3PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
b'SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3palA00
3FIAA 1PRWA 2E6WA 3CTNA 4Q04A 3H4SE 1KFUL 2LP2A 1SCMB 2SASA 4OV2A 1UHKA 1K90D 1RECA 5CSJA 1SMGA 1L7ZA 1OE9B 3DVKA 1XFWO 1M39A 1LKJA 4GGNA 2HPSA 2Y5IA 3O78A 1IQ5A 3AAJA 2JOJA 5KU1A 1A75B 3AAKA 2F3YA 1S6JA 2AMIA 2KGBC 1AK8A 1WY9A 2L5XB 1K96A 3TZ1A 1JBAA 1WRLA 1WRZA 2AUCA 1PSRA 2B1UA 2D8NA 2LHLA 4JWQA 2JNXA 1S36A 2JULA 2JXCA 1UWOA 1MR8A 2BE4A 3DVMA 1K9KA 3NXAA 4A4CA 2IS9A 3LLEA 2GGZA 4IL1A 1LXFC 4YGBB 3WHTB 1D1OA 4F0ZB 1SK6D 3DF0B 1QVIY 1KK8B 1H4BA 2KYFA 3SIBA 4CPVA 4GNKB 1BMOA 1KFXL 1QIVA 1ZACA 4GGFA 1B47A 1AVSA 3GOFA 2JC2A 5I8NA 5DKQA 3I5GB 4MRYA 2WCEA 4PE7A 4QJ3B 1F71A 3BUXB 1M63B 5DKNA 1QJTA 3SG2A 2K2FA 4GBAA 1DJGA 1PALA 2HETA 2I2RE 2M9GA 3BQ3A 1IQ3A 1ALWA 3DF0A 1QVIZ 4XYNA 2G9BA 1G4YR 1KK7Y 4OKHA 1QLKA 1QX2A 1TN4A 1YVLA 2EC6C 2F3ZA 2KGRA 4YGDB 1LVCD 1CLBA 3DVEA 1CMFA 4MEWA 4NDBA 3PN7B 2OS8C 1CB1A 1B4CA 2M7NA 3FS7A 3F45A 3HCMA 3OX5A 1FBVA 1HT9A 3I5IC 4CLNA 2I18A 1KFUS 1Y0VH 1DJYA 2MAZA 2LVVA 1FW4A 2HF5A 2AAOA 3BOWB 3EVUA 3CLNA 2WORA 2JTTA 1XFUO 1XA5A 2JT0A 1IRJA 4WRIA 4JPZB 1KK7Z 1QV0A 4PHKA 3NSIA 5KTYA 1NX3A 5JJGA 1OMDA 3TDIA 3TDUA 1YTZC 1RK9A 5D69A 1DMOA 1AP4A 1K2HA 3BUWB 2H61A 3TS5B 1CMGA 1C7WA 1GJYA 5I2OA 2PSRA 4N1FA 1EXRA 1PK0D 1K93D 3BOWA 3KPXA 1OZSA 1BR4B 1SR6B 2KAXA 1J55A 2O5GA 4GFTA 3TUYB 1IH0A 2JTZA 3JTDC 1N0YA 3MSEB 1ODBA 2CBLA 1A4PA 1EL4A 2H2KA 3JVTB 1TNPA 1V1FA 1YUSA 2JU0A 3PFVA 1NSHA 3WXAA 1J1EA 2CT9A 1SCVA 3D0YB 2NCOA 4WQ3A 3NSLA 5ER5A 4FTGA 3LK1A 3PM8A 3EK4A 2LUCA 1S26D 3OX6A 2PMYA 1NX2A 3FWBA 2ZN8A 4MZKA 1KCYA 3DD4A 3K21A 1RWYA 1M45A 2K2AA 2PRUA 2GV5A 3OHMB 4CIDA 1YX8A 3TDZA 1KQMC 3WNXB 2CNPA 3A4UB 5KSZA 1OOJA 4YI9A 3D0YA 1JFKA 3CWGA 1DVIA 2KQYA 2LVJA 2NXQA 2OPOA 2NZ0A 1B1GA 1B8CA 4YRUA 3LL8B 1DGVA 1LA0A 1SNLA 1KK8C 1ZMZA 3E3RA 3VROA 1L2OB 3C1VA 5PALA 4C0KA 1S1EA 4GUKA 2LMUA 5GQQC 1F54A 2HQ8A 2ISDA 1YR5A 4JQ0D 3NSKA 2RGIA 2FCDA 1XFXO 2FJUB 4U8DA 3VGOA 2PASA 3ZNIA 1BJFA 2KBMA 2MBXA 1A03A 2M0RA 2BL0C 1LA3A 4QJ4B 2ZNEA 1CFCA 3I5FC 5ER4X 2KAYA 1CFPA 1XK4C 3VRNA 1CFFA 3WHUB 2I94A 1GQMA 2FCEA 3PN7C 4ZCUA 2F2PA 2PVBA 4PE1A 5CSNA 2BCAA 1J7OA 1MXEA 5I2LA 2KI4C 4ZCVA 1J7RA 5JOLA 2LV7A 2MLEC 2OTGC 1F8HA 1NX1A 4ETOA 1TTXA 4OR9B 1NUBA 1OMRA 1V1GA 1PSBA 4AQIA 2L4HA 2LAPA 4MRXA 2M29A 5K89A 1TCOB 2BBMA 5BPJA 1XFVO 1W7JB 1CLMA 4HRGA 4UPGA 4PDZA 1TCFA 1FPWA 3SG4A 2LUXA 1KWOC 2KHNA 4YBHB 1M46A 4YGCB 2LHIA 3SG5A 2LC5A 4QJ5B 1G8IA 2KFFA 1AJ4A 2LNKA 1A2XA 1NP8A 2R2IA 1QS7A 4CFQA 1CFDA 1NCZA 1OZOA 2A4JA 1UP5A 2L51A 4OCIA 1F4QA 3GK1A 3GK2A 4P2YB 2L2EA 3IF7A 1DJHA 4N1GA 4PHJA 1CTRA 2Q91A 1J7QA 5HYDA 1K9UA 5TNCA 1TNQA 3EK8A 4M2QA 2JT3A 3EVRA 2ZNDA 2WNDA 4DCKA 1RTP1 3A8RA 4DUQA 2Y4QA 1QX7A 1JUOA 3GK4X 2BCXA 1IGVA 4PE4A 2M1KB 3EKHA 3I5HC 2EGDA 2K61A 2KAVA 3O2PA 1KSMA 2TN4A 2KFHA 1WDCC 1YUUA 2QPTA 1N65A 5CPVA 4ORAB 3CR2A 1DJXA 5HLOA 1JF2A 1QX5B 4GAOA 1QASA 5B8IB 1UURA 2QACA 1MHOA 1NCXA 1SCMC 1UUSA 4OVNF 3VRPA 5HKWA 1F4OA 1JFJA 1SY9A 2M7LA 1E8AA 2JQ6A 3D10A 2WC8A 4TNCA 3LCPC 2EC6B 5CSFA 2FOTA 1X02A 1U5IA 4HRHA 2F33A 1S3PA 1CDPA 4BY5A 1QLSA 1S5GY 2OS8B 5J3XA 1WLZA 4PHNA 3I5IB 5I2QA 2JZIA 4HSZA 4M2PA 1EG3A 1ZUZA 4GGFC 3EK7A 2WCBA 4I5LB 2GGMA 2LMVA 3BXKA 3BYAA 2JNFA 1Y6WA 1MQ1A 2HQWA 2K7DA 2VRGA 3ZWHA 2ZRTA 1RJVA 2LLTA 2M97A 1A29A 1EH2A 1LINA 1B8LA 1S5GZ 3IQQA 5FYXA 3LK0A 4PE0A 4YGEB 1PULA 3KO0A 3SIAA 4PCWA 1KQVA 4P5OE 1OMVA 2F8PA 3SG3A 3NSOA 1BF5A 3QRXA 1BT6A 3I5GC 1C7VA 2COLB 3PALA 2NCPA 1MWNA 1MXLC 1CDLA 1DJZA 4GPLB 4MN0A 3JTDB 2NLNA 5AEQA 2M3WA 2O60A 1YVHA 4N5XA 4MZLA 1YUTA 5AFPA 2JT8A 1C07A 1W7IB 1S6IA 1DF0A 2L4IA 3CR4X 5HKYA 1ALVA 3EVVA 1J7PA 2KFGA 1YRTB 1K94A 1OSAA 4ORBB 1BODA 1F55A 2G2BA 1JWDA 2JRFA 2KI6D 1IJ5A 2L98A 4MVFA 1NCYA 1NPQA 4I5JA 3SJSA 3PATA 1SRAA 1MF8B 4YGAA 2WCFA 2CCMA 4FQOA 2F2OA 1FI5A 4MBEA 1AHRA 4ORCB 2M1UA 1CDNA 4R1EA 2H61C 3CS1A 1SKTA 1YX7A 1SL9A 4I5KA 1WRKA 3O4YA 3VRRA 4BY4A 3OB1B 2M8UA 1PVBA 1KQMB 2DOQA 1BOCA 5IBWA 1SYMA 2LCPA 2KBIA 1S6CA 4HREE 1IKUA 2WOSA 4AQJA 1OQPA 5CSIA 2CTNA 1R2UA 1TNXA 2JXLA 2LP3A 4DS7A 2MRDA 5G08A 3PLFB 4MSPA 1JF0A 4L9MA 1A75A 2MJWB 3TS5C 2CXJA 1EJ3A 1ZOTB 2K0JA 2LM5A 5AXIA 1K9PA 2ZFDA 2KOTA 4WQ2A 1MUXA 1BU3A 2L50A 3SG6A 1Y1XA 1XVJA 2KI6C 2BKHB 2ZRSA 1SR6C 3TUYC 2LVKA 1QXPA 2LE9B 3CZTX 2MA2A 1N2DA 1QIWA 2JWWA 4D1EA 1WLMA 2Q4UA 2I7AA 3RLZA 2Y1MA 3AKBA 1PVAA 2BCBA 2BL0B 1BG1A 1Y1AA 4ICBA 3JVTC 1NYAA 1SL8A 1K8UA 1B8RA 3I5FB 1JC2A 3KEVA 4MLWA 3CR5X 1BR1B 3M0WA 5D7FA 2LANA 4XJKB 2K7CA 3AKAA 2K7BA 1TIZA 1CM4A 1IJ6A 1CKKA 5AANA 5HKZA 5F6TA 4NDCA 1QV1A 4NQGA 1UHJA 1HQVA 1NX0A 1U5IB 2KI4B 2LLSA 1CLLA 4YI8A 1AJ5A 2BBNA 4DIRA 2OTGB 2M49B 1CDMA 1IG5A 2KNEA 2E30A 1R6PA 2ZN9A 4A4BA 1RROA 1KSOA 1XK4A 2V53A 1DJWA 1Q80A 3RM1A 1YURA 4XJKA 1BLQA 1CNPA 1JSAA 3FWCA 1RFJA 4MZJA 3O6BA 1FI6A 3KHEA 3SG7A 1TOPA 2BKIB 2MHHA 1KWOB 3IQOA 1B9AA 1L2OC 2MLFC 4C0JA 1NIWA 2K7OA 3EKJA 3HX4A 2LMTA 1YRUB 3ICBA 2KQ6A 1DJIA 1QTXA 1EG4A 5HLVA 1B7TY 1SBJA 1XFYO 4E68A 1FF1A 1CM1A 4USLA 1SPYA 1XYDA 1ZFSA 1DT7B 1UHIA 2PALA 1UHNA 1NWDA 2BE6A 1XFZO 3BUMB 2LLUA 2KYCA 4DRWA 1SL7A 1KFXS 2BECA 1J1DA 3DVJA 1QATA 1F70A 2LVIA 1VRKA 3BUNB 3KF9A 2P6BB 1TRFA 1DF0B 3OB2B 4C0LA 1XO5A 4CFRA 2L0PA 1TNWA 1AUIB 2ZKMX 3CGAA 3VRQA 2KSPA 2KDHA 5AERA 1M31A 1B7TZ 1K95A 4PHMA 1GGWA 2Y1NA 3PSRA 1Y1UA 3I5HB 4I5NB 4PALA 1H8BA 3OP0A 1DGUA 1SW8A 1G33A 2EHBA 1GGZA 4AOMA 4M2OA 1WDCB 2SCPA 1UHHA 2K8MB 1IWQA 3BUOB 4NDDA 1DTLA 5DKRA 2JPTA
chains in the Genus database with same CATH superfamily
2WCKA 1PRWA 2E6WA 3FIAA 3CTNA 4Q04A 3H4SE 1KFUL 2LP2A 1SCMB 2SASA 2QEBA 4OV2A 1UHKA 1K90D 1RECA 2KLEA 4IJ7A 5CSJA 1SMGA 1L7ZA 3S0AA 1OE9B 3DVKA 1XFWO 2FJYA 1M39A 1LKJA 4GGNA 2HPSA 2Y5IA 3O78A 1IQ5A 3AAJA 2JOJA 5KU1A 1A75B 3AAKA 2F3YA 4OZDA 1S6JA 4KYNA 5FI7A 2AMIA 2KGBC 3L4LA 1AK8A 1WY9A 2L5XB 1K96A 3TZ1A 1JBAA 1WRLA 1WRZA 2AUCA 1PSRA 2B1UA 1OOHA 2D8NA 2LHLA 4JWQA 2JNXA 1S36A 2JULA 2JXCA 1UWOA 1MR8A 2BE4A 3DVMA 1K9KA 3NXAA 4A4CA 1DELA 2IS9A 3LLEA 2GGZA 4IL1A 1LXFC 4YGBB 3WHTB 1D1OA 4F0ZB 1SK6D 3DF0B 1QVIY 1KK8B 1H4BA 2KYFA 3SIBA 4CPVA 4GNKB 1BMOA 1KFXL 1QIVA 1ZACA 4GGFA 1B47A 1AVSA 3GOFA 2JC2A 5I8NA 5DKQA 3I5GB 4MRYA 2WCEA 4PE7A 4QJ3B 2WCHA 1F71A 3BUXB 1M63B 5DKNA 1QJTA 3SG2A 1ORGA 2K2FA 5FI2A 4GBAA 1DJGA 1PALA 2HETA 2I2RE 2M9GA 2WCJA 3BQ3A 1IQ3A 1ALWA 3DY9A 3DF0A 1QVIZ 4XYNA 3VB1A 2G9BA 1G4YR 1KK7Y 3L4AA 4OKHA 1QLKA 3O4XA 1QX2A 1TN4A 1YVLA 2EC6C 2F3ZA 2KGRA 4YGDB 1LVCD 1CLBA 3DVEA 1CMFA 4MEWA 4NDBA 3PN7B 3S0GA 2OS8C 1CB1A 1B4CA 2M7NA 3FS7A 3F45A 3HCMA 3OX5A 1FBVA 1HT9A 3I5IC 4CLNA 1IIOA 2I18A 1KFUS 1Y0VH 1DJYA 1C3ZA 2LVVA 2MAZA 1FW4A 2HF5A 2AAOA 3BOWB 3EVUA 5EL2A 3CLNA 2P70A 2WORA 2JTTA 1XFUO 1XA5A 2L2CA 1GM0A 2JT0A 1IRJA 4WRIA 4JPZB 1KK7Z 1QV0A 4PHKA 3NSIA 5KTYA 1NX3A 5JJGA 1OMDA 3TDIA 3TDUA 1YTZC 1RK9A 5D69A 1DMOA 1AP4A 1K2HA 3BUWB 2H61A 3TS5B 1CMGA 1C7WA 1GJYA 1LS8A 5I2OA 2PSRA 4N1FA 1EXRA 1PK0D 1K93D 3BOWA 3KPXA 4JKTA 1OZSA 1BR4B 3V2LA 1SR6B 2KAXA 1J55A 2O5GA 4GFTA 3TUYB 1IH0A 2JTZA 3JTDC 1DC1A 1N0YA 3MSEB 1OOIX 1ODBA 2CBLA 1A4PA 1EL4A 2H2KA 3JVTB 1TNPA 1W9ZA 1V1FA 1YUSA 2JU0A 3PFVA 1NSHA 3WXAA 1J1EA 2CT9A 1SCVA 3D0YB 2NCOA 4WQ3A 3NSLA 2QEVA 3CABA 5ER5A 4FTGA 3SS5A 3LK1A 3PM8A 3S0DA 3EK4A 2LUCA 1S26D 3OX6A 2PMYA 1NX2A 3FWBA 2ZN8A 4MZKA 1KCYA 3DD4A 3K21A 1RWYA 1M45A 2K2AA 2PRUA 2GV5A 3OHMB 4CIDA 3S0EA 3L47A 1YX8A 3OGNA 3TDZA 3BFBA 1KQMC 3WNXB 2CNPA 3A4UB 5KSZA 4PT1A 1OOJA 4YI9A 3D0YA 1JFKA 3CWGA 1DVIA 2KQYA 2LVJA 2NXQA 2OPOA 2NZ0A 1B1GA 1B8CA 4INXA 4YRUA 3LL8B 3S0BA 3B86A 3FE9A 4FQTA 1DGVA 1LA0A 1SNLA 1KK8C 1ZMZA 3E3RA 3VROA 1L2OB 3C1VA 5PALA 4C0KA 1S1EA 4GUKA 2LMUA 5GQQC 1F54A 2HQ8A 2ISDA 1YR5A 4JQ0D 2GTEA 3NSKA 2RGIA 3S0FA 2FCDA 3D73A 1XFXO 2FJUB 4U8DA 3VGOA 2PASA 3ZNIA 1BJFA 2KBMA 2MBXA 1A03A 2M0RA 2BL0C 1LA3A 5FI6A 4QJ4B 2ZNEA 5DICA 1CFCA 3I5FC 2QEOA 5ER4X 2KAYA 3IVTA 2BAPA 1CFPA 1XK4C 3VRNA 1CFFA 2KLDA 3WHUB 2I94A 1GQMA 2FCEA 3PN7C 4ZCUA 2F2PA 2PVBA 4PE1A 5CSNA 2BCAA 1J7OA 1OOFA 1MXEA 2WC6A 5I2LA 2KI4C 4ZCVA 1SSEB 1J7RA 2PQLA 4JD9A 5JOLA 2LV7A 2MLEC 2OTGC 1F8HA 1NX1A 3BJHA 4ETOA 1TTXA 4OR9B 1NUBA 1OMRA 1V1GA 5HL1A 1PSBA 3NHIA 4AQIA 2L4HA 2LAPA 4MRXA 2M29A 5K89A 1TCOB 2BBMA 5BPJA 1XFVO 1W7JB 1CLMA 4HRGA 4UPGA 4PDZA 1TCFA 1FPWA 3SG4A 2LUXA 1KWOC 2KHNA 4YBHB 1M46A 4YGCB 2LHIA 3SG5A 2LC5A 4QJ5B 1G8IA 2KFFA 1AJ4A 3B6XA 2LNKA 1A2XA 1NP8A 2R2IA 1QS7A 4CFQA 1CFDA 1NCZA 1OZOA 2A4JA 1UP5A 2L51A 4OCIA 1F4QA 3BFAA 3GK1A 3GK2A 3NHTA 1C3YA 4P2YB 2L2EA 3IF7A 1DJHA 4N1GA 4PHJA 1CTRA 2Q91A 1J7QA 5HYDA 1K9UA 5TNCA 2L5YA 1TNQA 3EK8A 4M2QA 2JT3A 3EVRA 5HKYA 2ZNDA 2JPOA 2WNDA 4DCKA 1RTP1 3A8RA 3DYEA 4DUQA 2Y4QA 1QX7A 1JUOA 3GK4X 2BCXA 1IGVA 4PE4A 2M1KB 3EKHA 3I5HC 2EGDA 2K61A 2KAVA 3O2PA 1KSMA 2TN4A 2KFHA 1WDCC 1YUUA 2PYQA 2QPTA 1N65A 5CPVA 4ORAB 2K60A 3CR2A 3D78A 3EG5B 1DJXA 5HLOA 1JF2A 1QX5B 4GAOA 1QASA 5B8IB 1UURA 2QACA 5I94A 1MHOA 1NCXA 1SCMC 1UUSA 2YGUA 4OVNF 3VRPA 5HKWA 1F4OA 1XFRA 5D3OA 1JFJA 1SY9A 2M7LA 1E8AA 2JQ6A 3D10A 2WC8A 4TNCA 3LCPC 2EC6B 5CSFA 2FOTA 3B88A 1X02A 1U5IA 4HRHA 2F33A 1S3PA 1CDPA 4BY5A 1QLSA 1S5GY 2OS8B 5J3XA 1WLZA 4PHNA 3I5IB 5I2QA 2JZIA 4HSZA 4M2PA 1EG3A 1ZUZA 4GGFC 3EK7A 2WCBA 3CZ0A 4I5LB 2GGMA 2LMVA 3BXKA 3BYAA 2JNFA 1Y6WA 1MQ1A 2HQWA 2K7DA 2VRGA 3ZWHA 2ZRTA 1RJVA 2LLTA 2M97A 1A29A 3R72A 1EH2A 1LINA 1B8LA 1S5GZ 3IQQA 5FYXA 3UO9A 3LK0A 1QWVA 2ERBA 4PE0A 1PULA 4YGEB 3KO0A 1DEKA 3SIAA 4PCWA 1KQVA 4P5OE 1OMVA 2F8PA 3SG3A 3NSOA 1BF5A 3QRXA 3CDNA 1BT6A 3CYZA 3I5GC 2COLB 1C7VA 3PALA 2NCPA 1MWNA 1MXLC 2H8VA 1CDLA 1DJZA 4GPLB 4MN0A 3JTDB 2NLNA 5AEQA 2M3WA 2O60A 1YVHA 2KPHA 4MZLA 1YUTA 4N5XA 5AFPA 2JT8A 3SS4A 1C07A 1W7IB 1S6IA 1DF0A 2L4IA 3CR4X 3Q8IA 1ALVA 1TUZA 3EVVA 1TWOA 2KFGA 1YRTB 1K94A 1OSAA 2QDIA 4ORBB 1BODA 2G2BA 1F55A 1JWDA 2JRFA 2KI6D 1IJ5A 2L98A 4MVFA 1NCYA 1NPQA 3NGVA 4I5JA 3SJSA 3PATA 1SRAA 1MF8B 4YGAA 2WCFA 2CCMA 3D77A 4FQOA 2F2OA 3OBVA 3PM2A 1FI5A 4MBEA 1AHRA 1Z4HA 4ORCB 2M1UA 1CDNA 4R1EA 2H61C 3CS1A 3D74A 3D76A 1SKTA 1YX7A 1SL9A 3B7AA 1WRKA 3CZ2A 3O4YA 4I5KA 3DZTA 3VRRA 4BY4A 3OB1B 2M8UA 1PVBA 1KQMB 2DOQA 1BOCA 5IBWA 1SYMA 2LCPA 2QEHA 1T14A 2KBIA 1S6CA 4HREE 1IKUA 2WOSA 4AQJA 1OQPA 5CSIA 2CTNA 1J7PA 1R2UA 1TNXA 2JXLA 2LP3A 3D75A 2MRDA 4DS7A 3BFHA 5G08A 3PLFB 4MSPA 1JF0A 1TUJA 1A75A 2MJWB 4L9MA 3TS5C 4F7FA 2CXJA 1EJ3A 1ZOTB 2K0JA 2LM5A 5AXIA 1K9PA 2ZFDA 2KOTA 3CZ1A 4WQ2A 1MUXA 1BU3A 3UNWA 2L50A 3SG6A 1Y1XA 1XVJA 2KI6C 2BKHB 2ZRSA 1SR6C 3TUYC 2LVKA 1QXPA 2LE9B 3CZTX 2MA2A 1N2DA 1QIWA 2JWWA 4D1EA 1WLMA 2Q4UA 2I7AA 3R1OA 3RLZA 3N7HA 2Y1MA 3AKBA 1PVAA 2BCBA 2BL0B 1BG1A 1Y1AA 4ICBA 3JVTC 1NYAA 1SL8A 1K8UA 1B8RA 3I5FB 1JC2A 3KEVA 4MLWA 3CR5X 1BR1B 3M0WA 5D7FA 1OOGA 2LANA 4XJKB 2K7CA 3AKAA 2K7BA 2WCMA 1TIZA 1CM4A 1IJ6A 1CKKA 5AANA 5HKZA 5F6TA 4NDCA 1QV1A 4NQGA 1UHJA 1HQVA 2WCLA 1NX0A 1U5IB 2KI4B 3R1VA 2LLSA 2BNXA 1CLLA 4YI8A 1AJ5A 2BBNA 4DIRA 2OTGB 2M49B 4INWA 1CDMA 1IG5A 2KNEA 2E30A 1R6PA 2ZN9A 3QMEA 4A4BA 1RROA 1KSOA 1XK4A 2V53A 1DJWA 1DQEA 1Q80A 3RM1A 1YURA 4XJKA 1BLQA 1CNPA 1JSAA 3FWCA 1RFJA 4MZJA 3O6BA 1FI6A 3KHEA 3SG7A 1TOPA 3FE8A 2BKIB 2MHHA 1KWOB 3IQOA 1B9AA 1L2OC 2MLFC 4C0JA 1NIWA 2K7OA 3EKJA 3HX4A 3SS3A 2LMTA 1YRUB 3ICBA 2KQ6A 1DJIA 1QTXA 1EG4A 5HLVA 1B7TY 1SBJA 1XFYO 4E68A 1FF1A 1CM1A 4USLA 1SPYA 1XYDA 3FE6A 3RZSA 1ZFSA 1DT7B 1UHIA 2PALA 3PJIA 1UHNA 1Z2CB 3DXLA 1NWDA 2BE6A 1XFZO 3BUMB 2LLUA 2KYCA 4DRWA 1SL7A 1KFXS 2BECA 1J1DA 3DVJA 1QATA 1F70A 2LVIA 1VRKA 3BUNB 3KF9A 2P6BB 1TRFA 1DF0B 3OB2B 4C0LA 1XO5A 4CFRA 2L0PA 1TNWA 2WC5A 1AUIB 2ZKMX 3CGAA 3VRQA 2KSPA 2KDHA 5AERA 3K1EA 1M31A 1B7TZ 1K95A 3R1PA 4PHMA 1GGWA 2Y1NA 3PSRA 1Y1UA 3B87A 3I5HB 4I5NB 4PALA 1H8BA 3OP0A 1DGUA 1SW8A 1G33A 2EHBA 1GGZA 1P28A 2P71A 4AOMA 4M2OA 1WDCB 1OW4A 2SCPA 1UHHA 2K8MB 1IWQA 3BUOB 4NDDA 1DTLA 5DKRA 2JPTA
chains in the Genus database with same CATH topology
3FIAA 1PRWA 2E6WA 3CTNA 4Q04A 3H4SE 1KFUL 2LP2A 1SCMB 2SASA 4OV2A 1UHKA 1K90D 1RECA 5CSJA 1SMGA 1L7ZA 1OE9B 3DVKA 1XFWO 1M39A 1LKJA 4GGNA 2HPSA 2Y5IA 3O78A 1IQ5A 3AAJA 2JOJA 5KU1A 1A75B 3AAKA 2F3YA 1S6JA 2AMIA 2KGBC 1AK8A 1WY9A 2L5XB 1K96A 3TZ1A 1JBAA 1WRLA 1WRZA 2AUCA 1PSRA 2B1UA 2D8NA 2LHLA 4JWQA 2JNXA 1S36A 2JULA 2JXCA 1UWOA 1MR8A 2BE4A 3DVMA 1K9KA 3NXAA 4A4CA 2IS9A 3LLEA 2GGZA 4IL1A 1LXFC 4YGBB 3WHTB 1D1OA 4F0ZB 1SK6D 3DF0B 1QVIY 1KK8B 1H4BA 2KYFA 3SIBA 4CPVA 4GNKB 1BMOA 1KFXL 1QIVA 1ZACA 4GGFA 1B47A 1AVSA 3GOFA 2JC2A 5I8NA 5DKQA 3I5GB 4MRYA 2WCEA 4PE7A 4QJ3B 1F71A 3BUXB 1M63B 5DKNA 1QJTA 3SG2A 2K2FA 4GBAA 1DJGA 1PALA 2HETA 2I2RE 2M9GA 3BQ3A 1IQ3A 1ALWA 3DF0A 1QVIZ 4XYNA 2G9BA 1G4YR 1KK7Y 4OKHA 1QLKA 1QX2A 1TN4A 1YVLA 2EC6C 2F3ZA 2KGRA 4YGDB 1LVCD 1CLBA 3DVEA 1CMFA 4MEWA 4NDBA 3PN7B 2OS8C 1CB1A 1B4CA 2M7NA 3FS7A 3F45A 3HCMA 3OX5A 1FBVA 1HT9A 3I5IC 4CLNA 2I18A 1KFUS 1Y0VH 1DJYA 2MAZA 2LVVA 1FW4A 2HF5A 2AAOA 3BOWB 3EVUA 3CLNA 2WORA 2JTTA 1XFUO 1XA5A 2JT0A 1IRJA 4WRIA 4JPZB 1KK7Z 1QV0A 4PHKA 3NSIA 5KTYA 1NX3A 5JJGA 1OMDA 3TDIA 3TDUA 1YTZC 1RK9A 5D69A 1DMOA 1AP4A 1K2HA 3BUWB 2H61A 3TS5B 1CMGA 1C7WA 1GJYA 5I2OA 2PSRA 4N1FA 1EXRA 1PK0D 1K93D 3BOWA 3KPXA 1OZSA 1BR4B 1SR6B 2KAXA 1J55A 2O5GA 4GFTA 3TUYB 1IH0A 2JTZA 3JTDC 1N0YA 3MSEB 1ODBA 2CBLA 1A4PA 1EL4A 2H2KA 3JVTB 1TNPA 1V1FA 1YUSA 2JU0A 3PFVA 1NSHA 3WXAA 1J1EA 2CT9A 1SCVA 3D0YB 2NCOA 4WQ3A 3NSLA 5ER5A 4FTGA 3LK1A 3PM8A 3EK4A 2LUCA 1S26D 3OX6A 2PMYA 1NX2A 3FWBA 2ZN8A 4MZKA 1KCYA 3DD4A 3K21A 1RWYA 1M45A 2K2AA 2PRUA 2GV5A 3OHMB 4CIDA 1YX8A 3TDZA 1KQMC 3WNXB 2CNPA 3A4UB 5KSZA 1OOJA 4YI9A 3D0YA 1JFKA 3CWGA 1DVIA 2KQYA 2LVJA 2NXQA 2OPOA 2NZ0A 1B1GA 1B8CA 4YRUA 3LL8B 1DGVA 1LA0A 1SNLA 1KK8C 1ZMZA 3E3RA 3VROA 1L2OB 3C1VA 5PALA 4C0KA 1S1EA 4GUKA 2LMUA 5GQQC 1F54A 2HQ8A 2ISDA 1YR5A 4JQ0D 3NSKA 2RGIA 2FCDA 1XFXO 2FJUB 4U8DA 3VGOA 2PASA 3ZNIA 1BJFA 2KBMA 2MBXA 1A03A 2M0RA 2BL0C 1LA3A 4QJ4B 2ZNEA 1CFCA 3I5FC 5ER4X 2KAYA 1CFPA 1XK4C 3VRNA 1CFFA 3WHUB 2I94A 1GQMA 2FCEA 3PN7C 4ZCUA 2F2PA 2PVBA 4PE1A 5CSNA 2BCAA 1J7OA 1MXEA 5I2LA 2KI4C 4ZCVA 1J7RA 5JOLA 2LV7A 2MLEC 2OTGC 1F8HA 1NX1A 4ETOA 1TTXA 4OR9B 1NUBA 1OMRA 1V1GA 1PSBA 4AQIA 2L4HA 2LAPA 4MRXA 2M29A 5K89A 1TCOB 2BBMA 5BPJA 1XFVO 1W7JB 1CLMA 4HRGA 4UPGA 4PDZA 1TCFA 1FPWA 3SG4A 2LUXA 1KWOC 2KHNA 4YBHB 1M46A 4YGCB 2LHIA 3SG5A 2LC5A 4QJ5B 1G8IA 2KFFA 1AJ4A 2LNKA 1A2XA 1NP8A 2R2IA 1QS7A 4CFQA 1CFDA 1NCZA 1OZOA 2A4JA 1UP5A 2L51A 4OCIA 1F4QA 3GK1A 3GK2A 4P2YB 2L2EA 3IF7A 1DJHA 4N1GA 4PHJA 1CTRA 2Q91A 1J7QA 5HYDA 1K9UA 5TNCA 1TNQA 3EK8A 4M2QA 2JT3A 3EVRA 2ZNDA 2WNDA 4DCKA 1RTP1 3A8RA 4DUQA 2Y4QA 1QX7A 1JUOA 3GK4X 2BCXA 1IGVA 4PE4A 2M1KB 3EKHA 3I5HC 2EGDA 2K61A 2KAVA 3O2PA 1KSMA 2TN4A 2KFHA 1WDCC 1YUUA 2QPTA 1N65A 5CPVA 4ORAB 3CR2A 1DJXA 5HLOA 1JF2A 1QX5B 4GAOA 1QASA 5B8IB 1UURA 2QACA 1MHOA 1NCXA 1SCMC 1UUSA 4OVNF 3VRPA 5HKWA 1F4OA 1JFJA 1SY9A 2M7LA 1E8AA 2JQ6A 3D10A 2WC8A 4TNCA 3LCPC 2EC6B 5CSFA 2FOTA 1X02A 1U5IA 4HRHA 2F33A 1S3PA 1CDPA 4BY5A 1QLSA 1S5GY 2OS8B 5J3XA 1WLZA 4PHNA 3I5IB 5I2QA 2JZIA 4HSZA 4M2PA 1EG3A 1ZUZA 4GGFC 3EK7A 2WCBA 4I5LB 2GGMA 2LMVA 3BXKA 3BYAA 2JNFA 1Y6WA 1MQ1A 2HQWA 2K7DA 2VRGA 3ZWHA 2ZRTA 1RJVA 2LLTA 2M97A 1A29A 1EH2A 1LINA 1B8LA 1S5GZ 3IQQA 5FYXA 3LK0A 4PE0A 4YGEB 1PULA 3KO0A 3SIAA 4PCWA 1KQVA 4P5OE 1OMVA 2F8PA 3SG3A 3NSOA 1BF5A 3QRXA 1BT6A 3I5GC 1C7VA 2COLB 3PALA 2NCPA 1MWNA 1MXLC 1CDLA 1DJZA 4GPLB 4MN0A 3JTDB 2NLNA 5AEQA 2M3WA 2O60A 1YVHA 4N5XA 4MZLA 1YUTA 5AFPA 2JT8A 1C07A 1W7IB 1S6IA 1DF0A 2L4IA 3CR4X 5HKYA 1ALVA 3EVVA 1J7PA 2KFGA 1YRTB 1K94A 1OSAA 4ORBB 1BODA 1F55A 2G2BA 1JWDA 2JRFA 2KI6D 1IJ5A 2L98A 4MVFA 1NCYA 1NPQA 4I5JA 3SJSA 3PATA 1SRAA 1MF8B 4YGAA 2WCFA 2CCMA 4FQOA 2F2OA 1FI5A 4MBEA 1AHRA 4ORCB 2M1UA 1CDNA 4R1EA 2H61C 3CS1A 1SKTA 1YX7A 1SL9A 4I5KA 1WRKA 3O4YA 3VRRA 4BY4A 3OB1B 2M8UA 1PVBA 1KQMB 2DOQA 1BOCA 5IBWA 1SYMA 2LCPA 2KBIA 1S6CA 4HREE 1IKUA 2WOSA 4AQJA 1OQPA 5CSIA 2CTNA 1R2UA 1TNXA 2JXLA 2LP3A 4DS7A 2MRDA 5G08A 3PLFB 4MSPA 1JF0A 4L9MA 1A75A 2MJWB 3TS5C 2CXJA 1EJ3A 1ZOTB 2K0JA 2LM5A 5AXIA 1K9PA 2ZFDA 2KOTA 4WQ2A 1MUXA 1BU3A 2L50A 3SG6A 1Y1XA 1XVJA 2KI6C 2BKHB 2ZRSA 1SR6C 3TUYC 2LVKA 1QXPA 2LE9B 3CZTX 2MA2A 1N2DA 1QIWA 2JWWA 4D1EA 1WLMA 2Q4UA 2I7AA 3RLZA 2Y1MA 3AKBA 1PVAA 2BCBA 2BL0B 1BG1A 1Y1AA 4ICBA 3JVTC 1NYAA 1SL8A 1K8UA 1B8RA 3I5FB 1JC2A 3KEVA 4MLWA 3CR5X 1BR1B 3M0WA 5D7FA 2LANA 4XJKB 2K7CA 3AKAA 2K7BA 1TIZA 1CM4A 1IJ6A 1CKKA 5AANA 5HKZA 5F6TA 4NDCA 1QV1A 4NQGA 1UHJA 1HQVA 1NX0A 1U5IB 2KI4B 2LLSA 1CLLA 4YI8A 1AJ5A 2BBNA 4DIRA 2OTGB 2M49B 1CDMA 1IG5A 2KNEA 2E30A 1R6PA 2ZN9A 4A4BA 1RROA 1KSOA 1XK4A 2V53A 1DJWA 1Q80A 3RM1A 1YURA 4XJKA 1BLQA 1CNPA 1JSAA 3FWCA 1RFJA 4MZJA 3O6BA 1FI6A 3KHEA 3SG7A 1TOPA 2BKIB 2MHHA 1KWOB 3IQOA 1B9AA 1L2OC 2MLFC 4C0JA 1NIWA 2K7OA 3EKJA 3HX4A 2LMTA 1YRUB 3ICBA 2KQ6A 1DJIA 1QTXA 1EG4A 5HLVA 1B7TY 1SBJA 1XFYO 4E68A 1FF1A 1CM1A 4USLA 1SPYA 1XYDA 1ZFSA 1DT7B 1UHIA 2PALA 1UHNA 1NWDA 2BE6A 1XFZO 3BUMB 2LLUA 2KYCA 4DRWA 1SL7A 1KFXS 2BECA 1J1DA 3DVJA 1QATA 1F70A 2LVIA 1VRKA 3BUNB 3KF9A 2P6BB 1TRFA 1DF0B 3OB2B 4C0LA 1XO5A 4CFRA 2L0PA 1TNWA 1AUIB 2ZKMX 3CGAA 3VRQA 2KSPA 2KDHA 5AERA 1M31A 1B7TZ 1K95A 4PHMA 1GGWA 2Y1NA 3PSRA 1Y1UA 3I5HB 4I5NB 4PALA 1H8BA 3OP0A 1DGUA 1SW8A 1G33A 2EHBA 1GGZA 4AOMA 4M2OA 1WDCB 2SCPA 1UHHA 2K8MB 1IWQA 3BUOB 4NDDA 1DTLA 5DKRA 2JPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIA A;  1PRW A;  2E6W A;  3CTN A;  4Q04 A;  3H4S E;  1KFU L;  2LP2 A;  1SCM B;  2SAS A;  4OV2 A;  1UHK A;  1K90 D;  1REC A;  5CSJ A;  1SMG A;  1L7Z A;  1OE9 B;  3DVK A;  1XFW O;  1M39 A;  1LKJ A;  4GGN A;  2HPS A;  2Y5I A;  3O78 A;  1IQ5 A;  3AAJ A;  2JOJ A;  5KU1 A;  1A75 B;  3AAK A;  2F3Y A;  1S6J A;  2AMI A;  2KGB C;  1AK8 A;  1WY9 A;  2L5X B;  1K96 A;  3TZ1 A;  1JBA A;  1WRL A;  1WRZ A;  2AUC A;  1PSR A;  2B1U A;  2D8N A;  2LHL A;  4JWQ A;  2JNX A;  1S36 A;  2JUL A;  2JXC A;  1UWO A;  1MR8 A;  2BE4 A;  3DVM A;  1K9K A;  3NXA A;  4A4C A;  2IS9 A;  3LLE A;  2GGZ A;  4IL1 A;  1LXF C;  4YGB B;  3WHT B;  1D1O A;  4F0Z B;  1SK6 D;  3DF0 B;  1QVI Y;  1KK8 B;  1H4B A;  2KYF A;  3SIB A;  4CPV A;  4GNK B;  1BMO A;  1KFX L;  1QIV A;  1ZAC A;  4GGF A;  1B47 A;  1AVS A;  3GOF A;  2JC2 A;  5I8N A;  5DKQ A;  3I5G B;  4MRY A;  2WCE A;  4PE7 A;  4QJ3 B;  1F71 A;  3BUX B;  1M63 B;  5DKN A;  1QJT A;  3SG2 A;  2K2F A;  4GBA A;  1DJG A;  1PAL A;  2HET A;  2I2R E;  2M9G A;  3BQ3 A;  1IQ3 A;  1ALW A;  3DF0 A;  1QVI Z;  4XYN A;  2G9B A;  1G4Y R;  1KK7 Y;  4OKH A;  1QLK A;  1QX2 A;  1TN4 A;  1YVL A;  2EC6 C;  2F3Z A;  2KGR A;  4YGD B;  1LVC D;  1CLB A;  3DVE A;  1CMF A;  4MEW A;  4NDB A;  3PN7 B;  2OS8 C;  1CB1 A;  1B4C A;  2M7N A;  3FS7 A;  3F45 A;  3HCM A;  3OX5 A;  1FBV A;  1HT9 A;  3I5I C;  4CLN A;  2I18 A;  1KFU S;  1Y0V H;  1DJY A;  2MAZ A;  2LVV A;  1FW4 A;  2HF5 A;  2AAO A;  3BOW B;  3EVU A;  3CLN A;  2WOR A;  2JTT A;  1XFU O;  1XA5 A;  2JT0 A;  1IRJ A;  4WRI A;  4JPZ B;  1KK7 Z;  1QV0 A;  4PHK A;  3NSI A;  5KTY A;  1NX3 A;  5JJG A;  1OMD A;  3TDI A;  3TDU A;  1YTZ C;  1RK9 A;  5D69 A;  1DMO A;  1AP4 A;  1K2H A;  3BUW B;  2H61 A;  3TS5 B;  1CMG A;  1C7W A;  1GJY A;  5I2O A;  2PSR A;  4N1F A;  1EXR A;  1PK0 D;  1K93 D;  3BOW A;  3KPX A;  1OZS A;  1BR4 B;  1SR6 B;  2KAX A;  1J55 A;  2O5G A;  4GFT A;  3TUY B;  1IH0 A;  2JTZ A;  3JTD C;  1N0Y A;  3MSE B;  1ODB A;  2CBL A;  1A4P A;  1EL4 A;  2H2K A;  3JVT B;  1TNP A;  1V1F A;  1YUS A;  2JU0 A;  3PFV A;  1NSH A;  3WXA A;  1J1E A;  2CT9 A;  1SCV A;  3D0Y B;  2NCO A;  4WQ3 A;  3NSL A;  5ER5 A;  4FTG A;  3LK1 A;  3PM8 A;  3EK4 A;  2LUC A;  1S26 D;  3OX6 A;  2PMY A;  1NX2 A;  3FWB A;  2ZN8 A;  4MZK A;  1KCY A;  3DD4 A;  3K21 A;  1RWY A;  1M45 A;  2K2A A;  2PRU A;  2GV5 A;  3OHM B;  4CID A;  1YX8 A;  3TDZ A;  1KQM C;  3WNX B;  2CNP A;  3A4U B;  5KSZ A;  1OOJ A;  4YI9 A;  3D0Y A;  1JFK A;  3CWG A;  1DVI A;  2KQY A;  2LVJ A;  2NXQ A;  2OPO A;  2NZ0 A;  1B1G A;  1B8C A;  4YRU A;  3LL8 B;  1DGV A;  1LA0 A;  1SNL A;  1KK8 C;  1ZMZ A;  3E3R A;  3VRO A;  1L2O B;  3C1V A;  5PAL A;  4C0K A;  1S1E A;  4GUK A;  2LMU A;  5GQQ C;  1F54 A;  2HQ8 A;  2ISD A;  1YR5 A;  4JQ0 D;  3NSK A;  2RGI A;  2FCD A;  1XFX O;  2FJU B;  4U8D A;  3VGO A;  2PAS A;  3ZNI A;  1BJF A;  2KBM A;  2MBX A;  1A03 A;  2M0R A;  2BL0 C;  1LA3 A;  4QJ4 B;  2ZNE A;  1CFC A;  3I5F C;  5ER4 X;  2KAY A;  1CFP A;  1XK4 C;  3VRN A;  1CFF A;  3WHU B;  2I94 A;  1GQM A;  2FCE A;  3PN7 C;  4ZCU A;  2F2P A;  2PVB A;  4PE1 A;  5CSN A;  2BCA A;  1J7O A;  1MXE A;  5I2L A;  2KI4 C;  4ZCV A;  1J7R A;  5JOL A;  2LV7 A;  2MLE C;  2OTG C;  1F8H A;  1NX1 A;  4ETO A;  1TTX A;  4OR9 B;  1NUB A;  1OMR A;  1V1G A;  1PSB A;  4AQI A;  2L4H A;  2LAP A;  4MRX A;  2M29 A;  5K89 A;  1TCO B;  2BBM A;  5BPJ A;  1XFV O;  1W7J B;  1CLM A;  4HRG A;  4UPG A;  4PDZ A;  1TCF A;  1FPW A;  3SG4 A;  2LUX A;  1KWO C;  2KHN A;  4YBH B;  1M46 A;  4YGC B;  2LHI A;  3SG5 A;  2LC5 A;  4QJ5 B;  1G8I A;  2KFF A;  1AJ4 A;  2LNK A;  1A2X A;  1NP8 A;  2R2I A;  1QS7 A;  4CFQ A;  1CFD A;  1NCZ A;  1OZO A;  2A4J A;  1UP5 A;  2L51 A;  4OCI A;  1F4Q A;  3GK1 A;  3GK2 A;  4P2Y B;  2L2E A;  3IF7 A;  1DJH A;  4N1G A;  4PHJ A;  1CTR A;  2Q91 A;  1J7Q A;  5HYD A;  1K9U A;  5TNC A;  1TNQ A;  3EK8 A;  4M2Q A;  2JT3 A;  3EVR A;  2ZND A;  2WND A;  4DCK A;  1RTP 1;  3A8R A;  4DUQ A;  2Y4Q A;  1QX7 A;  1JUO A;  3GK4 X;  2BCX A;  1IGV A;  4PE4 A;  2M1K B;  3EKH A;  3I5H C;  2EGD A;  2K61 A;  2KAV A;  3O2P A;  1KSM A;  2TN4 A;  2KFH A;  1WDC C;  1YUU A;  2QPT A;  1N65 A;  5CPV A;  4ORA B;  3CR2 A;  1DJX A;  5HLO A;  1JF2 A;  1QX5 B;  4GAO A;  1QAS A;  5B8I B;  1UUR A;  2QAC A;  1MHO A;  1NCX A;  1SCM C;  1UUS A;  4OVN F;  3VRP A;  5HKW A;  1F4O A;  1JFJ A;  1SY9 A;  2M7L A;  1E8A A;  2JQ6 A;  3D10 A;  2WC8 A;  4TNC A;  3LCP C;  2EC6 B;  5CSF A;  2FOT A;  1X02 A;  1U5I A;  4HRH A;  2F33 A;  1S3P A;  1CDP A;  4BY5 A;  1QLS A;  1S5G Y;  2OS8 B;  5J3X A;  1WLZ A;  4PHN A;  3I5I B;  5I2Q A;  2JZI A;  4HSZ A;  4M2P A;  1EG3 A;  1ZUZ A;  4GGF C;  3EK7 A;  2WCB A;  4I5L B;  2GGM A;  2LMV A;  3BXK A;  3BYA A;  2JNF A;  1Y6W A;  1MQ1 A;  2HQW A;  2K7D A;  2VRG A;  3ZWH A;  2ZRT A;  1RJV A;  2LLT A;  2M97 A;  1A29 A;  1EH2 A;  1LIN A;  1B8L A;  1S5G Z;  3IQQ A;  5FYX A;  3LK0 A;  4PE0 A;  4YGE B;  1PUL A;  3KO0 A;  3SIA A;  4PCW A;  1KQV A;  4P5O E;  1OMV A;  2F8P A;  3SG3 A;  3NSO A;  1BF5 A;  3QRX A;  1BT6 A;  3I5G C;  1C7V A;  2COL B;  3PAL A;  2NCP A;  1MWN A;  1MXL C;  1CDL A;  1DJZ A;  4GPL B;  4MN0 A;  3JTD B;  2NLN A;  5AEQ A;  2M3W A;  2O60 A;  1YVH A;  4N5X A;  4MZL A;  1YUT A;  5AFP A;  2JT8 A;  1C07 A;  1W7I B;  1S6I A;  1DF0 A;  2L4I A;  3CR4 X;  5HKY A;  1ALV A;  3EVV A;  1J7P A;  2KFG A;  1YRT B;  1K94 A;  1OSA A;  4ORB B;  1BOD A;  1F55 A;  2G2B A;  1JWD A;  2JRF A;  2KI6 D;  1IJ5 A;  2L98 A;  4MVF A;  1NCY A;  1NPQ A;  4I5J A;  3SJS A;  3PAT A;  1SRA A;  1MF8 B;  4YGA A;  2WCF A;  2CCM A;  4FQO A;  2F2O A;  1FI5 A;  4MBE A;  1AHR A;  4ORC B;  2M1U A;  1CDN A;  4R1E A;  2H61 C;  3CS1 A;  1SKT A;  1YX7 A;  1SL9 A;  4I5K A;  1WRK A;  3O4Y A;  3VRR A;  4BY4 A;  3OB1 B;  2M8U A;  1PVB A;  1KQM B;  2DOQ A;  1BOC A;  5IBW A;  1SYM A;  2LCP A;  2KBI A;  1S6C A;  4HRE E;  1IKU A;  2WOS A;  4AQJ A;  1OQP A;  5CSI A;  2CTN A;  1R2U A;  1TNX A;  2JXL A;  2LP3 A;  4DS7 A;  2MRD A;  5G08 A;  3PLF B;  4MSP A;  1JF0 A;  4L9M A;  1A75 A;  2MJW B;  3TS5 C;  2CXJ A;  1EJ3 A;  1ZOT B;  2K0J A;  2LM5 A;  5AXI A;  1K9P A;  2ZFD A;  2KOT A;  4WQ2 A;  1MUX A;  1BU3 A;  2L50 A;  3SG6 A;  1Y1X A;  1XVJ A;  2KI6 C;  2BKH B;  2ZRS A;  1SR6 C;  3TUY C;  2LVK A;  1QXP A;  2LE9 B;  3CZT X;  2MA2 A;  1N2D A;  1QIW A;  2JWW A;  4D1E A;  1WLM A;  2Q4U A;  2I7A A;  3RLZ A;  2Y1M A;  3AKB A;  1PVA A;  2BCB A;  2BL0 B;  1BG1 A;  1Y1A A;  4ICB A;  3JVT C;  1NYA A;  1SL8 A;  1K8U A;  1B8R A;  3I5F B;  1JC2 A;  3KEV A;  4MLW A;  3CR5 X;  1BR1 B;  3M0W A;  5D7F A;  2LAN A;  4XJK B;  2K7C A;  3AKA A;  2K7B A;  1TIZ A;  1CM4 A;  1IJ6 A;  1CKK A;  5AAN A;  5HKZ A;  5F6T A;  4NDC A;  1QV1 A;  4NQG A;  1UHJ A;  1HQV A;  1NX0 A;  1U5I B;  2KI4 B;  2LLS A;  1CLL A;  4YI8 A;  1AJ5 A;  2BBN A;  4DIR A;  2OTG B;  2M49 B;  1CDM A;  1IG5 A;  2KNE A;  2E30 A;  1R6P A;  2ZN9 A;  4A4B A;  1RRO A;  1KSO A;  1XK4 A;  2V53 A;  1DJW A;  1Q80 A;  3RM1 A;  1YUR A;  4XJK A;  1BLQ A;  1CNP A;  1JSA A;  3FWC A;  1RFJ A;  4MZJ A;  3O6B A;  1FI6 A;  3KHE A;  3SG7 A;  1TOP A;  2BKI B;  2MHH A;  1KWO B;  3IQO A;  1B9A A;  1L2O C;  2MLF C;  4C0J A;  1NIW A;  2K7O A;  3EKJ A;  3HX4 A;  2LMT A;  1YRU B;  3ICB A;  2KQ6 A;  1DJI A;  1QTX A;  1EG4 A;  5HLV A;  1B7T Y;  1SBJ A;  1XFY O;  4E68 A;  1FF1 A;  1CM1 A;  4USL A;  1SPY A;  1XYD A;  1ZFS A;  1DT7 B;  1UHI A;  2PAL A;  1UHN A;  1NWD A;  2BE6 A;  1XFZ O;  3BUM B;  2LLU A;  2KYC A;  4DRW A;  1SL7 A;  1KFX S;  2BEC A;  1J1D A;  3DVJ A;  1QAT A;  1F70 A;  2LVI A;  1VRK A;  3BUN B;  3KF9 A;  2P6B B;  1TRF A;  1DF0 B;  3OB2 B;  4C0L A;  1XO5 A;  4CFR A;  2L0P A;  1TNW A;  1AUI B;  2ZKM X;  3CGA A;  3VRQ A;  2KSP A;  2KDH A;  5AER A;  1M31 A;  1B7T Z;  1K95 A;  4PHM A;  1GGW A;  2Y1N A;  3PSR A;  1Y1U A;  3I5H B;  4I5N B;  4PAL A;  1H8B A;  3OP0 A;  1DGU A;  1SW8 A;  1G33 A;  2EHB A;  1GGZ A;  4AOM A;  4M2O A;  1WDC B;  2SCP A;  1UHH A;  2K8M B;  1IWQ A;  3BUO B;  4NDD A;  1DTL A;  5DKR A;  2JPT A; 
#chains in the Genus database with same CATH topology
 2WCK A;  1PRW A;  2E6W A;  3FIA A;  3CTN A;  4Q04 A;  3H4S E;  1KFU L;  2LP2 A;  1SCM B;  2SAS A;  2QEB A;  4OV2 A;  1UHK A;  1K90 D;  1REC A;  2KLE A;  4IJ7 A;  5CSJ A;  1SMG A;  1L7Z A;  3S0A A;  1OE9 B;  3DVK A;  1XFW O;  2FJY A;  1M39 A;  1LKJ A;  4GGN A;  2HPS A;  2Y5I A;  3O78 A;  1IQ5 A;  3AAJ A;  2JOJ A;  5KU1 A;  1A75 B;  3AAK A;  2F3Y A;  4OZD A;  1S6J A;  4KYN A;  5FI7 A;  2AMI A;  2KGB C;  3L4L A;  1AK8 A;  1WY9 A;  2L5X B;  1K96 A;  3TZ1 A;  1JBA A;  1WRL A;  1WRZ A;  2AUC A;  1PSR A;  2B1U A;  1OOH A;  2D8N A;  2LHL A;  4JWQ A;  2JNX A;  1S36 A;  2JUL A;  2JXC A;  1UWO A;  1MR8 A;  2BE4 A;  3DVM A;  1K9K A;  3NXA A;  4A4C A;  1DEL A;  2IS9 A;  3LLE A;  2GGZ A;  4IL1 A;  1LXF C;  4YGB B;  3WHT B;  1D1O A;  4F0Z B;  1SK6 D;  3DF0 B;  1QVI Y;  1KK8 B;  1H4B A;  2KYF A;  3SIB A;  4CPV A;  4GNK B;  1BMO A;  1KFX L;  1QIV A;  1ZAC A;  4GGF A;  1B47 A;  1AVS A;  3GOF A;  2JC2 A;  5I8N A;  5DKQ A;  3I5G B;  4MRY A;  2WCE A;  4PE7 A;  4QJ3 B;  2WCH A;  1F71 A;  3BUX B;  1M63 B;  5DKN A;  1QJT A;  3SG2 A;  1ORG A;  2K2F A;  5FI2 A;  4GBA A;  1DJG A;  1PAL A;  2HET A;  2I2R E;  2M9G A;  2WCJ A;  3BQ3 A;  1IQ3 A;  1ALW A;  3DY9 A;  3DF0 A;  1QVI Z;  4XYN A;  3VB1 A;  2G9B A;  1G4Y R;  1KK7 Y;  3L4A A;  4OKH A;  1QLK A;  3O4X A;  1QX2 A;  1TN4 A;  1YVL A;  2EC6 C;  2F3Z A;  2KGR A;  4YGD B;  1LVC D;  1CLB A;  3DVE A;  1CMF A;  4MEW A;  4NDB A;  3PN7 B;  3S0G A;  2OS8 C;  1CB1 A;  1B4C A;  2M7N A;  3FS7 A;  3F45 A;  3HCM A;  3OX5 A;  1FBV A;  1HT9 A;  3I5I C;  4CLN A;  1IIO A;  2I18 A;  1KFU S;  1Y0V H;  1DJY A;  1C3Z A;  2LVV A;  2MAZ A;  1FW4 A;  2HF5 A;  2AAO A;  3BOW B;  3EVU A;  5EL2 A;  3CLN A;  2P70 A;  2WOR A;  2JTT A;  1XFU O;  1XA5 A;  2L2C A;  1GM0 A;  2JT0 A;  1IRJ A;  4WRI A;  4JPZ B;  1KK7 Z;  1QV0 A;  4PHK A;  3NSI A;  5KTY A;  1NX3 A;  5JJG A;  1OMD A;  3TDI A;  3TDU A;  1YTZ C;  1RK9 A;  5D69 A;  1DMO A;  1AP4 A;  1K2H A;  3BUW B;  2H61 A;  3TS5 B;  1CMG A;  1C7W A;  1GJY A;  1LS8 A;  5I2O A;  2PSR A;  4N1F A;  1EXR A;  1PK0 D;  1K93 D;  3BOW A;  3KPX A;  4JKT A;  1OZS A;  1BR4 B;  3V2L A;  1SR6 B;  2KAX A;  1J55 A;  2O5G A;  4GFT A;  3TUY B;  1IH0 A;  2JTZ A;  3JTD C;  1DC1 A;  1N0Y A;  3MSE B;  1OOI X;  1ODB A;  2CBL A;  1A4P A;  1EL4 A;  2H2K A;  3JVT B;  1TNP A;  1W9Z A;  1V1F A;  1YUS A;  2JU0 A;  3PFV A;  1NSH A;  3WXA A;  1J1E A;  2CT9 A;  1SCV A;  3D0Y B;  2NCO A;  4WQ3 A;  3NSL A;  2QEV A;  3CAB A;  5ER5 A;  4FTG A;  3SS5 A;  3LK1 A;  3PM8 A;  3S0D A;  3EK4 A;  2LUC A;  1S26 D;  3OX6 A;  2PMY A;  1NX2 A;  3FWB A;  2ZN8 A;  4MZK A;  1KCY A;  3DD4 A;  3K21 A;  1RWY A;  1M45 A;  2K2A A;  2PRU A;  2GV5 A;  3OHM B;  4CID A;  3S0E A;  3L47 A;  1YX8 A;  3OGN A;  3TDZ A;  3BFB A;  1KQM C;  3WNX B;  2CNP A;  3A4U B;  5KSZ A;  4PT1 A;  1OOJ A;  4YI9 A;  3D0Y A;  1JFK A;  3CWG A;  1DVI A;  2KQY A;  2LVJ A;  2NXQ A;  2OPO A;  2NZ0 A;  1B1G A;  1B8C A;  4INX A;  4YRU A;  3LL8 B;  3S0B A;  3B86 A;  3FE9 A;  4FQT A;  1DGV A;  1LA0 A;  1SNL A;  1KK8 C;  1ZMZ A;  3E3R A;  3VRO A;  1L2O B;  3C1V A;  5PAL A;  4C0K A;  1S1E A;  4GUK A;  2LMU A;  5GQQ C;  1F54 A;  2HQ8 A;  2ISD A;  1YR5 A;  4JQ0 D;  2GTE A;  3NSK A;  2RGI A;  3S0F A;  2FCD A;  3D73 A;  1XFX O;  2FJU B;  4U8D A;  3VGO A;  2PAS A;  3ZNI A;  1BJF A;  2KBM A;  2MBX A;  1A03 A;  2M0R A;  2BL0 C;  1LA3 A;  5FI6 A;  4QJ4 B;  2ZNE A;  5DIC A;  1CFC A;  3I5F C;  2QEO A;  5ER4 X;  2KAY A;  3IVT A;  2BAP A;  1CFP A;  1XK4 C;  3VRN A;  1CFF A;  2KLD A;  3WHU B;  2I94 A;  1GQM A;  2FCE A;  3PN7 C;  4ZCU A;  2F2P A;  2PVB A;  4PE1 A;  5CSN A;  2BCA A;  1J7O A;  1OOF A;  1MXE A;  2WC6 A;  5I2L A;  2KI4 C;  4ZCV A;  1SSE B;  1J7R A;  2PQL A;  4JD9 A;  5JOL A;  2LV7 A;  2MLE C;  2OTG C;  1F8H A;  1NX1 A;  3BJH A;  4ETO A;  1TTX A;  4OR9 B;  1NUB A;  1OMR A;  1V1G A;  5HL1 A;  1PSB A;  3NHI A;  4AQI A;  2L4H A;  2LAP A;  4MRX A;  2M29 A;  5K89 A;  1TCO B;  2BBM A;  5BPJ A;  1XFV O;  1W7J B;  1CLM A;  4HRG A;  4UPG A;  4PDZ A;  1TCF A;  1FPW A;  3SG4 A;  2LUX A;  1KWO C;  2KHN A;  4YBH B;  1M46 A;  4YGC B;  2LHI A;  3SG5 A;  2LC5 A;  4QJ5 B;  1G8I A;  2KFF A;  1AJ4 A;  3B6X A;  2LNK A;  1A2X A;  1NP8 A;  2R2I A;  1QS7 A;  4CFQ A;  1CFD A;  1NCZ A;  1OZO A;  2A4J A;  1UP5 A;  2L51 A;  4OCI A;  1F4Q A;  3BFA A;  3GK1 A;  3GK2 A;  3NHT A;  1C3Y A;  4P2Y B;  2L2E A;  3IF7 A;  1DJH A;  4N1G A;  4PHJ A;  1CTR A;  2Q91 A;  1J7Q A;  5HYD A;  1K9U A;  5TNC A;  2L5Y A;  1TNQ A;  3EK8 A;  4M2Q A;  2JT3 A;  3EVR A;  5HKY A;  2ZND A;  2JPO A;  2WND A;  4DCK A;  1RTP 1;  3A8R A;  3DYE A;  4DUQ A;  2Y4Q A;  1QX7 A;  1JUO A;  3GK4 X;  2BCX A;  1IGV A;  4PE4 A;  2M1K B;  3EKH A;  3I5H C;  2EGD A;  2K61 A;  2KAV A;  3O2P A;  1KSM A;  2TN4 A;  2KFH A;  1WDC C;  1YUU A;  2PYQ A;  2QPT A;  1N65 A;  5CPV A;  4ORA B;  2K60 A;  3CR2 A;  3D78 A;  3EG5 B;  1DJX A;  5HLO A;  1JF2 A;  1QX5 B;  4GAO A;  1QAS A;  5B8I B;  1UUR A;  2QAC A;  5I94 A;  1MHO A;  1NCX A;  1SCM C;  1UUS A;  2YGU A;  4OVN F;  3VRP A;  5HKW A;  1F4O A;  1XFR A;  5D3O A;  1JFJ A;  1SY9 A;  2M7L A;  1E8A A;  2JQ6 A;  3D10 A;  2WC8 A;  4TNC A;  3LCP C;  2EC6 B;  5CSF A;  2FOT A;  3B88 A;  1X02 A;  1U5I A;  4HRH A;  2F33 A;  1S3P A;  1CDP A;  4BY5 A;  1QLS A;  1S5G Y;  2OS8 B;  5J3X A;  1WLZ A;  4PHN A;  3I5I B;  5I2Q A;  2JZI A;  4HSZ A;  4M2P A;  1EG3 A;  1ZUZ A;  4GGF C;  3EK7 A;  2WCB A;  3CZ0 A;  4I5L B;  2GGM A;  2LMV A;  3BXK A;  3BYA A;  2JNF A;  1Y6W A;  1MQ1 A;  2HQW A;  2K7D A;  2VRG A;  3ZWH A;  2ZRT A;  1RJV A;  2LLT A;  2M97 A;  1A29 A;  3R72 A;  1EH2 A;  1LIN A;  1B8L A;  1S5G Z;  3IQQ A;  5FYX A;  3UO9 A;  3LK0 A;  1QWV A;  2ERB A;  4PE0 A;  1PUL A;  4YGE B;  3KO0 A;  1DEK A;  3SIA A;  4PCW A;  1KQV A;  4P5O E;  1OMV A;  2F8P A;  3SG3 A;  3NSO A;  1BF5 A;  3QRX A;  3CDN A;  1BT6 A;  3CYZ A;  3I5G C;  2COL B;  1C7V A;  3PAL A;  2NCP A;  1MWN A;  1MXL C;  2H8V A;  1CDL A;  1DJZ A;  4GPL B;  4MN0 A;  3JTD B;  2NLN A;  5AEQ A;  2M3W A;  2O60 A;  1YVH A;  2KPH A;  4MZL A;  1YUT A;  4N5X A;  5AFP A;  2JT8 A;  3SS4 A;  1C07 A;  1W7I B;  1S6I A;  1DF0 A;  2L4I A;  3CR4 X;  3Q8I A;  1ALV A;  1TUZ A;  3EVV A;  1TWO A;  2KFG A;  1YRT B;  1K94 A;  1OSA A;  2QDI A;  4ORB B;  1BOD A;  2G2B A;  1F55 A;  1JWD A;  2JRF A;  2KI6 D;  1IJ5 A;  2L98 A;  4MVF A;  1NCY A;  1NPQ A;  3NGV A;  4I5J A;  3SJS A;  3PAT A;  1SRA A;  1MF8 B;  4YGA A;  2WCF A;  2CCM A;  3D77 A;  4FQO A;  2F2O A;  3OBV A;  3PM2 A;  1FI5 A;  4MBE A;  1AHR A;  1Z4H A;  4ORC B;  2M1U A;  1CDN A;  4R1E A;  2H61 C;  3CS1 A;  3D74 A;  3D76 A;  1SKT A;  1YX7 A;  1SL9 A;  3B7A A;  1WRK A;  3CZ2 A;  3O4Y A;  4I5K A;  3DZT A;  3VRR A;  4BY4 A;  3OB1 B;  2M8U A;  1PVB A;  1KQM B;  2DOQ A;  1BOC A;  5IBW A;  1SYM A;  2LCP A;  2QEH A;  1T14 A;  2KBI A;  1S6C A;  4HRE E;  1IKU A;  2WOS A;  4AQJ A;  1OQP A;  5CSI A;  2CTN A;  1J7P A;  1R2U A;  1TNX A;  2JXL A;  2LP3 A;  3D75 A;  2MRD A;  4DS7 A;  3BFH A;  5G08 A;  3PLF B;  4MSP A;  1JF0 A;  1TUJ A;  1A75 A;  2MJW B;  4L9M A;  3TS5 C;  4F7F A;  2CXJ A;  1EJ3 A;  1ZOT B;  2K0J A;  2LM5 A;  5AXI A;  1K9P A;  2ZFD A;  2KOT A;  3CZ1 A;  4WQ2 A;  1MUX A;  1BU3 A;  3UNW A;  2L50 A;  3SG6 A;  1Y1X A;  1XVJ A;  2KI6 C;  2BKH B;  2ZRS A;  1SR6 C;  3TUY C;  2LVK A;  1QXP A;  2LE9 B;  3CZT X;  2MA2 A;  1N2D A;  1QIW A;  2JWW A;  4D1E A;  1WLM A;  2Q4U A;  2I7A A;  3R1O A;  3RLZ A;  3N7H A;  2Y1M A;  3AKB A;  1PVA A;  2BCB A;  2BL0 B;  1BG1 A;  1Y1A A;  4ICB A;  3JVT C;  1NYA A;  1SL8 A;  1K8U A;  1B8R A;  3I5F B;  1JC2 A;  3KEV A;  4MLW A;  3CR5 X;  1BR1 B;  3M0W A;  5D7F A;  1OOG A;  2LAN A;  4XJK B;  2K7C A;  3AKA A;  2K7B A;  2WCM A;  1TIZ A;  1CM4 A;  1IJ6 A;  1CKK A;  5AAN A;  5HKZ A;  5F6T A;  4NDC A;  1QV1 A;  4NQG A;  1UHJ A;  1HQV A;  2WCL A;  1NX0 A;  1U5I B;  2KI4 B;  3R1V A;  2LLS A;  2BNX A;  1CLL A;  4YI8 A;  1AJ5 A;  2BBN A;  4DIR A;  2OTG B;  2M49 B;  4INW A;  1CDM A;  1IG5 A;  2KNE A;  2E30 A;  1R6P A;  2ZN9 A;  3QME A;  4A4B A;  1RRO A;  1KSO A;  1XK4 A;  2V53 A;  1DJW A;  1DQE A;  1Q80 A;  3RM1 A;  1YUR A;  4XJK A;  1BLQ A;  1CNP A;  1JSA A;  3FWC A;  1RFJ A;  4MZJ A;  3O6B A;  1FI6 A;  3KHE A;  3SG7 A;  1TOP A;  3FE8 A;  2BKI B;  2MHH A;  1KWO B;  3IQO A;  1B9A A;  1L2O C;  2MLF C;  4C0J A;  1NIW A;  2K7O A;  3EKJ A;  3HX4 A;  3SS3 A;  2LMT A;  1YRU B;  3ICB A;  2KQ6 A;  1DJI A;  1QTX A;  1EG4 A;  5HLV A;  1B7T Y;  1SBJ A;  1XFY O;  4E68 A;  1FF1 A;  1CM1 A;  4USL A;  1SPY A;  1XYD A;  3FE6 A;  3RZS A;  1ZFS A;  1DT7 B;  1UHI A;  2PAL A;  3PJI A;  1UHN A;  1Z2C B;  3DXL A;  1NWD A;  2BE6 A;  1XFZ O;  3BUM B;  2LLU A;  2KYC A;  4DRW A;  1SL7 A;  1KFX S;  2BEC A;  1J1D A;  3DVJ A;  1QAT A;  1F70 A;  2LVI A;  1VRK A;  3BUN B;  3KF9 A;  2P6B B;  1TRF A;  1DF0 B;  3OB2 B;  4C0L A;  1XO5 A;  4CFR A;  2L0P A;  1TNW A;  2WC5 A;  1AUI B;  2ZKM X;  3CGA A;  3VRQ A;  2KSP A;  2KDH A;  5AER A;  3K1E A;  1M31 A;  1B7T Z;  1K95 A;  3R1P A;  4PHM A;  1GGW A;  2Y1N A;  3PSR A;  1Y1U A;  3B87 A;  3I5H B;  4I5N B;  4PAL A;  1H8B A;  3OP0 A;  1DGU A;  1SW8 A;  1G33 A;  2EHB A;  1GGZ A;  1P28 A;  2P71 A;  4AOM A;  4M2O A;  1WDC B;  1OW4 A;  2SCP A;  1UHH A;  2K8M B;  1IWQ A;  3BUO B;  4NDD A;  1DTL A;  5DKR A;  2JPT A; 
#chains in the Genus database with same CATH homology
 3FIA A;  1PRW A;  2E6W A;  3CTN A;  4Q04 A;  3H4S E;  1KFU L;  2LP2 A;  1SCM B;  2SAS A;  4OV2 A;  1UHK A;  1K90 D;  1REC A;  5CSJ A;  1SMG A;  1L7Z A;  1OE9 B;  3DVK A;  1XFW O;  1M39 A;  1LKJ A;  4GGN A;  2HPS A;  2Y5I A;  3O78 A;  1IQ5 A;  3AAJ A;  2JOJ A;  5KU1 A;  1A75 B;  3AAK A;  2F3Y A;  1S6J A;  2AMI A;  2KGB C;  1AK8 A;  1WY9 A;  2L5X B;  1K96 A;  3TZ1 A;  1JBA A;  1WRL A;  1WRZ A;  2AUC A;  1PSR A;  2B1U A;  2D8N A;  2LHL A;  4JWQ A;  2JNX A;  1S36 A;  2JUL A;  2JXC A;  1UWO A;  1MR8 A;  2BE4 A;  3DVM A;  1K9K A;  3NXA A;  4A4C A;  2IS9 A;  3LLE A;  2GGZ A;  4IL1 A;  1LXF C;  4YGB B;  3WHT B;  1D1O A;  4F0Z B;  1SK6 D;  3DF0 B;  1QVI Y;  1KK8 B;  1H4B A;  2KYF A;  3SIB A;  4CPV A;  4GNK B;  1BMO A;  1KFX L;  1QIV A;  1ZAC A;  4GGF A;  1B47 A;  1AVS A;  3GOF A;  2JC2 A;  5I8N A;  5DKQ A;  3I5G B;  4MRY A;  2WCE A;  4PE7 A;  4QJ3 B;  1F71 A;  3BUX B;  1M63 B;  5DKN A;  1QJT A;  3SG2 A;  2K2F A;  4GBA A;  1DJG A;  1PAL A;  2HET A;  2I2R E;  2M9G A;  3BQ3 A;  1IQ3 A;  1ALW A;  3DF0 A;  1QVI Z;  4XYN A;  2G9B A;  1G4Y R;  1KK7 Y;  4OKH A;  1QLK A;  1QX2 A;  1TN4 A;  1YVL A;  2EC6 C;  2F3Z A;  2KGR A;  4YGD B;  1LVC D;  1CLB A;  3DVE A;  1CMF A;  4MEW A;  4NDB A;  3PN7 B;  2OS8 C;  1CB1 A;  1B4C A;  2M7N A;  3FS7 A;  3F45 A;  3HCM A;  3OX5 A;  1FBV A;  1HT9 A;  3I5I C;  4CLN A;  2I18 A;  1KFU S;  1Y0V H;  1DJY A;  2MAZ A;  2LVV A;  1FW4 A;  2HF5 A;  2AAO A;  3BOW B;  3EVU A;  3CLN A;  2WOR A;  2JTT A;  1XFU O;  1XA5 A;  2JT0 A;  1IRJ A;  4WRI A;  4JPZ B;  1KK7 Z;  1QV0 A;  4PHK A;  3NSI A;  5KTY A;  1NX3 A;  5JJG A;  1OMD A;  3TDI A;  3TDU A;  1YTZ C;  1RK9 A;  5D69 A;  1DMO A;  1AP4 A;  1K2H A;  3BUW B;  2H61 A;  3TS5 B;  1CMG A;  1C7W A;  1GJY A;  5I2O A;  2PSR A;  4N1F A;  1EXR A;  1PK0 D;  1K93 D;  3BOW A;  3KPX A;  1OZS A;  1BR4 B;  1SR6 B;  2KAX A;  1J55 A;  2O5G A;  4GFT A;  3TUY B;  1IH0 A;  2JTZ A;  3JTD C;  1N0Y A;  3MSE B;  1ODB A;  2CBL A;  1A4P A;  1EL4 A;  2H2K A;  3JVT B;  1TNP A;  1V1F A;  1YUS A;  2JU0 A;  3PFV A;  1NSH A;  3WXA A;  1J1E A;  2CT9 A;  1SCV A;  3D0Y B;  2NCO A;  4WQ3 A;  3NSL A;  5ER5 A;  4FTG A;  3LK1 A;  3PM8 A;  3EK4 A;  2LUC A;  1S26 D;  3OX6 A;  2PMY A;  1NX2 A;  3FWB A;  2ZN8 A;  4MZK A;  1KCY A;  3DD4 A;  3K21 A;  1RWY A;  1M45 A;  2K2A A;  2PRU A;  2GV5 A;  3OHM B;  4CID A;  1YX8 A;  3TDZ A;  1KQM C;  3WNX B;  2CNP A;  3A4U B;  5KSZ A;  1OOJ A;  4YI9 A;  3D0Y A;  1JFK A;  3CWG A;  1DVI A;  2KQY A;  2LVJ A;  2NXQ A;  2OPO A;  2NZ0 A;  1B1G A;  1B8C A;  4YRU A;  3LL8 B;  1DGV A;  1LA0 A;  1SNL A;  1KK8 C;  1ZMZ A;  3E3R A;  3VRO A;  1L2O B;  3C1V A;  5PAL A;  4C0K A;  1S1E A;  4GUK A;  2LMU A;  5GQQ C;  1F54 A;  2HQ8 A;  2ISD A;  1YR5 A;  4JQ0 D;  3NSK A;  2RGI A;  2FCD A;  1XFX O;  2FJU B;  4U8D A;  3VGO A;  2PAS A;  3ZNI A;  1BJF A;  2KBM A;  2MBX A;  1A03 A;  2M0R A;  2BL0 C;  1LA3 A;  4QJ4 B;  2ZNE A;  1CFC A;  3I5F C;  5ER4 X;  2KAY A;  1CFP A;  1XK4 C;  3VRN A;  1CFF A;  3WHU B;  2I94 A;  1GQM A;  2FCE A;  3PN7 C;  4ZCU A;  2F2P A;  2PVB A;  4PE1 A;  5CSN A;  2BCA A;  1J7O A;  1MXE A;  5I2L A;  2KI4 C;  4ZCV A;  1J7R A;  5JOL A;  2LV7 A;  2MLE C;  2OTG C;  1F8H A;  1NX1 A;  4ETO A;  1TTX A;  4OR9 B;  1NUB A;  1OMR A;  1V1G A;  1PSB A;  4AQI A;  2L4H A;  2LAP A;  4MRX A;  2M29 A;  5K89 A;  1TCO B;  2BBM A;  5BPJ A;  1XFV O;  1W7J B;  1CLM A;  4HRG A;  4UPG A;  4PDZ A;  1TCF A;  1FPW A;  3SG4 A;  2LUX A;  1KWO C;  2KHN A;  4YBH B;  1M46 A;  4YGC B;  2LHI A;  3SG5 A;  2LC5 A;  4QJ5 B;  1G8I A;  2KFF A;  1AJ4 A;  2LNK A;  1A2X A;  1NP8 A;  2R2I A;  1QS7 A;  4CFQ A;  1CFD A;  1NCZ A;  1OZO A;  2A4J A;  1UP5 A;  2L51 A;  4OCI A;  1F4Q A;  3GK1 A;  3GK2 A;  4P2Y B;  2L2E A;  3IF7 A;  1DJH A;  4N1G A;  4PHJ A;  1CTR A;  2Q91 A;  1J7Q A;  5HYD A;  1K9U A;  5TNC A;  1TNQ A;  3EK8 A;  4M2Q A;  2JT3 A;  3EVR A;  2ZND A;  2WND A;  4DCK A;  1RTP 1;  3A8R A;  4DUQ A;  2Y4Q A;  1QX7 A;  1JUO A;  3GK4 X;  2BCX A;  1IGV A;  4PE4 A;  2M1K B;  3EKH A;  3I5H C;  2EGD A;  2K61 A;  2KAV A;  3O2P A;  1KSM A;  2TN4 A;  2KFH A;  1WDC C;  1YUU A;  2QPT A;  1N65 A;  5CPV A;  4ORA B;  3CR2 A;  1DJX A;  5HLO A;  1JF2 A;  1QX5 B;  4GAO A;  1QAS A;  5B8I B;  1UUR A;  2QAC A;  1MHO A;  1NCX A;  1SCM C;  1UUS A;  4OVN F;  3VRP A;  5HKW A;  1F4O A;  1JFJ A;  1SY9 A;  2M7L A;  1E8A A;  2JQ6 A;  3D10 A;  2WC8 A;  4TNC A;  3LCP C;  2EC6 B;  5CSF A;  2FOT A;  1X02 A;  1U5I A;  4HRH A;  2F33 A;  1S3P A;  1CDP A;  4BY5 A;  1QLS A;  1S5G Y;  2OS8 B;  5J3X A;  1WLZ A;  4PHN A;  3I5I B;  5I2Q A;  2JZI A;  4HSZ A;  4M2P A;  1EG3 A;  1ZUZ A;  4GGF C;  3EK7 A;  2WCB A;  4I5L B;  2GGM A;  2LMV A;  3BXK A;  3BYA A;  2JNF A;  1Y6W A;  1MQ1 A;  2HQW A;  2K7D A;  2VRG A;  3ZWH A;  2ZRT A;  1RJV A;  2LLT A;  2M97 A;  1A29 A;  1EH2 A;  1LIN A;  1B8L A;  1S5G Z;  3IQQ A;  5FYX A;  3LK0 A;  4PE0 A;  4YGE B;  1PUL A;  3KO0 A;  3SIA A;  4PCW A;  1KQV A;  4P5O E;  1OMV A;  2F8P A;  3SG3 A;  3NSO A;  1BF5 A;  3QRX A;  1BT6 A;  3I5G C;  1C7V A;  2COL B;  3PAL A;  2NCP A;  1MWN A;  1MXL C;  1CDL A;  1DJZ A;  4GPL B;  4MN0 A;  3JTD B;  2NLN A;  5AEQ A;  2M3W A;  2O60 A;  1YVH A;  4N5X A;  4MZL A;  1YUT A;  5AFP A;  2JT8 A;  1C07 A;  1W7I B;  1S6I A;  1DF0 A;  2L4I A;  3CR4 X;  5HKY A;  1ALV A;  3EVV A;  1J7P A;  2KFG A;  1YRT B;  1K94 A;  1OSA A;  4ORB B;  1BOD A;  1F55 A;  2G2B A;  1JWD A;  2JRF A;  2KI6 D;  1IJ5 A;  2L98 A;  4MVF A;  1NCY A;  1NPQ A;  4I5J A;  3SJS A;  3PAT A;  1SRA A;  1MF8 B;  4YGA A;  2WCF A;  2CCM A;  4FQO A;  2F2O A;  1FI5 A;  4MBE A;  1AHR A;  4ORC B;  2M1U A;  1CDN A;  4R1E A;  2H61 C;  3CS1 A;  1SKT A;  1YX7 A;  1SL9 A;  4I5K A;  1WRK A;  3O4Y A;  3VRR A;  4BY4 A;  3OB1 B;  2M8U A;  1PVB A;  1KQM B;  2DOQ A;  1BOC A;  5IBW A;  1SYM A;  2LCP A;  2KBI A;  1S6C A;  4HRE E;  1IKU A;  2WOS A;  4AQJ A;  1OQP A;  5CSI A;  2CTN A;  1R2U A;  1TNX A;  2JXL A;  2LP3 A;  4DS7 A;  2MRD A;  5G08 A;  3PLF B;  4MSP A;  1JF0 A;  4L9M A;  1A75 A;  2MJW B;  3TS5 C;  2CXJ A;  1EJ3 A;  1ZOT B;  2K0J A;  2LM5 A;  5AXI A;  1K9P A;  2ZFD A;  2KOT A;  4WQ2 A;  1MUX A;  1BU3 A;  2L50 A;  3SG6 A;  1Y1X A;  1XVJ A;  2KI6 C;  2BKH B;  2ZRS A;  1SR6 C;  3TUY C;  2LVK A;  1QXP A;  2LE9 B;  3CZT X;  2MA2 A;  1N2D A;  1QIW A;  2JWW A;  4D1E A;  1WLM A;  2Q4U A;  2I7A A;  3RLZ A;  2Y1M A;  3AKB A;  1PVA A;  2BCB A;  2BL0 B;  1BG1 A;  1Y1A A;  4ICB A;  3JVT C;  1NYA A;  1SL8 A;  1K8U A;  1B8R A;  3I5F B;  1JC2 A;  3KEV A;  4MLW A;  3CR5 X;  1BR1 B;  3M0W A;  5D7F A;  2LAN A;  4XJK B;  2K7C A;  3AKA A;  2K7B A;  1TIZ A;  1CM4 A;  1IJ6 A;  1CKK A;  5AAN A;  5HKZ A;  5F6T A;  4NDC A;  1QV1 A;  4NQG A;  1UHJ A;  1HQV A;  1NX0 A;  1U5I B;  2KI4 B;  2LLS A;  1CLL A;  4YI8 A;  1AJ5 A;  2BBN A;  4DIR A;  2OTG B;  2M49 B;  1CDM A;  1IG5 A;  2KNE A;  2E30 A;  1R6P A;  2ZN9 A;  4A4B A;  1RRO A;  1KSO A;  1XK4 A;  2V53 A;  1DJW A;  1Q80 A;  3RM1 A;  1YUR A;  4XJK A;  1BLQ A;  1CNP A;  1JSA A;  3FWC A;  1RFJ A;  4MZJ A;  3O6B A;  1FI6 A;  3KHE A;  3SG7 A;  1TOP A;  2BKI B;  2MHH A;  1KWO B;  3IQO A;  1B9A A;  1L2O C;  2MLF C;  4C0J A;  1NIW A;  2K7O A;  3EKJ A;  3HX4 A;  2LMT A;  1YRU B;  3ICB A;  2KQ6 A;  1DJI A;  1QTX A;  1EG4 A;  5HLV A;  1B7T Y;  1SBJ A;  1XFY O;  4E68 A;  1FF1 A;  1CM1 A;  4USL A;  1SPY A;  1XYD A;  1ZFS A;  1DT7 B;  1UHI A;  2PAL A;  1UHN A;  1NWD A;  2BE6 A;  1XFZ O;  3BUM B;  2LLU A;  2KYC A;  4DRW A;  1SL7 A;  1KFX S;  2BEC A;  1J1D A;  3DVJ A;  1QAT A;  1F70 A;  2LVI A;  1VRK A;  3BUN B;  3KF9 A;  2P6B B;  1TRF A;  1DF0 B;  3OB2 B;  4C0L A;  1XO5 A;  4CFR A;  2L0P A;  1TNW A;  1AUI B;  2ZKM X;  3CGA A;  3VRQ A;  2KSP A;  2KDH A;  5AER A;  1M31 A;  1B7T Z;  1K95 A;  4PHM A;  1GGW A;  2Y1N A;  3PSR A;  1Y1U A;  3I5H B;  4I5N B;  4PAL A;  1H8B A;  3OP0 A;  1DGU A;  1SW8 A;  1G33 A;  2EHB A;  1GGZ A;  4AOM A;  4M2O A;  1WDC B;  2SCP A;  1UHH A;  2K8M B;  1IWQ A;  3BUO B;  4NDD A;  1DTL A;  5DKR A;  2JPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...