3PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3palA00
2M49B 2SCPA 3EK7A 5CSNA 2ZN8A 4QJ5B 4YRUA 1QVIZ 3CLNA 4DCKA 1V1GA 2LMTA 4HSZA 1NCXA 2K2AA 1M63B 2CTNA 1UHHA 3RLZA 2JQ6A 2JXCA 4P5OE 2L4IA 2LP3A 3TUYC 5DKNA 1SRAA 2I2RE 1RK9A 1LVCD 1SMGA 2FCDA 4ORBB 3DVKA 2JULA 4YBHB 3ZWHA 1SY9A 1DJGA 1KK7Z 4MEWA 1EXRA 1UHNA 2KNEA 2JRFA 2MLFC 3DVMA 4CPVA 1J7OA 1WLMA 2BBMA 5CPVA 2K7DA 2DOQA 3OX5A 2L5XB 1CFFA 1XO5A 3NSKA 1AJ4A 2BECA 1E8AA 1K96A 2G2BA 4GGFA 3EVVA 4ETOA 1KK8B 1MF8B 1PULA 3C1VA 2JT0A 3F45A 3EVUA 2CCMA 1SPYA 3GK4X 2KI4B 1UWOA 5AFPA 4ICBA 1KFUL 3HCMA 2MRDA 2ISDA 1YX8A 2BCBA 1YX7A 1YTZC 1NP8A 1EJ3A 1M45A 2F8PA 3NXAA 1ODBA 3LK1A 2GV5A 2M29A 3D0YB 5HLOA 5J3XA 1BJFA 2K7OA 1YUSA 2NXQA 2HQWA 4M2PA 2JTZA 2KFGA 3FS7A 2MBXA 1QX5B 1XVJA 1B8CA 4JQ0D 2K7CA 3KF9A 4D1EA 1MXLC 3I5HB 1ZUZA 1F71A 1DJXA 1TRFA 2AAOA 2JZIA 2OS8C 4HRHA 1XFYO 2E30A 1PALA 1IH0A 1HT9A 3PM8A 2KFFA 1LINA 3GOFA 4XJKB 3TS5C 1M39A 1TIZA 2EGDA 3LLEA 4GFTA 5IBWA 4R1EA 1XFXO 5GQQC 2K7BA 2Y4QA 1KK8C 4ZCVA 3O4YA 1K90D 1K9PA 2M97A 3CZTX 3PN7B 3VRPA 5TNCA 1JFJA 2GGZA 1CTRA 2AMIA 4DRWA 2KHNA 1AHRA 1K8UA 1XYDA 1U5IA 1SKTA 1QASA 1MUXA 1ZACA 1J7RA 2ZNEA 4I5LB 4PE4A 4PHNA 1DTLA 1BR4B 2MHHA 2NCPA 2LVKA 4F0ZB 1J1DA 1CMFA 5HKYA 3EVRA 2KBIA 4UPGA 1CNPA 1J7PA 3M0WA 3PALA 4YGCB 4NDDA 4CIDA 4NQGA 1IWQA 4YGBB 1SCVA 2OTGC 1W7JB 3AKBA 1IRJA 1M46A 5DKRA 2F33A 4AQJA 4PHJA 4P2YB 1RWYA 3CR5X 2CBLA 2L4HA 1F54A 1LXFC 1Y1XA 1S6IA 1PK0D 2LUXA 4XYNA 1S6CA 2AUCA 2BCXA 2M3WA 2O60A 2BKHB 5I8NA 2IS9A 3ICBA 2EC6B 1SCMB 4N5XA 1A29A 2O5GA 3TZ1A 1C7VA 1QIVA 2HF5A 1SBJA 1KCYA 1FW4A 1QIWA 1TCFA 1IJ6A 1WRKA 1ZFSA 3I5FC 3PFVA 1JWDA 4ZCUA 4E68A 1H8BA 1GGZA 3SG4A 2BL0B 1L7ZA 1OZSA 1C07A 2LCPA 4I5JA 2G9BA 1CDNA 2WNDA 2KDHA 4I5KA 2PASA 5JJGA 1NIWA 2K61A 4PDZA 4XJKA 1W7IB 1FF1A 1KK7Y 2LLUA 1V1FA 2H61C 2ZN9A 3TS5B 2FOTA 1NX1A 2JWWA 4CLNA 4QJ4B 1EG3A 1G33A 1KFXS 1UHIA 1TNQA 2JT3A 3O78A 1OE9B 1UP5A 3AAJA 1GQMA 3KEVA 4FTGA 5D69A 1Y0VH 3EKHA 1ALVA 1SR6B 3H4SE 1N0YA 5F6TA 4JPZB 1K94A 1QXPA 1Y6WA 2SASA 3FWCA 1CDLA 1R6PA 1TCOB 1XFUO 3NSIA 3LL8B 1KSMA 4GNKB 3JTDB 2LANA 4TNCA 4GGNA 5CSFA 1LA3A 4PHKA 1SYMA 5FYXA 2BL0C 3BUXB 2LLTA 4A4CA 4MBEA 1QV1A 4FQOA 3SG2A 2LHLA 3CGAA 2L50A 2BE4A 2FCEA 2WORA 5PALA 5KU1A 1FI6A 2HQ8A 2M7NA 1S3PA 1B47A 1JFKA 1NX0A 4WQ3A 2JU0A 1B9AA 2KSPA 3PLFB 5I2QA 1AUIB 4Q04A 2KQ6A 2K8MB 2KI6D 1BODA 2F2OA 1AP4A 2JT8A 1A2XA 2Y1MA 3FWBA 1QV0A 1J55A 4AOMA 3D0YA 3SG3A 2M0RA 2KGRA 1BF5A 1CLBA 2BBNA 4MZKA 3WHUB 1CKKA 4BY5A 4GBAA 3VRNA 5HLVA 3IQQA 1IQ3A 3A4UB 3TDZA 1NPQA 1OZOA 1SK6D 1WLZA 1N65A 1RTP1 1PVBA 1PRWA 2P6BB 3DF0B 3I5GB 1HQVA 1WRLA 3SG6A 2LNKA 1NUBA 3VRRA 1JC2A 3JVTB 3BUOB 2H2KA 2PALA 2MJWB 1NYAA 2KAXA 2WC8A 2JXLA 4I5NB 1CLMA 2NCOA 1MQ1A 2JNXA 3PN7C 3I5IB 3GK1A 2ZRSA 1YUTA 4MN0A 1DT7B 1BOCA 3E3RA 3DD4A 1DMOA 3WNXB 3AKAA 2MAZA 1PVAA 2NZ0A 3SIBA 4N1FA 4GAOA 4A4BA 3DVEA 3OB1B 1JSAA 1YURA 2PMYA 4CFRA 2Y1NA 2LVIA 1B8RA 5HKZA 1IJ5A 1TTXA 3OX6A 1JF0A 1N2DA 2I7AA 3I5HC 3VRQA 1K95A 2MLEC 4PE1A 3VGOA 1KWOC 4MVFA 4DUQA 3PATA 2ZNDA 1NX2A 1CM1A 1SL9A 1M31A 2QPTA 1U5IB 2LLSA 2Q91A 4OKHA 1KQVA 4M2QA 3MSEB 3SIAA 2KAVA 2LVVA 3BOWA 4WQ2A 1XK4C 2JNFA 3IF7A 1Y1UA 1EH2A 3SG5A 4ORCB 1SCMC 2NLNA 1CB1A 1A03A 4PCWA 1FPWA 1F4OA 1A4PA 4M2OA 2TN4A 1X02A 1F55A 5KSZA 1XFVO 4C0KA 4MZJA 4GUKA 5I2LA 2I94A 1WDCC 3TDUA 1XFWO 1IKUA 4N1GA 1NWDA 1CDPA 5KTYA 3KO0A 1VRKA 2KI6C 2EC6C 3A8RA 4C0JA 1ZOTB 3BUMB 1YUUA 3BYAA 2BCAA 2WOSA 2WCFA 3CR2A 1XFZO 3BQ3A 1L2OB 1RROA 2L0PA 5D7FA 2PVBA 2BE6A 1NX3A 3QRXA 4HRGA 1DGUA 2KAYA 3ZNIA 1KFXL 1YRUB 4PHMA 1JBAA 2PRUA 2CXJA 1K93D 1QJTA 1NSHA 2KGBC 2H61A 1CFDA 4YI9A 3EK4A 1RFJA 1OMDA 1S1EA 2JPTA 1MXEA 1K9UA 2LMVA 3BOWB 1CDMA 3PSRA 1K9KA 1BLQA 1S36A 1BG1A 1AJ5A 5B8IB 2OTGB 2JOJA 3JTDC 1DJIA 1GGWA 1C7WA 3O6BA 2OS8B 1B8LA 1GJYA 4MRXA 1IG5A 1TOPA 1TNXA 2CT9A 3DVJA 1UURA 4NDBA 2KYFA 4AQIA 3IQOA 5HKWA 3FIAA 2OPOA 1DJWA 1EG4A 1KSOA 2L98A 4GPLB 4PALA 1AVSA 1KWOB 4MZLA 1TN4A 4U8DA 1H4BA 3CR4X 3D10A 1MWNA 1S26D 2F3ZA 1S5GZ 1DJZA 2B1UA 2I18A 5JOLA 3VROA 2JC2A 3OP0A 1DJHA 2L51A 3CWGA 1NCYA 1CM4A 2KI4C 2KBMA 2MA2A 5AERA 1J7QA 1OMRA 1FBVA 1MR8A 3BUNB 2WCBA 1CFPA 3I5IC 3KHEA 4DIRA 2QACA 1FI5A 1BU3A 1BMOA 4OVNF 3OHMB 3BUWB 2PSRA 3K21A 4JWQA 1XK4A 1UHJA 2K2FA 1UUSA 3DF0A 1SL7A 3LCPC 4OR9B 5AEQA 2JTTA 1G4YR 4BY4A 3CTNA 4MLWA 2M7LA 2CNPA 4IL1A 2R2IA 4QJ3B 1QTXA 1R2UA 4YGDB 1XA5A 1J1EA 2HPSA 2WCEA 2M1UA 2ZRTA 2F2PA 2L2EA 1UHKA 3LK0A 2Y5IA 1Y1AA 3GK2A 4NDCA 5AXIA 1YVHA 1WRZA 1DJYA 3JVTC 5BPJA 1YRTB 2M8UA 2LP2A 1YVLA 1KQMC 2EHBA 2F3YA 1CLLA 1YR5A 1IQ5A 3OB2B 1S5GY 5I2OA 4CFQA 1QX7A 1A75A 1PSRA 5ER5A 2ZKMX 2BKIB 1KQMB 1K2HA 1L2OC 1OSAA 1RJVA 2LC5A 2GGMA 2LMUA 2LUCA 2LAPA 4MRYA 1G8IA 2D8NA 2KFHA 4WRIA 1EL4A 1QLKA 4YGAA 3CS1A 3EK8A 3TUYB 1F8HA 2A4JA 2LV7A 1SL8A 2V53A 2LHIA 5K89A 1DF0B 1F4QA 1F70A 1WDCB 3SG7A 4C0LA 1BT6A 3NSOA 3NSLA 3WHTB 1QS7A 1TNPA 1D1OA 2E6WA 5ER4X 1LKJA 2K0JA 4PE0A 1OOJA 1IGVA 1LA0A 4L9MA 2M1KB 1KFUS 1B1GA 2KQYA 2ZFDA 1WY9A 4YGEB 5G08A 3RM1A 2KYCA 1OMVA 1SW8A 1B4CA 1S6JA 1PSBA 5AANA 1TNWA 3HX4A 1AK8A 1CMGA 1SR6C 4YI8A 1QATA 2KOTA 4PE7A 1ALWA 2COLB 1A75B 1MHOA 1ZMZA 3TDIA 1QLSA 4USLA 3AAKA 3SJSA 3BXKA 3I5FB 1BR1B 1JF2A 3I5GC 4OV2A 3EKJA 1OQPA 1DGVA 2M9GA 2LM5A 4MSPA 1DVIA 2RGIA 3WXAA 4OCIA 2FJUB 2HETA 2LE9B 5CSJA 5DKQA 1NCZA 1B7TZ 1QVIY 4DS7A 4GGFC 1Q80A 2Q4UA 1QX2A 4ORAB 5HYDA 1B7TY 5CSIA 1JUOA 1SNLA 2LVJA 1RECA 2VRGA 4HREE 1DF0A 3O2PA 1CFCA 3KPXA
chains in the Genus database with same CATH superfamily
2M49B 2SCPA 3EK7A 3D77A 5CSNA 3R1OA 2ZN8A 4QJ5B 2BNXA 4YRUA 4INXA 1QVIZ 3CLNA 4DCKA 1V1GA 2LMTA 4HSZA 1NCXA 2K2AA 3S0AA 3FE9A 1M63B 2CTNA 1UHHA 3RLZA 2JQ6A 3DY9A 2JXCA 3IVTA 4P5OE 2L4IA 2LP3A 2QDIA 2PQLA 3TUYC 5DKNA 1SRAA 2I2RE 1RK9A 1LVCD 1SMGA 2FCDA 4ORBB 3DVKA 2JULA 4YBHB 3ZWHA 1SY9A 1DJGA 1KK7Z 4MEWA 1EXRA 1UHNA 2KNEA 2JRFA 2MLFC 3DVMA 3EG5B 4CPVA 4FQTA 1J7OA 1WLMA 2BBMA 5CPVA 2K7DA 2DOQA 3OX5A 2L5XB 1CFFA 3S0DA 1XO5A 3NSKA 1AJ4A 2BECA 1E8AA 1K96A 2G2BA 4GGFA 3EVVA 4ETOA 1KK8B 1MF8B 1PULA 2QEOA 1ORGA 2JT0A 3C1VA 3CZ1A 3EVUA 3F45A 3FE6A 2CCMA 1SPYA 3GK4X 2GTEA 2KI4B 1UWOA 5AFPA 4ICBA 1KFUL 3HCMA 2MRDA 2ISDA 1YX8A 2BCBA 1YX7A 1YTZC 1NP8A 1EJ3A 1M45A 2F8PA 2WCMA 3NHIA 3NXAA 1ODBA 3LK1A 2GV5A 2M29A 3D0YB 5HLOA 5J3XA 1BJFA 2K7OA 1YUSA 2NXQA 2HQWA 3L4AA 3L47A 4M2PA 2JTZA 2KFGA 3FS7A 2MBXA 1QX5B 1XVJA 1B8CA 4JQ0D 2K7CA 3KF9A 4D1EA 1MXLC 3I5HB 3NGVA 1ZUZA 1F71A 1DJXA 1TRFA 2AAOA 2JZIA 2OS8C 4PT1A 3B86A 4HRHA 2FJYA 1XFYO 2E30A 1PALA 1IH0A 1HT9A 3PM8A 2KFFA 1LINA 3SS3A 3GOFA 4XJKB 3TS5C 3BFBA 1M39A 1TIZA 2EGDA 3LLEA 4GFTA 1DEKA 5IBWA 4R1EA 1XFXO 5GQQC 2K7BA 2Y4QA 2KLEA 1KK8C 4ZCVA 1SSEB 3O4YA 1K90D 1K9PA 2M97A 3B6XA 3CZTX 3PN7B 3VRPA 5TNCA 1JFJA 2GGZA 1CTRA 2AMIA 4DRWA 2KHNA 1AHRA 1K8UA 1XYDA 1U5IA 4F7FA 3R1PA 1SKTA 1QASA 1MUXA 1ZACA 1J7RA 2ZNEA 4I5LB 1OW4A 4PE4A 4PHNA 1DTLA 1BR4B 2MHHA 2NCPA 2LVKA 4F0ZB 1J1DA 1CMFA 5HKYA 3EVRA 2KBIA 3OGNA 4UPGA 1CNPA 1J7PA 3M0WA 3PALA 4YGCB 4JKTA 1IIOA 4NDDA 4CIDA 4NQGA 1IWQA 4YGBB 1SCVA 2OTGC 1W7JB 3AKBA 1IRJA 1M46A 5DKRA 2F33A 4AQJA 4PHJA 4P2YB 1RWYA 3CR5X 2CBLA 2L4HA 1F54A 1LXFC 3QMEA 1Y1XA 1S6IA 1PK0D 2LUXA 4XYNA 1S6CA 2AUCA 2BCXA 2M3WA 2O60A 2BKHB 5I8NA 2IS9A 3ICBA 2EC6B 1SCMB 4N5XA 1A29A 2O5GA 3TZ1A 1C7VA 1QIVA 2HF5A 1SBJA 1KCYA 1FW4A 1QIWA 1TCFA 1IJ6A 1WRKA 1ZFSA 3D73A 3I5FC 3PFVA 3CZ0A 1JWDA 4ZCUA 4E68A 1H8BA 1TWOA 3DZTA 1OOFA 1GGZA 3SG4A 4IJ7A 1T14A 2BL0B 1L7ZA 1OZSA 4KYNA 1C07A 2LCPA 3PJIA 5EL2A 4I5JA 2G9BA 1CDNA 2WNDA 2KDHA 4I5KA 2PASA 5JJGA 1NIWA 2K61A 4PDZA 4XJKA 1W7IB 2P71A 1FF1A 1KK7Y 2LLUA 1V1FA 2H61C 2ZN9A 3TS5B 2FOTA 1NX1A 2JWWA 2WC5A 4CLNA 4QJ4B 1EG3A 1G33A 1KFXS 1UHIA 1TNQA 2JT3A 3CYZA 1OE9B 1UP5A 3AAJA 1GQMA 3KEVA 3O78A 4FTGA 5D69A 1Y0VH 2WCKA 3EKHA 1ALVA 1SR6B 3H4SE 1N0YA 5F6TA 4JPZB 1K94A 1QXPA 1Y6WA 2SASA 3B7AA 1CDLA 1R6PA 1TCOB 1XFUO 3FWCA 3LL8B 1KSMA 3NSIA 4GNKB 3JTDB 2LANA 4TNCA 4GGNA 5CSFA 1LA3A 4PHKA 1SYMA 5FYXA 3UO9A 1C3ZA 2BL0C 3BUXB 2LLTA 1LS8A 4A4CA 4MBEA 1QV1A 4FQOA 3SG2A 2LHLA 3CGAA 1W9ZA 2L50A 2BE4A 2FCEA 2WORA 5PALA 4OZDA 5KU1A 1FI6A 2HQ8A 2M7NA 1S3PA 1B47A 1JFKA 1NX0A 4WQ3A 2JU0A 1B9AA 2KSPA 3PLFB 5I2QA 1AUIB 2WCLA 4Q04A 1TUZA 2KQ6A 2K8MB 2KI6D 1BODA 2F2OA 1AP4A 2JT8A 1A2XA 2Y1MA 3FWBA 1QV0A 1J55A 4AOMA 3D0YA 3SG3A 2M0RA 2KGRA 1BF5A 1CLBA 2P70A 2BBNA 3D75A 4MZKA 3WHUB 1CKKA 4BY5A 4GBAA 3VRNA 5HLVA 3FE8A 3IQQA 1IQ3A 3A4UB 3TDZA 1NPQA 1OZOA 1SK6D 2WCJA 3L4LA 1WLZA 4JD9A 1N65A 1RTP1 1PVBA 1PRWA 2P6BB 3DF0B 3I5GB 1HQVA 1WRLA 3SG6A 2LNKA 1NUBA 3VRRA 1JC2A 3JVTB 3BUOB 2H2KA 1QWVA 2PALA 2MJWB 1NYAA 2KAXA 2WC8A 2JXLA 4I5NB 1CLMA 2NCOA 1MQ1A 2JNXA 3PN7C 3UNWA 3I5IB 3GK1A 2ZRSA 1YUTA 4MN0A 1DT7B 1BOCA 3E3RA 3DD4A 1DMOA 3R72A 3AKAA 2MAZA 3WNXB 1PVAA 2NZ0A 3SIBA 3V2LA 4N1FA 4GAOA 4A4BA 3DVEA 3OB1B 4INWA 1JSAA 1YURA 2PMYA 2WCHA 2K60A 1Z4HA 2Y1NA 4CFRA 2LVIA 1B8RA 2L5YA 1IJ5A 3BJHA 5FI2A 5HKZA 1TTXA 3OX6A 1JF0A 1N2DA 2I7AA 3I5HC 3VRQA 1K95A 2MLEC 4PE1A 3VGOA 5DICA 1KWOC 4MVFA 4DUQA 3PATA 2ZNDA 1NX2A 1CM1A 1SL9A 1M31A 2QPTA 1U5IB 2LLSA 2KLDA 5FI6A 2Q91A 4OKHA 1KQVA 4M2QA 3MSEB 3SIAA 3VB1A 2H8VA 5I94A 2KAVA 2LVVA 3BOWA 4WQ2A 3S0FA 1XK4C 2JNFA 1P28A 3IF7A 1Y1UA 1EH2A 3SG5A 4ORCB 1SCMC 2NLNA 1CB1A 1A03A 4PCWA 1FPWA 1F4OA 1A4PA 4M2OA 2WC6A 2TN4A 1X02A 1F55A 5KSZA 1XFVO 4C0KA 4MZJA 4GUKA 3B88A 5I2LA 2I94A 1WDCC 3TDUA 1XFWO 1IKUA 4N1GA 1NWDA 1CDPA 5KTYA 3BFHA 1VRKA 3KO0A 2KI6C 2EC6C 3A8RA 4C0JA 1ZOTB 2ERBA 3BUMB 1YUUA 3D76A 2QEVA 2JPOA 3BYAA 1OOGA 2BCAA 2WOSA 2WCFA 3CR2A 1XFZO 3BQ3A 1L2OB 1RROA 2L0PA 5D7FA 2PVBA 2BE6A 1NX3A 3QRXA 4HRGA 1DGUA 2KAYA 3ZNIA 3NHTA 1KFXL 1YRUB 4PHMA 1DELA 1JBAA 2PRUA 2CXJA 1K93D 1QJTA 1NSHA 2KGBC 2H61A 1CFDA 3O4XA 3EK4A 1RFJA 4YI9A 3S0EA 1OMDA 1S1EA 2JPTA 1MXEA 1K9UA 2LMVA 3BOWB 1CDMA 2PYQA 3PSRA 1K9KA 1BLQA 1S36A 1BG1A 1AJ5A 5B8IB 3D74A 2OTGB 2JOJA 3JTDC 1DJIA 1GGWA 1C7WA 3O6BA 2OS8B 1B8LA 1GJYA 4MRXA 1IG5A 1TOPA 1TNXA 2CT9A 3DVJA 1UURA 4NDBA 2KYFA 4AQIA 3K1EA 3IQOA 5HKWA 3BFAA 3FIAA 2OPOA 1DJWA 1EG4A 1KSOA 2L98A 4GPLB 4PALA 1AVSA 1KWOB 4MZLA 1TN4A 4U8DA 1H4BA 3CR4X 3N7HA 3D10A 1MWNA 1S26D 1S5GZ 2F3ZA 3D78A 1DJZA 2B1UA 2I18A 5JOLA 3VROA 2JC2A 3OP0A 1DJHA 2L51A 3CWGA 1NCYA 1CM4A 2KI4C 2KBMA 2MA2A 5AERA 3DYEA 1J7QA 1OMRA 1FBVA 1MR8A 3BUNB 2WCBA 1CFPA 3B87A 3I5IC 3KHEA 4DIRA 2QACA 1FI5A 1BU3A 1BMOA 3PM2A 4OVNF 3OHMB 1DC1A 3BUWB 2PSRA 3K21A 4JWQA 1XK4A 2BAPA 1Z2CB 1UHJA 1XFRA 2QEBA 3DXLA 2K2FA 1UUSA 3DF0A 1SL7A 3LCPC 4OR9B 5AEQA 2JTTA 1G4YR 4BY4A 3CTNA 4MLWA 2M7LA 2CNPA 4IL1A 2R2IA 4QJ3B 1QTXA 1R2UA 4YGDB 1XA5A 1J1EA 2HPSA 2WCEA 2M1UA 2ZRTA 2F2PA 2L2EA 1UHKA 3LK0A 2Y5IA 1Y1AA 3GK2A 4NDCA 5AXIA 1C3YA 1YVHA 1WRZA 1DJYA 3JVTC 5BPJA 1YRTB 2M8UA 2LP2A 1YVLA 1KQMC 2EHBA 2F3YA 1CLLA 1YR5A 1IQ5A 3OB2B 1S5GY 5I2OA 4CFQA 1QX7A 1A75A 1PSRA 3RZSA 5ER5A 2ZKMX 3CABA 2BKIB 1KQMB 1K2HA 1L2OC 1OSAA 1RJVA 2LC5A 2GGMA 2LMUA 1TUJA 2LUCA 2LAPA 3SS4A 4MRYA 1G8IA 2D8NA 2KFHA 3R1VA 4WRIA 1EL4A 1QLKA 1DQEA 2L2CA 3CS1A 3EK8A 4YGAA 3TUYB 1OOIX 1F8HA 2A4JA 2LV7A 1SL8A 2V53A 2LHIA 1GM0A 5K89A 1DF0B 1F4QA 2KPHA 1F70A 1WDCB 3SG7A 4C0LA 1BT6A 3NSOA 3NSLA 3WHTB 1QS7A 1TNPA 3CZ2A 3S0BA 2E6WA 5ER4X 3SS5A 1D1OA 1LKJA 2K0JA 4PE0A 1OOJA 1IGVA 1LA0A 4L9MA 2M1KB 1KFUS 1B1GA 2KQYA 1OOHA 2ZFDA 1WY9A 4YGEB 5G08A 3RM1A 2KYCA 1OMVA 1SW8A 1B4CA 1S6JA 1PSBA 5AANA 1TNWA 3HX4A 1AK8A 1CMGA 1SR6C 4YI8A 1QATA 2KOTA 4PE7A 1ALWA 2COLB 1A75B 1MHOA 1ZMZA 3TDIA 1QLSA 4USLA 3AAKA 3SJSA 3BXKA 3I5FB 3OBVA 1BR1B 1JF2A 3I5GC 4OV2A 3EKJA 1OQPA 1DGVA 2M9GA 2LM5A 4MSPA 3S0GA 1DVIA 2RGIA 3WXAA 4OCIA 2FJUB 2HETA 2LE9B 5CSJA 5DKQA 1NCZA 2YGUA 1B7TZ 3Q8IA 1QVIY 2QEHA 4DS7A 4GGFC 1Q80A 2Q4UA 1QX2A 4ORAB 5HYDA 1B7TY 5CSIA 1JUOA 1SNLA 3CDNA 2LVJA 1RECA 2VRGA 4HREE 1DF0A 3O2PA 5D3OA 5FI7A 5HL1A 1CFCA 3KPXA
chains in the Genus database with same CATH topology
2M49B 2SCPA 3EK7A 5CSNA 2ZN8A 4QJ5B 4YRUA 1QVIZ 3CLNA 4DCKA 1V1GA 2LMTA 4HSZA 1NCXA 2K2AA 1M63B 2CTNA 1UHHA 3RLZA 2JQ6A 2JXCA 4P5OE 2L4IA 2LP3A 3TUYC 5DKNA 1SRAA 2I2RE 1RK9A 1LVCD 1SMGA 2FCDA 4ORBB 3DVKA 2JULA 4YBHB 3ZWHA 1SY9A 1DJGA 1KK7Z 4MEWA 1EXRA 1UHNA 2KNEA 2JRFA 2MLFC 3DVMA 4CPVA 1J7OA 1WLMA 2BBMA 5CPVA 2K7DA 2DOQA 3OX5A 2L5XB 1CFFA 1XO5A 3NSKA 1AJ4A 2BECA 1E8AA 1K96A 2G2BA 4GGFA 3EVVA 4ETOA 1KK8B 1MF8B 1PULA 3C1VA 2JT0A 3F45A 3EVUA 2CCMA 1SPYA 3GK4X 2KI4B 1UWOA 5AFPA 4ICBA 1KFUL 3HCMA 2MRDA 2ISDA 1YX8A 2BCBA 1YX7A 1YTZC 1NP8A 1EJ3A 1M45A 2F8PA 3NXAA 1ODBA 3LK1A 2GV5A 2M29A 3D0YB 5HLOA 5J3XA 1BJFA 2K7OA 1YUSA 2NXQA 2HQWA 4M2PA 2JTZA 2KFGA 3FS7A 2MBXA 1QX5B 1XVJA 1B8CA 4JQ0D 2K7CA 3KF9A 4D1EA 1MXLC 3I5HB 1ZUZA 1F71A 1DJXA 1TRFA 2AAOA 2JZIA 2OS8C 4HRHA 1XFYO 2E30A 1PALA 1IH0A 1HT9A 3PM8A 2KFFA 1LINA 3GOFA 4XJKB 3TS5C 1M39A 1TIZA 2EGDA 3LLEA 4GFTA 5IBWA 4R1EA 1XFXO 5GQQC 2K7BA 2Y4QA 1KK8C 4ZCVA 3O4YA 1K90D 1K9PA 2M97A 3CZTX 3PN7B 3VRPA 5TNCA 1JFJA 2GGZA 1CTRA 2AMIA 4DRWA 2KHNA 1AHRA 1K8UA 1XYDA 1U5IA 1SKTA 1QASA 1MUXA 1ZACA 1J7RA 2ZNEA 4I5LB 4PE4A 4PHNA 1DTLA 1BR4B 2MHHA 2NCPA 2LVKA 4F0ZB 1J1DA 1CMFA 5HKYA 3EVRA 2KBIA 4UPGA 1CNPA 1J7PA 3M0WA 3PALA 4YGCB 4NDDA 4CIDA 4NQGA 1IWQA 4YGBB 1SCVA 2OTGC 1W7JB 3AKBA 1IRJA 1M46A 5DKRA 2F33A 4AQJA 4PHJA 4P2YB 1RWYA 3CR5X 2CBLA 2L4HA 1F54A 1LXFC 1Y1XA 1S6IA 1PK0D 2LUXA 4XYNA 1S6CA 2AUCA 2BCXA 2M3WA 2O60A 2BKHB 5I8NA 2IS9A 3ICBA 2EC6B 1SCMB 4N5XA 1A29A 2O5GA 3TZ1A 1C7VA 1QIVA 2HF5A 1SBJA 1KCYA 1FW4A 1QIWA 1TCFA 1IJ6A 1WRKA 1ZFSA 3I5FC 3PFVA 1JWDA 4ZCUA 4E68A 1H8BA 1GGZA 3SG4A 2BL0B 1L7ZA 1OZSA 1C07A 2LCPA 4I5JA 2G9BA 1CDNA 2WNDA 2KDHA 4I5KA 2PASA 5JJGA 1NIWA 2K61A 4PDZA 4XJKA 1W7IB 1FF1A 1KK7Y 2LLUA 1V1FA 2H61C 2ZN9A 3TS5B 2FOTA 1NX1A 2JWWA 4CLNA 4QJ4B 1EG3A 1G33A 1KFXS 1UHIA 1TNQA 2JT3A 3O78A 1OE9B 1UP5A 3AAJA 1GQMA 3KEVA 4FTGA 5D69A 1Y0VH 3EKHA 1ALVA 1SR6B 3H4SE 1N0YA 5F6TA 4JPZB 1K94A 1QXPA 1Y6WA 2SASA 3FWCA 1CDLA 1R6PA 1TCOB 1XFUO 3NSIA 3LL8B 1KSMA 4GNKB 3JTDB 2LANA 4TNCA 4GGNA 5CSFA 1LA3A 4PHKA 1SYMA 5FYXA 2BL0C 3BUXB 2LLTA 4A4CA 4MBEA 1QV1A 4FQOA 3SG2A 2LHLA 3CGAA 2L50A 2BE4A 2FCEA 2WORA 5PALA 5KU1A 1FI6A 2HQ8A 2M7NA 1S3PA 1B47A 1JFKA 1NX0A 4WQ3A 2JU0A 1B9AA 2KSPA 3PLFB 5I2QA 1AUIB 4Q04A 2KQ6A 2K8MB 2KI6D 1BODA 2F2OA 1AP4A 2JT8A 1A2XA 2Y1MA 3FWBA 1QV0A 1J55A 4AOMA 3D0YA 3SG3A 2M0RA 2KGRA 1BF5A 1CLBA 2BBNA 4MZKA 3WHUB 1CKKA 4BY5A 4GBAA 3VRNA 5HLVA 3IQQA 1IQ3A 3A4UB 3TDZA 1NPQA 1OZOA 1SK6D 1WLZA 1N65A 1RTP1 1PVBA 1PRWA 2P6BB 3DF0B 3I5GB 1HQVA 1WRLA 3SG6A 2LNKA 1NUBA 3VRRA 1JC2A 3JVTB 3BUOB 2H2KA 2PALA 2MJWB 1NYAA 2KAXA 2WC8A 2JXLA 4I5NB 1CLMA 2NCOA 1MQ1A 2JNXA 3PN7C 3I5IB 3GK1A 2ZRSA 1YUTA 4MN0A 1DT7B 1BOCA 3E3RA 3DD4A 1DMOA 3WNXB 3AKAA 2MAZA 1PVAA 2NZ0A 3SIBA 4N1FA 4GAOA 4A4BA 3DVEA 3OB1B 1JSAA 1YURA 2PMYA 4CFRA 2Y1NA 2LVIA 1B8RA 5HKZA 1IJ5A 1TTXA 3OX6A 1JF0A 1N2DA 2I7AA 3I5HC 3VRQA 1K95A 2MLEC 4PE1A 3VGOA 1KWOC 4MVFA 4DUQA 3PATA 2ZNDA 1NX2A 1CM1A 1SL9A 1M31A 2QPTA 1U5IB 2LLSA 2Q91A 4OKHA 1KQVA 4M2QA 3MSEB 3SIAA 2KAVA 2LVVA 3BOWA 4WQ2A 1XK4C 2JNFA 3IF7A 1Y1UA 1EH2A 3SG5A 4ORCB 1SCMC 2NLNA 1CB1A 1A03A 4PCWA 1FPWA 1F4OA 1A4PA 4M2OA 2TN4A 1X02A 1F55A 5KSZA 1XFVO 4C0KA 4MZJA 4GUKA 5I2LA 2I94A 1WDCC 3TDUA 1XFWO 1IKUA 4N1GA 1NWDA 1CDPA 5KTYA 3KO0A 1VRKA 2KI6C 2EC6C 3A8RA 4C0JA 1ZOTB 3BUMB 1YUUA 3BYAA 2BCAA 2WOSA 2WCFA 3CR2A 1XFZO 3BQ3A 1L2OB 1RROA 2L0PA 5D7FA 2PVBA 2BE6A 1NX3A 3QRXA 4HRGA 1DGUA 2KAYA 3ZNIA 1KFXL 1YRUB 4PHMA 1JBAA 2PRUA 2CXJA 1K93D 1QJTA 1NSHA 2KGBC 2H61A 1CFDA 4YI9A 3EK4A 1RFJA 1OMDA 1S1EA 2JPTA 1MXEA 1K9UA 2LMVA 3BOWB 1CDMA 3PSRA 1K9KA 1BLQA 1S36A 1BG1A 1AJ5A 5B8IB 2OTGB 2JOJA 3JTDC 1DJIA 1GGWA 1C7WA 3O6BA 2OS8B 1B8LA 1GJYA 4MRXA 1IG5A 1TOPA 1TNXA 2CT9A 3DVJA 1UURA 4NDBA 2KYFA 4AQIA 3IQOA 5HKWA 3FIAA 2OPOA 1DJWA 1EG4A 1KSOA 2L98A 4GPLB 4PALA 1AVSA 1KWOB 4MZLA 1TN4A 4U8DA 1H4BA 3CR4X 3D10A 1MWNA 1S26D 2F3ZA 1S5GZ 1DJZA 2B1UA 2I18A 5JOLA 3VROA 2JC2A 3OP0A 1DJHA 2L51A 3CWGA 1NCYA 1CM4A 2KI4C 2KBMA 2MA2A 5AERA 1J7QA 1OMRA 1FBVA 1MR8A 3BUNB 2WCBA 1CFPA 3I5IC 3KHEA 4DIRA 2QACA 1FI5A 1BU3A 1BMOA 4OVNF 3OHMB 3BUWB 2PSRA 3K21A 4JWQA 1XK4A 1UHJA 2K2FA 1UUSA 3DF0A 1SL7A 3LCPC 4OR9B 5AEQA 2JTTA 1G4YR 4BY4A 3CTNA 4MLWA 2M7LA 2CNPA 4IL1A 2R2IA 4QJ3B 1QTXA 1R2UA 4YGDB 1XA5A 1J1EA 2HPSA 2WCEA 2M1UA 2ZRTA 2F2PA 2L2EA 1UHKA 3LK0A 2Y5IA 1Y1AA 3GK2A 4NDCA 5AXIA 1YVHA 1WRZA 1DJYA 3JVTC 5BPJA 1YRTB 2M8UA 2LP2A 1YVLA 1KQMC 2EHBA 2F3YA 1CLLA 1YR5A 1IQ5A 3OB2B 1S5GY 5I2OA 4CFQA 1QX7A 1A75A 1PSRA 5ER5A 2ZKMX 2BKIB 1KQMB 1K2HA 1L2OC 1OSAA 1RJVA 2LC5A 2GGMA 2LMUA 2LUCA 2LAPA 4MRYA 1G8IA 2D8NA 2KFHA 4WRIA 1EL4A 1QLKA 4YGAA 3CS1A 3EK8A 3TUYB 1F8HA 2A4JA 2LV7A 1SL8A 2V53A 2LHIA 5K89A 1DF0B 1F4QA 1F70A 1WDCB 3SG7A 4C0LA 1BT6A 3NSOA 3NSLA 3WHTB 1QS7A 1TNPA 1D1OA 2E6WA 5ER4X 1LKJA 2K0JA 4PE0A 1OOJA 1IGVA 1LA0A 4L9MA 2M1KB 1KFUS 1B1GA 2KQYA 2ZFDA 1WY9A 4YGEB 5G08A 3RM1A 2KYCA 1OMVA 1SW8A 1B4CA 1S6JA 1PSBA 5AANA 1TNWA 3HX4A 1AK8A 1CMGA 1SR6C 4YI8A 1QATA 2KOTA 4PE7A 1ALWA 2COLB 1A75B 1MHOA 1ZMZA 3TDIA 1QLSA 4USLA 3AAKA 3SJSA 3BXKA 3I5FB 1BR1B 1JF2A 3I5GC 4OV2A 3EKJA 1OQPA 1DGVA 2M9GA 2LM5A 4MSPA 1DVIA 2RGIA 3WXAA 4OCIA 2FJUB 2HETA 2LE9B 5CSJA 5DKQA 1NCZA 1B7TZ 1QVIY 4DS7A 4GGFC 1Q80A 2Q4UA 1QX2A 4ORAB 5HYDA 1B7TY 5CSIA 1JUOA 1SNLA 2LVJA 1RECA 2VRGA 4HREE 1DF0A 3O2PA 1CFCA 3KPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M49 B;  2SCP A;  3EK7 A;  5CSN A;  2ZN8 A;  4QJ5 B;  4YRU A;  1QVI Z;  3CLN A;  4DCK A;  1V1G A;  2LMT A;  4HSZ A;  1NCX A;  2K2A A;  1M63 B;  2CTN A;  1UHH A;  3RLZ A;  2JQ6 A;  2JXC A;  4P5O E;  2L4I A;  2LP3 A;  3TUY C;  5DKN A;  1SRA A;  2I2R E;  1RK9 A;  1LVC D;  1SMG A;  2FCD A;  4ORB B;  3DVK A;  2JUL A;  4YBH B;  3ZWH A;  1SY9 A;  1DJG A;  1KK7 Z;  4MEW A;  1EXR A;  1UHN A;  2KNE A;  2JRF A;  2MLF C;  3DVM A;  4CPV A;  1J7O A;  1WLM A;  2BBM A;  5CPV A;  2K7D A;  2DOQ A;  3OX5 A;  2L5X B;  1CFF A;  1XO5 A;  3NSK A;  1AJ4 A;  2BEC A;  1E8A A;  1K96 A;  2G2B A;  4GGF A;  3EVV A;  4ETO A;  1KK8 B;  1MF8 B;  1PUL A;  3C1V A;  2JT0 A;  3F45 A;  3EVU A;  2CCM A;  1SPY A;  3GK4 X;  2KI4 B;  1UWO A;  5AFP A;  4ICB A;  1KFU L;  3HCM A;  2MRD A;  2ISD A;  1YX8 A;  2BCB A;  1YX7 A;  1YTZ C;  1NP8 A;  1EJ3 A;  1M45 A;  2F8P A;  3NXA A;  1ODB A;  3LK1 A;  2GV5 A;  2M29 A;  3D0Y B;  5HLO A;  5J3X A;  1BJF A;  2K7O A;  1YUS A;  2NXQ A;  2HQW A;  4M2P A;  2JTZ A;  2KFG A;  3FS7 A;  2MBX A;  1QX5 B;  1XVJ A;  1B8C A;  4JQ0 D;  2K7C A;  3KF9 A;  4D1E A;  1MXL C;  3I5H B;  1ZUZ A;  1F71 A;  1DJX A;  1TRF A;  2AAO A;  2JZI A;  2OS8 C;  4HRH A;  1XFY O;  2E30 A;  1PAL A;  1IH0 A;  1HT9 A;  3PM8 A;  2KFF A;  1LIN A;  3GOF A;  4XJK B;  3TS5 C;  1M39 A;  1TIZ A;  2EGD A;  3LLE A;  4GFT A;  5IBW A;  4R1E A;  1XFX O;  5GQQ C;  2K7B A;  2Y4Q A;  1KK8 C;  4ZCV A;  3O4Y A;  1K90 D;  1K9P A;  2M97 A;  3CZT X;  3PN7 B;  3VRP A;  5TNC A;  1JFJ A;  2GGZ A;  1CTR A;  2AMI A;  4DRW A;  2KHN A;  1AHR A;  1K8U A;  1XYD A;  1U5I A;  1SKT A;  1QAS A;  1MUX A;  1ZAC A;  1J7R A;  2ZNE A;  4I5L B;  4PE4 A;  4PHN A;  1DTL A;  1BR4 B;  2MHH A;  2NCP A;  2LVK A;  4F0Z B;  1J1D A;  1CMF A;  5HKY A;  3EVR A;  2KBI A;  4UPG A;  1CNP A;  1J7P A;  3M0W A;  3PAL A;  4YGC B;  4NDD A;  4CID A;  4NQG A;  1IWQ A;  4YGB B;  1SCV A;  2OTG C;  1W7J B;  3AKB A;  1IRJ A;  1M46 A;  5DKR A;  2F33 A;  4AQJ A;  4PHJ A;  4P2Y B;  1RWY A;  3CR5 X;  2CBL A;  2L4H A;  1F54 A;  1LXF C;  1Y1X A;  1S6I A;  1PK0 D;  2LUX A;  4XYN A;  1S6C A;  2AUC A;  2BCX A;  2M3W A;  2O60 A;  2BKH B;  5I8N A;  2IS9 A;  3ICB A;  2EC6 B;  1SCM B;  4N5X A;  1A29 A;  2O5G A;  3TZ1 A;  1C7V A;  1QIV A;  2HF5 A;  1SBJ A;  1KCY A;  1FW4 A;  1QIW A;  1TCF A;  1IJ6 A;  1WRK A;  1ZFS A;  3I5F C;  3PFV A;  1JWD A;  4ZCU A;  4E68 A;  1H8B A;  1GGZ A;  3SG4 A;  2BL0 B;  1L7Z A;  1OZS A;  1C07 A;  2LCP A;  4I5J A;  2G9B A;  1CDN A;  2WND A;  2KDH A;  4I5K A;  2PAS A;  5JJG A;  1NIW A;  2K61 A;  4PDZ A;  4XJK A;  1W7I B;  1FF1 A;  1KK7 Y;  2LLU A;  1V1F A;  2H61 C;  2ZN9 A;  3TS5 B;  2FOT A;  1NX1 A;  2JWW A;  4CLN A;  4QJ4 B;  1EG3 A;  1G33 A;  1KFX S;  1UHI A;  1TNQ A;  2JT3 A;  3O78 A;  1OE9 B;  1UP5 A;  3AAJ A;  1GQM A;  3KEV A;  4FTG A;  5D69 A;  1Y0V H;  3EKH A;  1ALV A;  1SR6 B;  3H4S E;  1N0Y A;  5F6T A;  4JPZ B;  1K94 A;  1QXP A;  1Y6W A;  2SAS A;  3FWC A;  1CDL A;  1R6P A;  1TCO B;  1XFU O;  3NSI A;  3LL8 B;  1KSM A;  4GNK B;  3JTD B;  2LAN A;  4TNC A;  4GGN A;  5CSF A;  1LA3 A;  4PHK A;  1SYM A;  5FYX A;  2BL0 C;  3BUX B;  2LLT A;  4A4C A;  4MBE A;  1QV1 A;  4FQO A;  3SG2 A;  2LHL A;  3CGA A;  2L50 A;  2BE4 A;  2FCE A;  2WOR A;  5PAL A;  5KU1 A;  1FI6 A;  2HQ8 A;  2M7N A;  1S3P A;  1B47 A;  1JFK A;  1NX0 A;  4WQ3 A;  2JU0 A;  1B9A A;  2KSP A;  3PLF B;  5I2Q A;  1AUI B;  4Q04 A;  2KQ6 A;  2K8M B;  2KI6 D;  1BOD A;  2F2O A;  1AP4 A;  2JT8 A;  1A2X A;  2Y1M A;  3FWB A;  1QV0 A;  1J55 A;  4AOM A;  3D0Y A;  3SG3 A;  2M0R A;  2KGR A;  1BF5 A;  1CLB A;  2BBN A;  4MZK A;  3WHU B;  1CKK A;  4BY5 A;  4GBA A;  3VRN A;  5HLV A;  3IQQ A;  1IQ3 A;  3A4U B;  3TDZ A;  1NPQ A;  1OZO A;  1SK6 D;  1WLZ A;  1N65 A;  1RTP 1;  1PVB A;  1PRW A;  2P6B B;  3DF0 B;  3I5G B;  1HQV A;  1WRL A;  3SG6 A;  2LNK A;  1NUB A;  3VRR A;  1JC2 A;  3JVT B;  3BUO B;  2H2K A;  2PAL A;  2MJW B;  1NYA A;  2KAX A;  2WC8 A;  2JXL A;  4I5N B;  1CLM A;  2NCO A;  1MQ1 A;  2JNX A;  3PN7 C;  3I5I B;  3GK1 A;  2ZRS A;  1YUT A;  4MN0 A;  1DT7 B;  1BOC A;  3E3R A;  3DD4 A;  1DMO A;  3WNX B;  3AKA A;  2MAZ A;  1PVA A;  2NZ0 A;  3SIB A;  4N1F A;  4GAO A;  4A4B A;  3DVE A;  3OB1 B;  1JSA A;  1YUR A;  2PMY A;  4CFR A;  2Y1N A;  2LVI A;  1B8R A;  5HKZ A;  1IJ5 A;  1TTX A;  3OX6 A;  1JF0 A;  1N2D A;  2I7A A;  3I5H C;  3VRQ A;  1K95 A;  2MLE C;  4PE1 A;  3VGO A;  1KWO C;  4MVF A;  4DUQ A;  3PAT A;  2ZND A;  1NX2 A;  1CM1 A;  1SL9 A;  1M31 A;  2QPT A;  1U5I B;  2LLS A;  2Q91 A;  4OKH A;  1KQV A;  4M2Q A;  3MSE B;  3SIA A;  2KAV A;  2LVV A;  3BOW A;  4WQ2 A;  1XK4 C;  2JNF A;  3IF7 A;  1Y1U A;  1EH2 A;  3SG5 A;  4ORC B;  1SCM C;  2NLN A;  1CB1 A;  1A03 A;  4PCW A;  1FPW A;  1F4O A;  1A4P A;  4M2O A;  2TN4 A;  1X02 A;  1F55 A;  5KSZ A;  1XFV O;  4C0K A;  4MZJ A;  4GUK A;  5I2L A;  2I94 A;  1WDC C;  3TDU A;  1XFW O;  1IKU A;  4N1G A;  1NWD A;  1CDP A;  5KTY A;  3KO0 A;  1VRK A;  2KI6 C;  2EC6 C;  3A8R A;  4C0J A;  1ZOT B;  3BUM B;  1YUU A;  3BYA A;  2BCA A;  2WOS A;  2WCF A;  3CR2 A;  1XFZ O;  3BQ3 A;  1L2O B;  1RRO A;  2L0P A;  5D7F A;  2PVB A;  2BE6 A;  1NX3 A;  3QRX A;  4HRG A;  1DGU A;  2KAY A;  3ZNI A;  1KFX L;  1YRU B;  4PHM A;  1JBA A;  2PRU A;  2CXJ A;  1K93 D;  1QJT A;  1NSH A;  2KGB C;  2H61 A;  1CFD A;  4YI9 A;  3EK4 A;  1RFJ A;  1OMD A;  1S1E A;  2JPT A;  1MXE A;  1K9U A;  2LMV A;  3BOW B;  1CDM A;  3PSR A;  1K9K A;  1BLQ A;  1S36 A;  1BG1 A;  1AJ5 A;  5B8I B;  2OTG B;  2JOJ A;  3JTD C;  1DJI A;  1GGW A;  1C7W A;  3O6B A;  2OS8 B;  1B8L A;  1GJY A;  4MRX A;  1IG5 A;  1TOP A;  1TNX A;  2CT9 A;  3DVJ A;  1UUR A;  4NDB A;  2KYF A;  4AQI A;  3IQO A;  5HKW A;  3FIA A;  2OPO A;  1DJW A;  1EG4 A;  1KSO A;  2L98 A;  4GPL B;  4PAL A;  1AVS A;  1KWO B;  4MZL A;  1TN4 A;  4U8D A;  1H4B A;  3CR4 X;  3D10 A;  1MWN A;  1S26 D;  2F3Z A;  1S5G Z;  1DJZ A;  2B1U A;  2I18 A;  5JOL A;  3VRO A;  2JC2 A;  3OP0 A;  1DJH A;  2L51 A;  3CWG A;  1NCY A;  1CM4 A;  2KI4 C;  2KBM A;  2MA2 A;  5AER A;  1J7Q A;  1OMR A;  1FBV A;  1MR8 A;  3BUN B;  2WCB A;  1CFP A;  3I5I C;  3KHE A;  4DIR A;  2QAC A;  1FI5 A;  1BU3 A;  1BMO A;  4OVN F;  3OHM B;  3BUW B;  2PSR A;  3K21 A;  4JWQ A;  1XK4 A;  1UHJ A;  2K2F A;  1UUS A;  3DF0 A;  1SL7 A;  3LCP C;  4OR9 B;  5AEQ A;  2JTT A;  1G4Y R;  4BY4 A;  3CTN A;  4MLW A;  2M7L A;  2CNP A;  4IL1 A;  2R2I A;  4QJ3 B;  1QTX A;  1R2U A;  4YGD B;  1XA5 A;  1J1E A;  2HPS A;  2WCE A;  2M1U A;  2ZRT A;  2F2P A;  2L2E A;  1UHK A;  3LK0 A;  2Y5I A;  1Y1A A;  3GK2 A;  4NDC A;  5AXI A;  1YVH A;  1WRZ A;  1DJY A;  3JVT C;  5BPJ A;  1YRT B;  2M8U A;  2LP2 A;  1YVL A;  1KQM C;  2EHB A;  2F3Y A;  1CLL A;  1YR5 A;  1IQ5 A;  3OB2 B;  1S5G Y;  5I2O A;  4CFQ A;  1QX7 A;  1A75 A;  1PSR A;  5ER5 A;  2ZKM X;  2BKI B;  1KQM B;  1K2H A;  1L2O C;  1OSA A;  1RJV A;  2LC5 A;  2GGM A;  2LMU A;  2LUC A;  2LAP A;  4MRY A;  1G8I A;  2D8N A;  2KFH A;  4WRI A;  1EL4 A;  1QLK A;  4YGA A;  3CS1 A;  3EK8 A;  3TUY B;  1F8H A;  2A4J A;  2LV7 A;  1SL8 A;  2V53 A;  2LHI A;  5K89 A;  1DF0 B;  1F4Q A;  1F70 A;  1WDC B;  3SG7 A;  4C0L A;  1BT6 A;  3NSO A;  3NSL A;  3WHT B;  1QS7 A;  1TNP A;  1D1O A;  2E6W A;  5ER4 X;  1LKJ A;  2K0J A;  4PE0 A;  1OOJ A;  1IGV A;  1LA0 A;  4L9M A;  2M1K B;  1KFU S;  1B1G A;  2KQY A;  2ZFD A;  1WY9 A;  4YGE B;  5G08 A;  3RM1 A;  2KYC A;  1OMV A;  1SW8 A;  1B4C A;  1S6J A;  1PSB A;  5AAN A;  1TNW A;  3HX4 A;  1AK8 A;  1CMG A;  1SR6 C;  4YI8 A;  1QAT A;  2KOT A;  4PE7 A;  1ALW A;  2COL B;  1A75 B;  1MHO A;  1ZMZ A;  3TDI A;  1QLS A;  4USL A;  3AAK A;  3SJS A;  3BXK A;  3I5F B;  1BR1 B;  1JF2 A;  3I5G C;  4OV2 A;  3EKJ A;  1OQP A;  1DGV A;  2M9G A;  2LM5 A;  4MSP A;  1DVI A;  2RGI A;  3WXA A;  4OCI A;  2FJU B;  2HET A;  2LE9 B;  5CSJ A;  5DKQ A;  1NCZ A;  1B7T Z;  1QVI Y;  4DS7 A;  4GGF C;  1Q80 A;  2Q4U A;  1QX2 A;  4ORA B;  5HYD A;  1B7T Y;  5CSI A;  1JUO A;  1SNL A;  2LVJ A;  1REC A;  2VRG A;  4HRE E;  1DF0 A;  3O2P A;  1CFC A;  3KPX A; 
#chains in the Genus database with same CATH topology
 2M49 B;  2SCP A;  3EK7 A;  3D77 A;  5CSN A;  3R1O A;  2ZN8 A;  4QJ5 B;  2BNX A;  4YRU A;  4INX A;  1QVI Z;  3CLN A;  4DCK A;  1V1G A;  2LMT A;  4HSZ A;  1NCX A;  2K2A A;  3S0A A;  3FE9 A;  1M63 B;  2CTN A;  1UHH A;  3RLZ A;  2JQ6 A;  3DY9 A;  2JXC A;  3IVT A;  4P5O E;  2L4I A;  2LP3 A;  2QDI A;  2PQL A;  3TUY C;  5DKN A;  1SRA A;  2I2R E;  1RK9 A;  1LVC D;  1SMG A;  2FCD A;  4ORB B;  3DVK A;  2JUL A;  4YBH B;  3ZWH A;  1SY9 A;  1DJG A;  1KK7 Z;  4MEW A;  1EXR A;  1UHN A;  2KNE A;  2JRF A;  2MLF C;  3DVM A;  3EG5 B;  4CPV A;  4FQT A;  1J7O A;  1WLM A;  2BBM A;  5CPV A;  2K7D A;  2DOQ A;  3OX5 A;  2L5X B;  1CFF A;  3S0D A;  1XO5 A;  3NSK A;  1AJ4 A;  2BEC A;  1E8A A;  1K96 A;  2G2B A;  4GGF A;  3EVV A;  4ETO A;  1KK8 B;  1MF8 B;  1PUL A;  2QEO A;  1ORG A;  2JT0 A;  3C1V A;  3CZ1 A;  3EVU A;  3F45 A;  3FE6 A;  2CCM A;  1SPY A;  3GK4 X;  2GTE A;  2KI4 B;  1UWO A;  5AFP A;  4ICB A;  1KFU L;  3HCM A;  2MRD A;  2ISD A;  1YX8 A;  2BCB A;  1YX7 A;  1YTZ C;  1NP8 A;  1EJ3 A;  1M45 A;  2F8P A;  2WCM A;  3NHI A;  3NXA A;  1ODB A;  3LK1 A;  2GV5 A;  2M29 A;  3D0Y B;  5HLO A;  5J3X A;  1BJF A;  2K7O A;  1YUS A;  2NXQ A;  2HQW A;  3L4A A;  3L47 A;  4M2P A;  2JTZ A;  2KFG A;  3FS7 A;  2MBX A;  1QX5 B;  1XVJ A;  1B8C A;  4JQ0 D;  2K7C A;  3KF9 A;  4D1E A;  1MXL C;  3I5H B;  3NGV A;  1ZUZ A;  1F71 A;  1DJX A;  1TRF A;  2AAO A;  2JZI A;  2OS8 C;  4PT1 A;  3B86 A;  4HRH A;  2FJY A;  1XFY O;  2E30 A;  1PAL A;  1IH0 A;  1HT9 A;  3PM8 A;  2KFF A;  1LIN A;  3SS3 A;  3GOF A;  4XJK B;  3TS5 C;  3BFB A;  1M39 A;  1TIZ A;  2EGD A;  3LLE A;  4GFT A;  1DEK A;  5IBW A;  4R1E A;  1XFX O;  5GQQ C;  2K7B A;  2Y4Q A;  2KLE A;  1KK8 C;  4ZCV A;  1SSE B;  3O4Y A;  1K90 D;  1K9P A;  2M97 A;  3B6X A;  3CZT X;  3PN7 B;  3VRP A;  5TNC A;  1JFJ A;  2GGZ A;  1CTR A;  2AMI A;  4DRW A;  2KHN A;  1AHR A;  1K8U A;  1XYD A;  1U5I A;  4F7F A;  3R1P A;  1SKT A;  1QAS A;  1MUX A;  1ZAC A;  1J7R A;  2ZNE A;  4I5L B;  1OW4 A;  4PE4 A;  4PHN A;  1DTL A;  1BR4 B;  2MHH A;  2NCP A;  2LVK A;  4F0Z B;  1J1D A;  1CMF A;  5HKY A;  3EVR A;  2KBI A;  3OGN A;  4UPG A;  1CNP A;  1J7P A;  3M0W A;  3PAL A;  4YGC B;  4JKT A;  1IIO A;  4NDD A;  4CID A;  4NQG A;  1IWQ A;  4YGB B;  1SCV A;  2OTG C;  1W7J B;  3AKB A;  1IRJ A;  1M46 A;  5DKR A;  2F33 A;  4AQJ A;  4PHJ A;  4P2Y B;  1RWY A;  3CR5 X;  2CBL A;  2L4H A;  1F54 A;  1LXF C;  3QME A;  1Y1X A;  1S6I A;  1PK0 D;  2LUX A;  4XYN A;  1S6C A;  2AUC A;  2BCX A;  2M3W A;  2O60 A;  2BKH B;  5I8N A;  2IS9 A;  3ICB A;  2EC6 B;  1SCM B;  4N5X A;  1A29 A;  2O5G A;  3TZ1 A;  1C7V A;  1QIV A;  2HF5 A;  1SBJ A;  1KCY A;  1FW4 A;  1QIW A;  1TCF A;  1IJ6 A;  1WRK A;  1ZFS A;  3D73 A;  3I5F C;  3PFV A;  3CZ0 A;  1JWD A;  4ZCU A;  4E68 A;  1H8B A;  1TWO A;  3DZT A;  1OOF A;  1GGZ A;  3SG4 A;  4IJ7 A;  1T14 A;  2BL0 B;  1L7Z A;  1OZS A;  4KYN A;  1C07 A;  2LCP A;  3PJI A;  5EL2 A;  4I5J A;  2G9B A;  1CDN A;  2WND A;  2KDH A;  4I5K A;  2PAS A;  5JJG A;  1NIW A;  2K61 A;  4PDZ A;  4XJK A;  1W7I B;  2P71 A;  1FF1 A;  1KK7 Y;  2LLU A;  1V1F A;  2H61 C;  2ZN9 A;  3TS5 B;  2FOT A;  1NX1 A;  2JWW A;  2WC5 A;  4CLN A;  4QJ4 B;  1EG3 A;  1G33 A;  1KFX S;  1UHI A;  1TNQ A;  2JT3 A;  3CYZ A;  1OE9 B;  1UP5 A;  3AAJ A;  1GQM A;  3KEV A;  3O78 A;  4FTG A;  5D69 A;  1Y0V H;  2WCK A;  3EKH A;  1ALV A;  1SR6 B;  3H4S E;  1N0Y A;  5F6T A;  4JPZ B;  1K94 A;  1QXP A;  1Y6W A;  2SAS A;  3B7A A;  1CDL A;  1R6P A;  1TCO B;  1XFU O;  3FWC A;  3LL8 B;  1KSM A;  3NSI A;  4GNK B;  3JTD B;  2LAN A;  4TNC A;  4GGN A;  5CSF A;  1LA3 A;  4PHK A;  1SYM A;  5FYX A;  3UO9 A;  1C3Z A;  2BL0 C;  3BUX B;  2LLT A;  1LS8 A;  4A4C A;  4MBE A;  1QV1 A;  4FQO A;  3SG2 A;  2LHL A;  3CGA A;  1W9Z A;  2L50 A;  2BE4 A;  2FCE A;  2WOR A;  5PAL A;  4OZD A;  5KU1 A;  1FI6 A;  2HQ8 A;  2M7N A;  1S3P A;  1B47 A;  1JFK A;  1NX0 A;  4WQ3 A;  2JU0 A;  1B9A A;  2KSP A;  3PLF B;  5I2Q A;  1AUI B;  2WCL A;  4Q04 A;  1TUZ A;  2KQ6 A;  2K8M B;  2KI6 D;  1BOD A;  2F2O A;  1AP4 A;  2JT8 A;  1A2X A;  2Y1M A;  3FWB A;  1QV0 A;  1J55 A;  4AOM A;  3D0Y A;  3SG3 A;  2M0R A;  2KGR A;  1BF5 A;  1CLB A;  2P70 A;  2BBN A;  3D75 A;  4MZK A;  3WHU B;  1CKK A;  4BY5 A;  4GBA A;  3VRN A;  5HLV A;  3FE8 A;  3IQQ A;  1IQ3 A;  3A4U B;  3TDZ A;  1NPQ A;  1OZO A;  1SK6 D;  2WCJ A;  3L4L A;  1WLZ A;  4JD9 A;  1N65 A;  1RTP 1;  1PVB A;  1PRW A;  2P6B B;  3DF0 B;  3I5G B;  1HQV A;  1WRL A;  3SG6 A;  2LNK A;  1NUB A;  3VRR A;  1JC2 A;  3JVT B;  3BUO B;  2H2K A;  1QWV A;  2PAL A;  2MJW B;  1NYA A;  2KAX A;  2WC8 A;  2JXL A;  4I5N B;  1CLM A;  2NCO A;  1MQ1 A;  2JNX A;  3PN7 C;  3UNW A;  3I5I B;  3GK1 A;  2ZRS A;  1YUT A;  4MN0 A;  1DT7 B;  1BOC A;  3E3R A;  3DD4 A;  1DMO A;  3R72 A;  3AKA A;  2MAZ A;  3WNX B;  1PVA A;  2NZ0 A;  3SIB A;  3V2L A;  4N1F A;  4GAO A;  4A4B A;  3DVE A;  3OB1 B;  4INW A;  1JSA A;  1YUR A;  2PMY A;  2WCH A;  2K60 A;  1Z4H A;  2Y1N A;  4CFR A;  2LVI A;  1B8R A;  2L5Y A;  1IJ5 A;  3BJH A;  5FI2 A;  5HKZ A;  1TTX A;  3OX6 A;  1JF0 A;  1N2D A;  2I7A A;  3I5H C;  3VRQ A;  1K95 A;  2MLE C;  4PE1 A;  3VGO A;  5DIC A;  1KWO C;  4MVF A;  4DUQ A;  3PAT A;  2ZND A;  1NX2 A;  1CM1 A;  1SL9 A;  1M31 A;  2QPT A;  1U5I B;  2LLS A;  2KLD A;  5FI6 A;  2Q91 A;  4OKH A;  1KQV A;  4M2Q A;  3MSE B;  3SIA A;  3VB1 A;  2H8V A;  5I94 A;  2KAV A;  2LVV A;  3BOW A;  4WQ2 A;  3S0F A;  1XK4 C;  2JNF A;  1P28 A;  3IF7 A;  1Y1U A;  1EH2 A;  3SG5 A;  4ORC B;  1SCM C;  2NLN A;  1CB1 A;  1A03 A;  4PCW A;  1FPW A;  1F4O A;  1A4P A;  4M2O A;  2WC6 A;  2TN4 A;  1X02 A;  1F55 A;  5KSZ A;  1XFV O;  4C0K A;  4MZJ A;  4GUK A;  3B88 A;  5I2L A;  2I94 A;  1WDC C;  3TDU A;  1XFW O;  1IKU A;  4N1G A;  1NWD A;  1CDP A;  5KTY A;  3BFH A;  1VRK A;  3KO0 A;  2KI6 C;  2EC6 C;  3A8R A;  4C0J A;  1ZOT B;  2ERB A;  3BUM B;  1YUU A;  3D76 A;  2QEV A;  2JPO A;  3BYA A;  1OOG A;  2BCA A;  2WOS A;  2WCF A;  3CR2 A;  1XFZ O;  3BQ3 A;  1L2O B;  1RRO A;  2L0P A;  5D7F A;  2PVB A;  2BE6 A;  1NX3 A;  3QRX A;  4HRG A;  1DGU A;  2KAY A;  3ZNI A;  3NHT A;  1KFX L;  1YRU B;  4PHM A;  1DEL A;  1JBA A;  2PRU A;  2CXJ A;  1K93 D;  1QJT A;  1NSH A;  2KGB C;  2H61 A;  1CFD A;  3O4X A;  3EK4 A;  1RFJ A;  4YI9 A;  3S0E A;  1OMD A;  1S1E A;  2JPT A;  1MXE A;  1K9U A;  2LMV A;  3BOW B;  1CDM A;  2PYQ A;  3PSR A;  1K9K A;  1BLQ A;  1S36 A;  1BG1 A;  1AJ5 A;  5B8I B;  3D74 A;  2OTG B;  2JOJ A;  3JTD C;  1DJI A;  1GGW A;  1C7W A;  3O6B A;  2OS8 B;  1B8L A;  1GJY A;  4MRX A;  1IG5 A;  1TOP A;  1TNX A;  2CT9 A;  3DVJ A;  1UUR A;  4NDB A;  2KYF A;  4AQI A;  3K1E A;  3IQO A;  5HKW A;  3BFA A;  3FIA A;  2OPO A;  1DJW A;  1EG4 A;  1KSO A;  2L98 A;  4GPL B;  4PAL A;  1AVS A;  1KWO B;  4MZL A;  1TN4 A;  4U8D A;  1H4B A;  3CR4 X;  3N7H A;  3D10 A;  1MWN A;  1S26 D;  1S5G Z;  2F3Z A;  3D78 A;  1DJZ A;  2B1U A;  2I18 A;  5JOL A;  3VRO A;  2JC2 A;  3OP0 A;  1DJH A;  2L51 A;  3CWG A;  1NCY A;  1CM4 A;  2KI4 C;  2KBM A;  2MA2 A;  5AER A;  3DYE A;  1J7Q A;  1OMR A;  1FBV A;  1MR8 A;  3BUN B;  2WCB A;  1CFP A;  3B87 A;  3I5I C;  3KHE A;  4DIR A;  2QAC A;  1FI5 A;  1BU3 A;  1BMO A;  3PM2 A;  4OVN F;  3OHM B;  1DC1 A;  3BUW B;  2PSR A;  3K21 A;  4JWQ A;  1XK4 A;  2BAP A;  1Z2C B;  1UHJ A;  1XFR A;  2QEB A;  3DXL A;  2K2F A;  1UUS A;  3DF0 A;  1SL7 A;  3LCP C;  4OR9 B;  5AEQ A;  2JTT A;  1G4Y R;  4BY4 A;  3CTN A;  4MLW A;  2M7L A;  2CNP A;  4IL1 A;  2R2I A;  4QJ3 B;  1QTX A;  1R2U A;  4YGD B;  1XA5 A;  1J1E A;  2HPS A;  2WCE A;  2M1U A;  2ZRT A;  2F2P A;  2L2E A;  1UHK A;  3LK0 A;  2Y5I A;  1Y1A A;  3GK2 A;  4NDC A;  5AXI A;  1C3Y A;  1YVH A;  1WRZ A;  1DJY A;  3JVT C;  5BPJ A;  1YRT B;  2M8U A;  2LP2 A;  1YVL A;  1KQM C;  2EHB A;  2F3Y A;  1CLL A;  1YR5 A;  1IQ5 A;  3OB2 B;  1S5G Y;  5I2O A;  4CFQ A;  1QX7 A;  1A75 A;  1PSR A;  3RZS A;  5ER5 A;  2ZKM X;  3CAB A;  2BKI B;  1KQM B;  1K2H A;  1L2O C;  1OSA A;  1RJV A;  2LC5 A;  2GGM A;  2LMU A;  1TUJ A;  2LUC A;  2LAP A;  3SS4 A;  4MRY A;  1G8I A;  2D8N A;  2KFH A;  3R1V A;  4WRI A;  1EL4 A;  1QLK A;  1DQE A;  2L2C A;  3CS1 A;  3EK8 A;  4YGA A;  3TUY B;  1OOI X;  1F8H A;  2A4J A;  2LV7 A;  1SL8 A;  2V53 A;  2LHI A;  1GM0 A;  5K89 A;  1DF0 B;  1F4Q A;  2KPH A;  1F70 A;  1WDC B;  3SG7 A;  4C0L A;  1BT6 A;  3NSO A;  3NSL A;  3WHT B;  1QS7 A;  1TNP A;  3CZ2 A;  3S0B A;  2E6W A;  5ER4 X;  3SS5 A;  1D1O A;  1LKJ A;  2K0J A;  4PE0 A;  1OOJ A;  1IGV A;  1LA0 A;  4L9M A;  2M1K B;  1KFU S;  1B1G A;  2KQY A;  1OOH A;  2ZFD A;  1WY9 A;  4YGE B;  5G08 A;  3RM1 A;  2KYC A;  1OMV A;  1SW8 A;  1B4C A;  1S6J A;  1PSB A;  5AAN A;  1TNW A;  3HX4 A;  1AK8 A;  1CMG A;  1SR6 C;  4YI8 A;  1QAT A;  2KOT A;  4PE7 A;  1ALW A;  2COL B;  1A75 B;  1MHO A;  1ZMZ A;  3TDI A;  1QLS A;  4USL A;  3AAK A;  3SJS A;  3BXK A;  3I5F B;  3OBV A;  1BR1 B;  1JF2 A;  3I5G C;  4OV2 A;  3EKJ A;  1OQP A;  1DGV A;  2M9G A;  2LM5 A;  4MSP A;  3S0G A;  1DVI A;  2RGI A;  3WXA A;  4OCI A;  2FJU B;  2HET A;  2LE9 B;  5CSJ A;  5DKQ A;  1NCZ A;  2YGU A;  1B7T Z;  3Q8I A;  1QVI Y;  2QEH A;  4DS7 A;  4GGF C;  1Q80 A;  2Q4U A;  1QX2 A;  4ORA B;  5HYD A;  1B7T Y;  5CSI A;  1JUO A;  1SNL A;  3CDN A;  2LVJ A;  1REC A;  2VRG A;  4HRE E;  1DF0 A;  3O2P A;  5D3O A;  5FI7 A;  5HL1 A;  1CFC A;  3KPX A; 
#chains in the Genus database with same CATH homology
 2M49 B;  2SCP A;  3EK7 A;  5CSN A;  2ZN8 A;  4QJ5 B;  4YRU A;  1QVI Z;  3CLN A;  4DCK A;  1V1G A;  2LMT A;  4HSZ A;  1NCX A;  2K2A A;  1M63 B;  2CTN A;  1UHH A;  3RLZ A;  2JQ6 A;  2JXC A;  4P5O E;  2L4I A;  2LP3 A;  3TUY C;  5DKN A;  1SRA A;  2I2R E;  1RK9 A;  1LVC D;  1SMG A;  2FCD A;  4ORB B;  3DVK A;  2JUL A;  4YBH B;  3ZWH A;  1SY9 A;  1DJG A;  1KK7 Z;  4MEW A;  1EXR A;  1UHN A;  2KNE A;  2JRF A;  2MLF C;  3DVM A;  4CPV A;  1J7O A;  1WLM A;  2BBM A;  5CPV A;  2K7D A;  2DOQ A;  3OX5 A;  2L5X B;  1CFF A;  1XO5 A;  3NSK A;  1AJ4 A;  2BEC A;  1E8A A;  1K96 A;  2G2B A;  4GGF A;  3EVV A;  4ETO A;  1KK8 B;  1MF8 B;  1PUL A;  3C1V A;  2JT0 A;  3F45 A;  3EVU A;  2CCM A;  1SPY A;  3GK4 X;  2KI4 B;  1UWO A;  5AFP A;  4ICB A;  1KFU L;  3HCM A;  2MRD A;  2ISD A;  1YX8 A;  2BCB A;  1YX7 A;  1YTZ C;  1NP8 A;  1EJ3 A;  1M45 A;  2F8P A;  3NXA A;  1ODB A;  3LK1 A;  2GV5 A;  2M29 A;  3D0Y B;  5HLO A;  5J3X A;  1BJF A;  2K7O A;  1YUS A;  2NXQ A;  2HQW A;  4M2P A;  2JTZ A;  2KFG A;  3FS7 A;  2MBX A;  1QX5 B;  1XVJ A;  1B8C A;  4JQ0 D;  2K7C A;  3KF9 A;  4D1E A;  1MXL C;  3I5H B;  1ZUZ A;  1F71 A;  1DJX A;  1TRF A;  2AAO A;  2JZI A;  2OS8 C;  4HRH A;  1XFY O;  2E30 A;  1PAL A;  1IH0 A;  1HT9 A;  3PM8 A;  2KFF A;  1LIN A;  3GOF A;  4XJK B;  3TS5 C;  1M39 A;  1TIZ A;  2EGD A;  3LLE A;  4GFT A;  5IBW A;  4R1E A;  1XFX O;  5GQQ C;  2K7B A;  2Y4Q A;  1KK8 C;  4ZCV A;  3O4Y A;  1K90 D;  1K9P A;  2M97 A;  3CZT X;  3PN7 B;  3VRP A;  5TNC A;  1JFJ A;  2GGZ A;  1CTR A;  2AMI A;  4DRW A;  2KHN A;  1AHR A;  1K8U A;  1XYD A;  1U5I A;  1SKT A;  1QAS A;  1MUX A;  1ZAC A;  1J7R A;  2ZNE A;  4I5L B;  4PE4 A;  4PHN A;  1DTL A;  1BR4 B;  2MHH A;  2NCP A;  2LVK A;  4F0Z B;  1J1D A;  1CMF A;  5HKY A;  3EVR A;  2KBI A;  4UPG A;  1CNP A;  1J7P A;  3M0W A;  3PAL A;  4YGC B;  4NDD A;  4CID A;  4NQG A;  1IWQ A;  4YGB B;  1SCV A;  2OTG C;  1W7J B;  3AKB A;  1IRJ A;  1M46 A;  5DKR A;  2F33 A;  4AQJ A;  4PHJ A;  4P2Y B;  1RWY A;  3CR5 X;  2CBL A;  2L4H A;  1F54 A;  1LXF C;  1Y1X A;  1S6I A;  1PK0 D;  2LUX A;  4XYN A;  1S6C A;  2AUC A;  2BCX A;  2M3W A;  2O60 A;  2BKH B;  5I8N A;  2IS9 A;  3ICB A;  2EC6 B;  1SCM B;  4N5X A;  1A29 A;  2O5G A;  3TZ1 A;  1C7V A;  1QIV A;  2HF5 A;  1SBJ A;  1KCY A;  1FW4 A;  1QIW A;  1TCF A;  1IJ6 A;  1WRK A;  1ZFS A;  3I5F C;  3PFV A;  1JWD A;  4ZCU A;  4E68 A;  1H8B A;  1GGZ A;  3SG4 A;  2BL0 B;  1L7Z A;  1OZS A;  1C07 A;  2LCP A;  4I5J A;  2G9B A;  1CDN A;  2WND A;  2KDH A;  4I5K A;  2PAS A;  5JJG A;  1NIW A;  2K61 A;  4PDZ A;  4XJK A;  1W7I B;  1FF1 A;  1KK7 Y;  2LLU A;  1V1F A;  2H61 C;  2ZN9 A;  3TS5 B;  2FOT A;  1NX1 A;  2JWW A;  4CLN A;  4QJ4 B;  1EG3 A;  1G33 A;  1KFX S;  1UHI A;  1TNQ A;  2JT3 A;  3O78 A;  1OE9 B;  1UP5 A;  3AAJ A;  1GQM A;  3KEV A;  4FTG A;  5D69 A;  1Y0V H;  3EKH A;  1ALV A;  1SR6 B;  3H4S E;  1N0Y A;  5F6T A;  4JPZ B;  1K94 A;  1QXP A;  1Y6W A;  2SAS A;  3FWC A;  1CDL A;  1R6P A;  1TCO B;  1XFU O;  3NSI A;  3LL8 B;  1KSM A;  4GNK B;  3JTD B;  2LAN A;  4TNC A;  4GGN A;  5CSF A;  1LA3 A;  4PHK A;  1SYM A;  5FYX A;  2BL0 C;  3BUX B;  2LLT A;  4A4C A;  4MBE A;  1QV1 A;  4FQO A;  3SG2 A;  2LHL A;  3CGA A;  2L50 A;  2BE4 A;  2FCE A;  2WOR A;  5PAL A;  5KU1 A;  1FI6 A;  2HQ8 A;  2M7N A;  1S3P A;  1B47 A;  1JFK A;  1NX0 A;  4WQ3 A;  2JU0 A;  1B9A A;  2KSP A;  3PLF B;  5I2Q A;  1AUI B;  4Q04 A;  2KQ6 A;  2K8M B;  2KI6 D;  1BOD A;  2F2O A;  1AP4 A;  2JT8 A;  1A2X A;  2Y1M A;  3FWB A;  1QV0 A;  1J55 A;  4AOM A;  3D0Y A;  3SG3 A;  2M0R A;  2KGR A;  1BF5 A;  1CLB A;  2BBN A;  4MZK A;  3WHU B;  1CKK A;  4BY5 A;  4GBA A;  3VRN A;  5HLV A;  3IQQ A;  1IQ3 A;  3A4U B;  3TDZ A;  1NPQ A;  1OZO A;  1SK6 D;  1WLZ A;  1N65 A;  1RTP 1;  1PVB A;  1PRW A;  2P6B B;  3DF0 B;  3I5G B;  1HQV A;  1WRL A;  3SG6 A;  2LNK A;  1NUB A;  3VRR A;  1JC2 A;  3JVT B;  3BUO B;  2H2K A;  2PAL A;  2MJW B;  1NYA A;  2KAX A;  2WC8 A;  2JXL A;  4I5N B;  1CLM A;  2NCO A;  1MQ1 A;  2JNX A;  3PN7 C;  3I5I B;  3GK1 A;  2ZRS A;  1YUT A;  4MN0 A;  1DT7 B;  1BOC A;  3E3R A;  3DD4 A;  1DMO A;  3WNX B;  3AKA A;  2MAZ A;  1PVA A;  2NZ0 A;  3SIB A;  4N1F A;  4GAO A;  4A4B A;  3DVE A;  3OB1 B;  1JSA A;  1YUR A;  2PMY A;  4CFR A;  2Y1N A;  2LVI A;  1B8R A;  5HKZ A;  1IJ5 A;  1TTX A;  3OX6 A;  1JF0 A;  1N2D A;  2I7A A;  3I5H C;  3VRQ A;  1K95 A;  2MLE C;  4PE1 A;  3VGO A;  1KWO C;  4MVF A;  4DUQ A;  3PAT A;  2ZND A;  1NX2 A;  1CM1 A;  1SL9 A;  1M31 A;  2QPT A;  1U5I B;  2LLS A;  2Q91 A;  4OKH A;  1KQV A;  4M2Q A;  3MSE B;  3SIA A;  2KAV A;  2LVV A;  3BOW A;  4WQ2 A;  1XK4 C;  2JNF A;  3IF7 A;  1Y1U A;  1EH2 A;  3SG5 A;  4ORC B;  1SCM C;  2NLN A;  1CB1 A;  1A03 A;  4PCW A;  1FPW A;  1F4O A;  1A4P A;  4M2O A;  2TN4 A;  1X02 A;  1F55 A;  5KSZ A;  1XFV O;  4C0K A;  4MZJ A;  4GUK A;  5I2L A;  2I94 A;  1WDC C;  3TDU A;  1XFW O;  1IKU A;  4N1G A;  1NWD A;  1CDP A;  5KTY A;  3KO0 A;  1VRK A;  2KI6 C;  2EC6 C;  3A8R A;  4C0J A;  1ZOT B;  3BUM B;  1YUU A;  3BYA A;  2BCA A;  2WOS A;  2WCF A;  3CR2 A;  1XFZ O;  3BQ3 A;  1L2O B;  1RRO A;  2L0P A;  5D7F A;  2PVB A;  2BE6 A;  1NX3 A;  3QRX A;  4HRG A;  1DGU A;  2KAY A;  3ZNI A;  1KFX L;  1YRU B;  4PHM A;  1JBA A;  2PRU A;  2CXJ A;  1K93 D;  1QJT A;  1NSH A;  2KGB C;  2H61 A;  1CFD A;  4YI9 A;  3EK4 A;  1RFJ A;  1OMD A;  1S1E A;  2JPT A;  1MXE A;  1K9U A;  2LMV A;  3BOW B;  1CDM A;  3PSR A;  1K9K A;  1BLQ A;  1S36 A;  1BG1 A;  1AJ5 A;  5B8I B;  2OTG B;  2JOJ A;  3JTD C;  1DJI A;  1GGW A;  1C7W A;  3O6B A;  2OS8 B;  1B8L A;  1GJY A;  4MRX A;  1IG5 A;  1TOP A;  1TNX A;  2CT9 A;  3DVJ A;  1UUR A;  4NDB A;  2KYF A;  4AQI A;  3IQO A;  5HKW A;  3FIA A;  2OPO A;  1DJW A;  1EG4 A;  1KSO A;  2L98 A;  4GPL B;  4PAL A;  1AVS A;  1KWO B;  4MZL A;  1TN4 A;  4U8D A;  1H4B A;  3CR4 X;  3D10 A;  1MWN A;  1S26 D;  2F3Z A;  1S5G Z;  1DJZ A;  2B1U A;  2I18 A;  5JOL A;  3VRO A;  2JC2 A;  3OP0 A;  1DJH A;  2L51 A;  3CWG A;  1NCY A;  1CM4 A;  2KI4 C;  2KBM A;  2MA2 A;  5AER A;  1J7Q A;  1OMR A;  1FBV A;  1MR8 A;  3BUN B;  2WCB A;  1CFP A;  3I5I C;  3KHE A;  4DIR A;  2QAC A;  1FI5 A;  1BU3 A;  1BMO A;  4OVN F;  3OHM B;  3BUW B;  2PSR A;  3K21 A;  4JWQ A;  1XK4 A;  1UHJ A;  2K2F A;  1UUS A;  3DF0 A;  1SL7 A;  3LCP C;  4OR9 B;  5AEQ A;  2JTT A;  1G4Y R;  4BY4 A;  3CTN A;  4MLW A;  2M7L A;  2CNP A;  4IL1 A;  2R2I A;  4QJ3 B;  1QTX A;  1R2U A;  4YGD B;  1XA5 A;  1J1E A;  2HPS A;  2WCE A;  2M1U A;  2ZRT A;  2F2P A;  2L2E A;  1UHK A;  3LK0 A;  2Y5I A;  1Y1A A;  3GK2 A;  4NDC A;  5AXI A;  1YVH A;  1WRZ A;  1DJY A;  3JVT C;  5BPJ A;  1YRT B;  2M8U A;  2LP2 A;  1YVL A;  1KQM C;  2EHB A;  2F3Y A;  1CLL A;  1YR5 A;  1IQ5 A;  3OB2 B;  1S5G Y;  5I2O A;  4CFQ A;  1QX7 A;  1A75 A;  1PSR A;  5ER5 A;  2ZKM X;  2BKI B;  1KQM B;  1K2H A;  1L2O C;  1OSA A;  1RJV A;  2LC5 A;  2GGM A;  2LMU A;  2LUC A;  2LAP A;  4MRY A;  1G8I A;  2D8N A;  2KFH A;  4WRI A;  1EL4 A;  1QLK A;  4YGA A;  3CS1 A;  3EK8 A;  3TUY B;  1F8H A;  2A4J A;  2LV7 A;  1SL8 A;  2V53 A;  2LHI A;  5K89 A;  1DF0 B;  1F4Q A;  1F70 A;  1WDC B;  3SG7 A;  4C0L A;  1BT6 A;  3NSO A;  3NSL A;  3WHT B;  1QS7 A;  1TNP A;  1D1O A;  2E6W A;  5ER4 X;  1LKJ A;  2K0J A;  4PE0 A;  1OOJ A;  1IGV A;  1LA0 A;  4L9M A;  2M1K B;  1KFU S;  1B1G A;  2KQY A;  2ZFD A;  1WY9 A;  4YGE B;  5G08 A;  3RM1 A;  2KYC A;  1OMV A;  1SW8 A;  1B4C A;  1S6J A;  1PSB A;  5AAN A;  1TNW A;  3HX4 A;  1AK8 A;  1CMG A;  1SR6 C;  4YI8 A;  1QAT A;  2KOT A;  4PE7 A;  1ALW A;  2COL B;  1A75 B;  1MHO A;  1ZMZ A;  3TDI A;  1QLS A;  4USL A;  3AAK A;  3SJS A;  3BXK A;  3I5F B;  1BR1 B;  1JF2 A;  3I5G C;  4OV2 A;  3EKJ A;  1OQP A;  1DGV A;  2M9G A;  2LM5 A;  4MSP A;  1DVI A;  2RGI A;  3WXA A;  4OCI A;  2FJU B;  2HET A;  2LE9 B;  5CSJ A;  5DKQ A;  1NCZ A;  1B7T Z;  1QVI Y;  4DS7 A;  4GGF C;  1Q80 A;  2Q4U A;  1QX2 A;  4ORA B;  5HYD A;  1B7T Y;  5CSI A;  1JUO A;  1SNL A;  2LVJ A;  1REC A;  2VRG A;  4HRE E;  1DF0 A;  3O2P A;  1CFC A;  3KPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...