2G2U A;  4QD4 A;  1MKI A;  1BLS A;  3BFE A;  1CI8 A;  3PBT A;  2GDN A;  2Y59 A;  4ZBE A;  2ZM8 A;  1TVF A;  3VFH A;  4CJN A;  2WUQ A;  1VM1 A;  3UDX A;  4IVK A;  4OP8 A;  4S2N A;  1GHM A;  1I2W A;  1OME A;  4MBH A;  2ZQ7 A;  5M19 A;  3WRZ A;  3Q07 A;  1ERO A;  3A3F A;  3GV9 A;  5CXW A;  2EX6 A;  1FR6 A;  1YT4 A;  3SS5 A;  4BJP A;  1L0F A;  5GHX A;  5DTT A;  2V1Z A;  1S0W A;  3GVB A;  1JWP A;  3MZD A;  5DF7 A;  5F1G A;  2P74 A;  3PBS A;  3WS1 A;  3BYD A;  1NYY A;  1BLP A;  2VGJ A;  4ZJ2 A;  3WS5 A;  1YLY A;  3N8L A;  3WS2 A;  5CED A;  1KGG A;  1PWD A;  1Y54 A;  4HES A;  3A3J A;  1MY8 A;  2HP6 A;  3HLG A;  4N1H A;  3N4I A;  4KQO A;  2Z2L B;  4X6T A;  5CGW A;  4FCF A;  5IHV A;  4KZ8 A;  1XXM A;  3PTE A;  5EVI B;  5HAI A;  4DDS A;  4HBU A;  4E3K A;  1KVL A;  3HVF A;  4KEN B;  1FOF A;  1N9B A;  4P0M A;  3OPH A;  1ES5 A;  1FCO A;  4WZ5 A;  5BOH A;  3ZDJ A;  4EBP A;  1FCN A;  1E25 A;  5DTK A;  5AQA A;  2WGW B;  2JC7 A;  1L0E A;  1FCM A;  1WYB A;  4X69 A;  1Z6F A;  3IH9 A;  1K4E A;  4KZ5 A;  4R4R A;  5HX9 A;  4IVI A;  3LO7 A;  2PU2 A;  2Y4A A;  5GLA A;  4R23 A;  5EVI D;  1SHV A;  5E2G A;  4DE3 A;  1EI5 A;  5EVI C;  3S22 A;  3VOY A;  5CTM A;  1HTZ A;  2XD5 A;  4EUZ A;  4B88 A;  5E2F A;  5FSR A;  4H8R A;  4FH4 A;  4C6Y A;  4UA6 A;  3UE0 A;  2VGK A;  4C75 A;  1ALQ A;  2EXB A;  3MXR A;  3HRE A;  5CTN A;  4Y0T A;  4OQI A;  3LCE A;  2R9W A;  1KDS A;  3IF6 C;  3M6B A;  3HUN A;  3S1Y A;  5A93 A;  3QNC A;  4HBT A;  4OQG A;  4OOL A;  1YQS A;  3VSL A;  3C4O A;  1C3B A;  2RL3 A;  1BUL A;  2EFX A;  4JXV A;  4S2L A;  1HVB A;  3UPO A;  1NZU A;  4DE0 A;  4N1X A;  1K54 A;  5FDH A;  2Y2I A;  5FI6 A;  4PM7 A;  1JWZ A;  1GA9 A;  3ZG7 B;  3OPL A;  2XD1 A;  3C7U A;  4ZJ1 A;  5FAT A;  2ZC4 B;  3Q7V A;  1KVM A;  3IF6 A;  5HAR A;  1K56 A;  3ITB A;  4XUX A;  4M3K A;  2UWX A;  4ID4 A;  1TDG A;  1H8Z A;  2V20 A;  3O88 A;  4EQI A;  1S6R A;  1EWZ A;  1XA1 A;  2PBY A;  2ZC6 B;  1ONG A;  3BFD A;  4DDY A;  5A90 A;  3HLD A;  3BM6 A;  4E6W A;  2J9P A;  4JF6 A;  2WGI A;  4MNR A;  3BFF A;  4OPZ A;  3ZGA B;  1PYY A;  2Y2G A;  5EEC A;  4JF5 A;  1KE4 A;  1PIO A;  1L0G A;  4EBL A;  4EWF A;  4DE1 A;  4GD6 A;  4GDN A;  1LI9 A;  5A92 A;  1J9M A;  3OZH A;  4UA9 A;  2DRW A;  4E3I A;  3O3V A;  3V3R A;  2WAE A;  3G35 A;  4O7D A;  1LLB A;  1E3U D;  5FAO A;  4N9L A;  2A49 A;  3UE1 A;  5E2H A;  1MWR A;  3BLM A;  1ERM A;  1GA0 A;  3UY6 A;  4JBF A;  2WYX A;  1WYC A;  3O87 A;  3BFC A;  2XQZ A;  4E3J A;  4NK3 A;  3UDF A;  4HEF A;  3ZFZ A;  4FH2 A;  4U0X A;  1IYP A;  4FD8 A;  2X02 A;  1H5X A;  3MKE A;  3N8R A;  4S2J A;  3HLW A;  5FI2 A;  1XA7 A;  4KZ3 A;  1TDL A;  5F82 A;  5CEC A;  5I94 A;  3ZVW A;  2EX8 A;  1IEL A;  5GHZ A;  1CK3 A;  4MBF A;  2WGV A;  5GL9 A;  2ZM0 A;  3NDG A;  4K0W A;  3IXH A;  3W4O A;  4OKP A;  1K38 A;  1YMS A;  2BLS A;  4WEJ A;  3IWI A;  4P85 A;  3EQV A;  4OON A;  1M40 A;  2ZQD A;  5JYO A;  4JXW A;  1NRF A;  1PZP A;  4ZTK A;  3GRJ A;  1GCE A;  4L0L A;  5G18 A;  2QMI A;  4U0T A;  1FQG A;  4U3T A;  4UA7 A;  3OCL A;  1ESU A;  3G34 A;  1LL5 A;  1Q2P A;  4S2N C;  4P87 A;  3ZNY A;  3FV7 A;  2E8I A;  4ZAM A;  5EOE A;  2WK0 A;  4PM5 A;  5CHM A;  4YIN A;  4LV2 A;  3CZD A;  4X56 A;  4BEN A;  1ZKJ A;  1SDE A;  3MBZ A;  1G6A A;  2Y2N A;  3NBL A;  1YLT A;  3SS4 A;  2A3U A;  4OVD A;  3VFF A;  3VP2 A;  3GMW A;  2IWD A;  3FKW A;  3SH9 A;  2H0T A;  1YLW A;  3ISG A;  2WAF A;  1XPB A;  3CMZ A;  3VP4 A;  1U60 A;  4R1G A;  4WEK A;  4LV3 A;  1K6S A;  4QHC A;  4GZB A;  3PBR A;  4OPQ A;  2EFU A;  3G32 A;  4KZ9 A;  2WAD A;  4MBK A;  4LCL A;  3HUM A;  5DVA A;  3QNB A;  2X71 A;  5TFQ A;  3V50 A;  2X01 A;  3FYZ A;  2Y2P A;  5KMW A;  1K55 C;  3D4F A;  1KE0 A;  5FAQ A;  2H10 A;  2HDQ A;  4Y0U A;  5EE8 A;  4C3Q A;  4KG6 A;  3IH8 A;  3ZCZ A;  1Q2Q A;  2Y2O A;  4QY5 A;  2WZZ A;  4X68 A;  4XUZ A;  1XGI A;  1MWT A;  5AQB A;  1YMX A;  4KG5 A;  3FZC A;  4QU3 A;  3E2K A;  4E6X A;  4IED A;  3IXG A;  3NDE A;  5HAQ A;  1ES2 A;  3PBN A;  2HDS A;  4OOM A;  5FA7 A;  4GKU A;  1MBL A;  3HL9 A;  1RGY A;  4JKT A;  3NY4 A;  1G68 A;  5CRF A;  2EXA A;  3IQA A;  4OPR A;  1NY0 A;  3MFD A;  2ZMA A;  3HLC A;  3LY3 A;  5GHY A;  3ZG8 B;  3MKF A;  3AGD A;  4OP5 A;  4X53 A;  1DJC A;  3HBR A;  3NI9 A;  1ESI A;  1L2S A;  2BG1 A;  5EVL A;  2XF3 A;  1NZO A;  1K57 C;  2ZLY A;  1W8Q A;  2XEP A;  3B3X A;  1LI0 A;  2XGN A;  3G4P A;  4IBR A;  5AQ7 A;  1K6R A;  2OLU A;  3AGF A;  2Y2M A;  5F83 A;  3G31 A;  1JWV A;  1ZC2 A;  1XX2 A;  2JBF A;  1RP5 A;  1DJB A;  1CEF A;  3BRM A;  4K0X A;  3SOI A;  3JYI A;  2PU4 A;  3Q1F A;  5FQQ A;  3FKV A;  1BLH A;  2XDM A;  5CEB A;  2OV5 A;  4DKI A;  1JTD A;  4LEN A;  4UHU A;  3ZG0 A;  3IXD A;  3LY4 A;  3A3I A;  4DF6 A;  4S2M A;  1HZO A;  4Y0O A;  5FAP A;  4WEL A;  5JYP A;  4KZ7 A;  3C4P A;  4DXC A;  4WMC D;  3G2Y A;  4DRT A;  3IHB A;  1O7E A;  4KQQ A;  3HLB A;  4Y7P A;  5HW3 A;  3HUO A;  5GLC A;  3P09 A;  1XGJ A;  2R9X A;  1SKF A;  1DJA A;  2J7V A;  4S2I A;  3VMA A;  2P9V B;  2WKI A;  3IHA A;  1W79 A;  2Q9N A;  3C5A A;  3UPN A;  4PM9 A;  5DF8 A;  3RXW A;  4R4S A;  5FQK A;  3SH7 A;  3N6I A;  4K91 A;  4OQ0 A;  4JLF A;  2OLV A;  5FQJ A;  5FQM A;  1IYQ A;  3IWQ A;  4FSF A;  4BLM A;  1AXB A;  1W7F A;  4ZDX A;  4E3N A;  1M6K A;  1PWC A;  4R3B A;  1KDW A;  4D2O A;  3BLS A;  3N8S A;  3ZNT A;  5EPH A;  3ITA A;  3LEZ A;  3N7W A;  4OQH A;  1N4O A;  3ZG5 A;  3PBQ A;  1JVJ A;  1QME A;  3PAG A;  1FSW A;  1SCW A;  1YLP A;  5CHJ A;  4JXG A;  2ZD8 A;  4RX2 A;  4QY6 A;  5J8X A;  1K55 A;  2ZQ9 A;  2C5W B;  3WS4 A;  2I72 A;  5CHU A;  5AQ9 A;  1LL9 A;  1IYS A;  2DNS A;  5EUA A;  5TGF A;  3IT9 A;  3Q7Z A;  2CC1 A;  4PMA A;  4R3J A;  1TEM A;  1PZO A;  3DW0 A;  2XR0 A;  2Y2L A;  3GR2 A;  1JTG A;  1O07 A;  2WZX A;  3GQZ A;  4B4Z A;  5FI7 A;  3W4P A;  1GHI A;  4PM6 A;  1HD8 A;  1ZG4 A;  3UNW A;  5KZH A;  4S2K A;  2ZJ9 A;  1RCJ A;  3Q82 A;  4GD8 A;  1GHP A;  2Y2H A;  2FFF B;  3BFG A;  3OPR A;  3OPP A;  1IEM A;  3AGE A;  5D3O A;  2ZC5 B;  1K25 A;  1KE3 A;  4GN2 A;  1W8Y A;  5DTS A;  3GTC A;  5EOO A;  4WBG A;  3A3D A;  1MWU A;  2OSU A;  1KGF A;  4NET A;  3UO9 A;  2V2F F;  3TSG A;  3WRT A;  1WE4 A;  2EX9 A;  2Y55 A;  3GSG A;  3IXB A;  1IKG A;  3BEC A;  1NJ4 A;  2WKH A;  1BTL A;  2XLN A;  5F1F A;  4N92 A;  4Z9Q A;  3IF6 B;  2EX2 A;  4BL3 A;  3Q7V B;  3UE3 A;  1BUE A;  1FR1 A;  3QHY A;  3V3S A;  4S2P A;  3HLE A;  3A3E A;  1ERQ A;  2ZQ8 A;  3RXX A;  4KZB A;  4WZ4 A;  3S4X A;  4WM9 A;  5FQI A;  3TG9 A;  2HDU A;  2DCF A;  2C6W B;  3IWO A;  2ZM2 A;  4GNU A;  4LCM A;  4PPR A;  4P6B A;  2J9O A;  3W4Q A;  3G2Z A;  4PM8 A;  1YM1 A;  5M1A A;  4RYE A;  3C7V A;  3SS3 A;  4GDB A;  4GB7 A;  1BT5 A;  4BL2 A;  1W5D A;  3WS0 A;  5HFO A;  2JE5 A;  2JCH A;  5A91 A;  1CEG A;  2Y2Q A;  4A5R A;  3CG5 A;  3W8K A;  4CPK A;  5CGX A;  1K4F A;  3NC8 A;  4OLG A;  1ONH A;  1PW1 A;  3DWZ A;  3OCN A;  3CJM A;  4BQM A;  3VSK A;  1H8Y A;  2Q9M A;  1ES3 A;  2HPB A;  1I5Q A;  4WZ5 C;  3UN7 A;  2HP9 A;  3VOZ A;  4BD1 A;  4Q8I A;  5M18 A;  3DWK A;  1NYM A;  4KQR A;  4OH0 A;  2Z2M B;  2Y2K A;  4YFM A;  3IF5 A;  5KSH A;  2QZ6 A;  3V5M A;  1K56 D;  4RX3 A;  4OLD A;  1ES4 A;  3BEB A;  2FFY A;  5FQ9 A;  2ZQA A;  4S2O A;  4OOY A;  4EV4 A;  4KZA A;  3UPP A;  1IYO A;  2XH9 A;  4X55 A;  4DE2 A;  5CGS A;  5GLB A;  4F94 A;  2WKE A;  1MXO A;  1YLJ A;  3Q81 A;  5DF9 A;  3RJU A;  4WYY A;  5E43 A;  3SH8 A;  3TOI A;  1SDN A;  4E3M A;  4E3L A;  4JF4 A;  5KSC A;  2P9V A;  3VP3 A;  4EBN A;  2B5R A;  3M6H A;  3MXS A;  4UAA A;  2ZC7 A;  1NXY A;  2WGW A;  1KGE A;  1MPL A;  3M2K A;  2J8Y A;  1E3U A;  2H0Y A;  3O86 A;  4JPM A;  4MEZ A;  4RVA A;  3V39 A;  1VQQ A;  4IBX A;  2ZQC A;  1CI9 A; 
#chains in the Genus database with same CATH topology
 3PAE A;  3H7W A;  3LR3 A;  5U47 A;  3NJA A;  2ZMV A;  2Y2J A;  1ZG6 A;  3BY8 A;  4BD0 A;  3ZVT A;  4N9K A;  1PI5 A;  2PR5 A;  2IWB A;  4WMC A;  4GHI B;  1FSY A;  2XFT A;  2WKQ A;  1YLZ A;  1XKZ A;  2XFS A;  3NCK A;  4M4X A;  3VP0 A;  1LHY A;  3QP6 A;  3LYX A;  2Y91 A;  5HL1 A;  2XK1 A;  2XRN A;  4MLL A;  1P9W A;  4GCZ A;  1V9Z A;  2IWC A;  3NOP C;  3BFE A;  5HSQ A;  4PAU A;  1TVF A;  1IOU A;  1TS8 A;  4S2N A;  1I2W A;  3E98 A;  4MBH A;  5M19 A;  2J80 A;  1S4S A;  5GHX A;  2JKR M;  5DTT A;  3WS1 A;  1JWP A;  3PBS A;  3BYD A;  3KSH A;  3WS2 A;  2EWW A;  3D9Y A;  5CED A;  5HPI A;  4BWI A;  4HES A;  3ZQ5 A;  2B02 A;  3N4I A;  2PT7 A;  2E8J A;  4KZ8 A;  3PTE A;  1N9N A;  5EVI B;  5HAI A;  4DDS A;  4HBU A;  5KIZ A;  4WZ5 A;  1FOF A;  3OPH A;  4EBP A;  1DP8 A;  1WYB A;  5EV0 A;  3IH9 A;  5IT5 A;  4IVI A;  1T1C A;  1P9R A;  3T1X A;  3VE3 A;  5E2F A;  3UB7 A;  2EXB A;  4OQI A;  2HF6 A;  5A93 A;  4OOL A;  5FEF A;  1C3B A;  2RL3 A;  3KYZ A;  4JXV A;  4S2L A;  3MS6 A;  1NZU A;  2VV6 A;  1FIL A;  3PHY A;  1JWZ A;  3MQQ A;  3OPL A;  1OT9 A;  2G7U A;  4IHQ A;  3BWL A;  4ID4 A;  1TDG A;  1PFL A;  1XJ6 A;  2QJ7 A;  1S6R A;  3LR5 A;  1XA1 A;  3BM6 A;  4E6W A;  3RTY A;  4XT2 A;  2WGI A;  4Y5F A;  2V8C A;  3LIB A;  1L0G A;  4EBL A;  2VV8 A;  1LI9 A;  3OZH A;  2DRW A;  2ZMF A;  3IX3 A;  5L10 A;  2VJW A;  4P6Z M;  1MWR A;  1IYP A;  2X02 A;  3MKE A;  4S2J A;  3C30 A;  4KZ3 A;  1TDL A;  5I94 A;  4MBF A;  5DKL A;  4IUH A;  2W3D A;  3IXH A;  4NXE A;  4WEJ A;  2HJ9 C;  3EQV A;  4G3W A;  1YSQ A;  1M40 A;  4JXW A;  4ESP A;  3GRJ A;  2QMI A;  4X1M A;  2M7V A;  5IS1 A;  2JKR I;  3ZNY A;  2CMN A;  4ZAM A;  2LB9 A;  4YIN A;  4WL9 A;  3CZD A;  3VP2 A;  4L9F A;  3FKW A;  1D7E A;  3LR0 A;  1U60 A;  1P0Z A;  1K6S A;  3PBR A;  4LCL A;  2X71 A;  2X01 A;  3FYZ A;  1K55 C;  3E4P A;  4Y0U A;  4ME4 A;  4C3Q A;  3ZCZ A;  2WZZ A;  1MWT A;  4E6X A;  4IED A;  3IXG A;  3NDE A;  3R4K A;  5HAQ A;  4Q0I A;  3PBN A;  3TRC A;  4OOM A;  5A8B A;  1GSV A;  1NLY A;  1G68 A;  4LRY C;  2B95 A;  2ZMA A;  5GHY A;  3HBR A;  1ESI A;  1GSW A;  1NZO A;  1K57 C;  2ZLY A;  1LI0 A;  2Y2M A;  1JWV A;  1ZC2 A;  1CEF A;  3QP8 A;  4I39 A;  2K2N A;  3KYE A;  2MJ6 A;  4UHU A;  3UB6 A;  4Y0O A;  5FAP A;  2XRO A;  4DRT A;  3ZYT A;  4KQQ A;  1PRQ A;  4LGW A;  5GLC A;  2P9V B;  2WKI A;  1W79 A;  3C5A A;  3UPN A;  3H7W B;  4X25 A;  5FQK A;  3T1S A;  4JLF A;  1T1A A;  3IX8 A;  1H8M A;  4FSF A;  4ZDX A;  2W3E A;  3N8S A;  3ITA A;  4OQH A;  1N4O A;  4ARZ A;  4BBU A;  5CHJ A;  1K55 A;  5AVF A;  4HJ6 A;  3WS4 A;  1LL9 A;  2EWV A;  2INW A;  1TEM A;  2Y2L A;  3GR2 A;  4B4Z A;  4Y3I A;  1ZG4 A;  3K3D A;  4GD8 A;  1GHP A;  2PYR A;  3BFG A;  3OPR A;  3S7P A;  1MWU A;  4EEP A;  4R38 A;  1L3L A;  2V2F F;  3WRT A;  1WE4 A;  2ZL1 A;  4GS9 B;  3S7Q A;  3BEC A;  4CLC C;  1LSX A;  4N92 A;  3Q7V B;  1BUE A;  4EEU A;  3V3S A;  1SKO A;  5DFY A;  3A3E A;  5HWT A;  2K31 A;  1FIK A;  2C6W B;  3IWO A;  4P6B A;  3W4Q A;  4PM8 A;  3MQO A;  3OOV A;  3WS0 A;  4A5R A;  4DMZ A;  3W8K A;  5CGX A;  1K4F A;  3OCN A;  1PW1 A;  3VSK A;  1I5Q A;  4BD1 A;  2Z2M B;  3IF5 A;  1S1Y A;  3FG8 A;  1JNU A;  5KSH A;  2QZ6 A;  2KDK A;  1LSV A;  2P04 A;  3BEB A;  2FFY A;  1S67 L;  3UPP A;  3JVU A;  2XH9 A;  3P01 A;  3NEC A;  4F94 A;  1MXO A;  3Q81 A;  5EM1 A;  3D72 A;  3KSI A;  5E43 A;  2V1B A;  4E3L A;  2P9V A;  1OJ5 A;  2L0W A;  3VP3 A;  1NXY A;  3M2K A;  4MEZ A;  1E3U A;  2H0Y A;  2ZQC A;  1CI9 A;  2Y8H A;  5CER A;  1ZHH B;  2LB5 A;  3FWL A;  4B4X A;  1L0D A;  3HLF A;  5HAP A;  2Q0O A;  4HQA A;  3T50 A;  2VEA A;  2W3H A;  4DXB A;  2ZOI A;  2GNX A;  2RCX A;  3PBO A;  4LV0 A;  1PW8 A;  3M2J A;  2HDR A;  4I38 A;  2VLG A;  2GJ3 A;  3FPV A;  5I5L A;  5E2E A;  3O5Y A;  3EQU A;  2PBD P;  4ZJ3 A;  3G30 A;  5J4E A;  4QB8 A;  1T19 A;  2QPN A;  4R0Q A;  3LIC A;  4O0P A;  1MWS A;  3UDI A;  2G2W A;  4XXR A;  1PWG A;  4YWZ A;  3MZF A;  2L1M A;  5TR7 A;  1CI8 A;  2W3F A;  4ZBE A;  2ZM8 A;  1OT6 A;  1VM1 A;  4OP8 A;  5L09 A;  1OME A;  3WRZ A;  3Q07 A;  1N9O A;  3A3F A;  3SS5 A;  1L0F A;  1YSP A;  3DTK A;  4II7 A;  3GVB A;  5F1G A;  1NYY A;  4Y17 A;  3HJK A;  3KSG A;  5FL3 A;  1MY8 A;  4HY8 A;  5CGW A;  4FCF A;  3GEC A;  2PRF A;  3C8C A;  2DMW A;  3UME A;  1N9B A;  2V8F A;  4MN6 A;  1E25 A;  3LEQ A;  2JC7 A;  1L0E A;  4X69 A;  1K4E A;  5HX9 A;  3LO7 A;  1STZ A;  5GLA A;  4R23 A;  1A0K A;  1EI5 A;  4K08 A;  5TJJ A;  4NKP A;  4EUZ A;  5LBR A;  2JHE A;  4C75 A;  1ALQ A;  4Y0T A;  3C38 A;  2R9W A;  1KDS A;  4OQG A;  3VSL A;  3C4O A;  4H6J B;  3MJQ A;  2HV1 A;  2ACG A;  3ITB A;  4R3A A;  4M3K A;  2UWX A;  2V20 A;  2YKH A;  3O88 A;  5J3W A;  3BFD A;  4DDY A;  5A90 A;  3HCY A;  2J9P A;  4JF6 A;  4PKY A;  4UEY A;  1PYY A;  2O9B A;  4HHD A;  4GD6 A;  4GDN A;  4ETX A;  1J9M A;  4UA9 A;  3O3V A;  5G4Z A;  1YAX A;  3BQ8 A;  5FAO A;  2A49 A;  3UE1 A;  4HP9 A;  3BLM A;  2EA9 A;  1GA0 A;  2XA7 S;  4BMW A;  4JBF A;  2WYX A;  3UDF A;  4HEF A;  5HL6 A;  3N8R A;  5CEC A;  4I5S A;  5GHZ A;  2WGV A;  5GL9 A;  2ZM0 A;  3NDG A;  4ARZ B;  3LIF A;  3F1P B;  5JYO A;  1NRF A;  4ZTK A;  4EER A;  3DBA A;  1VET B;  4U3T A;  3OCL A;  1LL5 A;  4S2N C;  1D1J A;  4P87 A;  3FV7 A;  4EXO A;  2E8I A;  4PM5 A;  4LV2 A;  1SDE A;  2YKF A;  1G6A A;  3LR4 A;  2Y2N A;  4L9E A;  3NBL A;  3SS4 A;  4GLQ A;  3ISG A;  3MMH A;  4O8G A;  2QHK A;  4WEK A;  4LV3 A;  4QHC A;  4MBK A;  3HUM A;  3QNB A;  5TFQ A;  1WA9 A;  2Y2P A;  4WUJ A;  3D4F A;  1KE0 A;  5FAQ A;  4KG6 A;  1XFN A;  3IH8 A;  2Y2O A;  5AQB A;  4QU3 A;  1W63 Q;  3T1R A;  5F69 A;  4EU0 A;  4KQD A;  4Y2F A;  2HDS A;  4HH2 A;  3HL9 A;  1MZU A;  1SZV A;  1RGY A;  3NY4 A;  2PHY A;  3HLC A;  4Q0H A;  4OP5 A;  2P7J A;  5DJU A;  3H82 A;  3U4L P;  4IUK A;  3B3X A;  2XGN A;  2W1T B;  3EGD C;  3KYQ A;  2JBF A;  4ZRR A;  1RP5 A;  1DJB A;  5HDD A;  3BRM A;  4K0X A;  3JYI A;  1OTI A;  2VA0 A;  4FUW A;  1JTD A;  2WKR A;  3LY4 A;  4DF6 A;  2GX5 A;  1HZO A;  4WEL A;  4GHI A;  5JYP A;  4UQI S;  3T4L A;  3IHB A;  5FDS A;  4Y7P A;  5HW3 A;  1CF0 A;  3HUO A;  3ULF A;  2R9X A;  2J7V A;  4S2I A;  1OTD A;  3UE6 A;  3IHA A;  3U2A A;  4PM9 A;  3SH7 A;  3N6I A;  4K91 A;  4MN7 A;  3IWQ A;  1M6K A;  4MMN A;  1PWC A;  1KDW A;  2HGV A;  3BLS A;  3MF0 A;  4I3J A;  1Y4O A;  3LEZ A;  5F68 A;  3PBQ A;  1Y28 A;  2ZD8 A;  2PD8 A;  2C5W B;  3K3C A;  5AQ9 A;  2DNS A;  1IYS A;  5TGF A;  2Y79 A;  3Q7Z A;  1PZO A;  3DW0 A;  3MSH A;  2W27 A;  3W4P A;  1GHI A;  5KZH A;  2ZJ9 A;  1RCJ A;  1S66 L;  3Q82 A;  2FFF B;  4HH3 A;  5D3O A;  3AGE A;  2ZC5 B;  5DTS A;  1GSX A;  5EOO A;  4WBG A;  3F1N A;  3LUQ A;  3TSG A;  2EX9 A;  3V67 A;  3LGO A;  2Y55 A;  3IXB A;  1IKG A;  1NJ4 A;  2WKH A;  1T18 A;  2XLN A;  3IF6 B;  1VB6 A;  1FR1 A;  4GW9 A;  4S2P A;  3UB9 A;  3RXX A;  4KZB A;  3T4S A;  5HPF A;  2HDU A;  3FC7 A;  2ZM2 A;  4PPR A;  2R78 A;  4WF0 A;  3G2Z A;  3SS3 A;  3EGX C;  5HFO A;  2Y2Q A;  4HJ3 A;  3DTE A;  2V9A A;  4OLG A;  4HI4 A;  1ONH A;  3UN7 A;  2HP9 A;  3DWK A;  4OH0 A;  1LL8 A;  2J3T D;  4RX3 A;  4OLD A;  1ES4 A;  1H0M A;  4S2O A;  3CLO A;  4DE2 A;  4MCW A;  5GLB A;  2WKE A;  2QWS A;  3RJU A;  4WYY A;  1CJF A;  5KSC A;  4E3I A;  1VQQ A;  5TBM B;  4R6L A;  4HNB A;  1VEU A;  2BAS A;  1XJ2 A;  5EVI A;  1XP4 A;  2KLI A;  3KO6 A;  2H28 A;  3T4K A;  4KG2 A;  4KZ6 A;  3VV4 A;  1IKI A;  3CAX A;  3B47 A;  4E3O A;  1X0O A;  3S7N A;  1E4D A;  5L8M A;  3SZT A;  3E4O A;  3OC2 A;  3MFX A;  1EW0 A;  4OPY A;  5GLD A;  1PI4 A;  4WLA A;  3T12 B;  4JXS A;  4GOG A;  4G3V A;  4QJG A;  1DY6 A;  1BZA A;  3R7W B;  3E2L A;  3ZHH A;  4NXG A;  1ODV A;  4AFI A;  1I2S A;  3R7W A;  4NXB A;  3ZG9 B;  3CI6 A;  2G2U A;  4QD4 A;  1MKI A;  3PBT A;  2GDN A;  2Y59 A;  3VFH A;  3EEA A;  3UDX A;  4R70 A;  1GHM A;  1XJ4 A;  1ERO A;  3GV9 A;  5CXW A;  2Z6D A;  1G6O A;  1FR6 A;  1YT4 A;  3T4Q A;  3MZD A;  5DF7 A;  2WKP A;  2VGJ A;  4ZJ2 A;  3WS5 A;  3P7N A;  5DFX A;  1Y54 A;  2PAV P;  3K2N A;  3A3J A;  4JGQ A;  2HP6 A;  3HLG A;  5IHV A;  1XXM A;  3G6O A;  3HVF A;  4KEN B;  4P0M A;  5TBM A;  1F5M A;  5DTK A;  2WGW B;  2PYP A;  1FCM A;  1TS7 A;  3OBF A;  1Z6F A;  5HDS A;  4KZ5 A;  4R4R A;  2Y4A A;  2JKT I;  5EVI D;  1SHV A;  3S22 A;  2XD5 A;  3NOU C;  4B88 A;  4C6Y A;  4UA6 A;  3KX0 X;  3LI8 A;  3JVV A;  5CTN A;  3SW1 A;  3M6B A;  1OTE A;  2FZ0 A;  3DTI A;  1OTB A;  2A24 A;  1J3W A;  1BUL A;  2EFX A;  4D60 A;  3IS2 B;  1HVB A;  2J3T C;  3QP4 A;  4N1X A;  1K54 A;  4KUO A;  2Y2I A;  2V0U A;  4PM7 A;  5F6A A;  2XD1 A;  5FAT A;  3Q7V A;  3IF6 A;  1K56 A;  1H8Z A;  2ZC6 B;  1ACF A;  2PD7 A;  1NRJ A;  4MNR A;  4PKY G;  4EUV A;  3BFF A;  4OPZ A;  3ZGA B;  4HP4 A;  1UWP X;  4JF5 A;  1KE4 A;  4DE1 A;  5A92 A;  3TJZ C;  2I9V A;  1TS6 A;  3G35 A;  4N9L A;  4MDZ A;  5HWV A;  2ZL1 B;  3UY6 A;  2QJ5 A;  1WYC A;  3BFC A;  4E3J A;  4NG2 A;  1H5X A;  3HLW A;  1XA7 A;  1YKD A;  1CK3 A;  4K0W A;  3W4O A;  1K38 A;  1Z09 A;  2BLS A;  2QKP A;  3IWI A;  1TD5 A;  2ZQD A;  1GCE A;  4L0L A;  5G18 A;  4U0T A;  4UA7 A;  4F3L B;  1ESU A;  3G34 A;  1Q2P A;  3NHQ A;  5EOE A;  1ZKJ A;  1YLT A;  2H0T A;  3CMZ A;  3VP4 A;  1G28 A;  2V0W A;  4OPQ A;  5MC7 A;  2EFU A;  3G32 A;  2JKF A;  5DVA A;  3V50 A;  5KMW A;  2OOL A;  3JPU A;  2VK3 A;  3A0V A;  4FOF A;  1Q2Q A;  4QY5 A;  4B93 A;  1XGI A;  3FZC A;  3H82 B;  4P6Z S;  5L07 A;  3E2K A;  5AVE A;  4CLC E;  4GKU A;  4JKT A;  1G5U A;  5CRF A;  2EXA A;  5HDC A;  3MFD A;  3VE4 A;  4Y13 A;  3ZG8 B;  3MKF A;  4X53 A;  1DJC A;  1L2S A;  5EVL A;  2XF3 A;  1W8Q A;  3KSF A;  4IBR A;  3F1O B;  1XX2 A;  2PU4 A;  5FQQ A;  1BLH A;  2OV5 A;  2V1A A;  4CLC D;  4S2M A;  4WN5 A;  4DXC A;  2AVX A;  3G2Y A;  1O7E A;  3PXP A;  1XGJ A;  3RH8 B;  1SKF A;  1DJA A;  2P08 A;  3VMA A;  1UGU A;  5DF8 A;  1T1B A;  1TS0 A;  3LIA A;  5FQJ A;  3CIT A;  1IYQ A;  1BYW A;  4X1L A;  4BLM A;  3UB5 P;  1W7F A;  1VEU B;  4E3N A;  3H9W A;  4R3B A;  1H3Q A;  3T1Q B;  3F1P A;  3ZG5 A;  1JVJ A;  1QME A;  1YLP A;  5J8X A;  2ZQ9 A;  2UV0 E;  2CC1 A;  2W1R A;  1CQA A;  1JTG A;  3GQZ A;  1HD8 A;  2VV7 A;  2Y2H A;  1IEM A;  1K25 A;  4GN2 A;  4YNR A;  4I3I A;  2OSU A;  2HZ5 A;  3EWK A;  4NET A;  3UO9 A;  4YOF A;  5J7E A;  2Z6C A;  4HOI A;  1OTA A;  3TW8 A;  4GS9 A;  4BL3 A;  1ERQ A;  4JGO A;  4H6J A;  4WZ4 A;  3S4X A;  3CUE C;  3L9K A;  4WM9 A;  4GNU A;  3NUL A;  4UQI M;  4B9O A;  2J9O A;  4EES A;  1W63 M;  1YM1 A;  5M1A A;  4NXF A;  3MQ0 A;  2GZA A;  1CEG A;  1K0K A;  4LPZ A;  3HJI A;  3DWZ A;  4BQM A;  2JKG A;  3IS2 A;  1H8Y A;  2Q9M A;  4Q8I A;  5HD3 A;  4I3A A;  1NYM A;  4DJ3 A;  4KQR A;  2O9A A;  4YFM A;  3V5M A;  1K56 D;  5FQ9 A;  2ZQA A;  4EV4 A;  3FPW A;  3BW6 A;  4KZA A;  1DP6 A;  5EM0 A;  3T4J A;  5DF9 A;  3SH8 A;  4EBN A;  2B5R A;  3M6H A;  3MXS A;  2WGW A;  1KOU A;  4Q0J A;  2J8Y A;  3O86 A;  1IFQ A;  4JGP A;  5AJG A;  1K57 A;  1BLC A;  4GJ4 A;  3A0R A;  3VP1 A;  2O0Y A;  4O01 A;  2ZC3 B;  3DTM A;  5L2F A;  1K54 C;  4EW7 A;  3NIA A;  1YPR A;  3WWX A;  3I7J A;  5FAS A;  1OPX A;  2H5S A;  3IX4 A;  3MZE A;  4IJG A;  3LI9 A;  3P98 A;  4KZ4 A;  3D3O A;  3B42 A;  4HIA A;  1BSG A;  4LV1 A;  2HP5 A;  1RGZ A;  2OWH A;  1QMF A;  4RA7 A;  1BLS A;  1MC0 A;  3E0Y A;  3MR0 A;  4CJN A;  2WUQ A;  4QPR A;  4IVK A;  2VKS A;  3EOI A;  2ZQ7 A;  2VX8 A;  2J3W A;  2EX6 A;  1LT0 A;  4BJP A;  2V1Z A;  1S0W A;  1D06 A;  2P74 A;  2BTF P;  2JKT M;  3PR6 A;  1BLP A;  3B33 A;  1YLY A;  3N8L A;  1KGG A;  1PWD A;  4N1H A;  4KQO A;  2Z2L B;  4X6T A;  4Z1W A;  4E3K A;  1KVL A;  5BOH A;  4Y15 A;  1ES5 A;  1FCO A;  3ZDJ A;  1FCN A;  3T4T A;  5AQA A;  2FH5 A;  2PU2 A;  4EQ1 A;  5E2G A;  1UWN X;  4DE3 A;  5EVI C;  3VOY A;  5CTM A;  5IU1 A;  1HTZ A;  5FSR A;  2NUP C;  4H8R A;  4FH4 A;  3UE0 A;  2VGK A;  4CLC A;  3MXR A;  2IA2 A;  2O99 A;  3CPT B;  3HRE A;  3LCE A;  3IF6 C;  3S1Y A;  3HUN A;  3QNC A;  1MKM A;  4HBT A;  1YQS A;  2O9C A;  3UPO A;  4DE0 A;  5FDH A;  5FI6 A;  1GA9 A;  3ZG7 B;  3GDI A;  1SKO B;  3C7U A;  4ZJ1 A;  2ZC4 B;  1KVM A;  5HAR A;  4XUX A;  1VHM A;  1XJ3 A;  2M7U A;  4EQI A;  2PBY A;  1EWZ A;  1ONG A;  3OLO A;  3HLD A;  2Y2G A;  5EEC A;  5EVE A;  5F5Y A;  1PIO A;  4EWF A;  4XT2 B;  3QP2 A;  3V3R A;  2WAE A;  3ICY A;  3CHW P;  4O7D A;  1LLB A;  1E3U D;  5E2H A;  1F98 A;  1ERM A;  3C2W A;  3CPT A;  4RQ9 A;  4DJ2 A;  4CLC B;  3O87 A;  4JGR A;  2A2L A;  3BY9 A;  2XQZ A;  4NK3 A;  2OAQ 1;  3ZFZ A;  4FH2 A;  4U0X A;  4FD8 A;  5FI2 A;  5F82 A;  3ZVW A;  3LFV A;  2EX8 A;  4PHT A;  1IEL A;  1P97 A;  4OKP A;  1YMS A;  4HJ4 A;  3VOL A;  3E4Q A;  2VGL M;  4P85 A;  4OON A;  1PZP A;  1FQG A;  1DP9 A;  3L7H A;  2WK0 A;  5CHM A;  2ZOH A;  2QYB A;  4X56 A;  4BEN A;  3MBZ A;  2A3U A;  4OVD A;  2PR6 A;  3BQA A;  3GMW A;  2IWD A;  3VFF A;  3SH9 A;  1YLW A;  2WAF A;  1XPB A;  4R1G A;  2JN7 A;  3UB8 A;  4GZB A;  4KZ9 A;  2WAD A;  5C5K A;  2H10 A;  2HDQ A;  5EE8 A;  2D01 A;  4XUZ A;  4X68 A;  1YMX A;  4KG5 A;  4NEE D;  5G4Y A;  2XA7 M;  1ES2 A;  4LFU A;  5FA7 A;  1OJG A;  3PYP A;  1MBL A;  3TE8 A;  3IQA A;  4OPR A;  1NY0 A;  3LY3 A;  3AGD A;  2W1T A;  3F1O A;  3NI9 A;  4KUK A;  2BG1 A;  2VZW A;  2XEP A;  5AQ7 A;  3G4P A;  2OWJ A;  1K6R A;  2OLU A;  3AGF A;  5F83 A;  2PDR A;  3G31 A;  1XFQ A;  2B18 A;  3QP1 A;  3SOI A;  3Q1F A;  2K7S A;  3FKV A;  2XDM A;  5CEB A;  2L4R A;  3A0S A;  3BJN A;  4LEN A;  3ZG0 A;  4DKI A;  3IXD A;  3A3I A;  3LID A;  4KZ7 A;  3LIE A;  2KX6 A;  3C4P A;  4WMC D;  3HLB A;  3P09 A;  5DJT A;  5CX7 A;  2Q9N A;  3CWF A;  3S7O A;  3RXW A;  1NLZ A;  4R4S A;  4LRZ E;  4OQ0 A;  4F3L A;  2OLV A;  5FQM A;  3DAV A;  1AXB A;  5HZH A;  3EEH A;  4BBV A;  4D2O A;  3ZNT A;  5EPH A;  3N7W A;  2VGL S;  1N9L A;  3PAG A;  1FSW A;  1SCW A;  4JXG A;  4RX2 A;  4QY6 A;  5HD5 A;  2I72 A;  5CHU A;  5EUA A;  1PNE A;  5EFW A;  1VET A;  3IT9 A;  4PMA A;  3CUE A;  4R3J A;  2M1C A;  2XR0 A;  3UMD A;  1O07 A;  2WZX A;  5FI7 A;  3T4O A;  4PM6 A;  1NWZ A;  5FEG A;  4FTX A;  3W2Z A;  3UNW A;  2W0N A;  4S2K A;  4L9G A;  3OPP A;  1KE3 A;  1W8Y A;  3GTC A;  3A3D A;  3IBR A;  1KGF A;  1F9I A;  4EET B;  1AWI A;  4LLO B;  3GSG A;  1BTL A;  5F1F A;  4Z9Q A;  2KOI A;  2EX2 A;  3UE3 A;  2HJE A;  3QHY A;  4LRX C;  2XSS A;  3QP5 A;  3HLE A;  1V9Y A;  3F1N B;  4BBT A;  2ZQ8 A;  5HWW A;  3NOT C;  5FQI A;  3TG9 A;  2OAP 1;  2DCF A;  4CQH A;  4LCM A;  1HLU P;  4RYE A;  3C7V A;  4QWO A;  4GDB A;  4GB7 A;  1BT5 A;  4DN0 A;  4BL2 A;  1W5D A;  2JE5 A;  2JCH A;  5A91 A;  1S4R A;  1DRM A;  3CG5 A;  4CPK A;  1LSW A;  3NC8 A;  3CJM A;  3VOZ A;  1ES3 A;  2HPB A;  4WZ5 C;  5M18 A;  2A24 B;  4ETZ A;  2ZBB A;  2Y2K A;  2D02 A;  2W3G A;  1F2K A;  5K5B A;  4OOY A;  1IYO A;  1S1Z A;  4MN5 A;  4X55 A;  5CGS A;  2NUT C;  3MXQ A;  3IBJ A;  4E04 A;  1YLJ A;  5DKK A;  3TOI A;  1SDN A;  4E3M A;  4JF4 A;  3RFB A;  4UAA A;  2ZC7 A;  1KGE A;  1MPL A;  1TF1 A;  4JPM A;  4RVA A;  1ZTU A;  3V39 A;  4G3K A;  4IBX A; 
#chains in the Genus database with same CATH homology
 5EVI A;  1XP4 A;  3PAE A;  1K57 A;  1BLC A;  5CER A;  3FWL A;  4B4X A;  4KG2 A;  1L0D A;  5U47 A;  4KZ6 A;  3HLF A;  5HAP A;  2Y2J A;  3VP1 A;  1ZG6 A;  1IKI A;  4BD0 A;  2ZC3 B;  3DTM A;  3ZVT A;  4N9K A;  5L2F A;  4DXB A;  1PI5 A;  4E3O A;  1K54 C;  2RCX A;  3PBO A;  3NIA A;  4LV0 A;  2IWB A;  1PW8 A;  3M2J A;  4WMC A;  1E4D A;  2HDR A;  3WWX A;  3I7J A;  3OC2 A;  5FAS A;  2H5S A;  1FSY A;  4OPY A;  2XFT A;  3MZE A;  5GLD A;  1PI4 A;  5E2E A;  3P98 A;  1YLZ A;  1XKZ A;  4JXS A;  4KZ4 A;  2XFS A;  3NCK A;  3EQU A;  4GOG A;  4ZJ3 A;  3VP0 A;  3G30 A;  1BSG A;  1LHY A;  4QJG A;  1DY6 A;  4QB8 A;  2QPN A;  2Y91 A;  4LV1 A;  1BZA A;  3E2L A;  4R0Q A;  2HP5 A;  1RGZ A;  3ZHH A;  1MWS A;  3UDI A;  2G2W A;  5HL1 A;  4XXR A;  1QMF A;  2XK1 A;  1PWG A;  4MLL A;  4RA7 A;  3MZF A;  5TR7 A;  1I2S A;  3ZG9 B;  2IWC A;  2G2U A;  4QD4 A;  1MKI A;  1BLS A;  3BFE A;  1CI8 A;  3PBT A;  2GDN A;  2Y59 A;  4ZBE A;  2ZM8 A;  1TVF A;  3VFH A;  4CJN A;  2WUQ A;  1VM1 A;  3UDX A;  4IVK A;  4OP8 A;  4S2N A;  1GHM A;  1I2W A;  1OME A;  4MBH A;  2ZQ7 A;  5M19 A;  3WRZ A;  3Q07 A;  1ERO A;  3A3F A;  3GV9 A;  5CXW A;  2EX6 A;  1FR6 A;  1YT4 A;  3SS5 A;  4BJP A;  1L0F A;  5GHX A;  5DTT A;  2V1Z A;  1S0W A;  3GVB A;  1JWP A;  3MZD A;  5DF7 A;  5F1G A;  2P74 A;  3PBS A;  3WS1 A;  3BYD A;  1NYY A;  1BLP A;  2VGJ A;  4ZJ2 A;  3WS5 A;  1YLY A;  3N8L A;  3WS2 A;  5CED A;  1KGG A;  1PWD A;  1Y54 A;  4HES A;  3A3J A;  1MY8 A;  2HP6 A;  3HLG A;  4N1H A;  3N4I A;  4KQO A;  2Z2L B;  4X6T A;  5CGW A;  4FCF A;  5IHV A;  4KZ8 A;  1XXM A;  3PTE A;  5EVI B;  5HAI A;  4DDS A;  4HBU A;  4E3K A;  1KVL A;  3HVF A;  4KEN B;  1FOF A;  1N9B A;  4P0M A;  3OPH A;  1ES5 A;  1FCO A;  4WZ5 A;  5BOH A;  3ZDJ A;  4EBP A;  1FCN A;  1E25 A;  5DTK A;  5AQA A;  2WGW B;  2JC7 A;  1L0E A;  1FCM A;  1WYB A;  4X69 A;  1Z6F A;  3IH9 A;  1K4E A;  4KZ5 A;  4R4R A;  5HX9 A;  4IVI A;  3LO7 A;  2PU2 A;  2Y4A A;  5GLA A;  4R23 A;  5EVI D;  1SHV A;  5E2G A;  4DE3 A;  1EI5 A;  5EVI C;  3S22 A;  3VOY A;  5CTM A;  1HTZ A;  2XD5 A;  4EUZ A;  4B88 A;  5E2F A;  5FSR A;  4H8R A;  4FH4 A;  4C6Y A;  4UA6 A;  3UE0 A;  2VGK A;  4C75 A;  1ALQ A;  2EXB A;  3MXR A;  3HRE A;  5CTN A;  4Y0T A;  4OQI A;  3LCE A;  2R9W A;  1KDS A;  3IF6 C;  3M6B A;  3HUN A;  3S1Y A;  5A93 A;  3QNC A;  4HBT A;  4OQG A;  4OOL A;  1YQS A;  3VSL A;  3C4O A;  1C3B A;  2RL3 A;  1BUL A;  2EFX A;  4JXV A;  4S2L A;  1HVB A;  3UPO A;  1NZU A;  4DE0 A;  4N1X A;  1K54 A;  5FDH A;  2Y2I A;  5FI6 A;  4PM7 A;  1JWZ A;  1GA9 A;  3ZG7 B;  3OPL A;  2XD1 A;  3C7U A;  4ZJ1 A;  5FAT A;  2ZC4 B;  3Q7V A;  1KVM A;  3IF6 A;  5HAR A;  1K56 A;  3ITB A;  4XUX A;  4M3K A;  2UWX A;  4ID4 A;  1TDG A;  1H8Z A;  2V20 A;  3O88 A;  4EQI A;  1S6R A;  1EWZ A;  1XA1 A;  2PBY A;  2ZC6 B;  1ONG A;  3BFD A;  4DDY A;  5A90 A;  3HLD A;  3BM6 A;  4E6W A;  2J9P A;  4JF6 A;  2WGI A;  4MNR A;  3BFF A;  4OPZ A;  3ZGA B;  1PYY A;  2Y2G A;  5EEC A;  4JF5 A;  1KE4 A;  1PIO A;  1L0G A;  4EBL A;  4EWF A;  4DE1 A;  4GD6 A;  4GDN A;  1LI9 A;  5A92 A;  1J9M A;  3OZH A;  4UA9 A;  2DRW A;  4E3I A;  3O3V A;  3V3R A;  2WAE A;  3G35 A;  4O7D A;  1LLB A;  1E3U D;  5FAO A;  4N9L A;  2A49 A;  3UE1 A;  5E2H A;  1MWR A;  3BLM A;  1ERM A;  1GA0 A;  3UY6 A;  4JBF A;  2WYX A;  1WYC A;  3O87 A;  3BFC A;  2XQZ A;  4E3J A;  4NK3 A;  3UDF A;  4HEF A;  3ZFZ A;  4FH2 A;  4U0X A;  1IYP A;  4FD8 A;  2X02 A;  1H5X A;  3MKE A;  3N8R A;  4S2J A;  3HLW A;  5FI2 A;  1XA7 A;  4KZ3 A;  1TDL A;  5F82 A;  5CEC A;  5I94 A;  3ZVW A;  2EX8 A;  1IEL A;  5GHZ A;  1CK3 A;  4MBF A;  2WGV A;  5GL9 A;  2ZM0 A;  3NDG A;  4K0W A;  3IXH A;  3W4O A;  4OKP A;  1K38 A;  1YMS A;  2BLS A;  4WEJ A;  3IWI A;  4P85 A;  3EQV A;  4OON A;  1M40 A;  2ZQD A;  5JYO A;  4JXW A;  1NRF A;  1PZP A;  4ZTK A;  3GRJ A;  1GCE A;  4L0L A;  5G18 A;  2QMI A;  4U0T A;  1FQG A;  4U3T A;  4UA7 A;  3OCL A;  1ESU A;  3G34 A;  1LL5 A;  1Q2P A;  4S2N C;  4P87 A;  3ZNY A;  3FV7 A;  2E8I A;  4ZAM A;  5EOE A;  2WK0 A;  4PM5 A;  5CHM A;  4YIN A;  4LV2 A;  3CZD A;  4X56 A;  4BEN A;  1ZKJ A;  1SDE A;  3MBZ A;  1G6A A;  2Y2N A;  3NBL A;  1YLT A;  3SS4 A;  2A3U A;  4OVD A;  3VFF A;  3VP2 A;  3GMW A;  2IWD A;  3FKW A;  3SH9 A;  2H0T A;  1YLW A;  3ISG A;  2WAF A;  1XPB A;  3CMZ A;  3VP4 A;  1U60 A;  4R1G A;  4WEK A;  4LV3 A;  1K6S A;  4QHC A;  4GZB A;  3PBR A;  4OPQ A;  2EFU A;  3G32 A;  4KZ9 A;  2WAD A;  4MBK A;  4LCL A;  3HUM A;  5DVA A;  3QNB A;  2X71 A;  5TFQ A;  3V50 A;  2X01 A;  3FYZ A;  2Y2P A;  5KMW A;  1K55 C;  3D4F A;  1KE0 A;  5FAQ A;  2H10 A;  2HDQ A;  4Y0U A;  5EE8 A;  4C3Q A;  4KG6 A;  3IH8 A;  3ZCZ A;  1Q2Q A;  2Y2O A;  4QY5 A;  2WZZ A;  4X68 A;  4XUZ A;  1XGI A;  1MWT A;  5AQB A;  1YMX A;  4KG5 A;  3FZC A;  4QU3 A;  3E2K A;  4E6X A;  4IED A;  3IXG A;  3NDE A;  5HAQ A;  1ES2 A;  3PBN A;  2HDS A;  4OOM A;  5FA7 A;  4GKU A;  1MBL A;  3HL9 A;  1RGY A;  4JKT A;  3NY4 A;  1G68 A;  5CRF A;  2EXA A;  3IQA A;  4OPR A;  1NY0 A;  3MFD A;  2ZMA A;  3HLC A;  3LY3 A;  5GHY A;  3ZG8 B;  3MKF A;  3AGD A;  4OP5 A;  4X53 A;  1DJC A;  3HBR A;  3NI9 A;  1ESI A;  1L2S A;  2BG1 A;  5EVL A;  2XF3 A;  1NZO A;  1K57 C;  2ZLY A;  1W8Q A;  2XEP A;  3B3X A;  1LI0 A;  2XGN A;  3G4P A;  4IBR A;  5AQ7 A;  1K6R A;  2OLU A;  3AGF A;  2Y2M A;  5F83 A;  3G31 A;  1JWV A;  1ZC2 A;  1XX2 A;  2JBF A;  1RP5 A;  1DJB A;  1CEF A;  3BRM A;  4K0X A;  3SOI A;  3JYI A;  2PU4 A;  3Q1F A;  5FQQ A;  3FKV A;  1BLH A;  2XDM A;  5CEB A;  2OV5 A;  4DKI A;  1JTD A;  4LEN A;  4UHU A;  3ZG0 A;  3IXD A;  3LY4 A;  3A3I A;  4DF6 A;  4S2M A;  1HZO A;  4Y0O A;  5FAP A;  4WEL A;  5JYP A;  4KZ7 A;  3C4P A;  4DXC A;  4WMC D;  3G2Y A;  4DRT A;  3IHB A;  1O7E A;  4KQQ A;  3HLB A;  4Y7P A;  5HW3 A;  3HUO A;  5GLC A;  3P09 A;  1XGJ A;  2R9X A;  1SKF A;  1DJA A;  2J7V A;  4S2I A;  3VMA A;  2P9V B;  2WKI A;  3IHA A;  1W79 A;  2Q9N A;  3C5A A;  3UPN A;  4PM9 A;  5DF8 A;  3RXW A;  4R4S A;  5FQK A;  3SH7 A;  3N6I A;  4K91 A;  4OQ0 A;  4JLF A;  2OLV A;  5FQJ A;  5FQM A;  1IYQ A;  3IWQ A;  4FSF A;  4BLM A;  1AXB A;  1W7F A;  4ZDX A;  4E3N A;  1M6K A;  1PWC A;  4R3B A;  1KDW A;  4D2O A;  3BLS A;  3N8S A;  3ZNT A;  5EPH A;  3ITA A;  3LEZ A;  3N7W A;  4OQH A;  1N4O A;  3ZG5 A;  3PBQ A;  1JVJ A;  1QME A;  3PAG A;  1FSW A;  1SCW A;  1YLP A;  5CHJ A;  4JXG A;  2ZD8 A;  4RX2 A;  4QY6 A;  5J8X A;  1K55 A;  2ZQ9 A;  2C5W B;  3WS4 A;  2I72 A;  5CHU A;  5AQ9 A;  1LL9 A;  1IYS A;  2DNS A;  5EUA A;  5TGF A;  3IT9 A;  3Q7Z A;  2CC1 A;  4PMA A;  4R3J A;  1TEM A;  1PZO A;  3DW0 A;  2XR0 A;  2Y2L A;  3GR2 A;  1JTG A;  1O07 A;  2WZX A;  3GQZ A;  4B4Z A;  5FI7 A;  3W4P A;  1GHI A;  4PM6 A;  1HD8 A;  1ZG4 A;  3UNW A;  5KZH A;  4S2K A;  2ZJ9 A;  1RCJ A;  3Q82 A;  4GD8 A;  1GHP A;  2Y2H A;  2FFF B;  3BFG A;  3OPR A;  3OPP A;  1IEM A;  3AGE A;  5D3O A;  2ZC5 B;  1K25 A;  1KE3 A;  4GN2 A;  1W8Y A;  5DTS A;  3GTC A;  5EOO A;  4WBG A;  3A3D A;  1MWU A;  2OSU A;  1KGF A;  4NET A;  3UO9 A;  2V2F F;  3TSG A;  3WRT A;  1WE4 A;  2EX9 A;  2Y55 A;  3GSG A;  3IXB A;  1IKG A;  3BEC A;  1NJ4 A;  2WKH A;  1BTL A;  2XLN A;  5F1F A;  4N92 A;  4Z9Q A;  3IF6 B;  2EX2 A;  4BL3 A;  3Q7V B;  3UE3 A;  1BUE A;  1FR1 A;  3QHY A;  3V3S A;  4S2P A;  3HLE A;  3A3E A;  1ERQ A;  2ZQ8 A;  3RXX A;  4KZB A;  4WZ4 A;  3S4X A;  4WM9 A;  5FQI A;  3TG9 A;  2HDU A;  2DCF A;  2C6W B;  3IWO A;  2ZM2 A;  4GNU A;  4LCM A;  4PPR A;  4P6B A;  2J9O A;  3W4Q A;  3G2Z A;  4PM8 A;  1YM1 A;  5M1A A;  4RYE A;  3C7V A;  3SS3 A;  4GDB A;  4GB7 A;  1BT5 A;  4BL2 A;  1W5D A;  3WS0 A;  5HFO A;  2JE5 A;  2JCH A;  5A91 A;  1CEG A;  2Y2Q A;  4A5R A;  3CG5 A;  3W8K A;  4CPK A;  5CGX A;  1K4F A;  3NC8 A;  4OLG A;  1ONH A;  1PW1 A;  3DWZ A;  3OCN A;  3CJM A;  4BQM A;  3VSK A;  1H8Y A;  2Q9M A;  1ES3 A;  2HPB A;  1I5Q A;  4WZ5 C;  3UN7 A;  2HP9 A;  3VOZ A;  4BD1 A;  4Q8I A;  5M18 A;  3DWK A;  1NYM A;  4KQR A;  4OH0 A;  2Z2M B;  2Y2K A;  4YFM A;  3IF5 A;  5KSH A;  2QZ6 A;  3V5M A;  1K56 D;  4RX3 A;  4OLD A;  1ES4 A;  3BEB A;  2FFY A;  5FQ9 A;  2ZQA A;  4S2O A;  4OOY A;  4EV4 A;  4KZA A;  3UPP A;  1IYO A;  2XH9 A;  4X55 A;  4DE2 A;  5CGS A;  5GLB A;  4F94 A;  2WKE A;  1MXO A;  1YLJ A;  3Q81 A;  5DF9 A;  3RJU A;  4WYY A;  5E43 A;  3SH8 A;  3TOI A;  1SDN A;  4E3M A;  4E3L A;  4JF4 A;  5KSC A;  2P9V A;  3VP3 A;  4EBN A;  2B5R A;  3M6H A;  3MXS A;  4UAA A;  2ZC7 A;  1NXY A;  2WGW A;  1KGE A;  1MPL A;  3M2K A;  2J8Y A;  1E3U A;  2H0Y A;  3O86 A;  4JPM A;  4MEZ A;  4RVA A;  3V39 A;  1VQQ A;  4IBX A;  2ZQC A;  1CI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...