3PANA

The crystal structure of adenosine deaminase with hypoxanthine bound from pseudomonas aeruginosa
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of adenosine deaminase with hypoxanthine bound from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 123
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3panA00
3HTWA 3B40A 1S3TC 3PAOA 5FSEC 1EJXC 3WYZA 1EJRC 2FTYA 2RAGA 4QS6A 3EWCA 4CQCA 1QW7A 4LH8A 3OJGA 4GY1A 2QT3A 2FFIA 2BB0A 1NDVA 2HQAA 5LXXA 2FTWA 3TNBA 4ERIA 3GTIA 1R9YA 1ONWA 2E1WA 1A5LC 4DO7A 4J35A 2A3LA 4KEZA 4C6OA 3OODA 3CAKA 2YZ5A 4PBFA 4KERA 1WXYA 3LU2A 3GTFA 2Z26A 3QY7A 4R88A 4ERAA 3QY6A 3A3XA 4LCQA 3DC8A 4NP7A 2BGNE 4LCSA 2Z7GA 2ICSA 2PLMA 1UIPA 1V77A 3WZ0E 4XD3A 2WJDA 4QSFA 1EF2A 2ANUA 4CEUC 1EJUC 4LANA 3F4CA 1EJTC 2IMRA 1EYWA 2I5GA 4CNTA 1GKQA 2WJFA 2HPIA 4GZ7A 4PBEA 2E25A 3IARA 3A3WA 4C6JA 2YB1A 1ADDA 3URBA 4DIAA 1ITUA 2O4MA 4DI8A 3S4TA 4XAZA 1M68A 2I9UA 5HMDA 2G3FA 1E9ZB 4PCNA 2YXOA 4KETA 3E38A 3HM7A 4C5YA 3TN5A 2GOKA 5CH9A 1RA5A 3NURA 4C6DA 3IJ6A 3E2VA 1NDZA 1A4MA 1V51A 1KRAC 4RE0A 3LSCA 1P6BA 1XRTA 4EP8C 2DVTA 3MJMA 3FDGA 3TN3A 1R9XA 3K4WA 1V4YA 2VR2A 2QVNA 1ONXA 3HPAA 4IQJA 4CQBA 1FWHC 2R1MA 2Z2BA 3IGHX 4XAGA 1UBPC 4WVXA 3GG7A 1EJSC 4B92A 2VUNA 4B90A 3T81A 1FWCC 1E9YB 4BKNA 4G7EA 1WXZA 3N2CA 4HJWA 4XD6A 1M7JA 4C6FA 1PSCA 2HNHA 1KCXA 1EZ2A 2HPMA 4GC3A 3QGAC 3MTWA 5A6TC 4QTGA 3E3HA 1NDWA 4IFOA 4DZHA 1FKWA 3PNZA 1FWGC 1VFLA 4DYKA 3IRSA 3BE7A 4IF2A 4EPEC 2QPXA 1EJVC 2AMXA 1YRRA 1JGMA 2Z00A 3LNPA 3R0DA 3GUWA 4RDWA 4BY3A 2PGFA 3ORWA 4QS5A 1EJWC 2PAJA 4GY0A 2PUZA 1A5NC 1POKA 2GWNA 1RK6A 4AQLA 4EPBC 3FDKA 1A5OC 2ZC1A 4IFKB 4H01A 1DPMA 3QY8A 4XD4A 2HBXA 3EGJA 3GTXA 1FWFC 3OU8A 2P53A 2OGJA 4J5NA 1IE7C 2WM1A 4V1XA 2CZVA 1YBQB 4IH3A 3LGGA 4PCPA 1PB0A 1A5MC 1R9ZA 1J6OA 4H9XA 4NI8A 4R85A 1ITQA 1QXLA 4E3TA 4H9MA 4L9XA 2R1PA 2UZ9A 1RJQA 3NEHA 1PO9A 1NDYA 1RJPA 3E0LA 3SO7A 3C86A 4ERGA 1RJRA 3MDUA 3S2LA 1KRCC 2D2HA 4I6VA 3NQBA 2Z28A 4IFRA 4LAOA 3MKVA 1V7AA 2WJEA 3UBPC 2Z4GA 4ICMA 2R1NA 4G2DA 5G4HC 1RA0A 4C6BA 4GYFA 2EG7A 4C6NA 3IV8A 3RN6A 1K70A 2OB3A 4LEFA 2UBPC 4XAYA 4AC7C 2DVXA 3RHGA 1XRFA 2Z27A 2QS8A 2AQOA 4H9UA 2GSEA 4M51A 1UMLA 2Z2AA 4C6KA 4IGMA 3IACA 2KAUC 4QROA 3LSBA 1FWBC 1KRBC 3PBMA 4H9VA 4EPDC 3GIQA 3PNUA 4NG3A 4WHBA 4CNUA 3JZEA 3A4JA 4C5ZA 4F0SA 2FVKA 2D2GA 1FKXA 2EG6A 3LA4A 3QGKC 2O4QA 4HK6A 4IG2A 4L6DA 4GX8A 3OQEA 1K6WA 4LFYA 4CNSA 3MDWA 3TN4A 3SFWA 1FWEC 3CS2A 5FSDC 4QRNA 2FVMA 3V7PA 4KESA 1BF6A 5E5CA 3URQA 4XAFA 1W1IE 4PE8A 4RDZA 4V1YA 1NFGA 2VHLA 3AUOA 3ITCA 3MVIA 3AU2A 4HK5A 1POJA 4GOAA 3AU6A 4RDYA 4GBDA 4GXWA 4C6CA 4HA0A 3DUGA 3GTHA 4KIRA 3S2MA 2P50A 1PTAA 3S2JA 4HK7A 4INFA 4LALA 3UR5A 3F2DA 1RK5A 4F0RA 1FWJC 4RDVA 4UBPC 4H9ZA 2VC7A 3MPGA 4I6KA 3B0XA 4GX9A 1O12A 1UIOA 4LAKA 4F0LA 5AKQA 4B3ZA 2XIOA 4BJHA 1FWAC 1XWYA 1O5RA 2GZXA 3ICJA 4KEUA 1P1MA 4G7EB 2Z25A 4XD5A 4C6LA 1I0BA 3GU2A 1A5KC 4YIWA 3OVGA 4RZBA 2EG8A 4CQDA 3MVTA 4LCRA 2R1KA 4ZSTA 3TN6A 3UR2A 2Q09A 3GU1A 4B91A 3UPMA 1YMYA 1HZYA 2HBVA 4DLMA 3URAA 2Y1HA 4C6QA 3S2NA 3GIPA 1J79A 4H9YA 4EPKA 2R1LA 1GKPA 1ZZMA 3K5XA 4GY7A 3O0FA 3T8LA 4J2MA 3LY0A 2D2JA 2Z29A 4C60A 4DLFA 2F6KA 3CJPA 3MSRA 4JOMA 3RYSA 3GRIA 1A4LA 2DVUA 3DCPA 3PANA 4UB9A 3K2GA 3GU9A 4WGXA 1FWDC 4DZIA 4C6MA 4C6IA 3FEQA 1J5SA 4GK8A 3E74A 3OOQA 4R7WA 1YIXA 1K1DA 3ISIX 4KEVA 3UF9A 3URNA 1V79A 2GWGA 4D8LA 3G77A 3F4DA 1GKRA 3ID7A 4IFKA 3O7UA 4ZSUA 1I0DA 5HMEA 5HMFA 1FWIC 2W9MA 4C6PA 2VC5A 4P5UA 3B0YA 1J6PA 3D6NA 4KQNA 3F2CA 1RAKA 2OOFA 3WMLA 3EWDA 2Z24A 4IGNA 4LAMA 1YNYA 3IPWA 2AQVA 1M65A 4C6EA 3RCMA 1KRMA 4H9TA 2OODA 3F2BA 4C65A 1P6CA 3T1GA 2PGRA 4KF1A 4TQTA 2VM8A 4H00A 3LGDA 3LS9A 4Z42C 4MUPA 4DI9A 1XGEA 4IG2B 4CEXC 2ADAA 2OQLA 4OFCA 3E0FA 2YB4A 4DNMA 2Q01A 3KM8A 1YBQA
chains in the Genus database with same CATH superfamily
3WH7A 2OSXA 1S3TC 2A0NA 2FTYA 1OT2A 1FWWA 4CQCA 2PMQA 1EP3A 3KL3A 1W91A 2VFHA 2Z2UA 7REQB 1XKJA 3MCMA 1JPDX 1TJ0A 2XVNA 3WLSA 2QAFA 1R9YA 1UD6A 2DFAA 2E1WA 1XYMA 1MXGA 4U3AA 1CXEA 3CAKA 4PBFA 4EACA 3OYXA 1NARA 3WNLA 4TXEA 4DNHA 1XIBA 3VYLA 2VWSA 3BURA 1HX0A 1Q7ZA 2FZNA 3T7VA 1AQFA 2ANUA 5E0KA 3WQCA 2TPSA 4AW7A 1ZJBA 2I5GA 3UCCA 1KWKA 3VD9A 4WIWA 2WZIA 2OLSA 1OZQA 1JIBA 1GQJA 2D3LA 4EKJA 2INFA 3URBA 1XM3A 2PBGA 1E73M 3EDKA 3KL0A 5H6HA 3DFHA 1UOKA 2I9UA 2XH7A 3HG2A 1E9ZB 3HM7A 1IWPA 1F8IA 1D3HA 1IYXA 3WN6A 2I16A 2QMKA 1SJDA 3NURA 4JL1A 1Q8AA 5A2AA 3NQGA 3VMNA 4PL2A 4WKHA 3GD6A 4DJDD 3FNDA 3VIMA 2A7PA 4P7RA 3VDHA 3B0PA 5C7HA 7CGTA 3BQ6A 3R89A 3IJIA 1UZHA 1V93A 1S1RA 4LF2A 1MDRA 5LNSA 4CQBA 1FWHC 5CJMA 4MF4A 4QJ1A 2WKJA 3DBPA 3RMJA 2BG5A 2Y7FA 1ML1A 1RCXB 2VELA 1OK4A 2VD9A 2V5LA 3AXXA 4PUEA 4D6JA 3YPIA 4JFUA 3GY1A 3IUIA 1KC7A 4YTUA 4DPQA 1FHDA 2XYLA 1CXFA 3JS3A 3VD3A 2OJPA 1V02E 1XG4A 1NOFA 3DG6A 3GG1A 1WKDA 2YBTA 4GJJA 2ZRYA 3W70A 2QUUA 3V18A 3DGBA 2ZRVA 3TJ4A 4E2BA 1EEXA 1G69A 4I3GA 4HCDA 1WZMA 3AZTA 2PD9A 4QFUA 4D6HA 1MNSA 1R2SA 2CLMA 2F6XA 4CLMA 1PUDA 4W93A 4HTYA 1OZMA 1X96A 1C8QA 1S5WA 3MQTA 2QUMA 1H0GA 1PWLA 2VGFA 2OTDA 5FCZA 1EBGA 3KBMA 4MLRA 3NO5A 4XX6A 3UWWA 3H6OA 4L9XA 2X05A 6A3HA 4AWUA 1NDYA 5FL0A 3BK0A 3LERA 1GG0A 2UY3A 2WVVA 1OINA 5HPOA 5A6BA 3CZGA 4JQ1A 2J27A 2YXXA 3HG4A 2J9YA 3A4AA 3LM3A 2R1NA 1A5SA 3WDHA 3W1TA 4K68A 1XIJA 1X8FA 3IV8A 5AHEA 3CHEA 2NLYA 3PSVA 2W3ZA 4H6KA 3SDOA 3FSTA 5A8QA 4IJBA 3SY8A 2PFHA 2Z2AA 4AC1X 3IJDA 2KAUC 4NZFA 5FF0A 2PLJA 1ZNNA 3EBVA 1E1FA 1T6MA 4PFMA 3S47A 1WDPA 1TSIA 5LZLA 2RDUA 1AUSL 1U1JA 1E40A 2NVDA 1CNVA 3A24A 2PTZA 3VGDA 1D7KA 3QZAA 1SR9A 2DZXA 4DXVA 2VC6A 1NOUA 2DP3A 4DBWA 3MA8A 4BQ4A 1W37A 3TC6A 4NZ3A 1DQUA 3UZJA 3G8RA 4L7ZA 1AD1A 2WCGA 5HR6A 1FFQA 4AF0B 2DUZA 1H2JA 4YN5A 4RV8A 3CB8A 4GXWA 3T0CA 4HA0A 5E70A 1YEYA 1EXPA 4QE1A 3R43A 3MBDA 4GUJA 2X1RA 1ONEA 1LLZA 1V6YA 4QX4A 2PDKA 1HXJA 2ZUMA 1H0IA 3H4XA 1R3RA 3QFEA 3KBJA 4IMGA 7REQA 2WJZA 3B4YA 2B7OA 3AXHA 2Z25A 2YPIA 3WJWA 3P0XA 5CSUA 3FAXA 1G4PA 2WANA 1Z69A 1OGBA 4JR5A 5D2WA 3L4XA 4DYEA 3UR2A 1KM1A 4WR3A 3NZQA 5HDRA 1UR0A 5A3HA 4QQUA 3B06A 3WDQA 1ITCA 3H54A 4GY7A 4R3UA 3TQPA 5K4XA 2F6KA 2ZRZA 3NDZA 1XR2A 1E6RA 3LCIA 1FWDC 3UZYA 5AC5A 2HDJA 1ZJIA 4NX5A 3M5ZA 4GZIA 3CV1A 3BGJA 4DWSD 3O0KA 3AIUA 3ISIX 4TVUA 5LHEA 1JDCA 1T96A 4MZ8A 3U3HA 5AYYA 2YCEA 4FX7A 3W88A 1X1NA 2WWDA 2YXGA 3IWPA 5G4WA 3D6NA 1JZ3A 2XFYA 3L4WA 4FXFA 4DF0A 1J0ZA 3AS3A 3W6YA 2NQLA 5JH1A 1QBAA 3SQSA 4MUPA 5AYXA 1I2OA 3AIVA 2OQLA 4YPJA 2ONEA 4DZAA 1XF0A 1TFVA 3VD5A 4PTWA 3T05A 3WLMA 1VEMA 4W7WA 4LH8A 5BMWA 1WB0A 3OLEA 4LUSB 2ZKMX 3C8NA 4Y9MA 4DO5A 4K8EA 2Y8UA 4DN1A 1FP8A 2FMOA 5EFDA 3H22A 5MKGA 4YWSA 1QI4A 3BLEA 2OYMA 3HFTA 4JDYA 1V3JA 3HURA 3LU2A 3NOEA 4M3PA 3QBUA 1B4KA 2Z7GA 2D73A 4O1BA 5IDIA 4A35A 1EF2A 4M81A 2OEKA 1EJUC 3TW6A 3VPLA 3LHVA 4MJ2A 1W1TA 1VENA 2RFGA 3S5NA 4Q7NA 3XINA 3LRLA 4C6JA 3FA5A 1VYRA 3WK2A 1TPEA 2W66A 1T5AA 2B0MA 4QDPA 1BWVA 5J5RA 2WHJA 3MUCA 1ICSA 4XSLA 1ME9A 4C5YA 4NF7A 5A8OA 4OOUA 5CSYA 3T09A 3T40A 3I10A 1WX0A 3H4GA 1UWTA 2GVGA 4Q7BA 2D20A 3PTQA 1V51A 4BHYA 2HMCA 4WKAA 2J7FA 3LSCA 4MG4A 5D9OA 3AQUA 4M56A 2QZRA 4HOXA 5CBIA 2GSHA 1AZ2A 1VRXA 5I23A 4XKYA 2J47A 2YSWA 1GZ1A 2Y61A 1QOXA 4B92A 1OSEA 2OOGA 3PSWA 1K4HA 3JUGA 1YNQA 2POTA 2X1TA 4E0CA 4G1KA 4LTSA 1Q65A 4US5D 3VIFA 5J5DA 1S5TA 2CLEA 4F9DA 3HPFA 3QC3A 3N2OA 1KBIA 1ZP4A 3NDOA 1G94A 1BQGA 4UFJA 5A6MA 4LW7A 3UG3A 2GVYA 3MW7A 4IMCA 1KV8A 4YVPA 1JGMA 4WSKA 2CW6A 1V0MA 1NWSA 5G1TA 3RUBL 3SUWA 3VNKA 3SN1A 3DHUA 6TIMA 2GVLA 3SIMA 1WDRA 2OSWA 1VHNA 2AGTA 4R7JA 1YTKA 2IQDA 5LA1A 3WUEA 1XQKA 1QOQA 1Q2RA 4AAJA 1SFJA 4JTRA 2BWGA 1F6KA 1R9ZA 1RXOB 2E6YA 4XZNX 1Q66A 4DBEA 3MWCA 2CCRA 4X9SA 4LXFA 2W91A 1YLVA 4ZFMA 4D72A 2FZ8A 2V3DA 3V5OA 3VOGA 4MPQA 4NRSA 5K9DA 3FA3A 1LLOA 4H8UA 3N3MA 4HOZA 1Q6QA 3BJFA 4JCLA 2XINA 2I5IA 1TTQA 4RUBA 2BASA 2J79A 3HF3A 3AIQA 5CC7A 4ZOBA 1EH9A 3AROA 4HN8A 3W83A 4B4HA 3IACA 2YBUA 4WRHA 2D22A 3ABRA 3N29A 1ICPA 4DUVA 4PL1A 1YNPA 4L4OA 5TD4A 1K7FA 4X2RA 1JCTA 4H4IA 4EXAA 1JUKA 1U1UA 2OPJA 2C8NA 2WZMA 3VCNA 4CU6A 3KBNA 3KBWA 5FSDC 1F76A 1FUYA 5FJUA 4UTHA 3CZJA 2V5JA 4LU0A 1TMQA 1B9BA 4Z1AA 5I0DA 1QASA 3A21A 3GSMA 4TV6A 3ZR5A 3UT0A 5DMYA 4IPPA 5JIWA 3QOKA 3NAVA 3CEPA 3HQNA 2REQB 3QPZA 1OFEA 2GUUA 3VIIA 3SBFA 4GRSA 3TEVA 1EWDA 4LALA 3F2DA 3CV7A 1RK5A 4HNTA 2JE8A 4JBRA 1M3UA 2BLEA 4WQ6A 1R3TA 1IWBA 4I6KA 1ISVA 3CQ0A 3DECA 1EOKA 4GNKB 4OBSA 1GCYA 3XIMA 3SCVA 2RGLA 1X1ZA 4IIGA 4DRSA 5C2CA 2AL1A 3MV11 2KX9A 5F2LA 1UA3A 1CIUA 3UR8A 3L4TA 2ZUVA 1M1BA 1I0BA 3L65A 4JTKA 1WYIA 4YIWA 4GYJA 4YTTA 1W9DM 2R1KA 4AG0A 3W7PA 3HZ3A 3N11A 5A8GA 1HZYA 4IMDA 5H8MA 1FP9A 3L23A 1R3SA 1OEPA 2CHOA 3LCHA 4DAFA 3ONBA 5FF7A 1E6SM 3STGA 3QFWA 4JOMA 1MQRA 3TLLA 3KX6A 4U5IA 2Y8KA 3QR0A 1M6JA 4UR9A 4YHEA 1YW1A 1AJZA 5GNZA 4JIIX 2ZIDA 3MUIA 1CGTA 3GNOA 1ZY9A 1VFTA 2G3NA 4GI8A 2ZX9A 2WOQA 1GQNA 3KVMA 3EKLA 1S2AA 3H26A 3A22A 3F5LA 1HVXA 2PF0A 3KBSA 3O6DA 1V3KA 1TIWA 2EKCA 2RGMA 3LHYA 3N14A 4RJEA 5DCBA 5IFPA 3LS9A 4H00A 2PI6A 4QBXA 4IG2B 5AY7A 3G1VA 4I9TA 4O0KA 3OG2A 2CZEA 3EOUA 2GGIA 3T0AA 3ZLFA 4Q4SA 4EX4A 4XZBA 3XISA 3ZM8A 4E2VA 1UR1A 2QGHA 2W92A 3OJGA 3BAKA 4R5EA 5K4ZA 4M24A 3CYJA 4B3KA 5C2GA 4QJ3B 2EO7A 1R0MA 3FKKA 4ERIA 1Q7MA 1CGUA 2FHBA 4MOZA 1ONWA 3MZ2A 4FNUA 4UR7A 2V9DA 3TTSA 2J6XA 3C6CA 2HK0A 5AYBA 1WDWA 1OGGA 4FK9A 1YTDA 3VM5A 1P4CA 3RIKA 3EB4A 5ABTA 1UP3A 4KCWA 5KEZA 3HMCA 1DIKA 1TELA 2GVEA 3LQLA 4PEKA 4NXSA 2HPIA 2WKLA 4D6GA 2YL8A 4C7FA 4LEQA 3IARA 4TIMA 3PM6A 3QYSA 4D6EA 1CLXA 5LYRA 3OLDA 3MSGA 3R8HA 2A3BA 4JL2A 1QWKA 3DDMA 4H8NA 1XLCA 2PWEA 2PCEA 5EMLA 5E9AA 1SMAA 3PAJA 2X1SA 3QTGA 1CX9A 4AZ5A 3L5LA 4J3UA 1DJIA 2YYUA 3CT7A 4QHRA 4LBUA 3HPXA 5FF3A 4NJHA 3EWWA 2O7QA 4YYFA 1UBPC 1R46A 1DJZA 2P3ZA 3N3TA 3P80A 1P5BA 4V27A 4F4RA 3AYTA 1WXZA 2G5WA 4UTWA 4C1NA 4NZ5A 4BI7A 1JAKA 2J25A 2A85A 2C7FA 1E4IA 2BSLA 5DBUA 4DM2A 2DEPA 5E09A 1L2UA 4N42A 3AS0A 4H2CA 3W37A 5FACA 1XSJA 1QI3A 2PB1A 2DSKA 1EJVC 4JY8A 3TONA 2PTDA 2TRSA 2JALA 2E28A 1Z8AA 3IK2A 4XIMA 3LV6A 2J8FA 1T8XA 1A5NC 4JQ3A 1GEHA 2WSPA 4L1GA 4JQ2A 3TTOA 1V3LA 1OHLA 4FF5A 1M04A 4XUGA 5T9BG 2OYLA 3CH0A 1X6LA 2QHAA 4QLJA 2Q3OA 1YBQB 5LIYX 3DGRA 2GGJA 4MKSA 1SZNA 1KFBA 1PO9A 4M6QA 4MB3A 3DFYA 3SO7A 4FB7A 3TVAA 1RJRA 2DV0A 5AN7A 4LS0A 3LK6A 2CETA 4JQ4A 3W22A 3E96A 1AH4A 3W24A 1KFKA 4X2PA 3FA4A 1E43A 3AMDA 5C71A 1XJBA 2NXGA 2FQIA 4A3HA 4AC7C 3KTCA 4GIYA 1H1ZA 4GNVA 3TYUA 4FP1A 4LVDA 3UZWA 2Y6ZA 4HNLA 1UMLA 4N2YA 3EWYA 3CO4A 1G7VA 3VKKA 1FQ0A 4H9VA 3N1AA 3T0TA 2Y85A 4L9YA 4GISA 3G6LA 3LA4A 4AHOA 2HJPA 2CZDA 1ZALA 2EGZA 5DXYA 1XBXA 1A5AA 3WNPA 2V3EA 3NSMA 4X3ZA 3SFWA 1A53A 1E51A 3SGUA 5IFTA 4BR1A 2XG9A 2GJRA 2DH2A 2O9OA 1QMLA 3MI2A 3B8DA 4OOZA 3A4XA 3R13A 4ZL1A 5T91A 3VMPA 5DANA 2OEMA 3AUJA 4DJDC 4L80A 2ACQA 3VKAA 2BOFX 3GNPA 2WK2A 3LHTA 3AHXA 4ZCWA 5FJRA 5HQLA 1QI5A 5G5IA 3TJIA 2L5HA 2VC7A 1AJ2A 1O12A 1HP5A 2G97A 2XZ9A 3THCA 2H8XA 1LDCA 5AVHA 4AWEA 4IXXA 4MMWA 3T0BA 3AMGA 1X7IA 3WDPP 2O9RA 4JFVA 1TUXA 4FNPA 1F74A 1MEWA 3A6OA 3BO9A 1B30A 3KCJA 2EG8A 2J8GA 1RBOB 3TH6A 2ZUSA 3P0WA 1F6YA 3BMVA 2I9EA 5K9XA 1YE6A 5GPRA 3RCNA 1AZ1A 5ABEA 4JHMA 3DFQA 3W1MA 4HPHA 3CT2A 3AXKA 1UROA 4C6QA 2PDYA 1LBFA 5K7JA 1Y5WA 4J28A 1SFTA 2NT1A 3BAIA 3GS6A 3WF4A 3R12A 2VX5A 2E68A 2ESCA 3GDTA 5BWAA 1UUOA 1PBGA 1VGAA 2YCLB 4FXJA 2X0SA 2YDSA 2JEQA 4GJIA 5DO8A 4TVCA 1BXCA 2Y0FA 1GYNA 3UWZA 1EZWA 3KL5A 4I5UA 2ZUNA 1OABA 2B7QA 3O6YX 3P7YA 1W2PA 4B16A 3QQWA 2VZOA 3R7MA 1TRDA 2C71A 4ZE4A 2GSJA 2V2CA 3DXIA 3W7KA 4KF1A 4NHVA 4NIRA 4QG8A 1AD4A 4HU8A 3STEA 3FGCB 4HOWA 6XIAA 1YDNA 1YBQA 1MDLA 4HGXA 2VDIA 3GK0A 3BQ5A 3RPTA 2C79A 4YMZA 4F2TA 4GFSA 4AZGA 3TSDA 3VE9A 1TX2A 3A5FA 8RUCA 4MDPA 4UTIA 2PDJA 3FGCA 1FX6A 1E1CB 3KXQA 1V6WA 3SCSA 3USZA 1KFLA 3TNBA 3KOWA 3TTEA 4GQQA 4WZHA 5G2IA 4KEZA 2H8ZA 2NSOA 2VI0A 4LV4A 5CSSA 4GI6A 5HNRA 1JG9A 2PSNA 4HHHA 5XIAA 2JEPA 2F6UA 1BXNA 4URIA 5CLWA 2XISA 2RH9A 3U9IA 1ELSA 3VILA 1I2RA 4AEEA 3ANYA 3BWWA 3PFMA 3G6MA 1WO2A 4XZMX 2Z7KA 2IMRA 2Y88A 3RG6A 3BVJA 1UWQA 2BMBA 3UA4A 4RNFA 3W53A 1IQ8A 3CWNA 1UZ4A 1UR9A 2E25A 5FF4A 1QK0A 2YB1A 1TO3A 1YPXA 1KGUA 3ZFHA 4LUIA 2D2OA 3S1XA 2W0UA 1W9UA 3JU2A 2G37A 3GE7A 2G3FA 2CLIA 2YXOA 3G0SA 4KETA 3UY8A 5I24A 4NAFB 1MRAA 5A94A 5CH9A 3W2MA 3H2AA 3IJ6A 3QF0A 3PJWA 4D6FA 1IEWA 2BVYA 2HS8A 2ZZ5A 4O4WA 3KFTA 3TLQA 1AL8A 4PMQA 1Q13A 3NZGA 4GFIA 1E0XA 3C2FA 1ONXA 2F38A 1SO3A 5T9CE 2VX7A 1LBLA 4XAGA 3PTKA 4UCGA 4NVTA 1E4LA 3THAA 1JYWA 4BKNA 3WG6A 1OY0A 4P2VA 1JI2A 1A5UA 4ZO7A 1UZ1A 2BHUA 2HNHA 4O8RA 1KA9F 3HPZA 1IZKA 2A2IA 4NZCA 3NQDA 2G3IA 3NPUA 3CLMA 1V0LA 2OZTA 5HWNA 2FHFA 1XCWA 4EXQA 3WQ5A 3MMWA 4M0XA 3MYOA 3VD4A 1B9ZA 1QI0A 5AFDA 1UB3A 5KZMA 3WF3A 4BY3A 1LOQA 3W76A 3VIHA 3GQYA 1S2CA 3D3FA 3DKLA 2HBXA 4F9JA 1FWFC 2CPUA 1RPKA 2G3JA 4CKQA 3WQVA 3KVLA 4V1XA 3ITOA 4ZGYA 1VZWA 3HMJG 1XRSA 1GJPA 1TA3A 3APTA 5JU6A 1J6OA 4ACYA 3K4DA 4E3TA 3W7IA 2UZ9A 3U0HA 1I4NA 5C9WA 1ESWA 3W7MA 3R2GA 1RBAA 4JKKA 1FHUA 3NQ6A 5C7VA 1JVNA 3NIYA 1SR0A 2Y7GA 3M0VA 3MKVA 4FNQA 4ML9A 4L5ZA 3WX7A 4IICA 3N13A 2X09A 3W1PA 3R0KA 4DWSC 3TYBA 2HNEA 5CBJA 3W38A 4J1OA 3SRFA 3W0KA 1IEVA 1C29A 3AAMA 2QUVA 1QOPA 1W9VA 3RHGA 1XRFA 3S5YA 5F1UA 2PWHA 6CGTA 3BLDA 5C55A 2EF9A 1JRBA 3FHAA 4P8XA 3N9RA 1PHQA 1UR4A 2GPTA 3QTPA 3PWAA 3D5HA 2G96A 2PC4A 1IZJA 1QNPA 1KKRA 1ZFJA 2XM2A 2PDCA 2BXVA 1UD5A 2JK2A 3OQEA 3D0CA 4S3CA 2PWUA 5LNWA 5DN1A 2GJLA 4LBSA 4ZE5A 4R9OA 3W2KA 4LUYA 3WUBA 1WA3A 2YFOA 3PTDA 5FAJA 4KBXA 3OHIA 1Q5MA 2DSWA 4UNLA 3VGBA 2J24A 3VIPA 1J01A 3CL6A 5RUBA 5LIXX 2CXGA 3H7UA 1V03A 3WKZA 3I6RA 3VCCA 2NXIA 4HZ8A 3GFYA 3LPOA 3GXNA 2FGLA 2B81A 2PWDA 1UKPA 1G9HA 5I06A 1RQBA 3W1NA 2XIOA 2XSBA 1XLDA 2GZXA 1OIFA 2PWFA 4FIRA 1EKOA 3OVRA 3A13A 2BVTA 3VCRA 4M7TA 3RJXA 3B0UX 2WHLA 3OW1A 4XD5A 2ZA2A 4CD8A 4HP5A 4C6LA 3GC5A 1IXQA 1XUZA 4KFPA 4HYWA 2EPMX 4YCOA 4GQBA 1E6XM 1RSCA 4CQDA 5IXEA 3CGTA 4LCRA 3WDRA 5A2BA 2GYIA 2ASHA 1YE4A 1F6PA 2OO6A 3ITXA 5MF5A 2QCHA 1GW1A 3M0HA 2H6RA 1F4AA 2YGYA 3H55A 5DXXA 1US0A 3O0FA 3T8LA 4LBRA 3ATYA 3SCUA 1P48A 1Q4NX 2VOTA 3NQCA 1ZGDA 4CUCA 1E3ZA 3C2OA 3NXFA 1B0IA 3FEQA 4JS3A 2O7SA 2OX1A 3GDMA 1W8GA 1H5VA 1UP0A 4HPJA 3SRDA 4W86A 3C2VA 4OZOA 5A5WA 1I0DA 1FWIC 5CZJA 3UJRA 3E2RA 2YR1A 4H19A 3EWDA 1D2KA 2QPSA 3T42A 1ECEA 4DAIA 1TCDA 2WZTA 1XP3A 3TTQA 4JX5A 3LLFA 1UKQA 2PU1A 3RCMA 3VIOA 3BAXA 3E12A 1XD1A 3WQEA 2J77A 3EDDA 3IUHA 2WC3A 1VFSA 3ZT7A 1EEPA 1QPNA 3RX4A 4GGHA 3PAOA 1O1HA 3ITLA 3RPDA 4ATLA 2X7VA 4K36A 2YW3A 1U30A 3NVDA 2C14A 3OB8A 1JDDA 1WDSA 3LCXA 5PTDA 3OA3A 2OMAA 4S3FA 1R38A 1RHCA 5LXXA 1F3TA 4IIDA 3WIJA 1TCMA 3CAWA 1WZLA 3KDOA 4UFIA 3V75A 1OADA 2WZHA 4PH6A 2W4XA 4Y9OA 5I3FA 2VFIA 1HIZA 1ZENA 3GNRA 2NQ5A 3M6YA 4TR9A 2ZWYA 4KERA 1X6UA 3N4EA 3VXGA 1ALDA 2QW5A 2TODA 1XDJA 4LSBA 3AXMA 4RL3A 5H8UA 4ZB0A 4JXCA 2ICSA 3BSGA 4H8VA 1GVYA 2WVTA 3PN8A 3BAYA 2ISVA 4H83A 1EJTC 1A0DA 1TV7A 2Y7DA 4K8GA 5BCAA 2GVJA 4Q33A 2DGAA 4B5NA 4U3CA 1KLYA 4DIAA 3GTNA 4CQAA 4P8WA 2WVUA 2WCSA 1OK6A 3GDBA 3E38A 1OFPA 3C4UA 1QPOA 3TTYA 3W82A 3U6WA 3M5XA 1FXPA 1F4HA 3S1VA 5HATA 3W72A 4C6DA 2PS2A 5MKGB 1OD8A 3HJZA 2RJHA 3ZMRA 3WQFA 9XIMA 1HKIA 1JPIA 1Q6OA 3S6OA 3MI3A 4EP8C 1W56A 4W4QA 3MJMA 1LYXA 4XZ9A 3H8AA 5DBTA 1HTIA 2JIEA 1VFHA 1GOQA 1CECA 3WQ8A 1XD0A 1R87A 1TV5A 3HIJA 2VUNA 3NZ1A 1WXJA 3TOYA 5D9MA 2EPOA 3RDKA 1C90A 2POZA 4AIOA 1NAL1 1PSCA 1RALA 3GNXA 1BYCA 2FMNA 3TZFA 3W2JA 4AD5A 3N2MA 4F66A 3NQ2A 4WK9A 3WBWA 1G0CA 1K02A 3M0LA 1NDWA 1Q6EA 4H1ZA 1BWKA 4E2OA 3CYVA 3ITVA 2CU0A 1W2VA 3ABOA 1B3VA 1JZ6A 5B7YA 6PTDA 2V5CA 3G18A 3GUWA 3AWNA 1ISYA 3BLFA 2WMIA 3CTTA 3C3NA 3ORWA 2Z1SA 4PUDA 3L0NA 4MSSA 3GHSA 3EA3A 3S1GA 2ZC1A 2EJAA 1DPMA 1XYLA 1BRLA 3MU7A 4Y8FA 2INZA 1MNZA 3N34A 5C6MA 2P53A 2OGJA 3AICA 1AG1O 4IH3A 4PCPA 2X7WA 1YTEA 3BGGA 3TP4A 1XLEA 4JTHA 4A2RA 4R27A 1PDYA 3QR1A 3NL2A 2PRMA 2R8WA 4BI6A 1J18A 3BL3A 3V5FA 4ROQA 1O94A 3LNMA 1IWAA 3MHFA 4JX6A 3OZPA 3F5KA 1XIIA 3WLIA 1JD9A 1AMKA 2PWVA 1SQ7A 3TW9A 1W9BM 3L2MA 5J04A 2PA6A 1UG6A 5LIWX 1CGYA 1ME7A 3GYCA 2VCAA 3KWSA 3SN0A 3B05A 1AW5A 3NYZA 4X60A 4DO6A 1BG4A 1KCLA 4XKYB 8XIAA 3WD4A 2R24A 3AIWA 1AL7A 4LYPA 4MKNA 4CCDA 2E1DA 4EPDC 5BRBA 4WHBA 4GABA 1H61A 3JZEA 1HJWA 2E6AA 4I8DA 3OQ8A 2A1YA 1C8VA 2NVAA 1FOBA 4L6DA 1JNEA 1ITXA 1LOSA 1DWGM 3GVQA 3GFZA 3LENA 4IGSA 4JIQA 1IT0A 3TN4A 5IBXA 3F4VA 4AF0A 3URQA 2GGEA 1TG7A 3QVQA 4FMVA 2E4TA 3BAWA 4PMXA 3Q37A 4UTTA 2YL5A 4W5ZA 3PZ9A 4WOZA 4HU3A 3E9AA 3O16A 4PUWA 3VE7A 2PDMA 2YKKA 2ISWA 4GO8A 4O28A 4UFMA 1WKYA 4PMZA 1XRVA 3PWIA 3VKJA 3UR5A 3HOJA 2VEGA 4JFSA 3BZGA 1C92A 5SWUA 3TMLA 4K3ZA 3S5SA 4WDWA 1QNVA 1GGOA 4B3ZA 1S38A 1ONRA 3F4NA 5A6AA 1XPGA 4J9JA 3NA8A 2OQYA 4G7EB 4LUTA 4UTLA 1D7FA 2PDNA 2FZDA 4ZB2A 5BXRA 1LQ2A 3DENA 2NUWA 4NAEA 2YDAA 4FLRA 4FAMA 3UETA 2AKZA 4LY8A 3BOXA 5FJTA 4KS0A 3TSMA 3LBOA 3TWAA 4H7ZA 1ZQ5A 3QM3A 2CLKA 1RCOB 4IOTA 4IMAA 2IPFA 3ZSSA 1Y65A 3GIPA 3T2QA 1VAHA 3R25A 2DU2A 4J2MA 1SFSA 3JW7A 5EBAA 3NTYA 1U5JA 2HZGA 2E5DA 2IS7A 1L2QA 1A5CA 1W1VA 4H6EA 3GR8A 2GUBA 3DH7A 4R7WA 1WKFA 3M0ZA 1K1DA 1QHOA 5DX7A 1V79A 3G0UA 2ZZ1A 4IFKA 3WD3A 3SURA 4C6PA 4A3YA 1HUVA 1MQQA 2ABAA 3CIVA 4NXKA 1J12A 3VOFA 3SGGA 3WELA 3WLJA 5FEXA 2GL5A 4L61A 5I09A 1XSKA 4MAVA 5EA9A 4Y8EA 4POCA 1ZAIA 4NRRA 4Z2HA 3HGRA 3P5ZA 1J0JA 3T1GA 1VEOA 5JUVA 2W5FA 3VC5A 5DT5A 1K77A 4IXHA 4OFCA 4LNYA 1GPFA 2DT0A 1MW2A 4WSJA 4Q7IA 4XBKA 1XBYA 5H2ZA 5I5RA 3R11A 4QE4A 5D38A 5F4WA 1XX1A 2CLLA 4LC8A 4A22A 1E9LA 2CLHA 1GW9A 1UPPA 2QT3A 5I78A 3GVGA 4RPQA 2BP1A 4MY1A 1WPCA 4L65A 1VPQA 2V5DA 3TZNA 1ENUA 1HW6A 2WNWA 1A5LC 1R86A 4NYUA 5M03A 4QDWA 5LGXA 1P7TB 2QIIA 4MWAA 1TJ1A 3N73A 4NL1A 3H2OA 3WZ0E 3BV7A 3IIZA 4EIVA 5AC4A 3GG0A 3RNDA 2J62A 3AWOA 2OT1A 4O11A 1HL2A 1YXCA 2XIQA 2BZNA 3PK7A 3M0MA 3QV9A 5JVLA 5AVNA 2CKSA 5C8BB 4XQ6A 2G41A 3R58A 3U5YA 1M68A 1LT7A 3ZJ8A 3GWQA 5CG7A 2A79A 4WCJA 8XIMA 1R6WA 2C91A 1JQXA 2QCDA 1RA5A 1NWRA 1NDZA 1TR9A 1BVNP 5A6JA 2DQXA 4TX9A 2DVTA 3ATZA 1IEXA 1N7KA 1GQIA 2DORA 4PUMA 3SUUA 3V0UA 3GLCA 1DXFA 1NJJA 3VZYA 3K4WA 2VR2A 4OGZA 5A8NA 4O54A 3G1YA 4HPXA 2V5BA 5U4NA 3CZ8A 1UMYA 1NWUA 1U5VA 3LX9A 1GNXA 5D2VA 1R3WA 3ARSA 1E1EA 2FZMA 2OO0A 3KTSA 2WM0A 2VNCA 3FVDA 3G8EA 2HK1A 4HMNA 5I3KA 4RZ4A 4G1NA 2AOSA 3CH9A 3IIVA 1HKKA 3PZVA 3PNZA 1DXEA 3LBMA 3ARWA 3BE7A 1OFOA 3ZWSA 3WSUA 3C2YA 3EMCA 1LRNA 4PSPA 2O9TA 5JH2A 1TE6A 3M16A 3R0DA 2JKAA 3GAYA 2PGFA 2PAJA 3W7EA 2BS9A 5IBXC 5M1TA 3AMLA 3NQFA 4FEZA 3GTXA 5HXMA 4ICNA 4YTQA 2JIWA 2WM1A 5HUOA 4BI5A 1S3HA 4JN6A 4NI8A 2QV5A 1U2YA 3MO4A 3ALFA 3ARPA 4O1AA 3WMBA 1YDOA 3NQ7A 3ONCA 5IHRA 1BTCA 4DJEA 2GJPA 4Q8TA 1N2VA 1E15A 4KRZA 3NQBA 2O55A 3B9DA 3KRUA 2ACUA 4C6BA 4DYJA 2P0IA 2BX7A 5EMYA 1SSDA 2BOEX 1R47A 1KLZA 3S46A 1X8CA 2QS8A 3VU2A 4CGTA 4H9UA 2ZCGA 3TYAA 3C0LA 2D0HA 2DJLA 1YHTA 3WNNA 1XBZA 3ARRA 1HN1A 3BSMA 3PBMA 4GWEA 5A6KA 4XAPA 3PNUA 3UA3A 3PJXA 3W29A 4XISA 4F0SA 5DY3A 2E8YA 3CXOA 3PUOA 1O5XA 6REQB 2UWFA 3O15A 1O7AA 1FDZA 3SUVA 1TZ7A 1LT8A 1XIEA 2IQ0A 3DFOA 2WCAA 2DY3A 4QRNA 2PU0A 3GUGA 1BF6A 2IKIA 3CQIA 1UH3A 4OVXA 1AODA 2B7PA 2DSUA 1D8CA 1V02A 2VEPA 2NXHA 1XBVA 5EMKA 2W67A 2Y89A 1V3HA 3ENLA 3PBWA 3W7GA 1JUEA 1U1HA 1QATA 1UASA 3T8QA 1TV8A 4C6CA 1VBGA 3S2MA 3TCEA 4H04A 1QHPA 2RDTA 3CMGA 1ECQA 2A3EA 3NCOA 5IRPA 3Q67A 2ZC8A 4RV3A 1I45A 3MPGA 2DT1A 1UKTA 2OLAA 4XZHA 2QJIA 1FWNA 4F0LA 5AKQA 4A8NA 1M53A 4HKPA 1EYEA 3KP0A 3EYPA 4QR6A 1TB3A 3DERA 1K4GA 1I2PA 4GE8A 3BMWA 2DZTA 2VR4A 3U4FA 1KXTA 4H7CA 4RZBA 3DHDA 3GNDA 3VTRA 3OG3A 2UY5A 4HA4A 1S5NA 1XC4A 3CUIA 5EGRA 4O4VA 4V28A 1RCQA 4F3HA 4IL2A 3MP5A 1REQA 3MHGA 4DHGA 1GZJA 2EPLX 3UYCA 2ON3A 1W3TA 2J8TA 4S3DA 4L6OA 3M0JA 3BOFA 4C60A 3SJNA 3CJPA 3WLRA 1YQ2A 3PZOA 1KCZA 3GRIA 1F3XA 1PIGA 1CXKA 5CGTA 4CQ9A 4TVDA 1L0PA 1O66A 4UTUA 1UUMA 5FI8A 4GI9A 1LP6A 1BQCA 2WMGA 4TU1A 3WQ6A 4MPKA 3RPMA 1VFFA 4GCAA 2HVNA 2QCNA 1WOBA 5TQLA 2HXUA 3B3DA 5AC8A 1P7TA 5I6SA 3T0DA 1OWQA 4CEXC 2WMIB 2CITA 4IMFA 4EWJA 1OBAA 4PA8A 4AMCA 2Q01A 1E0TA 4KMQA 8TIMA 3W28A 1T99A 1Y5VA 4AVFA 5D8ZA 4O10A 4QS6A 1EP2A 4LYKA 5AC7A 3K8KA 2E09A 4J2PA 2VCBA 5CPNA 1JDEA 3KWXA 1F2JA 3C5QA 3DN5A 4O8AA 4REQB 3R94A 3BLKA 1LWIA 1SW7A 1TE1A 2A4AA 2BFGA 4W84A 5LSMA 1R5YA 3A64A 2PURA 5AECA 5BU9A 3L0KA 4QSFA 4EAMA 3HV8A 2NUXA 4JKMA 4AISA 1EYWA 1DHPA 2QPUA 2PRHA 2WMHA 1LG1A 2VL4A 3A3WA 1TTPA 4LAZA 3WJYA 4F8XA 5EMJA 2O4MA 1W0MA 4GUFA 2R82A 1LOLA 1GONA 1WV2A 4LPCA 1R3YA 2F7FA 3WL1A 1MW1A 3TK7A 4Z0JA 1UA7A 2VXNA 2I7GA 4DUOA 4Y9PA 4Y96A 1SM9A 4LJ3A 1VC4A 4RE0A 1R85A 3OLGA 2E7FA 4F79A 1LUCB 1RY8A 3TR9A 2FFCA 1XH1A 3HPAA 1QW9A 4AZCB 2OZ0A 4RR4A 1JF5A 1VCFA 1HNYA 1ISWA 1ISXA 3T81A 1VFOA 1E9YB 4RNHA 3EWZA 4J3WA 3ZOAA 3GR7A 4A3UA 2G4FA 3M5VA 4ORMA 1EDTA 4LYQA 5ENLA 2XIBA 3TC3A 3WK3A 4DYKA 1OYAA 4ASTA 3BLOA 5D30A 2GGGA 1UQYA 4JDBA 1AA1B 3P61A 4AZHA 2Z1XA 3H7VA 3UYIA 3BW2A 3TNOA 4AQLA 3WFAA 1JULA 3EX2A 4ZEPA 1REQB 1XYZA 4RE2A 3LOTA 3GXIA 4IGHA 3KCOA 2QGYA 1XFCA 3ZO9A 2XPKA 4BQ5A 4DJFA 5HNTA 4RNJA 3L5AA 3W7QA 1ZTVA 2QV4A 3I4EA 4XZIA 1RJPA 4S38A 3FEMA 1AH3A 4JTCA 1VBUA 5BRPA 2NWSA 4NAFA 2D2HA 3GB6A 3OO2A 5FAGA 4E8GA 3IIXA 4JIHA 1GOMA 1CPUA 3E0IA 1F8MA 3BCJA 5G4HC 3WJSA 4DWSA 1JGIA 3G3DA 4U28A 3L0GA 4GVHA 2D3NA 4KH2A 3TWBA 1KW1A 1JPKA 4MHBA 3RX3A 4GH3A 3VDGA 1PX3A 3C0SA 2AQOA 4Q8NA 1E71M 3W9ZA 1OG0A 1GT8A 4LV9A 4OIFA 3SN4A 1PTDA 1OF8A 4FOKA 1MW3A 2ALRA 4F0HA 1GYMA 1TTIA 2VT0A 1IV8A 1KTNA 3FXYA 1Z6KA 1QPQA 2ATSA 2NQ9A 4HK6A 2FDSA 1GUVA 3KZSA 2R9RA 3LV5A 4I7UA 1U83A 2D24A 4HN4A 3DYPA 1F05A 1V0NA 3W7RA 3NYDA 4WY0F 3V7PA 3TIMA 3REQB 4ZENA 2C16A 4XAFA 1W1IE 5HAOA 3UXLA 3RX2A 4L9ZA 3WO8A 5F2GA 4NUWA 2QXWA 3U5UA 3V4BA 3TROA 4MWAE 4OV4A 1JYNA 4RDYA 3QQ0A 2VUYA 1NU5A 3H2NA 3O2LA 1E6ZA 2W79A 4RK8A 1XCFA 4NYYA 3MCNA 3NPWA 4Q8PA 2ODOA 5A69A 4AX7A 1H62A 4D8ZA 4OUIA 2ZWZA 3O3RA 5JIPA 3TC7A 4G9PA 3H2EA 1UH4A 2BY1A 1YADA 2FJUB 4QCEA 4IHCA 1UJQA 5C70A 3VDAA 4ROPA 3A23A 4UTJA 1I75A 3W3OA 3ABZA 5HUPA 1V7YA 1A5KC 2LLEA 5CPMA 4HA1A 1ZS2A 3MVTA 2C18A 3DG7A 4F40A 1S46A 1FCUA 1Q6LA 4YL2A 2X0HA 2CXEA 3A9IA 2ZX6A 3TYZA 2P76A 4MY9A 3JR2A 1GKPA 3CWOX 4PRTA 4C1KA 2P3EA 5BOEA 1LWHA 2E6DA 3PANA 4UB9A 3GU9A 3V36A 2Q02A 3B9EA 2ZZ6A 2XSAA 3UJ2A 2E40A 1EO7A 1D9EA 3GBDA 1M41A 5LNUA 1BWLA 3PZTA 4JTJA 4ORIA 3SCQA 3I68A 1RLDA 3VM7A 5XIMA 2WHKA 2I56A 1V8EA 3QV6A 3NWRA 3F2CA 5JQ9A 4KEMA 4LAMA 2QUTA 2VVSA 3AMCA 4KWSA 4FXSA 2XIJA 2B31A 4H9TA 2NSXA 1YX1A 3RRAA 4OUEA 2V67A 1GVSA 4H3DA 3TKFA 2QQ6A 3W1UA 2VM8A 2EXOA 4QAIA 1UW9A 1JAEA 3IIPA 4E8DA 4O0QA 3IRDA 1VIWA 4PCFA 1T7LA 3W7LA 4Y7EA 3VGHA 4AHQA 2PP1A 2VEMA 3NJ3A 1FFRA 3B40A 5EY5A 3AOFA 3P14A 1CB7B 1OX4B 4FZIA 3UG8A 3GH4A 1UPMB 2RHGA 1PEZA 3LYEA 3FVMA 1JCLA 3PPGA 5FESA 3WUFA 1NDVA 1KO0A 3GH7A 1ODUA 3E02A 3GTIA 4NJKA 2FLIA 2GK1B 1QNOA 1KTCA 2HROA 2VGGA 4GVFA 4NP7A 5AYIA 4E4UA 1V77A 5C9ZA 4I5XA 4ADTA 3CPGA 1WE5A 4N9CA 3VNIA 1DE5A 1YPIA 3NEVA 1VIZA 3FJNA 1X6NA 4DO4A 4Q6JA 3C8FA 4LNCA 3V35A 4A05A 3ZVHA 1R3QA 3HGSA 1HO4A 4XAZA 4Q32A 2A3HA 4PCNA 3NPVA 3A4WA 2VFFA 4FOJA 1TPB1 4ATWA 1B57A 4XTDA 4V15A 4WUIA 2WNZA 1S2TA 1XDMA 3HBLA 3FIGA 5F1VA 3KRBA 4MWAC 1RVGA 2FZBA 1FHLA 3KS5A 4KRUA 4W8AA 1DKWA 4O17A 4P8VA 3QKZA 1DL3A 1FBAA 3BTNA 1NQ6A 3GG7A 3PZQA 3KDNA 3CMJA 5I00A 4EVZA 1J4EA 2VFDA 1WZAA 4G7EA 4CU8A 1BAGA 4LOCA 4HJWA 4C6FA 3SY5A 4JX4A 5CJ5A 1Q6RA 5DY2A 4WX2A 1H5YA 2QVHA 3APYA 1HGYA 1JJKA 1Q6FA 5M5DA 5A6TC 1Y8BA 2YL9A 5KZ6A 1K03A 3UG4A 1JR1A 5FJPA 3W75A 2DW6A 3VDCA 3ABQA 2WB5A 3KOYA 5B7ZA 3PFRA 2RUSA 4DWSB 5BXTA 2DH3A 4MB1A 3NQ8A 1NF0A 3AHVA 2BY3A 3BUVA 4U31A 3RCYA 1TPH1 3UVIA 3M44A 4EWND 2WC7A 4ONVA 3T78A 2X41A 5HR7A 3GVVA 5H91A 2ZVRA 3AIRA 1R30A 4GQGA 4LF1A 1PTGA 2XH0A 4PSRA 4PB5A 3CPRA 3UG5A 3RR1A 1AVAA 3M7SA 5KZDA 4AY1A 4ZXOA 3R4IA 3E0LA 3O6AA 1JFXA 2ZZ2A 1AK5A 1KBKA 5I7GA 2UV8G 1DJNA 1V7AA 4QM1A 3CUXA 3VD7A 3PZNA 2PLKA 4D2JA 3DFNA 1A49A 2FPVA 3PR2A 5D2XA 2QJNA 3I4KA 1CCWB 1RA0A 3WLNA 4GYFA 4ZVJA 1XLLA 2VENA 3V0TA 4N9EA 2OB3A 1FHVA 4D6DA 4JTLA 4IIBA 3O07A 2OXNA 4M51A 4WLCA 4UCFA 4ZR8A 2ZX8A 3INPA 4MIMA 4JN7A 3LSBA 3UPBA 3LZ3A 3A12A 3N9SA 3BC9A 3L5MA 4WDTA 4NG3A 4BCEA 1JF6A 1DEDA 4YVVA 2XFFA 2XN1A 2XVPA 4I7WA 1WDQA 2YYTA 3WEZA 4IG2A 1FCBA 4GX8A 1QWGA 2I17A 1SW3A 2GQAA 2WVVB 4G6CA 3J7HA 2E9BA 2QF8A 4JICA 1EL3A 4C1NB 5I3GA 5I77A 2NZLA 4MFDA 3MP3A 3S8HA 3TA6A 2VD8A 4RDZA 2VFGA 1OFBA 3IGUA 4C7GA 3P5YA 2V2DA 1OB0A 1PIIA 2VEIA 3H12A 4XVDA 1XUUA 3AZRA 3BG9A 3MP4A 4TV5A 3AU6A 2E67A 4H6RA 4B5XA 3WLLA 3TOPA 3NQAA 2C13A 4JZ5A 3ERPA 4HD5A 1J96A 2OVLA 3THDA 4ML4A 1SYTA 4F0RA 3H53A 1K8YA 3MUZ1 3EB2A 2DZWA 1Q4WA 4H9ZA 5A6SA 1LQ0A 3MSYA 4PRRA 4K39A 1ZU8A 1WCGA 1XPYA 1SJBA 1WBHA 4V2XA 4O52A 1XWYA 5HNNA 1EC7A 1N8FA 5C0QA 1Q7QA 2YA1A 4P7OA 2HS6A 4NI3A 1PX8A 4LWWA 2GK1A 3VIKA 1R2RA 3QMRA 2IPGA 4QCFA 2OR2A 4E5TA 3PZGA 2IPWA 5I07A 1W3JA 1CLKA 4QLKA 2QEZA 3RLHA 1V0KA 5M17A 1PXGA 2GDUA 1BRLB 1C93A 3HV9A 3EPOA 4REQA 4J7RA 3K5XA 1ZZMA 4K38A 4JYDA 4ZZ9A 3UP8A 3LY0A 4K8HA 3LTYA 3WBEA 1BYBA 1BHGA 1NP2A 3HN3A 3IVUA 4YNGA 3DCPA 4UZSA 4UR8A 4N7QA 1MWOA 3I3DA 5CC3A 3E74A 1GVIA 5E93A 1S2UA 1YIXA 3U2CA 3EAUA 4IQEA 4GIRA 4DBUA 1J0KA 2GWGA 3APGA 3CZEA 3VGEA 5HMFA 2W9MA 4LT9A 3E49A 1OX5A 5BMXA 3NO1A 4BQ3A 1H7PA 2YA0A 2ZBTA 3LDVA 3CMFA 3M4HA 2CYGA 4XIAA 4LGXA 3SSJA 1ZCOA 4OHQA 1XV8A 2V8ZA 4Z42C 3B8WA 5DELA 1M7OA 1EHAA 4QEHA 3GVRA 5E0FA 1E0VA 1VFMA 2ZE3A 3S6DA 1VQTA 1JL8A 1LUCA 3E2SA 3E6EA 3HTWA 4HB7A 4FA3A 5EFFA 4W88A 2VJXA 1EJRC 3BLLA 1OFRA 4YS1A 3K13A 4HPGA 3LI0A 3GZAA 4AVOA 4AHPA 3VUPA 4BEUA 4DX3A 4IX2A 2NX3A 1SJCA 1M7XA 5I2UA 2AL2A 5AZ0A 2PDFA 4DO7A 3C56A 1GEQA 3IAPA 2OZ8A 5I3HA 3M5YA 2F84A 1GHRA 1E0WA 3WUGA 1TQJA 4RZ6A 2Q71A 2XFWA 3UWVA 1HQTA 3EB3A 3PPFA 1YPFA 1MUWA 3UJFA 3OZOA 3DHPA 4HSHA 4GXPA 4S3AA 2VX4A 1Q6CA 1OG6A 4MUZA 4FR6A 3UD6A 4L1WA 4US5A 4E4FA 1PX4A 2QUNA 3IJLA 4XK2A 2CWXA 3BJSA 3D46A 5LKYA 1W6TA 2P8CA 1BF2A 2X42A 4PMVA 1XH2A 2GJNA 1PV8A 3WQGA 4C91A 1TJPA 3LTSA 4ZXLA 1HJUA 4WY0B 3TDFA 1KFWA 5BXPA 2ACSA 1P6BA 5E1QA 2QCLA 2C3ZA 5CQ1A 4A8LA 4KW2A 4WY0A 3TXZA 4CN4A 2QVNA 4HNUA 2YBVA 4TX6A 1MEIA 2EHHA 2GQ8A 1UZDA 3LN3A 3IGHX 2ZRUA 3TQ0A 3T44A 1XYAA 4E8CA 1XQLA 3LHUA 1IT7A 3GDRA 1MUMA 4O1EA 4F2BA 5ECUA 5A2CA 3PPCA 2WSRA 3GW0A 4KFOA 5FJJA 5FJOA 1ZUAX 3S6TA 2PDHA 1FVPA 1FKWA 2BGQA 1NVMA 1ZAJA 2QCDB 4JNZA 3GVWA 1WBJA 2OG9A 1TPVA 1HL8A 4D1JA 2AMXA 5FD0A 2GJXA 2XFRA 3K4AA 5GJNA 4CCCA 4BZYA 4UOQA 3FJ4A 1DBTA 5CPTA 2WNNA 3FDKA 4N0RA 1XDLA 5TIMA 2YCJA 3QY8A 4PTVA 3VUSA 4NZJA 3M9YA 1T40A 3LI1A 3W1LA 1RD6A 3WF0A 1PL9A 3ZT5A 1H7NA 3HG5A 4PR4A 3OHMB 4MYAA 4Z2KA 4U33A 4UMAA 3S9YA 1TWWA 4HTBA 5LXEA 3EA1A 2JBMA 3PTMA 4F0MA 2G95A 1NY1A 5C9XA 3VNDA 1I9CB 1T8QA 1UH2A 4B2DA 1PYFA 2NQZA 3ITYA 2VTFA 2NW0A 2UBPC 4XAYA 2J9ZA 3WQPA 1XFBA 2XHYA 3G5EA 1VCVA 3GDLA 1MRQA 1LQAA 2DQWA 1UBSA 4DPPA 4S3JA 1MEHA 1EX5A 2ZDRA 1FWBC 3TXVA 1PZ3A 3UWUA 3NNTA 4PULA 1OFAA 4CNUA 1EDQA 2GLKA 3QOMA 2XWDA 4AU0A 2DT2A 3UEQA 4C5ZA 2EJ1A 2G4JA 3RM8A 1QO5A 1FCQA 2PDBA 1HVQA 3KRZA 4I9AA 3R1ZA 5EL1A 1DWJM 3SECA 3WLKX 4NNCA 1OCJA 4X9YA 3W6LA 3MDWA 2DZPA 3QR3A 4M80A 2DT3A 4O19A 3V1HA 2DZVA 3F5JA 4ALDA 1CT5A 1EDGA 1L9WA 4PE8A 1GJWA 4V1YA 1UWUA 4YVXA 2PGEA 1CGXA 4GC4A 4GOAA 4OT7A 4U2ZA 1C8YA 4FO4A 4Z08A 1FY6A 2FGZA 4GQRA 3GC2A 4HSNA 1XLIA 3UXDA 4B5TA 4NZ1A 2Z0IA 1QPKA 2TSYA 4K37A 1RH9A 1W17A 4CN6A 1ZRQA 3NM1A 3DOPA 3WMSA 1KM6A 5TF0A 3NZPA 3UNTA 2PDUA 2W63A 4P7QA 2DIKA 1TWIA 2FPTA 1VJSA 1B54A 4WJEA 5HINA 1VPXA 4Z2IA 7XIMA 4IUGA 3GM8A 1C7TA 1M7PA 3VINA 1V08A 4M19A 3UZXA 4FNRA 1XKYA 1A5BA 3GR4A 3LPFA 4UOJA 2E5CA 3DC0A 5KSWA 3ECQA 4IJCA 1KM5A 2REQA 3IEBA 3UPMA 3EDFA 1VHCA 5D05A 2HBVA 3URAA 2Y1HA 3S2NA 1XH0A 1J79A 3BG5A 4PUJA 4EPKA 3D3AA 5DLCA 3AIEA 3GHRA 2D2JA 2Z29A 3W7DA 3S83A 3REQA 1EQCA 2J9XA 4EK7A 2G8ZA 3VC6A 4AZIA 2WVSA 3ABXA 2ZTJA 1AQMA 4AIEA 2X16A 2IXUA 1K9FA 3GDKA 3AHYA 4GK8A 3BLIA 3KBVA 4C7DA 2Y7EA 3LXBA 1R3VA 3ES8A 1DJGA 2Y5EA 1NP0A 1M5WA 3JRKA 2XH4A 3OIXA 3O7UA 4WXYA 2ZRWA 4MFEA 4R33A 3VOHA 4CD7A 1QJWA 3NFUA 2GGHA 4IJRA 5HMSA 1RAKA 2PDLA 4MB4A 3TCSA 4V33A 2YFNA 1M65A 3M0YA 4LVBA 3Q58A 1BLIA 1GJUA 3DI1A 2PTXA 3C0QA 2PGRA 1KM4A 2OSYA 4ZOEA 1VJZA 4DI9A 2D0GA 4D6CA 1K6AA 1H09A 4O57A 3SCNA 2YB4A 3QSRA 4MKVA 4AWTA 3N2BA 2Q6ZA 4J27A 1TPFA 3VGGA 4UXDA 1UR8A 3P3BA 1OF6A 1KFCA 3GYEA 1BYDA 3C2EA 2OGYA 5DF0A 5TNVA 3BAJA 3KTXA 2BVWA 3CL8A 1P0EA 4GY1A 4UMCA 1LCOA 4GKTA 2ZZ4A 1XLFA 2ATMA 4HVXA 3P82A 1RVKA 1VEPA 3U57A 3VFLA 4KGLA 1HFBA 1SMDA 1BGAA 3B8UA 4BA0A 3GHTA 2Z1VA 3SADA 2F9RA 3GTFA 2Z26A 4W89A 1PCWA 3A3XA 4LCQA 1IHIA 3DC8A 4LCSA 2NQHA 2YCLA 2VC9A 3RITA 3Q94A 1TR1A 1VB9A 4GKLA 2V5KA 3F4CA 5IDZA 4XBJA 3FAWA 2HISA 1BPLB 2FJKA 4YU1A 2RJGA 3G3MA 4ZQOA 2VKZG 4R34A 3P6LA 3N6QA 4AXNA 1PJ9A 3H7RA 2QF7A 3LRMA 1SO4A 3O9NA 1HT6A 4KCTA 4PCTA 2PZ0A 3S42A 1XRTA 4MM1A 4C90A 3HU7A 4AIBA 2DUXA 1CDGA 1NQKA 1G01A 3DFPA 3ARQA 5KINA 4ZOAA 3FX4A 1KBBA 1LRQA 2X1UA 3LHZA 1SO5A 3RMEA 4DUWA 1EJSC 4UTMA 1EWEA 3G1DA 5K3VA 1B90A 5D33A 1QDSA 2WQDA 4ZA0A 1BXBA 1NM9A 3UR7A 4N02A 1OC7A 1PDZA 5FA5A 3MKCA 2ZZ3A 6ALDA 5AHNA 4JHZA 4FF7A 1UJPA 2XIIA 4GI4A 3MTWA 1HF6A 1OYBA 4HQVA 1CYGA 1EIXA 4O50A 4B9YA 2BV9A 1VFLA 4WDXA 2J7DA 1EX1A 4YXGA 8A3HA 1XISA 2V0TA 1TPDA 4PB3A 1W5MA 1WOAA 1PCKA 4RDWA 4QISA 3SIZA 3N2XA 3B9AA 3M41A 2OKOA 2QDGA 2A3CA 1A5OC 2BDQA 2O0TA 2DSVA 4ATDA 3IAQA 1GOIA 1VPYA 2PF8A 3WBAA 5DRIA 5GVJA 5JXQA 1IE7C 4QEEA 1A5MC 5BU6A 1R7AA 4H9XA 2CC0A 3W01A 1RJQA 3IJQA 1YYAA 1D8WA 1NWTA 4ERGA 1K8ZA 3C86A 5HULA 4QQ3A 1O5QA 3AS1A 3KOZA 1WNOA 5FEPA 5C2XA 1KM0A 5REQB 3UBPC 2E9LA 3QRHA 2FZ9A 3BOLA 3GXDA 3AS2A 3R79A 3ME3A 4XVEA 2CHRA 3L2LA 1KKOA 1D3GA 5E9XA 3ZJ6A 3LB0A 4AIUA 5GJPA 3VKBA 3VIJA 3LGEA 1MUCA 3SUSA 1H7OA 4C6KA 3TFCA 1JXJA 5GNXA 2WHMA 3M0IA 4MGGA 4KCVA 2OU4A 3P81A 1Z9AA 1KRBC 3WF2A 4UOZA 4DF1A 3OBKA 3W74A 4Q4PA 2PEVA 2EG6A 3OA5A 3IIOA 4WJXA 4M5PA 1H60A 2P5NA 4XB3A 5CZKA 1K6WA 4ZOCA 3SI9A 4JTDA 1VKFA 3MT1A 4AEOA 1O68A 2CZ5A 3NR0A 5BNKA 5D2TA 5H1WA 4IQLA 3TAOA 1XLAA 1ZHAA 3CO8A 2DUAA 4ZQCA 2V6AA 1VBHA 9CGTA 4NILA 4RX0A 3ZYZA 4GVGA 1POJA 1OIMA 1MZRA 4TTUA 5EKYA 4PMRA 3OVQA 4QG6A 3DUGA 3UERA 4IP4A 1UKOA 4HMDA 4JTTA 3WH8A 3W1QA 4INFA 1J9YA 1BYAA 4A8IA 3U2ZA 4K1WA 3UJSA 1ISZA 4DF2A 4OQVA 1TPWA 4HZ6A 1DJQA 1UD4A 5AHMA 1VYSX 3FOKA 2OCZA 2F2KA 2D0FA 4P61A 1MI3A 1O5RA 5IHSA 4RXFA 4KEUA 2J88A 2J6VA 4XUYA 2NV1A 1P1MA 1LORA 4MDOA 4QG9A 4ZO9A 5IM51 4IL0A 4E4PA 2WMKA 1LTDA 2JFEX 3KVJA 1B31A 3F7JA 3QEZA 4NKCA 5CZ0A 2XH2A 1MYRA 3TV8A 2ALDA 3M47A 1C91A 4GACA 4JYEA 4LB4A 3WH6A 1OC5A 3RO8A 4ZQMA 1US2A 2Q09A 3CUJA 5AC6A 1JI1A 3OBEA 4UNIA 1WDDA 4M29A 2QCEA 5M3WA 2R1LA 4JNMA 1E4NA 3RJYA 1LLWA 1EBHA 3MHUA 4W8LA 2XWEA 2GDQA 3MSRA 4K2SA 3KVKA 3RO6A 1A0CA 3EX1A 4WGXA 3CBWA 3SW6A 3OOQA 3RR4A 5D02A 4JPGA 3CTLA 4KIEA 4WGHA 5M2FX 4KEVA 3UF9A 2WW5A 1XIDA 1OYCA 2H3BA 4ZQNA 5DCEA 4ZSUA 4PRWA 4P5UA 3CAVA 5J8LA 1ZL1A 3EPNA 5AYZA 2Y2WA 1Q8JA 2FB2A 4NU7A 3UXKA 4W8BA 2QDHA 4UFKA 2Z1WA 5DMLA 4CVWA 4BFAA 3RFAA 4TO8A 3C2RA 4IIEA 1HJSA 3LGDA 4PBGA 4JIRA 4PTNA 4S3EA 3WEOA 2QJHA 3U2EA 1KXQA 4DNMA 3Q4DA 2VZUA 4JGDA 4E38A 4HU0A 3G1SA 1W9XA 3VX1A 2ABBA 3IJ7A 3POHA 1EHNA 4OKDA 1DWIM 3UW6A 4U5KA 1JCNA 2B7NA 4Y6GA 4O13A 1K3UA 1V5XA 1S2VA 1QAPA 3QQ1A 4DJEC 5HNUA 2VMFA 3R10A 1I1XA 3LXCA 3BW4A 3V3WA 2YLAA 1DE6A 4LUTB 2FH6A 5E6YA 3QLDA 2HXTA 3KHJA 1ZB5A 4HYRA 1XLKA 3GIYA 1HJXA 2WJDA 3I7SA 5HWJA 3L2IA 5I03A 2GJXB 4BK9A 1H49A 5C54A 3S5OA 4DZ5A 1MZHA 1W3NA 2WJFA 2PDIA 1L8NA 4GZ7A 5T8GA 4PUNA 4A4AA 3T4WA 3WK0A 4HJFA 3GG8A 1PE1A 4L64A 4N4PA 2Z1BA 3LLDA 2FH8A 3NSNA 3EXTA 3W87A 2ZYFA 3P60A 1X97A 3VIGA 4DM1A 3E2VA 1RP9A 1I8JA 2EBNA 3W81A 1KR0A 2NV9A 1MW0A 1NOWA 4IM4A 3DBNA 3FDGA 3TN3A 4TMCA 4G7FA 4PFHA 4U10A 2C6QA 4S39A 2XM1A 2R1MA 2CBJA 3PB2A 4Y9NA 2VVNA 1TREA 1E4MM 4HNNA 5I3DA 1VLWA 2VZVA 1WKEA 1DHKA 3EDJA 3CZLA 1CB2A 2JGQA 3KS6A 1H4PA 2J74A 4NSBA 4GC3A 3WK1A 5HQMA 5TBOA 2Y8VA 1ZCCA 2PDQA 4DZHA 5CAHA 5MHBA 3F03K 3L7RA 3CM4A 4UFLA 1K7EA 1H7WA 7PTDA 1EFZA 1V6XA 2B4GA 2VURA 1SO6A 4JEJA 2CHNA 6ENLA 2NT0A 4W9TA 3DAQA 2OZ3A 5HANA 1POKA 1KWGA 4IFKB 5HBFA 1IEIA 1F61A 4CD4A 4PUKA 3DEQA 1E56A 3MUAA 2WPGA 5A95A 1C9DA 1SZGA 3RK8A 2H9AA 1RP8A 2CZVA 4PCSA 3NSXA 3LGGA 4H9MA 3V1PA 1S1PA 1A50A 1PAMA 1DJXA 5D9PA 2I1OA 3H2FA 4Q4QA 3QHMA 3QXBA 1NELA 1QBBA 3OVPA 3QN3A 1GG1A 4GINA 4OJYA 2VRQA 4S3KA 5ABFA 1EGVA 3PPHA 1PPIA 4MAZA 1H7RA 3NGJA 3NQEA 3AI0A 1O4UA 2Z27A 2PTYA 3LHWA 1PZ2A 3VNMA 5AOUA 4YHGA 3M0KA 3R8RA 5LIKX 4OU1A 1QFEA 1JNDA 5G1MA 4MJMA 5G4EA 2G3MA 2ZDSA 5XINA 2VP8A 3KEHA 3WJZA 2O4QA 3DI0A 2WV8A 4Z1BA 3IANA 2ZADA 3LM7A 4Z1YA 4GLEA 3CC1A 2PE4A 1FWEC 4HBKA 3MWAA 2OELA 3EPMA 4AVNA 3GW3A 3TJLA 3DHFA 4J3ZA 1SVDA 4US6A 1K7XA 1M01A 3E2QA 5LIUX 3AU2A 2CBVA 2IKJA 1PZ1A 3LCFA 2W27A 1YXYA 4MADA 4FI4A 2JKPA 3TA9A 5CKSA 4X61A 1KM3A 3VOCA 2ZX5A 1JRCA 3GTHA 1BFNA 1PWMA 5BYWA 4HK7A 4QJ5B 2WMFA 3FK4A 3UPWA 4MWAB 5HOSA 1UCWA 4D8AA 3UFYA 3GX9A 1NTHA 2Z6JA 4EOUA 3B0XA 4RE4A 1EXBA 2C1HA 4DJDA 5HJXA 2RDWA 1E5NA 4TX8A 3H70A 2WAGA 2PLCA 4GBUA 4QNWA 4HNVA 1SFLA 2GFTA 2PDXA 4QSHA 1XYFA 3O05A 3CU2A 3K8LA 1DQXA 2V68A 3HGOA 4P7NA 4M6UA 3GU2A 4X0VA 4OBRA 1O5KA 2ZZ7A 5G1YA 3ABSA 1BSLA 1QU4A 1TJRA 1UWAA 3QZEA 4A21A 3M1ZA 4M6PA 1A47A 4CQ8A 3ZLHA 2XVLA 3WQDA 4DJFD 3FJ6A 3I6TA 1BVZA 2INEA 3B0VC 3S9ZA 2P10A 4UQCA 2DVUA 4TUFA 3K2GA 1U22A 2CKRA 1WP6A 3O06A 1Q3NA 1GZGA 1Y0EA 1LWJA 3CNYA 4C6IA 1QO2A 1Q45A 1F07A 4IPJA 2DIEA 2QDEA 4JD4A 4UTTC 3KAOA 1GOOA 3URNA 2HE5A 4D8LA 3CEUA 5CXPA 3WF1A 2Y62A 4XV0A 3U48A 4U2YA 3VNZA 3O8AA 5BWFA 2Z24A 4ACZB 3ANVA 3NO3A 5F2MA 1BEUA 3DZ1A 2WSYA 3O6CA 5ECVA 3IK4A 3RRXA 3FYYA 4HA3A 1KRMA 1KGXA 3F2BA 2YDRA 4C65A 1AH0A 3M7WA 3CHCA 8CGTA 3T6CA 2UY4A 4Q3MA 1C9WA 3W2UA 2A5HA 2XN2A 3GO2A 4UTFA 1QHZA 2DZAA 4Z1CA 3M0XA 3KM8A 3VVGA 2D1ZA 2C19A 3TYEA 2VR5A 1KXVA 4Q22A 1W1A1 4J3SA 1B4EA 2PWGA 3WYZA 1AJ0A 1W5OA 7TAAA 4R53A 1SSGA 4O14A 4QDMA 3TMQA 1IXPA 3GKAA 2Q8XA 3LTPA 6TAAA 3P74A 2V63A 1DIOA 1C8XA 2PP3A 2ZOXA 3BSHA 1ZLPA 4NQ1A 4J35A 2A3LA 4U4MA 4JIEA 4LB3A 1Q63A 1CEOA 2EEXA 3QY6A 2BGNE 4GMEA 3W6MA 1DTNA 4UTWC 3N18A 3CAQA 4LANA 1OJXA 1T41A 1EIBA 1NSJA 3FLUA 7A3HA 4YTRA 3THUA 5C9RA 2X2GA 3RM4A 1EO5A 3W4RA 3SCWA 3C3UA 3VKCA 4NNBA 4AFYA 3KOFA 3LEPA 3EA2A 1J0IA 1P0KA 1KTBA 2J4GA 2GOKA 2QJJA 3N9KA 5EMUA 3VZXA 1KRAC 5CC5A 2A7NA 3IGSA 3AYRA 1HL9A 1TZZA 4PC8A 1R9XA 2DPEA 3R6IA 4UQAA 1EGMA 3E0WA 3OTRA 3S9IA 5REQA 3FFSA 1UP2A 3W27A 4ZTXA 5TAOA 5EU9A 4PMJA 4WVXA 3TE9A 1PZ0A 4DBSA 4LUSA 4TOQA 2QKFA 3QPEA 4AD0A 1FWCC 4Z2LA 2GQ3A 4PODA 3P84A 2XJ7A 4Q8MA 4Z17A 3E5PA 1VF8A 3ARVA 1KNWA 1EZ2A 4JQAA 1CXLA 4KPLA 3EXSA 5LGZA 4M82A 3E3HA 4IFOA 4AXKA 1FWGC 3WQOA 2C1GA 2PCQA 3LRKA 2PBOA 4N6FA 3KP1A 5ABGA 1JPHA 2Z00A 4W87A 3MZNA 1J11A 1UWIA 1UHVA 5U7SA 3EOEA 1EJWC 4Z0SA 1F7BA 1ZBKA 4GGBA 2PUZA 1XS2A 3B4UA 1PVNA 5LNRA 2GWNA 4PMOA 3U7BA 1V6VA 1MMFA 3UQNA 3ALGA 2WPBA 3KUMA 2IUZA 2FIQA 4EF9A 4UMBA 4IISA 4CD6A 3UGRA 2E0PA 2PODA 1CGWA 3WENA 3K1DA 4ADSA 3VAVA 3TW7A 3UWEA 1KQZA 1EA9C 4P7LA 2EPNA 1SW0A 2QNEA 2GUYA 1XSIA 4AD3A 3S2LA 2J7GA 3PULA 1P6WA 1QNQA 1VBRA 1GQKA 4LS2A 1FXQA 3CWHA 3HG3A 3RF9A 3DIPA 2Z6IA 3DFSA 4KWUA 4XO7A 4JEQA 2HEJA 3RN6A 4RW5A 3W86A 1H1YA 1J0YA 1QI2A 5AHLA 2YZRA 2OKTA 1GORA 1JXKA 1TVLA 2PDPA 4PYSA 3PBYA 3G1XA 1SU5A 2QJMA 4IMEA 4EE9A 1XC6A 3TR2A 3TYDA 1XYBA 2D2GA 4PMUA 1IGWA 3W02A 1UWRA 2AMGA 4OECA 1W5QA 4AEFA 3MMUA 1P0BA 1E6PA 1B3ZA 4N4QA 1IIHA 3T2OA 1J0HA 3ANUA 3W2LA 1DQWA 1OD0A 1DJWA 3P2VA 2NUYA 3FSUA 3ARZA 1TPC1 1E9IA 4QJ4B 4NJJA 3WFLA 1GK8A 4A8RA 4QGCA 4OTKA 1VFUA 3W2NA 1JCMP 5KTLA 3BW3A 4KIRA 3S2CA 3G22A 5F4SA 1PTAA 3S2JA 4D1IA 1KXHA 3NL5A 4H41A 4Q4KA 1TV4A 4Q8VA 1VD6A 4O16A 4FALA 2ZUWA 4H8HA 1V6UA 4LAKA 4AY7A 3BG3A 4UIOA 4BJHA 1ZP3A 3N6JA 3AO0A 3ZJ7A 3WBYA 3NGFA 4NY2A 1OFDA 1EGZA 4EXBA 3NG3A 4PTMA 4ILSA 2ISSA 4TMBA 3L66A 1O60A 1ICQA 3CUHA 4BF5A 1XXXA 1XINA 2X0YA 1ZAHA 1G6CA 3RU6A 2ZXBA 5CPLA 1G5AA 4H9YA 3WFZA 2CESA 3VX0A 2XUCA 2WO5A 4LRSA 5G2HA 1VLIA 3KZPA 2W6RA 4XO6A 2R14A 1X1OA 2QMJA 1VR6A 4FNTA 1B3WA 3T55A 3BDKA 3FV9A 4AH7A 1KM2A 3L4VA 2DZSA 4TTGA 3F4DA 2J7EA 3PUDA 2BTMA 3OP2A 2VZSA 1J6PA 2OOFA 1W1YA 2IW0A 1J8VA 1YNYA 4GZEA 4PGLA 4FIQA 1B1YA 5A6BD 1P6CA 1E6NA 2CLPA 4JTFA 1N82A 1JDFA 4TQTA 1TMLA 1E0UA 1XGEA 3UNDA 3OPSA 3QYQA 5KETA 2VGBA 2X2YA 3L9CA 2C0AA 3MB9A 2OT0A 4WDUA 5H8PA 1DWAM 3AHTA 4IIHA 4ZO6A 1EJXC 3KRSA 1THFD 2PP0A 3ZVHB 1W9PA 3NZRA 7ODCA 3TU9A 1R7OA 1DVJA 3NOYA 2FFIA 4ZB5A 3GXFA 1UD3A 2PDWA 5JBFA 3DG3A 1YXDA 2JF6A 4IPLA 4LVGA 3PUEA 4GYKA 1E3XA 4GYPA 3GBEA 3A3HA 1GVOA 4R88A 4ERAA 3KOXA 1KGWA 1TKKA 2ZUTA 2Y5JA 4KWWA 1OVDA 4GA8A 2ZXDA 5FIPA 1IR2A 3M46A 1KQYA 3PP7A 3B04A 3K1GA 2QCMA 1W1ZA 4JN8A 3BLPX 3MKKA 1W5PA 2HCVA 1Z41A 3I7RA 3TUUA 1H7XA 4O12A 3KHDA 3WJXA 3DESA 3WLPA 1F5ZA 2V30A 4I8YA 4PN2A 1Q85A 2WSQA 2WC4A 2PPGA 5LA0A 5AZ1A 3QC0A 4LQ1A 3P67A 2FB3A 2EQDA 4XWUA 5BRQA 3PZIA 4NJGA 4IX0A 3K30A 5JBDA 3IUDA 1A4MA 5DEZA 4IP5A 3G1FA 2O92A 1NH6A 3BXWA 3I65A 4MY8A 3CLWA 1XIMA 2HWGA 3M64A 1UWSA 1V4YA 3N4AA 3CL7A 4HHPA 4AUBA 3N04A 2YOCA 4KFNA 5BXSA 3GHUA 3WNOA 4L1XA 3SJ3A 4B90A 3VI2A 2XVGA 1H1NA 1FWRA 2BY2A 1QR7A 1NF7A 1X39A 3I3EA 5AHIA 5F7UA 4W7VA 2F2HA 4GUHA 6XIMA 1PYMA 3ZT6A 3MUY1 1SGJA 3N2CA 1M7JA 4GHRA 4LX4A 2BXYA 4WEVX 1KCXA 3AC0A 4ZODA 2HPMA 3EXRA 4J40A 3QGAC 4I90A 4DQWA 1BVWA 2ZX7A 3CPUA 1OX4A 3IRSA 4O18A 1EQPA 4FPSA 3N15A 3WLHA 3THQA 5CG0A 3DYMA 3TFXA 2P8BA 1EJ7L 3FYOA 3LNPA 4FLOA 4AZBA 4QS5A 3H23A 4Q4RA 4L6HA 5A6LA 1RK6A 3W85A 1P0NA 3BCDA 4QAWA 3EGJA 3OU8A 3MANA 4ACZA 1A0EA 2NQJA 1LRTA 4FHAA 1GOWA 1CZ1A 3FXGA 3EOLA 4EF8A 1B3OA 4R85A 3ZQ9A 3NEHA 4KRTA 3R5EA 4MNJA 4J3VA 2XDFA 3W71A 4G56A 1C3FA 2ZA3A 7ENLA 5CEWA 2NV2A 3N2TA 4GXMA 2C15A 4I6VA 2Z28A 3PF3A 3SB0A 5FKYA 3STPA 2BHYA 3EEGA 4ICMA 1M9HA 3QLLA 1L6WA 3ZJKA 1W32A 3L4YA 3N4FA 4LEFA 4S3GA 5GQBA 4RNIA 3MBFA 4HT3A 2GSEA 1KBLA 4FX8A 4IGMA 3E0VA 1TYGA 4WKFA 3RXZA 1TTJA 1XI3A 4XTIA 3BGAA 1BKSA 5DRCA 2MNRA 2PD5A 2VOMA 1FKXA 3PS7A 2V38A 3QGKC 3ZWTA 2WQPA 1OCNA 1JDAA 4HHLA 1T0OA 5E0CA 5DFAA 1NFPA 3B8VA 3BARA 3EX3A 1I1WA 3CS2A 4JTSA 2FVLA 2FVMA 2ZA1A 3AZSA 4QLLA 4OWGA 3TSBA 3UZ5A 4ZFCA 2WLZA 1Y5XA 3MVIA 4CNPA 4IT1A 5HWMA 1RD5A 2YCKX 1WAWA 3VDBA 1B5TA 3C52A 3UVAA 3ITTA 1KBJA 1S5VA 3PVFA 4WF7A 1W8SA 1XL9A 2QR6A 1J93A 1GQLA 2HV5A 5JBEA 1XHGA 4B15A 1FWJC 1IT8A 1P1XA 4Y90A 5I3JA 4UBPC 3SQLA 1HKJA 5IOBA 6REQA 4O15A 1TWZA 3IVTA 4KCUA 4LAUA 3CUFA 4I7VA 1EOMA 1H50A 4DB7A 4B2DD 2J7HA 3ICJA 1XG3A 4QXIA 1IZCA 3FS2A 2CZFA 5EPDA 1XLGA 3FJLA 1TJ2A 1GTEA 3T2PA 3GXMA 3S0CA 4WSHA 1SPQA 3BCFA 1RPXA 3EMQA 2P1FA 4PZVA 3WNKA 3TN6A 2NVCA 3EOOA 1LM1A 5K2ZA 4DLMA 3TX9A 1RR2A 1Z48A 1JUBA 3CASA 5A8MA 2YIHA 5D4YA 3Q45A 3E1F1 4DLFA 1VP5A 3LZ5A 3H2CA 3Q2DA 2BBFA 3AHZA 1UOZA 2YJQA 3OGVA 1W3LA 4DZIA 1J5SA 4NASA 2VFEA 4RZ5A 3FKRA 4D6IA 3TQKA 1BG9A 4MJZA 3M6DA 1E70M 1DXIA 2R6OA 3G77A 4L4PA 1TA3B 3HQOA 3SCPA 3B0YA 3WMLA 4PB4A 3T9PA 1S2WA 4A2SA 2WMJA 5CZSA 1MXSA 4AY8A 2QIWA 2ZXQA 3BANA 4GUIA 3GFXA 1G67A 4S23A 1EP1A 1FWTA 4ICCX 2WXDM 4GNJA 1TIMA 1GVQA 3B03A 2GDVA 3NQVA 3UZZA 4LS1A 1IXOA 3QKEA 3FW6A 4R9XA 5BW6A 3T08A 1M03A 4Y2WA 1VJIA 4WOQA 1G4SA 4IQDA 2HRWA 5ABFB 3EWCA 3L21A 3EX4A 1QW7A 4UQDA 2OFJA 4QNEA 1CENA 1PHWA 2FTWA 1WAUA 3VOIA 1HKMA 4IPIA 2CEQA 4PMYA 1PKNA 4C6OA 2ISFA 2BGSA 5DMNA 4Q8WA 1TVPA 1LG2A 1A80A 3QY7A 4JTAA 2I57A 3WD2A 2J7BA 5FEWA 4MZYA 3RLVA 1QPRA 4CEUC 2SFPA 4HZMA 4KWOA 3QGVA 2PTWA 1KR1A 4CNTA 3K46A 3ARYA 3QW3A 4A29A 4PBEA 4XG1A 4I9MA 1B2YA 3WLTA 1IXNA 2ACRA 2VYOA 5CGQA 4MWAD 1MVYA 1ITUA 5LNVA 3NUKA 3S1WA 4UQEA 3NQMA 4UZUA 2OQHA 3H2MA 3Q65A 1RY0A 4H6QA 2Q8LA 3G2GA 2BXZA 3BH4A 4UTKA 4M1RA 3I6EA 1DYSA 3MY9A 1UR3M 5I3IA 3VNLA 1DORA 1IEQA 1OCBA 3G24A 4ZO8A 2RDXA 2HTMA 3MMDA 1TRIA 3PJTA 3WNMA 1UR2A 1F73A 1JZ5A 1S39A 3NL6A 4UQBA 1OX6A 4CD5A 3I3BA 4F48A 2J13A 3M43A 2JGYA 3V5CA 3RU8X 4RCXA 3DX5A 4E6MA 1N8WA 3G1RA 4RLIA 5T26A 4Q8UA 3W84A 5D09A 3W73A 4OE7A 5C9UA 3BMXA 1EUNA 1DP0A 4AWSA 3CQJA 4K6AA 4RPPA 4QTGA 4HNCA 3NVTA 1QNSA 5KZEA 3U7VA 2V82A 3ZZ1A 2J75A 1H63A 1RUSA 4GUGA 1WQ5A 2W62A 3P8IA 1YRRA 3F1QA 1LBMA 4MJ4A 5HJYA 3N25A 4MTVA 4ZMGA 1AW2A 2W61A 2CFFA 3OLIA 4GD0A 5HQEA 4GY0A 4G5DA 3VO0A 3AJ7A 1FH8A 4O0ZA 1XLMA 3L4ZA 5CPSA 4H01A 4Z1DA 3W7HA 2XN0A 1ZSXA 4XD4A 4HHMA 4DJED 4W7UA 1CBGA 4QITA 4J5NA 1V6TA 1UUQA 2VEKA 3HA1A 4M6VA 1MFVA 1QXLA 4GZJA 3L67A 1JYXA 1H41A 2R1PA 3MYPA 1O6IA 1PKYA 3SR7A 2FTPA 5B80A 5CLTA 1L6SA 1G1YA 2AGKA 1AQ0A 3PBUA 3ES7A 3MDUA 1LL6A 1KRCC 2JQXA 4BS0A 2QCCA 4LAOA 1A3WA 2WJEA 3CV6A 3C61A 3WBXA 3GC4A 3LUTA 5HK4A 1H11A 1AQHA 2XGIA 3VFCA 1BTMA 1XGZA 1CTNA 3RLGA 1I60A 1Z44A 5CZTA 2V3GA 3FHQA 4B5SA 2AL2B 1LL7A 2YA2A 2E77A 2OYKA 3QMSA 1MFUA 4GG9A 3CK5A 3GIQA 3KLKA 4W85A 2ZXAA 2QLYA 3A4JA 2FVKA 1I2QA 3AJXA 2JF7A 5FOOA 4YWIA 4JFWA 1AMYA 3OZYA 2C0HA 3PBGA 1LF1A 4LFYA 3AYVA 4IUOA 4JKLA 4RXGA 1O95A 1TVNA 5E5CA 4O1CA 4ZBCA 2WWCA 3UY7A 1NFGA 2VHLA 3DKJA 2UY2A 2XGBA