3PANA

The crystal structure of adenosine deaminase with hypoxanthine bound from pseudomonas aeruginosa
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title The crystal structure of adenosine deaminase with hypoxanthine bound from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 123
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3panA00
4KERA 4H9UA 2Z2AA 3T81A 3GG7A 4GX9A 2PGRA 4IF2A 3MDWA 4ERIA 3PNUA 1EJRC 1PB0A 2Z2BA 4PCNA 2R1NA 3A4JA 1XRTA 1YMYA 4B3ZA 4EPBC 1I0DA 3S4TA 4G7EA 3SO7A 1A5KC 4EPKA 4NI8A 4C65A 3HPAA 3DCPA 2QPXA 4QROA 4C6EA 3PAOA 4PCPA 1P6BA 1A5NC 3ORWA 4NP7A 4XAYA 2Z24A 1FWBC 3S2MA 2VM8A 4KETA 4PE8A 1GKPA 1ONWA 4LAOA 4C5YA 4C6BA 2ADAA 2HBXA 3RCMA 5HMEA 3GIPA 3UPMA 4C6DA 3QGKC 1W1IE 3GRIA 1K70A 4G7EB 4GZ7A 2EG8A 3WYZA 3F4CA 4LCQA 4XD3A 4B90A 2QT3A 4TQTA 2G3FA 3UR5A 4WGXA 2WJEA 1A5MC 1EZ2A 4LALA 4XD6A 3URQA 3MDUA 3E38A 1O12A 5FSEC 1GKQA 1V79A 4IFKB 4ERGA 1KRAC 2KAUC 2O4MA 4GY7A 2YZ5A 1WXZA 1FWFC 2E25A 5LXXA 1EJWC 3JZEA 4B91A 4XAZA 3URBA 3MKVA 3LNPA 4HJWA 2HPMA 1RK6A 5E5CA 5A6TC 4LCSA 1KRMA 4H9YA 1J5SA 4GYFA 1R9XA 1ITUA 4ZSTA 1ZZMA 1POJA 2W9MA 3LGGA 3RHGA 3V7PA 4XAFA 3KM8A 4H9VA 1A4LA 2R1KA 1RA0A 3F4DA 4LEFA 3F2CA 3GU1A 2GOKA 3NQBA 1QW7A 1V77A 3B40A 4AQLA 1UIPA 4IQJA 3WZ0E 5FSDC 4IG2A 1FWEC 4KESA 1O5RA 2BGNE 3S2JA 2VHLA 4I6KA 3OQEA 2FFIA 1NDZA 4RDWA 1POKA 2OOFA 4DI9A 1P6CA 2I5GA 2YB4A 4CQDA 1EJSC 1A5OC 1FKWA 5G4HC 2GWNA 2D2GA 2UBPC 4JOMA 3T8LA 2PLMA 4H9ZA 3AU6A 3RN6A 4KIRA 4C6OA 2AQVA 3K2GA 2PUZA 1XRFA 1YRRA 3OJGA 3PBMA 3E74A 3E0FA 1RJRA 1I0BA 1RJQA 3UR2A 4C6NA 3IJ6A 3HTWA 1PSCA 4V1XA 2Q09A 2DVXA 3MVTA 3UBPC 4GX8A 2R1LA 2OODA 2QVNA 3DUGA 2WJFA 2O4QA 4Z42C 4H9MA 2YXOA 3PANA 4J35A 1K6WA 3IACA 1XWYA 3BE7A 1KRBC 1M7JA 4LAMA 1K1DA 3NEHA 4L6DA 3UF9A 4D8LA 1FWHC 4NG3A 4KEUA 4H01A 3LU2A 1YBQA 2A3LA 4YIWA 1E9ZB 4IH3A 2AQOA 2XIOA 4LAKA 2OQLA 3TN3A 3T1GA 3C86A 4HK7A 1A4MA 3GTXA 2WM1A 3EWCA 3EWDA 4EPDC 2GZXA 2Z4GA 3QY8A 4IGNA 3IPWA 4DZHA 1YNYA 4PBEA 2YB1A 1VFLA 3MTWA 1EF2A 4C60A 2VC5A 4DI8A 1KCXA 2BB0A 4IGMA 4XD4A 4CNTA 3GTHA 2ICSA 1J79A 3OVGA 4EPEC 3OU8A 4HK6A 3FDGA 4CQBA 3TN5A 4GBDA 3URNA 4DNMA 2PGFA 1S3TC 3TN6A 3LSCA 3MVIA 4GOAA 4CNUA 4R7WA 2QS8A 3LY0A 4J5NA 4C6IA 4KEVA 3RYSA 1ONXA 1R9ZA 3CS2A 1V7AA 4GY0A 1RJPA 2D2JA 3B0YA 4IFOA 2FTYA 5AKQA 4PBFA 4C6JA 3GTIA 1EYWA 1NDWA 1J6PA 1NDYA 4RDZA 4R88A 4CQCA 3LSBA 4DLMA 3HM7A 4P5UA 4C6KA 4DIAA 4H00A 4E3TA 3ICJA 4QTGA 2EG6A 1EJXC 3SFWA 2HQAA 3WMLA 1ADDA 4J2MA 4DYKA 3LA4A 3PNZA 1IE7C 1M65A 4QRNA 3G77A 2R1MA 4B92A 1EJTC 3K5XA 1FWGC 2FVKA 3K4WA 4UBPC 2FVMA 1RAKA 4XD5A 2AMXA 4IG2B 3F2DA 1J6OA 2HNHA 3QY6A 3S2NA 4AC7C 4C6MA 3ISIX 4EP8C 3MPGA 2VC7A 4H9XA 3A3WA 1PO9A 4M51A 3F2BA 3R0DA 1V51A 4LH8A 4CNSA 2VUNA 1QXLA 4BKNA 2EG7A 1RK5A 4LCRA 3GU2A 4GXWA 2Z00A 2D2HA 3OODA 3QGAC 3EGJA 2RAGA 3TN4A 4H9TA 1EJVC 4BY3A 1UIOA 1V4YA 2Z7GA 4DLFA 1R9YA 2I9UA 1YIXA 2VR2A 1A5LC 2OGJA 3NURA 1ITQA 1NDVA 4ZSUA 3IARA 1JGMA 3S2LA 4INFA 2Z25A 3A3XA 2GWGA 4IFKA 4ERAA 4C6LA 3GIQA 4R85A 4LFYA 4I6VA 3E3HA 1RA5A 4WVXA 3FDKA 4CEXC 3E2VA 4C6CA 4XAGA 2P50A 4C6PA 2DVUA 3D6NA 1UBPC 4C5ZA 1KRCC 4F0LA 1YBQB 2DVTA 1GKRA 1FWCC 4MUPA 1FKXA 4DO7A 2Z28A 3URAA 3GUWA 3E0LA 1UMLA 2R1PA 2Z26A 2Y1HA 3CJPA 4GK8A 1HZYA 4IFRA 2ZC1A 4V1YA 4ICMA 2HBVA 3IV8A 1FWIC 4HK5A 5HMDA 4BJHA 4DZIA 3AUOA 2E1WA 5HMFA 2HPIA 4RDYA 1PTAA 4C6QA 3FEQA 4KEZA 4HA0A 3MJMA 4F0RA 2Z27A 1M68A 1E9YB 4OFCA 1FWAC 4WHBA 4KF1A 2CZVA 3LGDA 2FTWA 3OOQA 4GC3A 2UZ9A 3IGHX 3O0FA 3ID7A 4UB9A 1FWJC 4RDVA 4RE0A 3B0XA 4LANA 4RZBA 2P53A 1NFGA 4G2DA 2F6KA 4QSFA 2WJDA 3ITCA 3QY7A 5CH9A 1XGEA 4F0SA 1BF6A 3DC8A 1P1MA 3GTFA 2IMRA 4L9XA 2ANUA 4GY1A 3AU2A 3LS9A 1FWDC 2Q01A 2GSEA 3GU9A 1WXYA 4QS6A 1DPMA 3O7UA 1EJUC 3IRSA 4C6FA 4QS5A 3TNBA 3CAKA 2Z29A 2OB3A 3N2CA 3MSRA 2PAJA 4CEUC 4KQNA
chains in the Genus database with same CATH superfamily
2WMGA 2FDSA 5E09A 1B4EA 3SSJA 2ZXDA 3THQA 1MVYA 1MZRA 1P7TA 3SCUA 3GDKA 4L4MA 1Y8BA 1WXJA 3PF3A 1XG3A 4DJDA 1GVYA 3S47A 1K8ZA 4H2CA 1LYXA 3WQ8A 4I9AA 2P1FA 3LHZA 1R3YA 1KQZA 3VC6A 5IOBA 3H7RA 3S2MA 3HU7A 2V82A 3TC3A 1BSIA 1I2PA 1S2UA 2Q3OA 3NQ8A 3O6DA 4MAVA 3BGAA 4XZLX 4RJEA 3BMXA 1LWHA 1KGWA 1ZJAA 4JTFA 4ICCX 5C9UA 1K70A 4G7EB 2RKXA 3EMCA 4DEFA 3U2EA 2EG8A 3WYZA 3BSGA 1J10A 5FCZA 1QWKA 5U7SA 4Z1DA 1YKWA 1J2BA 5CC6A 1SQ7A 4XUYA 1Z42A 2YA0A 1GKQA 4JX6A 5DLCA 3UJRA 4MM1A 2E25A 1SMAA 3HGOA 3SJ3A 3MKVA 4AIBA 4UFJA 1BWVA 1R9XA 1ZZMA 4JTCA 3LBMA 4IMAA 3SECA 2X1SA 1Q7QA 2PA6A 4NAFB 2YDRA 4CU7A 1NH6A 3F2CA 4NRRA 1JCYA 3M6DA 1T41A 4JTIA 5E9AA 2FHFA 4J3ZA 2AKZA 4HA1A 3FCPA 1UIPA 4BEQA 2JFEX 3WZ0E 2BGNE 3P2VA 1J0HA 2PTWA 2CLOA 3FAWA 2OFJA 5CLTA 4EXQA 5GNZA 5EB8A 1ITCA 4FNPA 4AFYA 1TB3A 4XG1A 1J0ZA 1H7XA 1UASA 1DQXA 1MUCA 3L4ZA 5MF5A 1HW6A 3W1MA 4ZXOA 4HZ8A 4AXNA 3LCGA 4O1BA 3UD6A 4Q4OA 4IIHA 4ZQNA 3KX6A 3G22A 1V5XA 4DELA 4GI9A 4HZ6A 4LV9A 3W83A 4CQ8A 3DHUA 4GJ1A 4D6JA 3CQKA 4JFWA 2PDWA 4UTKA 1QJWA 4J28A 4JY9A 4UNKA 1VB9A 3T09A 1V3HA 1CGXA 2QDGA 4J2PA 4MJ2A 4O1CA 4GH3A 3BUVA 5CPMA 3OIHA 5C8BB 3ANYA 3FKKA 4YCPA 3H21A 2YBUA 1O4UA 2G3JA 1TV7A 1TR1A 4OUIA 3A47A 2WK2A 2PDJA 4OQVA 3MI6A 4JTLA 3LTYA 3SUUA 1TCMA 1UG6A 4LX4A 1WKYA 5H91A 3VGGA 2BGSA 1LJYA 1PX8A 3ZMRA 3TJIA 5I03A 1BQGA 1VIWA 1TE6A 4GNVA 4K38A 3RLGA 1OVDA 3EXRA 4D72A 3ZS4A 1P0EA 2GK1B 3M0MA 1XGDA 2ACRA 4UTIA 1SPQA 2PWDA 3DYMA 1FVPA 1EP1A 2WQPA 4HGXA 4N9DA 3STCA 1E3ZA 2R94A 1J6PA 4E4PA 4AF0A 1E4MM 3K46A 3R10A 1GJWA 2VEIA 2D22A 3N14A 3C2YA 3GD6A 1I60A 3C0SA 3UVAA 1GVSA 3NQVA 2AL2B 1TX0A 2WJZA 1JPKA 2QJHA 3PAJA 4J2MA 3W2KA 1M65A 3D5HA 3M5XA 3S5YA 3CZGA 2J7GA 2MUCA 4R5EA 4XZIA 3ZVHA 5EU9A 3FGCB 2VRQA 1GVQA 3JW7A 1DJXA 3EZ4A 3PG8A 3W3OA 3OLGA 3DESA 3T42A 3MBDA 4EP8C 3W82A 1AG1O 1W5NA 1SO4A 1FWTA 3NJ3A 3SIMA 1TMHA 3TYAA 3GS6A 2W62A 1VIZA 1XIDA 4X2RA 1D8WA 5TAOA 2RAGA 2JKPA 1E1CA 2RDWA 2FGZA 1NIUA 1KBBA 1MW3A 2G5WA 1CX9A 5HQLA 3RDKA 2QJJA 4RZ5A 3WLPA 1MMFA 1RH9A 5C55A 3H55A 4YYCA 3W6MA 3B05A 5C9ZA 3KOZA 3MCOA 1OY0A 4WDWA 2VMFA 1LOQA 4I6VA 1GYMA 1AJZA 4WDUA 2F7FA 3R8RA 2PDIA 4CEXC 5TNVA 1RUSA 2OKTA 2Z6JA 2OLHA 4AYGA 3W1TA 4H6RA 3VIPA 1PVNA 2A1YA 1KLZA 4AB4A 4M5PA 3GNRA 3FVMA 4IFRA 3WLJA 1F7BA 1MDLA 2NX1A 2HBVA 4S23A 4HK5A 4GISA 1XS2A 1W1YA 1ODZA 1EDQA 4HA0A 4ATLA 2WM0A 3DHPA 5C9RA 2OWWA 5M5DA 3WH7A 3O0FA 5ABHA 3S3GA 1ZAJA 5E70A 3UFYA 4OT7A 2C19A 4ZO8A 3A64A 3WLIA 3WQOA 3TA6A 1VLWA 3PTQA 1PKLA 4BQ5A 3SQLA 4Z2LA 3AS3A 1E6XM 2GUYA 1HJUA 3VGFA 3EOSA 5E6ZA 3ES8A 1R3SA 2HRWA 3EB2A 4TXEA 4KEMA 5CJ5A 3LN3A 4H9UA 1Q8AA 1XH1A 3GG7A 3RX3A 4XIAA 2WMIA 1L6GA 3AZTA 2XVKA 5I09A 1EOKA 2R9RA 2XZ7A 1UWRA 4HBKA 6XIMA 1EIXA 3SO7A 4EPKA 2C1GA 4D6GA 4A8RA 1TVNA 3DI1A 5MKGB 3UCCA 2CZ5A 2NX3A 1LRNA 3NGJA 2EPLX 4NIRA 1OFAA 1A5NC 3EKLA 3FHQA 4H7CA 3W2LA 3E6EA 4ORIA 4CN6A 4L80A 1UH3A 1BTMA 3PZMA 4DWSC 1GKPA 3L5MA 2QUTA 3RCMA 1KCZA 4GO8A 1VKFA 1FHDA 1IZKA 3VMNA 2BXVA 1Q85A 4GPNA 4U2ZA 2UWFA 4UQCA 3STGA 2HTMA 2NV1A 4WGXA 3C8NA 4E3VA 3RX4A 4AX7A 3E38A 2C16A 3DDMA 1BQCA 3BSMA 1C90A 2DT0A 4E2VA 4EF9A 3QR0A 2AL1A 3EMQA 4K8EA 3H26A 4M81A 4GGBA 1ZALA 5EMUA 3ELFA 1VQTA 1G0CA 4A2RA 2QV5A 1GZGA 5DELA 2YFNA 4ZQRA 1H60A 3BCJA 2VXNA 1F8MA 1OABA 3B03A 4ZSTA 3P3BA 1WUEA 3LM3A 4MJMA 3QMTA 2VC9A 3NQEA 3WBEA 3KRSA 1DHKA 3NQBA 4Q8VA 4X0NA 5D33A 1CTNA 2CESA 4U28A 4HHMA 3T07A 1EQPA 1GHSA 3G1FA 3PJTA 3AIQA 3P74A 1UJQA 1D2KA 4DVOA 2PZ0A 1P6CA 2I5GA 4CQDA 3VKBA 3USZA 2ZXBA 2PI6A 3CUIA 3AU6A 4HT3A 5KMYA 4J3TA 1W32A 1OGBA 2F84A 2ONEA 4L6HA 3UVIA 5H6HA 1BFNA 3ABXA 4YTUA 2QJMA 2W6RA 3KZPA 2Q09A 4DWSD 1MDRA 2QVNA 2YPIA 2PP0A 1CI1A 3VX0A 3W24A 5FF7A 4UQBA 1RCOB 5D2WA 2EPHA 3UWZA 3IEBA 1IF2A 2CLFA 2PRLA 4ACZA 3AMCA 1CIUA 3O15A 3W81A 4V33A 3UYIA 3SBFA 2XGIA 2OZTA 1PL9A 3Q37A 4FNSA 4YHEA 1BXBA 1PJ9A 2ASHA 3GW0A 1VPYA 4OHQA 3S9IA 2J24A 2HCVA 4PBEA 4PYSA 3VE7A 1J0KA 3O2LA 1PX3A 1F9CA 1GORA 5M17A 1U22A 3VC5A 3GTHA 2ICSA 1J79A 2PCQA 1YPIA 2A7NA 1GW1A 3H2MA 4DXXA 1ZB5A 2DT3A 4Q7IA 1YXYA 3SADA 3G1YA 4PGLA 3V1PA 3PWAA 3R0KA 2XWEA 3PULA 3CV1A 1MRQA 3PN8A 5A8GA 3GTIA 5HBFA 1OQFA 1US3A 2ATMA 2DDXA 4DLMA 1AA1B 3A6OA 3AROA 3GX9A 1IIHA 5BCAA 1XLKA 2WZIA 3AISA 1EJXC 4OV4A 2ZQ0A 4R33A 5BWFA 3F5JA 3VMOA 3I6EA 2E68A 1EJTC 1CXIA 7TIMA 4FB7A 3ZM8A 4IG2B 3DN5A 2VP8A 5LHEA 2Y5JA 2CBIA 5FJJA 4HNLA 4J27A 4ZFMA 3MQTA 4PMYA 3VTRA 4LH8A 4CNSA 4J3SA 4OTKA 4X63A 4BKNA 4RV8A 2ZA3A 4A29A 2D2HA 1C8YA 1SZGA 5CG7A 4J3WA 1TR9A 2PRMA 3RLUA 3VCRA 1DQWA 5HATA 1XYCA 1LRTA 4ZSUA 4NZJA 1JGMA 1UQYA 3HPSA 4OGZA 3O16A 1ZBWA 3G1DA 4NJKA 4LFYA 3GBDA 5JBFA 4O18A 3CLWA 3EWWA 3LQLA 3GO2A 1LORA 3FNDA 4O4VA 5I2UA 2NV2A 4DWSA 4QEEA 3CQJA 2D0GA 4LVDA 1T5AA 3AMDA 3QYQA 3WK3A 3IJQA 5A8QA 2IKJA 4MUPA 1F8IA 3LXAA 4GIAA 2J8TA 3NDYA 3HQOA 3H2CA 1W3LA 2X8RA 3N4FA 3E5PA 5EL1A 1IR1A 3I4KA 3E0IA 3ERPA 4DAFA 1FWIC 1H1ZA 5D9MA 5C2XA 4N0RA 1JG9A 4RDYA 1G9HA 4FR1A 1PPIA 3EPMA 3QH2A 3PK7A 3G1SA 2FHCA 5FJUA 1IEIA 1L8NA 4GC3A 3ID7A 2EJAA 4UB9A 4WY0A 3QN3A 3DC0A 4ALDA 3F03K 4RZBA 2J88A 4MZYA 1CXKA 3UERA 1TV5A 3T4WA 5E0CA 1JD9A 5BROA 1R86A 4ROQA 2Q01A 2Y4SA 5U4NA 4FOUA 4AIUA 1C9WA 3OHIA 4ADSA 3QBUA 5H8UA 1K9TA 4LEQA 1IXQA 2QF8A 3OGRA 1UQZA 2QJNA 3PUOA 3DECA 2WC4A 2GQ9A 1SR0A 2DJXA 5LNUA 5CZTA 4ZOBA 1TSIA 4CKQA 4F66A 1XG4A 2C79A 3WLKX 2YZRA 3MO4A 1CB2A 5HAOA 4HSNA 4Y9OA 3CZJA 3ALFA 1P0KA 3SR7A 1S1PA 4Q4PA 3TOPA 3UJ2A 3EB4A 4DF2A 3G0SA 3IGXA 3CMJA 4AX6A 2TMDA 4HSOA 9XIMA 1LWJA 3EBVA 2PDGA 3UPMA 1I1WA 3BPWA 3EEGA 4B9ZA 4IGSA 3AHZA 3TK7A 3FW6A 3H53A 4DUXA 2ZYFA 1KM0A 1JPMA 2C14A 3WUGA 5J8LA 3VGBA 3R11A 3W73A 1LTDA 3V5OA 4LUTB 1MEHA 2J7EA 2WHLA 3FJ6A 1Q66A 3CEUA 5LXXA 2CITA 2VEGA 2A7PA 1P48A 2ZOXA 5TF0A 2ZUWA 3PFMA 5XIAA 2VEMA 2WAGA 4KH2A 1BG9A 1O5XA 5LXEA 3BTNA 1H49A 1QWGA 3P62A 1ONEA 3OLEA 4BF7A 1E0TA 3NTYA 3WQCA 1M7PA 4YVPA 3TDFA 1DVJA 3PWGA 1S5VA 1WDRA 1XH0A 1BYBA 3NL6A 1B31A 5KZ6A 1Q6QA 2GOKA 8XIAA 3SUWA 4AQLA 4WQ6A 2EO7A 3QZAA 5I3GA 5DFAA 1PIFA 5CPTA 4E6MA 4TVCA 5DMYA 4EKJA 3PZOA 4RXFA 4RDWA 4UXDA 3M0VA 4K8HA 3BOXA 1DJZA 1VYPX 3B8IA 2EGZA 2XIBA 1X97A 1WZKA 1GVIA 1GQJA 2PUZA 3LDVA 4OKDA 2E9LA 4UFKA 2H8XA 4PUUA 5CZKA 1QATA 4FLOA 1R6WA 5J5DA 1GEQA 3A22A 3WQ4A 2HE5A 5D37A 3LV5A 3L12A 2G0WA 3CHCA 2WBKA 3UR8A 2QUVA 2O4QA 5DCEA 2YXOA 1P5BA 2V2CA 5DCDA 2VNCA 5CC7A 3DKJA 1M53A 1FWHC 3RFAA 4OOUA 2ATSA 4EOUA 2A4AA 1P7TB 2QCDA 2OQLA 4CCDA 2FGBA 3RRXA 1YPXA 2R82A 4GUIA 5AYBA 1DWGM 2J25A 1KM1A 3H12A 3WFLA 3RJXA 2NLIA 3ATYA 2TAAA 1YNYA 3LG3A 4QISA 1AQMA 4RW5A 3DFQA 3MMUA 4R9XA 1HNYA 4US5A 4LJ3A 3TVAA 5HOSA 5BOFA 5ECUA 4CQBA 3IUIA 1TRIA 1IR2A 3VIIA 3CPUA 1B4KA 1M1BA 3KP0A 4FA3A 4LBSA 1CGYA 1H1YA 4S3CA 4DBWA 2WXDM 3LY0A 1W8GA 2QPUA 3AIUA 1CYGA 4QJ3B 2C15A 5KSWA 1OFRA 4S38A 4GY0A 4WY0F 3B0YA 3S1UA 2J8GA 2A3CA 4EACA 4GVFA 2IQ0A 1E3XA 4LVFA 2ZXAA 2QF7A 1KBLA 4C6KA 4M7TA 5KZDA 3HURA 2G3IA 4P7NA 1K03A 3CO4A 5F2MA 1UUQA 4JTEA 4JTUA 4HTYA 4B92A 2FVKA 5LYRA 4PTDA 2FVMA 1XLFA 1QPRA 3TP4A 4ZQCA 1UUMA 1UR0A 4AZ7A 5F7UA 3E96A 5A8OA 1IWBA 5AYXA 1OEPA 2SFPA 2Y24A 4JGDA 4LXFA 1LG1A 3TW6A 3QTGA 2VC7A 4H9XA 1VGAA 5L6UA 1BXNA 1B3OA 3S5NA 4RLIA 4E2OA 4LCRA 4PTWA 1OSEA 3U4AA 3W00A 2PC4A 2VFFA 1VFFA 1AL7A 4I7UA 2W92A 1OFQA 1UIOA 2VVNA 2AQWA 3PUEA 3W7DA 3KL5A 4BZYA 4EAMA 3WK1A 1GYLA 1NELA 1NDVA 4FPSA 4JD4A 1SUXA 4LYPA 1S5NA 3IARA 3L4VA 4Q6XA 1WOAA 3RIKA 3ALGA 1XKYA 3EX6A 1DWHM 4NF7A 1JZ2A 4HU4A 1HKKA 2Z7KA 3E3HA 4M6QA 3AHYA 3EPNA 1PUDA 2NT1A 4C6CA 1WZAA 2IPFA 4Q8TA 3BWWA 1NTHA 3PUDA 3NL3A 1PWMA 4O53A 3ONBA 3AYRA 2E9MA 3O6CA 1EEXA 2PDLA 4QNWA 2QNEA 5G1YA 3VIMA 2P88A 1D3CA 4AZ5A 4V1YA 3SQSA 1CW2A 3LCWA 3M16A 4Y7EA 4JTGA 3SAZA 1HJQA 3OG3A 1QTWA 4N9EA 3THDA 3CH9A 3GFXA 2D23A 2XIMA 1VRDA 1BKHA 4HZ7A 3IGHX 1E6NA 2BVYA 1FWJC 4GC4A 3I7RA 3TOYA 4MHBA 3M41A 2P53A 2J4GA 1ZP4A 2G3MA 3KW3A 1VJZA 2L5HA 4MG4A 2PD5A 4KCUA 2XFWA 1XC4A 1CLVA 2GFTA 4L9XA 2E5CA 2DUZA 5DQPA 1D8CA 3AWNA 1JYWA 3CT7A 1HKIA 2FZBA 4AF0B 3L66A 2PF0A 1UWQA 3I3EA 4DYEA 1NP2A 4H8NA 2OB3A 3W37A 1Q8JA 3BCDA 1EL3A 3EWZA 4IMDA 1Z48A 3MC5A 4MB3A 2ZA1A 4U10A 1XBVA 4PMRA 1V6UA 1UHVA 5LZLA 3MDWA 5D32A 4QGCA 1PCWA 4EPBC 4UCGA 4PUJA 2NQHA 4N6FA 3CIXA 2WYSA 3H54A 5CZ0A 3QKEA 1UOKA 4NI8A 3RPTA 1B3ZA 2PLKA 2WSRA 2BHYA 2PODA 3VINA 1EIBA 3CZEA 1O60A 3FA4A 2XVNA 3BLOA 3S5OA 2ZE3A 2VD8A 4ZGYA 2JBMA 2E28A 2VL4A 1ZU8A 5LIWX 3Q94A 3OGSA 1TE1A 2P0IA 3NSMA 2Y7EA 4W7UA 1QK0A 1E1CB 2WOQA 2CHNA 3KRUA 1BVZA 3VFLA 5I24A 3UR5A 4GI4A 3BC9A 1ZBCA 3SGUA 1O12A 1TPB1 4P8VA 2VX5A 3UNTA 1XFCA 2O4MA 4PCFA 4NU7A 4LW7A 3UZYA 4AMCA 4RPQA 2WVVA 3IIVA 4GYJA 2D3LA 2DPEA 3M43A 2V5CA 2GGIA 3GNOA 3RXZA 2YDSA 3WD0A 5T8GA 1E70M 3TTQA 3WF3A 4AISA 4Y9AA 4XWUA 1GTHA 1TPUA 3IJLA 5HUPA 2WCSA 4BFAA 2BX7A 1VCVA 2IPJA 4Y96A 5HXMA 2JEQA 1XM3A 4A3UA 3AMLA 5FD0A 1PV8A 1OCNA 2CC0A 2E3ZA 3CAQA 3BV7A 1A5OC 1FKWA 5G4HC 4R27A 2VWSA 4AZHA 2D2GA 2BMBA 2YLAA 3STFA 3WQ5A 1V3MA 5E0KA 3EDJA 4HPGA 3VD4A 5BMWA 3W7CA 2X1UA 2BTMA 2GUUA 3RPMA 1S1RA 3W88A 4X9SA 4BR1A 1WP6A 4MWAA 1OCQA 1I0BA 2RDXA 2Y62A 1RALA 3IJ6A 3GDLA 1FWSA 4JPGA 2PTDA 3GG0A 4FLRA 3V75A 4Z1AA 4S3GA 1HKVA 1DHPA 4GE8A 3SUSA 1K6WA 4NT0A 2IW0A 3SY8A 3IACA 4XQ6A 2NQLA 2WMIB 1UZ1A 1BF2A 4KEUA 3GAYA 1XDJA 2WHMA 1EC8A 3T1GA 3QOKA 1U5VA 5JBEA 1IT0A 1V8EA 4EPDC 5AECA 4LC8A 4LS1A 3OQ8A 3TYBA 3LB0A 5BOOA 2FZDA 3Q45A 1US2A 1KM5A 2ZZ2A 1FXQA 1QI2A 1DJWA 3RM9A 3WJZA 2Y89A 3H2OA 3MHUA 3AHXA 4UQEA 1E4NA 1FH9A 2DQXA 1K77A 3T2OA 2AMGA 4HK6A 3KZSA 3TYZA 7REQA 3ZLHA 5AHFA 3D3AA 3MVIA 4NRSA 4G5DA 3KTXA 1IV8A 3MSGA 5JIPA 3PJUA 4BI6A 3N6HA 4R7OA 3CWHA 3D0CA 4RKAA 1BVWA 1FOBA 1E1FA 3LCIA 1D7FA 4WXYA 2OYKA 4AEEA 4WF7A 8TIMA 2DIEA 3LSBA 3WUEA 3MY9A 3OVRA 1FFQA 1XXXA 3H2NA 1AZ2A 1V6TA 5A8MA 2YOCA 4QTGA 5D2VA 2EG6A 2XSBA 3WMLA 3GDTA 1GZJA 1LOSA 1YX1A 1JQXA 4MKVA 1WDSA 2CLHA 2QKFA 2R1MA 2ZVRA 4NYYA 3BANA 3VNMA 2PWUA 1XR2A 2D69A 1EDGA 4E4FA 5HWNA 4DUWA 1D3HA 4KKXA 3S6OA 3LPPA 4K7VA 3P93A 4FSAA 3W29A 2QAFA 2Y5SA 3H23A 2QJIA 3F2DA 1DBTA 4IL0A 1W3NA 4Q7NA 3VOIA 4IWWA 4YL2A 4W8BA 2R14A 3KCOA 1HJVA 1XLBA 3T9PA 4DBUA 4FNTA 1VFUA 5BXRA 2PC8A 3K1GA 4O13A 1HGYA 2FDMA 2VCAA 2Y7FA 3M4HA 2V0TA 5IRPA 2VX7A 2WNQA 2OR2A 3VUPA 2V69A 3GR8A 3M0KA 2BY1A 4CNNA 1FX6A 2Q6ZA 3AIWA 2VDIA 2X2GA 3TKFA 1VFTA 3BVJA 3IAPA 2JIEA 2WPGA 2WBGA 4ZZ9A 4PTVA 4INFA 4UOQA 2QULA 4PTNA 2GWGA 2GVYA 5A2BA 5GVJA 3KWSA 2NWRA 4NSBA 4DQWA 2NXHA 2GJLA 2RJHA 4ACZB 3HPZA 3D6NA 4G1KA 2J7CA 1UCWA 3ZVIA 4DO7A 1GQKA 3VVGA 5C5YA 4E4UA 5DXXA 1NARA 2Y1HA 2UY4A 4CU8A 5HANA 2HXUA 3OBEA 1VHCA 3DBPA 4I9JA 1XLCA 3STEA 1PZ0A 3VILA 3NVDA 1HO4A 1I45A 4OZOA 2X7VA 3KVJA 3IJ9A 4O8RA 4OFCA 1MW0A 3I68A 1DJQA 2QGHA 4O16A 2YXGA 2INEA 4NZ5A 4NJGA 3LPGA 1I2OA 3BOFA 3SFKA 3B0UX 3K1DA 1W56A 2GVLA 4C1NA 3ARZA 1GQLA 4HTBA 4UFLA 4HYVA 2Y8VA 1J11A 4DM1A 3ZWTA 1Q63A 4JFVA 1XD1A 3GTFA 1KKRA 4NJHA 1W17A 2ANUA 1JYVA 3TJ4A 3SUVA 5D8ZA 4PMXA 2VEFA 4QDWA 4QJ4B 3P8IA 3LMZA 4PMUA 3PHAA 4NASA 3WDJA 3LGEA 4CUCA 1OFBA 4DBSA 3ARTA 3LV6A 4HOXA 1IT8A 2FZ9A 3MSRA 4NYUA 3QMSA 1FH7A 3VOHA 3GG8A 2E0PA 4CD5A 2EKCA 1TV3A 4IF2A 1MUMA 3QRHA 5CEWA 4OE7A 4TO8A 2PTZA 3C2EA 2WQDA 3TA9A 2Z2BA 2R1NA 4WKAA 1MO0A 3QXBA 2FYMA 1XUZA 2VTFA 1RQBA 2HK0A 1KBKA 1W3HA 3HPAA 5HNUA 1TJ2A 3CIWA 1RHCA 4OJYA 2VKZG 4M6UA 3GE7A 1V93A 2VM8A 4A2SA 5BRBA 1GOWA 2F9RA 3L23A 1RBAA 2TODA 3LX9A 4JY8A 4NKCA 3H24A 1GNXA 4DXVA 2MANA 3APTA 4GZ7A 4U33A 1M6JA 1C8XA 1E4IA 4LCQA 5CAHA 3LLFA 2G3FA 3GDBA 3WIJA 3WDPP 3GNXA 4BWLA 4M82A 3CHDA 3UWUA 2X0YA 1UR9A 3DKLA 3MW7A 3W1RA 2CERA 3CZKA 4H04A 4ECLA 1V79A 5C6MA 1CGUA 4MDPA 3BGJA 5FACA 4W8LA 5F1UA 1NOWA 2WZMA 2PDQA 3MKCA 3RR4A 3T0AA 4LPCA 3RO6A 4NNCA 4HJWA 2A79A 5E5CA 3FJNA 2C8NA 5ABGA 5F4XA 1ZCOA 1LQ2A 3QR3A 4L65A 3VM5A 3RF9A 4UTUA 1WOBA 4LU0A 1JCLA 3W1UA 2Y85A 2PRHA 1A4LA 3PZUA 1FBAA 4FIRA 4CLMA 2PD9A 3LBCA 2DU2A 5F2LA 3MU7A 3W1LA 2WANA 3VNJA 4L4LA 3MA8A 3UW6A 3ZT7A 1K9FA 4IQJA 2ABAA 3BLEA 3U7VA 1O5RA 5G4WA 2W91A 4QCFA 4C1KA 3CIVA 1GG1A 3RNDA 1E73M 4N9CA 3W9ZA 4HP5A 3BW4A 3GH4A 1CBGA 3VIGA 2TRSA 1G69A 5BOEA 4JIPA 3NZ1A 1TMQA 1XD0A 2WNNA 3NEVA 3WN6A 1HX0A 1TJ0A 1RBLA 3GC4A 5E6YA 2E7FA 2OSXA 1G7VA 1KXTA 1O1HA 5D2YA 3KCJA 2YCEA 3MVTA 5CJNA 4CQ9A 2NUWA 4YNGA 3UJEA 1QHZA 3N9KA 3F5KA 3TQPA 1EX1A 1E6QM 4ZB0A 3B97A 3ZT6A 1XLEA 3BE7A 2V67A 4FXFA 1JD7A 3S5ZA 3LXBA 1JEZA 2Y8UA 4YIWA 1HKWA 5A6BD 5DMMA 3W0KA 1F74A 1V0MA 3EWDA 3HQPA 4GCXA 3AJ7A 2DJLA 3VCNA 4JTJA 1I2RA 1C93A 1EPVA 2FQIA 3PBYA 4FX8A 1QPNA 4IIGA 3B4UA 5CPLA 1EPXA 4XD4A 2WCGA 2I16A 1ZQ5A 3QF0A 4AD0A 1DP0A 2BNJA 4HHLA 1J0JA 2X7WA 1JPHA 1LROA 3QV9A 1AMKA 3CH0A 3N6QA 2GJNA 4CNUA 3OIXA 3P0WA 1AVAA 4PFHA 5DY3A 4J5NA 1TPFA 3MMTA 1H11A 1PIIA 4B5UA 3W22A 4DN1A 1JPDX 4JL2A 3ABQA 2V5LA 4IFOA 2I57A 3I10A 5ABEA 2C71A 2ZADA 2VURA 1PIGA 5A3HA 3DXIA 5CSRA 4KCTA 2W66A 1GVRA 2IUZA 3TC7A 1H7OA 3VKCA 5JBDA 5A6KA 1ADSA 3BICA 4J40A 3W02A 2CW6A 1GWJA 2INFA 3LHVA 1R47A 1M5WA 3AALA 3AHVA 4UQDA 1TWDA 1DJHA 2XVGA 3MMDA 2FH6A 4QG9A 3ZSTA 5FIPA 2FKPA 4Z2JA 3EX4A 2DSWA 1J5TA 4CN4A 3ZJ7A 3WF1A 1HJXA 4E2BA 2OT0A 1C92A 4Q8UA 1TX2A 3TJXA 5DRCA 4Q6JA 4L1XA 2VUNA 2V3GA 4IMCA 3U3HA 3PB2A 1Q6CA 2JGQA 2YLLA 4QBXA 3SCSA 2OEMA 1EJVC 3LMYA 4MB5A 4ZA0A 3VDHA 1YIXA 3HV8A 1QNSA 2VZUA 1XW8A 4HA3A 2A85A 4MY1A 3NSXA 4GH1A 3RLHA 4MKNA 3EWYA 4RCXA 2GJPA 4MUZA 2VJXA 2DSUA 3SN1A 1NP0A 5FF2A 3GB6A 2PDKA 3THUA 4PSRA 3S0CA 2QCDB 2YW4A 5IDZA 2LLEA 2PEVA 4OOZA 3U9IA 1WZMA 3O8AA 5A6MA 1HGWA 1WBHA 5HA7A 1OM0A 3SRHA 2YBVA 5SWUA 1A0DA 1QFEA 1EA0A 4YN5A 1ZFJA 3EPOA 1W3JA 3POHA 5K7JA 2PF8A 4B5XA 2Z27A 3OW1A 3T78A 1BLIA 2P0OA 2WNZA 3GAKA 3WQFA 1XLMA 1ZENA 4ZL1A 1BSLA 1CWYA 4GVHA 1WZLA 3TYCA 1W31A 1M01A 3WQVA 5FF3A 4JKLA 2WJDA 4AH7A 2Z1VA 4L6OA 1LM1A 4F0SA 1XRSA 1TWSA 4RE2A 3A13A 3PR2A 3RRAA 1KFLA 5CSUA 5A2AA 2WLZA 3AU2A 2ZRUA 1EFZA 1WNOA 3M7WA 4ZBCA 3GFZA 4O19A 5A69A 2PS2A 2ZTJA 2Q3RA 5K4XA 3L9CA 4PUKA 3CUHA 1PTDA 4JIEA 4P7RA 3L0KA 4I90A 3W1QA 4XKMA 1A5CA 2IXUA 1UZDA 1GTEA 4I7VA 1IZCA 2DEPA 4CNOA 3FA3A 3G1XA 4ATWA 5GJNA 1CB7B 5IBXA 3CZLA 4BHYA 2PDFA 2QPXA 2VZOA 3PAOA 5HWMA 1M9HA 3ITVA 4KPLA 1L0PA 4MY8A 3EDDA 4UTHA 2V5KA 3AO0A 2ADAA 3NDOA 3CZ8A 1WDDA 1LP6A 3LRKA 1VENA 3CYJA 2AAAA 2BHUA 2ALDA 4DHGA 4O11A 1EXPA 3M7SA 2VUYA 3OLIA 4LWWA 3OP2A 2OELA 4Q4RA 1ZCCA 2P5NA 5LNWA 2OX1A 3UG4A 1V03A 4HPXA 4A8NA 1EQCA 4IHCA 1E1EA 4U4MA 2WSPA 4Y9PA 2EKGA 2I56A 3VK5A 5I78A 4JN8A 5EA9A 1Z69A 3LNPA 4G9PA 1VBHA 1RK6A 2AGKA 1E6PA 3PZQA 1PAMA 3VX1A 1TREA 1POJA 4JTSA 2J78A 3RHGA 1R7OA 3H70A 3KAOA 4ZOCA 1A50A 4AYSA 2OVLA 3WCZA 1RA0A 3AOFA 4O8AA 3MWCA 4GQRA 1EBGA 3PZVA 1SVDA 1EDTA 3MCNA 4OBTA 3RUBL 4AWUA 1O1ZA 3V16A 2ZUTA 1N8FA 3KOFA 3F1QA 4HU0A 3FX4A 4GIRA 2GUBA 3SCQA 4PFMA 2RH9A 1POKA 5A6AA 3LOTA 1RLCL 4RUBA 3WNOA 2I17A 3T8LA 1B90A 2VFEA 2I5QA 1J0YA 1JXKA 4UNIA 1ELSA 4JHMA 3KRZA 3VPLA 2QDEA 2B7QA 5G4EA 2YYTA 3TROA 3QV8A 4C7FA 2XFRA 5DMNA 3G3MA 3QV6A 4I5UA 1UD8A 3DUGA 4DJFC 4E5TA 3SGGA 1SZFA 4EK7A 2IKIA 5IFTA 1R38A 2DSKA 3FIGA 5CCZA 4HU3A 3NQ7A 1DWAM 1MRAA 5AC4A 5BU9A 4H7ZA 1TQJA 1X6LA 2XGZA 3TN3A 1XL9A 3TR2A 1XBXA 2J9YA 5BZAA 2R8WA 3I4EA 4UFMA 4UIOA 4MPQA 4DZHA 4M3PA 1SFJA 3USBA 4DAIA 1F76A 3KHJA 3NCOA 3RITA 4JICA 3UT0A 1M7XA 5KZMA 3WH6A 4TIMA 3E5BA 2H3DA 1K8CA 2V9DA 5ENLA 1TV2A 3WLSA 3NVTA 4JQ3A 5GJMA 3FSUA 4EPEC 2QZRA 2ZIDA 3ATZA 4DWDA 2F6UA 4CVUA 1F61A 2PGFA 4RNFA 4FNUA 3ZYZA 1Y5XA 4AHQA 1LLOA 4N7QA 2VYOA 3C3NA 1Q4NX 1BRLA 1ONXA 1HN1A 4QJ5B 1R9ZA 3V0SA 1RLDA 4MJ4A 1MXSA 3UWVA 1QPKA 1RCXB 1GOQA 1EYWA 1VBRA 1NDYA 2GQAA 4QR6A 5AYZA 1GOOA 1FRBA 1KXVA 1QK2A 2WVVB 1UP3A 4MADA 1NSJA 4UTFA 1TELA 2OZ0A 3FY1A 3DFNA 2NSXA 5AC8A 2DZSA 4DY1A 4IQDA 4O0QA 1SJCA 4MDOA 3LA4A 3MZ2A 4F9DA 3KS5A 4L56A 4LTSA 4HYRA 1E43A 4WK9A 1JNDA 1QR7A 2HVMA 2I14A 4DJFD 4YU1A 2AMXA 1LL4A 4GJIA 3QY6A 3PPCA 4ICNA 1A49A 4C6MA 1V0KA 3K8KA 4EXBA 3EKZA 4RK8A 4M51A 3LRMA 3BGGA 3R58A 1J9YA 1GVFA 3DI0A 1RK5A 4IPNB 4L1GA 4KRUA 3GU2A 2YCLB 1CGVA 4CNPA 2HVOA 3MV11 1GJUA 1GG0A 4DLFA 3OBKA 1A5LC 4MWAB 3NZQA 1TWWA 3NG3A 3AXXA 2PMQA 4JN7A 4AEFA 4GA8A 1LF1A 2V30A 3L5AA 5LA2A 3E2VA 2ISVA 4HN4A 2DVUA 1E9IA 1BKSA 2O92A 4AD4A 3QQ1A 4NVTA 3GKFA 4GK8A 3CNYA 1W1B1 4DPPA 3U5UA 3WMBA 1EJ7L 4WX2A 4F0KA 3SCWA 2KX9A 1Q6FA 4JIIX 1ZNNA 2Q02A 1K6AA 3AXKA 4LC6A 4XZNX 4M19A 1LWIA 2REQB 1E5NA 4IUOA 3CWNA 3BLFA 7REQB 5H1WA 1P43A 2X1TA 1U83A 2DSZA 2ZZ6A 2WKJA 3XISA 2F6KA 1E0WA 2TPSA 5KINA 3CHEA 2DZVA 4JNMA 4AVFA 1CGWA 1Q13A 1UD4A 4GY1A 3BLIA 3DBNA 1QPQA 1L6FA 1W5MA 1BVNP 2Q71A 3F4NA 4J9JA 2J7FA 5CQ1A 1JDEA 5LIUX 4C6FA 4QS5A 1R2RA 4EE9A 1W54A 1EUNA 1FY6A 3DYOA 1CCWB 1BYCA 2OGYA 4DB7A 1I6NA 2NX9A 2PDPA 1PB0A 1EOMA 1F3TA 5I3HA 2ZVIA 5I3IA 1A80A 3S4TA 2O7QA 2WW5A 1QI4A 4Q4QA 5AOUA 2CHRA 2PGWA 3UY7A 1B0IA 4K8GA 2DH3A 3L21A 2J6XA 1UR8A 1R0MA 3WJWA 3W74A 1SZRA 1I4NA 3DX5A 4C6DA 1F07A 1KKOA 5T9CE 1IXPA 2ZXQA 4CCEA 3EAUA 4GINA 1W9PA 3O9NA 1XI3A 2A3AA 5AZ0A 3MB9A 4GYPC 5FSEC 1JNEA 5AC7A 1JFXA 2CU0A 3B0PA 4GY7A 4PTXA 2JF7A 2ZBTA 4E8GA 1EJWC 4W9TA 3T0TA 4MNKA 3DU0A 2PTXA 3RMJA 4L4OA 2ISFA 3OVQA 1JZ7A 1HQTA 2VX4A 4P7OA 3II1A 1C7TA 4EVZA 1GOXA 2OCZA 3UWEA 3V7PA 5DBUA 3GH5A 4FR6A 3VDGA 3UA3A 1TJ1A 4O1EA 1M3UA 3CQHA 4S3DA 3ZJ8A 2XN1A 3HG2A 3VKJA 4Z0SA 1ISWA 1W9UA 4GNJA 3UP8A 1QW7A 1WDQA 4GIEA 3GR4A 4WXZA 4KESA 4BS0A 3VOJA 4PMQA 2VHLA 4I6KA 4RE4A 2BY0A 2XH0A 4K3ZA 3NYDA 1EGMA 1KFJA 4IJRA 3MO7A 4GJJA 4C1NB 1B3VA 4WSHA 3WDIA 3KCLA 3BQ5A 5E1QA 5E9XA 1OC5A 3RN6A 4Z1BA 1UR3M 3K2GA 7TAAA 4Q33A 3ZLGA 2E6FA 3PBMA 1XCXA 3QLLA 4DF1A 4DO5A 3ABOA 4C6NA 4ZMGA 3VIHA 5C9WA 3WQDA 2DVXA 2DUAA 1N7KA 3KBMA 2FIQA 1NQKA 2ZUUA 1ODUA 4D6CA 3VNLA 2AGTA 1XYBA 1UKQA 1UA7A 1X38A 5JU6A 1TTQA 3W7KA 1H7PA 1HVXA 3BOLA 3KS6A 1X8CA 2VR4A 4JNYA 4P61A 1TKKA 1QU4A 3IS4A 4JIRA 3O6AA 3AIEA 3TUUA 3GC2A 3U57A 2XM1A 2NW0A 4QX4A 3GTNA 3WUFA 3TQVA 5G2WA 1EF2A 1WBJA 4US6A 5DN1A 3WMCA 2C0AA 3KRBA 4F40A 3S1VA 3SEPA 3EKGA 3ARSA 2ZUVA 3S6TA 3KHDA 5EBAA 5A8PA 4M8UA 3W23A 1F4HA 4IJCA 1GVOA 2Z0IA 2YCKX 3W7LA 1C3FA 3VCCA 4JXCA 4ZQMA 3M0ZA 4B5TA 3N2TA 4REQA 5CJMA 1X6UA 1TUFA 2BP1A 4CCZA 3WF2A 2JF6A 2VFIA 1NDWA 2GGEA 1LBMA 1A3XA 3HGSA 1VYRA 5D04C 1YLVA 4MMWA 3KTCA 2O7SA 1VR6A 2DORA 4CN1A 2HK1A 4XBSA 2PGEA 4QSHA 3PNZA 1PTGA 1KLYA 1QMLA 2HVNA 1XDMA 2UY2A 2CIPA 2PU1A 4RR4A 2BY2A 3GDMA 2HNHA 1FCQA 4JTQA 2DSVA 1Y5WA 4K39A 4GZIA 3IJ8A 1QOQA 3C0LA 3F2BA 5JXQA 1JULA 4H8VA 1V51A 3FAXA 1OYCA 1QXLA 4PZVA 3ITYA 3HIJA 3G1VA 4D71A 2INZA 4JIQA 1EP2A 4JYEA 3WQ6A 4F4RA 4TVUA 3SUTA 1AW5A 3AQUA 3KBJA 1V6WA 3DYPA 4HHPA 4JTKA 4IT1A 3HV9A 1QW8A 2CYGA 1H7RA 3C0QA 1X7FA 4IFKA 4FXRA 1B9ZA 2QCFA 4R85A 1C91A 3G6LA 4M1BA 3FDKA 2QCLA 3GVVA 3HA1A 2W0UA 5RUBA 1KRCC 3E12A 3W6LA 2V2DA 1GJPA 3IIOA 1TRDA 2Z28A 1FDJA 4FXJA 3W2JA 3PG9A 3LI1A 4YJ5A 2CCRA 3SCVA 2TYSA 3N2BA 4DZIA 3CTTA 3GXFA 1X96A 1KXQA 4C6QA 3MJMA 1VFHA 5C9XA 3N4EA 2X30A 3W7PA 3WBAA 4GFIA 4HOZA 1CLXA 5HNTA 3DGBA 3EOLA 1PYFA 1YTEA 1FWAC 2CZVA 5A94A 2UZ9A 1Q6DA 3NXLA 4JZ5A 3MUIA 2CLLA 4LNYA 3MSDA 3P84A 2EQDA 3TXZA 5F2GA 1MFVA 3O1NA 2Y2WA 1BF6A 3IK4A 3HOJA 3M44A 1ZJIA 3QGVA 4QLKA 2GJRA 4GQ0A 5I7GA 3ABSA 3LYEA 1C8VA 5A1AA 3KDOA 4FLQA 3GDRA 2VZTA 3FS2A 2ZRXA 4QS6A 5AN7A 5JVLA 1DTUA 1EJUC 1OCJA 1H0IA 2E4TA 2YX0A 4K1GA 2ISDA 3S46A 3FKRA 4PEEA 1VZWA 4W93A 1L2QA 5XIMA 2PB1A 3VXGA 2Z2AA 3W7HA 2DT2A 3DERA 2H6RA 2PP1A 3U6WA 5M1TA 3N9SA 2PPGA 1JUKA 1ME8A 3ITXA 4JTTA 4G7EA 1SYTA 1YE6A 1WKDA 2PDCA 3AFBA 3NYZA 2OO0A 2YL8A 3I6RA 2QCEA 3V1HA 1QOXA 4C65A 2WPBA 1C8QA 3DCPA 1A0CA 3M5ZA 3L0NA 2VQUA 3WK2A 4LRTA 3LPFA 1QPOA 1JDFA 3NQ2A 5LA0A 1TMLA 1LBLA 3WD1A 1LLZA 3V0TA 4TUFA 1E56A 4AY7A 3SSZA 3M0YA 3UXDA 3F4CA 1XLGA 4ES4A 3IJDA 1QCWA 1HF6A 2E9BA 1EYEA 4LALA 4PN2A 1HXJA 4IX0A 4ZTYA 2GDUA 1MXDA 2NUXA 4P7QA 2AKMA 3ARVA 3ARPA 3VOCA 1XCFA 3FLUA 3CASA 2GGJA 5I79A 5FL1A 3THCA 1B2YA 1LQ0A 1YTKA 4HNNA 3U48A 1KRMA 2X2YA 3KLKA 1DE6A 2QPSA 4XAFA 4IIDA 1EC9A 4KWVA 1RVKA 3G18A 2CBUA 3RCYA 5A2CA 1I75A 4YMZA 3VI2A 3B40A 4IMFA 5CBIA 4PBGA 1RQHA 3RR1A 4PMZA 2CZEA 4K1WA 4HA4A 4NHVA 1QOPA 2B31A 2QUUA 1W1A1 1AQFA 3COTA 4LT9A 1YHTA 5JMUA 2VOMA 2GWNA 3BZGA 5EMMA 3FHAA 1QBBA 1OBAA 3GXPA 3ENLA 1JUEA 4JR5A 1AD1A 3W26A 2GSJA 3LTSA 2FLIA 4ZCWA 4BQ2A 3MUAA 3Q65A 2PFHA 3E74A 1NWRA 4GWEA 5T26A 1DV7A 2PDXA 1PDZA 1VPXA 2OODA 2PWHA 4JDYA 4M80A 4JEQA 3A24A 5C70A 3W1XA 2ZRVA 3N73A 1OZQA 1UD2A 4GYKA 4D8LA 4TMCA 1YBQA 4AU0A 1VBGA 1EGVA 1DXIA 1A4MA 1WAUA 4QAWA 3L4YA 2GZXA 2XGBA 2Z4GA 2YCJA 1KM6A 1Q7MA 1NM9A 2NUYA 1UD5A 1XIFA 2ZZ7A 2Y7GA 2ZX7A 3VM7A 3MTWA 1R3VA 2OLAA 4XUGA 1B30A 2CLMA 3GLCA 2JGYA 2G95A 4KMQA 3ZWSA 3OVGA 1FTXA 5FAJA 2OMAA 4HZMA 4XAPA 5I3KA 3URNA 1XKJA 4XTIA 4IIFA 3WLTA 5C71A 2BDQA 1FUYA 3W4RA 4XZWA 4HCHA 3U7BA 3HMCA 2XFYA 3WQGA 3LLXA 4KEVA 3RYSA 3EDKA 1ZGDA 2XFFA 1S2CA 3ZR4A 1MW1A 2FTYA 4L4PA 1V02E 4HNOA 3R2GA 4UTJA 3TLQA 4Q32A 4RDZA 1DORA 2ACSA 1VBUA 1L6SA 2DT1A 3OA5A 1G7UA 4S2BA 3QOMA 3PM6A 3ICJA 4OIFA 1RSCA 3IUHA 3EXTA 3AAMA 5AVHA 3Q2DA 2ZDRA 1ADDA 5CPNA 4Z08A 1J12A 3S9YA 3G3DA 4GACA 1AODA 3ONCA 2J79A 2NV9A 1OX5A 3GBEA 1HUVA 1BWKA 4OBRA 3CUJA 3WQEA 3VNKA 3AXMA 3TSBA 5TBOA 3W1PA 3M0IA 3AWOA 1RPKA 3BAKA 4Y6GA 4XK2A 1V7YA 3IWPA 2A7RA 4B2DD 3WNKA 3CB3A 4E38A 2EEXA 3HMJG 3V36A 1D7KA 4XISA 1GK8A 1T96A 3XIMA 3QJAA 4XKYA 3N29A 3TFXA 1HL2A 3SCPA 1O66A 1CECA 5AB3A 1OK6A 3P5YA 4HMDA 4HYWA 1R5YA 2PU0A 1PXGA 3TCSA 1LDCA 2VGBA 1GVEA 3GIQA 7XIMA 3U2CA 1E5JA 3AC0A 4XSMA 4XAGA 1U33A 1DOSA 3NGFA 4UTTC 1W0MA 1JCTA 5DMLA 6REQA 1UMLA 2R1PA 2BSLA 1CPUA 1C7SA 3KLLA 4IP4A 4PRWA 1QUMA 3P60A 2BHZA 2E1WA 4P8WA 4UQ9A 1ONRA 3B8DA 4J7RA 5FJPA 1M04A 5HPCA 4O1DA 2RDUA 4KGLA 2E5BA 2FTWA 2D20A 4KS0A 1SFTA 2BS9A 4W5ZA 2OKOA 2FPVA 1BYAA 3N12A 4RDVA 4RE0A 3N13A 3WNPA 5D9NA 2E77A 3W7GA 1SJAA 5IM51 1T99A 1XLHA 1TTJA 3RX2A 4DBDA 2PE4A 3W75A 1FCUA 1E15A 1MUWA 1CGTA 2X16A 4NY2A 3POCA 1H7WA 1DPMA 1R87A 2WNWA 3FN9A 1H09A 2CKSA 4S3EA 2VDHA 2W63A 5I02A 3AJXA 3PJXA 4CEUC 3UR7A 4ZOAA 2X1IA 4ORMA 4GX9A 2PDNA 4H6EA 1EWDA 5I3DA 4JQ4A 3PNUA 1H63A 1XLJA 1VYSX 5HJLA 1YMYA 1JCXA 4CD4A 1OYBA 3HQNA 9CGTA 3I7SA 7CGTA 1CDGA 2FZ8A 3B8SA 4TR9A 3FSTA 4GHRA 1HP5A 4C6EA 4AVOA 4PCPA 1IXOA 3T40A 3ECQA 3ORWA 2Z24A 4DYJA 1P1XA 1IT7A 5HWJA 3W2UA 3FEMA 5BXTA 4JQ2A 5KETA 5FEXA 4QP0A 1XUUA 3D47A 3IK2A 2IQTA 2OWCA 4OECA 3H8AA 4AAJA 1IWAA 1TO3A 4XZ9A 1MQRA 1W2VA 3W72A 3BAWA 1NF0A 1QNVA 1V3IA 4KWUA 1TVPA 4QQ3A 2BOFX 3WJSA 4RPPA 7ENLA 3L4XA 4F2BA 5A6TC 1TFVA 4GD0A 2O9OA 4P8XA 4KWOA 4AZBA 2W9MA 2POZA 5AYYA 1YDNA 2GPTA 1Q3NA 4LBRA 3UXIA 2Z1KA 3WLMA 3TNOA 1ICSA 4GQGA 1V77A 1E40A 3I65A 3OB8A 1HL8A 3TYDA 1CZ1A 3WL0A 3RM8A 4B15A 1EX5A 5CGQA 1CLKA 4I8YA 4A6GA 4X2PA 5AZ1A 1Q6OA 1EZWA 4TMBA 2D3NA 1I1XA 4X9YA 2YB4A 2YL5A 3Q58A 4Y8FA 4D1IA 4FX6M 4JFSA 1Q6EA 4BK9A 3WDRA 2UBPC 1SW0A 5HUOA 5T91A 3MP3A 4UTWC 5XINA 3ES7A 4C6OA 1W2PA 3TTSA 3W01A 2QCMA 4RZ6A 1OJXA 2NQJA 5K2ZA 2RGLA 2PCEA 4JS3A 4XSLA 2FZMA 1L2UA 1A5AA 1RJQA 4GQQA 5F2IA 4LVBA 4V1XA 5LSMA 3UBPC 4GX8A 4S3JA 4TTUA 2WJFA 1XX1A 4QG6A 2EHHA 4N4QA 1TPEA 3W28A 3DZ1A 1TTPA 2OZ8A 4IZGA 4PR4A 4JTDA 5LIYX 4MFEA 4O28A 4LBUA 1KRBC 4FF5A 1S2VA 3SY1A 1SJDA 1DKWA 1V3JA 1DIEA 1E9ZB 4LAKA 1V3LA 3CM4A 2XIQA 3F4WA 3W38A 2O9PA 2BOEX 4QXIA 5CKSA 5H2ZA 1E6RA 2JKAA 4UCFA 1DTNA 2OOGA 3E0WA 4JHOA 4D1JA 3T7VA 1SU5A 4WKFA 4ACYA 1OG6A 2G50A 3NM1A 4E8DA 1KCXA 3PPGA 1LL6A 4J4KA 4AZIA 5FJTA 4YVXA 3BLLA 3W84A 4Z2KA 4GBDA 3APGA 4D6HA 2QEZA 4HCLA 1OFDA 2X41A 4R7WA 3V18A 3WY1A 3ZSSA 1KW1A 1F3EA 1W91A 4C6IA 1UC4A 3KOYA 1OF8A 1OG0A 2PSNA 4B3KA 1RP8A 4UNLA 2VFGA 4C6JA 3LPOA 2YBTA 1V08A 3WO8A 2FPTA 3NL5A 1SMDA 5K9DA 4DIAA 4W7WA 1KTNA 3R4IA 4ZOEA 2NQ5A 3LTPA 3DFOA 1NY1A 1RVGA 2ISWA 3E1F1 1IE7C 5D8WA 2YA1A 4LF2A 1MXGA 4XD5A 2HISA 5AFDA 4DJDC 2QCGA 2CNCA 2QCCA 3KP1A 4FALA 2QMJA 3B9DA 3BDKA 4KCWA 3WLQA 4JNZA 3SI9A 2YJQA 4ASTA 5TQLA 1GEHA 1TIWA 3CV2A 2YW3A 3NO3A 4X22A 3QVQA 3WFZA 3LZ3A 3O0KA 3C56A 3GVQA 3CMGA 1J93A 4Z2IA 2Z1WA 2P76A 1UPMB 8RUCA 5LKYA 3CBWA 3TE9A 4ZFCA 2GGHA 4H8UA 4QQUA 4X3ZA 1JYNA 5D9PA 4UMCA 1TTIA 3T08A 3BLKA 3AMGA 2P10A 4GNKB 2QYGA 4U2YA 4WZHA 3M0LA 4LYQA 4RL3A 1M7OA 3RJYA 3B9EA 1KFBA 2G3NA 2FZNA 3QW4B 5HDRA 4C6LA 2HS8A 2X0HA 4IPJA 3FFSA 4D2JA 3HZ3A 4WJXA 3BG5A 4C6PA 2UY3A 1UBPC 4W84A 4DM2A 3SIZA 1VRXA 4DJEC 2WVSA 1OGGA 2DQWA 2J6VA 4UFHA 1D3GA 2ZZ5A 2XYLA 4Q8OA 2QDDA 4MF4A 1XYLA 1ZL1A 1HZYA 9RUBA 1TA3A 1B5TA 1S3HA 4M56A 2A3HA 1LOLA 3A9IA 2EJ1A 2ZZ1A 3IVTA 5J5RA 4MLJA 4AIOA 1E6SM 1EA9C 4E2DA 3UCDA 4KEZA 3CK5A 1ME9A 4F0RA 4H6KA 2CXGA 3HPXA 2GGGA 5LNRA 2WMFA 1PHWA 4KF1A 4RNJA 1UUOA 3KTSA 4NZFA 6XIAA 3BXWA 1YE4A 3GM8A 2EXOA 1SO6A 1Z8AA 3LERA 1JPIA 2F2HA 1GOIA 3EXSA 3K30A 3QR1A 3HJEA 4DJDD 3GKAA 4MZ8A 1KFWA 2XTKA 2GVJA 1IEXA 3L68A 1JDDA 2IMRA 3H4XA 4REQB 1G6CA 3I3BA 4V27A 3G8RA 1AQHA 1GZ1A 9XIAA 4HNTA 3DENA 1NWUA 1LLWA 3IRSA 4X0VA 1FP9A 2V5JA 3CMFA 3S1GA 3ZO9A 1Q5MA 3N4AA 1DJIA 3CXOA 2I7GA 3GH7A 3H4GA 2WWDA 5JQ9A 2EAWA 4PL1A 3MUXA 1E0XA 4QDMA 3O05A 4HNVA 3E2RA 5JIWA 3HGJA 1UC5A 4AZGA 5CAKA 1UH2A 2CLPA 3GHUA 4LUYA 1HG3A 3IANA 1P4CA 3C2FA 3UGRA 3EA3A 2ZTKA 2V3DA 4QHRA 1SO3A 2D24A 1AW1A 1EC7A 1DXEA 3QPZA 4Y90A 1R46A 4WLCA 4PE8A 1DE5A 4GUFA 5CBJA 1KBJA 4DJED 4R3UA 3HFYA 4K2SA 1RY8A 4M6VA 5H8MA 5GJPA 3PPHA 4B5VA 2YYUA 1OC7A 2P8BA 4EXAA 2PWVA 4CCCA 1K9EA 1E55A 1A53A 4R34A 4TV5A 2B7PA 4BCEA 4RNIA 1A5MC 1O68A 3MDUA 2DFAA 4RE3A 2QCHA 3PSVA 2GVEA 1VF8A 3DFSA 5AY7A 3MT1A 5BWAA 1TPH1 4IFKB 2KAUC 3UPBA 1JAEA 3SCOA 4TX8A 3OZPA 2DP3A 4B3LA 1H62A 4DF0A 8CGTA 1TPVA 5CG0A 2O9RA 3HPFA 4KT2A 4AIEA 2I9EA 2VGIA 4LCSA 1NAL1 4ZO6A 3RGTA 3IUDA 1MNZA 1UWSA 3IVUA 1RXOB 3KVLA 3OEXA 3WLOA 3BURA 3B8VA 4FLSA 4N42A 1XV8A 2CFFA 2G4FA 1EF3A 3PZTA 3M0XA 4AXKA 1ZAIA 1XLAA 2ACQA 2W61A 3VNYA 5LGZA 4UMAA 4U3CA 5BNKA 2OYLA 3S2JA 1KFKA 1R3TA 1SW7A 1OWQA 5EYWA 2VCCA 3KOXA 3VOFA 3NL2A 1MI3A 2XSXA 2ZCGA 1TG7A 2PLMA 4GGHA 3P6LA 5I00A 3LBOA 3ARWA 1PE1A 5FAGA 2XN2A 3UNDA 4W5UA 3V5CA 4Z1YA 4IMGA 3JUGA 3A4WA 3E49A 4TOQA 4HIBA 4A3YA 2R1LA 3LXCA 4KWSA 5D38A 5HINA 2J27A 1RBOB 4G1NA 3KDNA 2XG9A 1JYXA 3ZLFA 3HBLA 4YTTA 5DCBA 4GVIA 1RD5A 1XFBA 4L9YA 1U1JA 1PBGA 4YLWA 4HB7A 1E0VA 1CENA 4IH3A 2XIOA 2J47A 1JIBA 3R79A 2E09A 2ABBA 3R8GA 5I23A 3CV6A 1AH4A 1E9LA 3NSNA 3MUY1 2FHBA 3ZFHA 3H6OA 2RDTA 3RU6A 1WQ5A 4K7YA 3B9OA 2UV8G 3PUGA 1ALDA 5A95A 4QCEA 1S5TA 1GHRA 3SB0A 2C7FA 4DNHA 4M29A 3WDHA 1W3KA 1ECEA 2YSWA 3W7JA 3CO8A 1S3TC 2A6LA 1Y5VA 2B4GA 3C61A 3DFTA 3LSCA 4F79A 1AFSA 2HJPA 4WGHA 4DJEA 1TJRA 1AL8A 4E8CA 4GABA 5FA5A 4LYRA 4MWAE 4MSSA 2IS7A 4J3VA 1WE5A 4DBEA 4AWEA 3LRLA 4OBSA 3TH6A 2OT1A 1Z9AA 4F9JA 1UA3A 4A21A 4CQCA 5D2XA 4JX4A 3AZRA 5HULA 2DY3A 1KGXA 3RU8X 3QLDA 2JQXA 2MNRA 1W5OA 4GRSA 3RAOA 1G4EA 4E3TA 4L9ZA 3EX2A 1SW3A 1ZTVA 4LS2A 5BRQA 4NJIA 3BJFA 3FYPA 4MY9A 3IAQA 2GSHA 3VOGA 1H3GA 3ABRA 4AMAA 4NNBA 1EP3A 4S2CA 1H51A 3CC1A 1KNWA 2OSYA 4HMNA 2J77A 2WV8A 3B8UA 1GOKA 1F05A 4LVGA 3P67A 4QJ1A 3INPA 1H5YA 2QCNA 2FGLA 4XV0A 1W1PA 3JS3A 3P7YA 2EG7A 1TPWA 1Y7VA 4GXWA 3ZVHB 2OO6A 2ESCA 5G1TA 2PDMA 1WAWA 3U2OA 5FJOA 1DIDA 1Q65A 4AD5A 3WBWA 1BPLB 1QNRA 5M03A 3N9RA 3H7UA 2D2OA 1W37A 1BD0A 4PULA 5IHRA 5C0QA 3DFHA 2XUCA 4MOZA 2HROA 1XP3A 4ERAA 1ITXA 1WPCA 5HQMA 3BQ6A 4GO9A 1UKOA 2CZFA 1B9BA 5FOOA 3WH9A 1JGIA 3SCNA 1QO5A 1VFMA 3O07A 1YBQB 2J9ZA 3SY5A 4Q8WA 1GKRA 4FNRA 3E0VA 3KEHA 3H2EA 5EMLA 1OC6A 2ZWZA 3W27A 4ZODA 2XISA 4QLLA 1RCQA 2DZTA 5CSSA 1VBJA 3LCXA 4BF9A 2W79A 5HMFA 1W1ZA 3B06A 2QHAA 1XQKA 5E93A 3IGSA 2YR1A 4IGHA 4NX5A 3N34A 1Z44A 4Z1CA 2VQTA 3OOQA 2VDGA 1XIHA 2E8YA 4IP5A 2QAPA 1IEQA 1ISVA 1DJYA 3B0XA 4QITA 4AW7A 2W67A 4HMEA 4NZ1A 4OU1A 1XBYA 1K8YA 5HQEA 3EWXA 5CH9A 1JCJA 4L7ZA 3BJTA 4PUNA 2HE8A 3G0UA 1E0UA 3E02A 4YWSA 1XLIA 1K7FA 1WXYA 4XTDA 4MZ1A 1SM9A 3ITLA 4H7VA 2YL6A 3IGUA 1T8XA 2BBFA 2Y7DA 2PAJA 4YHGA 3QW3A 3GW3A 1UB3A 3V5FA 3VDAA 4KERA 3T81A 2PGRA 4GUGA 1YTDA 3N1AA 3VU2A 1DXFA 1Q6LA 2C1HA 4B3ZA 4URIA 1UWTA 1YEYA 3B9AA 1F5ZA 3R6IA 3UXKA 4PC8A 1XPGA 3H7VA 2RJGA 2P3ZA 4IXHA 5EKYA 1XPYA 2Z1XA 2ZX6A 3ZQ9A 4JFUA 4EX4A 2O0TA 3O3RA 3N04A 1GW9A 3GIPA 2ZKMX 4M24A 4QLJA 5DBTA 4RZ4A 1F6YA 1W9VA 3XINA 3WNNA 4ZEPA 4XKYB 2JALA 3G1RA 4CD7A 1WDPA 3MSYA 3SQMA 3RLVA 1X1OA 1EZ2A 3MI3A 4ML9A 1KGUA 5EFFA 5FEZA 3WG6A 3A4AA 3IIZA 4UFIA 2W3ZA 3G0XA 1ENUA 3B9NA 3QV7A 4BEUA 3JZEA 4AZ6A 3B8WA 4CQAA 2OQYA 3VDCA 3A23A 3N25A 1J5SA 2XDFA 3WLHA 6REQB 4PA8A 5CPOA 4POCA 2DZWA 2WMJA 3OO2A 3VZYA 4KFOA 2XH2A 3UWWA 5BRPA 4H9VA 4OUEA 2ZUSA 3EOOA 1AK5A 3EX3A 4CD8A 3LI0A 1HIZA 4IPLA 4Y8EA 5FSDC 3LHUA 5FEPA 5GNYA 1XBZA 3A3HA 2ZWYA 3PY2A 4QM1A 1P0NA 4ZQPA 2HWGA 1H1NA 1NDZA 2HXTA 4A22A 4M6PA 3PPFA 3FA5A 3UESA 4RV3A 4FXSA 1YW1A 4Z2GA 2G37A 1W9DM 1XJBA 1YYAA 2WB5A 4RNHA 3VZZA 1VC4A 2AQVA 3KUMA 5K3VA 3TYUA 5HR7A 1O7AA 1TWIA 3BLDA 3TLLA 2CPUA 3CQIA 1H50A 1U2YA 3GXIA 1FFRA 3N2OA 6A3HA 4J35A 3MYOA 4H6QA 1XH2A 3BSHA 4ZO7A 1V3KA 5DO8A 5FF0A 1M7JA 4LAMA 1NOFA 1XCWA 3KBWA 4Q8NA 4IIEA 1PDYA 1ZBKA 3PC0A 5HPOA 3ME3A 1T8QA 4JFTA 4AVNA 1VJIA 1UMYA 4B4HA 4ZE4A 1G4TA 3UA4A 3AIBA 2H3BA 2VFHA 3FJ4A 4C60A 4PUDA 3CWOX 2PTYA 1XICA 1ZSXA 3HN3A 5JH1A 3LCLA 3OGVA 4GKLA 3TN5A 1GGOA 4DNMA 1G4PA 1OD0A 2QS8A 5A6JA 2B0MA 5IXEA 3L4UA 5DXYA 5GPRA 1V7AA 3F5LA 3C3UA 1JZ3A 4G8TA 1O6IA 1KD0A 5DT5A 3KL0A 3WD3A 4JN6A 4KFPA 1M41A 6TAAA 1TPDA 1ZBVA 5LNVA 5FI8A 3CV7A 1QW9A 4LYKA 3L2IA 3WF0A 1MW2A 1K8XA 6ENLA 3G2GA 4F3HA 1WDWA 3SGZA 3Q67A 4N2YA 4NXSA 5CPQA 4LY4A 3PBUA 4DX3A 1FA2A 3UEQA 2XH7A 5GQBA 4GBUA 3GFYA 5F1VA 4AC7C 3ISIX 2RFGA 4MB4A 1OGSA 1NFBA 1V6VA 1V02A 3R0DA 1KR0A 1NU5A 3ABZA 4HNUA 4GVGA 4OVXA 3AYSA 2Z00A 1MNSA 3H2AA 3RMEA 4GLEA 3VA8A 1Q2RA 3PZ9A 4H9TA 2HMCA 3VE9A 1YXCA 3DAQA 3S8HA 1QNPA 2FJKA 1H5VA 3P0XA 3MBFA 1SO5A 6ALDA 3RILA 1VH7A 1QBAA 1I9CB 7A3HA 3W85A 1XIIA 3TJLA 3LZ5A 1SR9A 3IV3A 1F6KA 2HEJA 1X98A 1EB3A 3QC3A 4MB1A 1L8PA 3W6YA 3W1AA 4TVDA 4Q3MA 2F38A 3KBNA 1V6YA 1XDLA 5D30A 4A3QA 2D0FA 4U3AA 4WDTA 1ADOA 3LHWA 3CHFA 3SURA 4M1RA 4MFDA 5HMDA 2YGYA 4NQ1A 5EFDA 4W88A 1ZRQA 1PTAA 5CZSA 3FEQA 2QIIA 4H3DA 3T0DA 3K8LA 4DWSB 3BAYA 2ZRZA 5I5RA 1AH0A 1HTIA 4O10A 4WSJA 3BG3A 1EH9A 3A21A 4TTGA 3N19B 2J9XA 3WNMA 4J3UA 1F3XA 5EGRA 5D02A 3I6TA 2BASA 2XINA 3WLLA 5AHNA 3ITCA 2IPWA 3NQMA 3M1ZA 2ZRWA 2DGAA 1P1MA 2FMNA 4UTMA 2PWFA 2V8ZA 1EO7A 2HZGA 3IIXA 1AD4A 2XIIA 4IX2A 5L9FA 1EUAA 2DZBA 2WSQA 1GYNA 4B5WA 3O7UA 4OV9A 3GR7A 4C1LA 4A3RA 2Q8LA 4WY0B 1TZ9A 3AS0A 4WD0A 2EBNA 3UCQA 5D4YA 1DJGA 2Y61A 4P2VA 1FH8A 3AYTA 2FB3A 2FMOA 2QVHA 1ML1A 3MP4A 1TPC1 3A4JA 5C2CA 4DRSA 1E6ZA 4PB3A 1DWFM 3BJSA 4YPJA 1OX6A 3PFRA 3N6JA 3W86A 5GNXA 3H4WA 3VIOA 1IZJA 4O1AA 1ZP3A 1KC7A 4Z2HA 1P6BA 4XAYA 3VIFA 4IP7A 1RR2A 1XYAA 3BAJA 1B3YA 3S5SA 3TAKA 3T0BA 3UG3A 1THFD 1ONWA 4LAOA 5F4SA 4C5YA 4ZVJA 1U5HA 1X8FA 4EWND 3W2MA 1UKSA 3WDQA 1W1TA 3G8EA 4XD6A 5EPDA 3WJXA 2Y8KA 3URQA 5PTDA 4ERGA 3A4XA 4O12A 3W7IA 3K4DA 1H41A 2ZRYA 3AHTA 3RPDA 1LT8A 2Y63A 3ARXA 2Y5EA 1TYGA 3ARRA 2YFOA 1UP2A 4XBJA 3DFPA 1CNVA 1TA3B 3C2RA 1T6MA 2E6AA 2O55A 3AIRA 2DIKA 3NPVA 4LY8A 1VD6A 4GXMA 1IIGA 3SJNA 1TIMA 2E6YA 3M0JA 4XX6A 4S3KA 3HG4A 1SGJA 3WNLA 4LGXA 5K9XA 4FOKA 2J8FA 1MFUA 4JOMA 2ZX8A 1H0GA 1PEZA 3QM3A 2Y70A 3GNPA 1S2WA 3G1AA 4K37A 1ICPA 2PWGA 2E1DA 2R91A 4P8UA 4PB4A 2ACUA 2F8QA 4KBXA 4PL2A 4Y9NA 4US5D 3HTWA 5G2IA 3L4WA 3IJIA 1PSCA 1OF6A 2POTA 4NX0A 4HOWA 1MEWA 2WVUA 3LD5A 1XIMA 4PUMA 1OK4A 3PBWA 2G4JA 4Z42C 2UY5A 3L7RA 1TWZA 3QHMA 1DJNA 3PZIA 5JH2A 4JCLA 1K1DA 1KCKA 4HN8A 1TV8A 4V2XA 2EPMX 3UF9A 2GLKA 1XSJA 3GUGA 3QZ6A 3MHFA 4H01A 5TD4A 3ARUA 2AQOA 1PS9A 4JL1A 3C86A 1DL3A 1J8VA 4H41A 1VFSA 4K6AA 3UXLA 3GNDA 3N18A 2OEJA 3PTDA 1IHIA 4FO4A 3HG5A 5FJRA 4FEZA 1QDSA 4Z0JA 4HJFA 3TAOA 1X7IA 1NWTA 2OG9A 2NQ9A 5C7HA 4ENLA 2V5DA 1AW2A 3EWUA 4DI8A 4FI4A 2BB0A 1QASA 4IGMA 1JXJA 1NOUA 3AYVA 4I3GA 3R25A 1UR4A 3HF3A 1FWNA 3BLPX 4UWMA 2QQ6A 2CWNA 3GHSA 3FXGA 4FP1A 3S2CA 4QIUA 4JQ1A 3WD4A 1WCGA 3P5ZA 3IIPA 3N2XA 4NAEA 4BF5A 3CYVA 5A6BA 1JQVA 3HJZA 1I2NA 3VGHA 2NLYA 4NXKA 3CL8A 3MANA 4DUVA 3KVKA 2WCAA 1UWIA 3NO5A 3T2PA 3CB8A 1BGAA 3WF4A 3LK6A 4ZENA 3N2MA 4UR8A 3BH4A 2J74A 1C9DA 1GPFA 4H00A 1IEWA 3L0GA 2HQAA 4DUOA 2BXZA 1ZLPA 4A8LA 5CXPA 4QRNA 2ZICA 2WMKA 3K5XA 3AUJA 4UC5A 1RPXA 3NZRA 3APYA 3GK0A 4O17A 3MMWA 3AXIA 2XJ7A 1I8JA 4CVWA 5B80A 2VELA 1H7NA 2WZEA 3K13A 5HR6A 1GQIA 1PO9A 2ZC8A 2YCIX 1CEOA 1OFPA 5CBBA 5LIXX 4PMVA 3FYOA 4ZE5A 3OODA 3JR2A 3M47A 1V4YA 1KBIA 2YDAA 1ITQA 1XIBA 5LNSA 1AH3A 3SRKA 3JRKA 3F7JA 2Z25A 3B3DA 2YIHA 1NF7A 3T4CA 1R3WA 2BWGA 5A5WA 2YA2A 1Z7AA 4IQEA 2G97A 1OCBA 1L9WA 4H4IA 3WBXA 5CLWA 3MWAA 4AD2A 3MKKA 5HK4A 3R12A 4F0LA 2ODOA 4GKTA 1FKXA 2GQ8A 1VHNA 3URAA 3GUWA 1EWEA 4AY8A 3DG3A 3UWYA 3IJ7A 1LG2A 3UGVA 2ZZ4A 1R2SA 4BJHA 3AUOA 2XZ9A 4ZB5A 1FHVA 3FOKA 1KWGA 3GXDA 1YDVA 4A4AA 1OFOA 3VGEA 4V15A 4IJBA 3TWAA 1JL8A 3WL1A 1QNQA 1YDOA 3HG3A 3OLDA 3WQPA 1QVBA 3S6DA 5REQA 2IKGA 2A0NA 2X1RA 1ISZA 1KCLA 4LOCA 3BK0A 4ML4A 5CGTA 1NFGA 4G2DA 4JTAA 3OZOA 4RW3A 1P0DA 2HS6A 3FVDA 1XSKA 1ECQA 3S42A 2DH2A 4O0ZA 3EA2A 1TJPA 4MWAC 2Z1BA 4H1ZA 3NQ6A 3TYEA 3E2SA 2PWEA 4QG8A 2QW5A 4O0KA 1JFHA 3EMZA 5CZJA 3GIYA 1JUBA 1IGWA 3DIPA 2RHGA 3N17A 1KXHA 3OYXA 3W7EA 3BW3A 3CT2A 1D9EA 1TUXA 3DHDA 2BV9A 2PLJA 3PB0A 3O06A 4PCNA 3FXYA 3TCEA 2NXGA 4Q7BA 1I0DA 3AS1A 3T55A 3A5VA 1BEUA 2VVSA 3UZJA 4UR7A 5CC5A 3MUZ1 2EPOA 2V81A 4PSPA 3QYSA 4GUJA 3VD9A 4LV4A 4J1OA 1L6WA 4Q22A 3A5FA 3NOYA 1N55A 1BWLA 1XIJA 3GZAA 1DIKA 4HQVA 4MKSA 4IISA 2DZAA 3A9BA 3VAVA 4WIWA 1RD6A 2CHOA 3QFWA 2OU4A 3L65A 1R3QA 2VCBA 1ZAHA 3M46A 2OYMA 2XU2A 3T0CA 2IPGA 2J7HA 2VZSA 3DGRA 4HPJA 1ME7A 3NFUA 6PTDA 2PDHA 2WVTA 3ITOA 3TZNA 3G5EA 2YZ5A 1WXZA 3MUCA 1FQ0A 4B91A 3UJSA 1EHNA 1M03A 1XC6A 4XAZA 3THAA 3TW9A 4O57A 3S83A 1WKEA 2X09A 4HU8A 1GOMA 4B16A 4JYDA 3FK4A 4W86A 1S5WA 1J96A 2NVAA 4MWAD 4TU1A 2J7BA 4JAWA 3PP7A 3TSMA 4LEFA 4UZUA 1FP8A 3E2QA 4HD5A 4FOJA 3WH8A 3VDBA 3BO9A 1KQYA 4TV6A 3GNNA 3MI2A 3STPA 1E4LA 4LB3A 3EEZA 1XGZA 1A3WA 3BZJA 4L61A 3OQEA 1J4EA 1XHGA 2FFIA 1XYMA 3CQ0A 1UYQA 4NZ4A 4DI9A 4V28A 3KWXA 2H8ZA 3CLMA 3PBGA 1WYIA 2V68A 3PBVA 4DO6A 3OA3A 1ICQA 1HT6A 4J3XA 4NILA 4HPHA 3WSUA 1W6TA 4FNQA 3VKKA 5K4ZA 2V3FA 1H4PA 4NZ3A 5B7YA 4AG0A 4MNLA 3VZXA 1QRQA 4L6DA 1OX4A 1B1YA 4XVDA 1ESWA 5BXSA 1TV4A 5IHSA 2RUSA 4GI6A 3LHYA 1ZS2A 4EWJA 1JZ4A 3IPWA 3D3FA 3TMLA 5I77A 3BMWA 3ZZ1A 3KXQA 2CLIA 2EPNA 3VD5A 4UOJA 1X1ZA 2VI0A 4U31A 4LRSA 1LRQA 2VEPA 4GXPA 4HNCA 3YPIA 3ANVA 4JIHA 1CXLA 4KIEA 2V5BA 3EYPA 3OYZA 2C3ZA 4C90A 2D2JA 1FDZA 4AD1A 1JAKA 3M6YA 1J01A 1KM4A 4WSKA 3NOEA 2OSWA 1YNPA 1BHGA 1KO0A 3OBAA 4GG9A 1BAGA 2YXXA 4HMCA 4ROPA 4QE4A 3CUXA 3SFWA 4Q8MA 3NQDA 4O52A 4DYKA 2CEQA 1U1HA 4O54A 3U5YA 2VO5A 1A3HA 3G77A 2YCLA 2QUNA 2B7NA 3HO8A 1WB0A 1RAKA 2VENA 4DPQA 1JCMP 5EY5A 2OEKA 2PDBA 3S2NA 2PP3A 3R94A 4LQ1A 2V3EA 4HHHA 3VNDA 4MYAA 1EHAA 5AHEA 1O5KA 1A47A 1SFLA 1N8WA 2WLYA 4ILSA 1Z6KA 1W5PA 2BVTA 1HJWA 3LCHA 3QQ0A 5AC5A 4BY3A 3QKZA 4GZJA 2WKLA 3WD2A 5CC3A 4FK9A 1IXNA 4MVAA 4BWLC 3VNZA 2YDQA 3AIVA 5HNNA 5BXPA 1OT2A 1S38A 4BI5A 2PDYA 4ADUA 4DJFA 2G96A 1I2QA 2CXEA 4D8AA 3UZZA 1OIMA 3R1ZA 2REQA 2DVTA 2JKEA 3NXFA 1UD6A 2QGYA 1RV8A 1LQAA 2V2HA 1JF6A 2V6AA 5ABFA 1QT1A 2A2IA 3R89A 2ZX9A 2DW6A 4LUSA 3EA1A 4QDPA 2DZUA 4B9YA 4PCSA 3L4TA 1JCNA 1ZY9A 1T0OA 1KB3A 3CPGA 4LAZA 2NXIA 1VCGA 2PZNA 4H83A 2WSYA 3LM7A 3TU9A 1LUCA 5LHFA 4OWGA 3SN0A 2BXYA 3GHTA 3S1XA 4W7VA 3LGDA 3KFTA 1GPWA 1QHOA 2ZDSA 4YTRA 3CHVA 4IPPA 1X39A 3QEZA 3AS2A 4I8DA 4A3HA 3QY7A 1OB0A 3OVPA 1QI0A 1XGEA 1XINA 1LT7A 1F73A 1W3TA 4MLRA 1R30A 3ZIZA 1UZHA 2E67A 3ZJKA 1UROA 5JUVA 4WOQA 3CAKA 3NPUA 6TIMA 2Y0FA 1P0BA 1XQLA 1PZ1A 3AZSA 1S39A 1JI1A 3BW2A 1ISXA 3JVAA 4W4QA 4K68A 2WZHA 4C91A 2XVLA 3AMKA 1ZHAA 1EJRC 3WFAA 3PZNA 4RX0A 1A5SA 1R85A 3REQA 1HKMA 2J66A 1A5KC 3SDOA 4YS1A 2FVLA 2GJXA 5IFPA 2AAMA 3MHGA 4NP7A 2VWTA 3M5VA 3I3DA 3BARA 3J7HA 3PTKA 2Y88A 4GIYA 7ODCA 4AWTA 1WV2A 1YDYA 2WMHA 3QGKC 4JHZA 2DZXA 1K4GA 4XD3A 4O1FA 1Q2SA 4Q4KA 2A3BA 4KFNA 3GC5A 3WEZA 3LUTA 4N6EA 1RP9A 4JCMA 5C2GA 4H19A 2F6XA 4MYXA 1VAHA 2FH8A 1LZOA 2WC7A 1UKPA 4XB3A 3TFCA 2PBOA 3M0HA 3MJYA 1N82A 3URBA 3WH5A 1MZHA 2RGMA 4MNMA 3UZ5A 1REQA 3N11A 1US0A 4H9YA 1R3RA 3QSTA 3TZFA 3NZGA 1VFOA 3W70A 4DO4A 1Z3NA 2J7DA 3KM8A 1A0EA 4C7DA 3L67A 4NNAA 5FF4A 2ZX5A 2XH4A 1PZ3A 2C13A 1UR2A 2GL5A 3I7QA 4WKHA 1OD8A 1O94A 2H9AA 5DY2A 3SCTA 1FWEC 3QFEA 4PB5A 2VOTA 3NA8A 4N9BA 4S3AA 4GQBA 1JI2A 3IRDA 1EXBA 1SFSA 1XLDA 4F0HA 1WA3A 3R7MA 1XRVA 1MYRA 3WKZA 2NVDA 1DIOA 4H9ZA 2QR6A 1UH4A 2XM2A 4MTVA 3C2OA 4KIRA 4AHPA 2PLCA 3DFYA 1PKMA 3GG1A 2JK2A 4FZIA 2NSOA 3T44A 4S3BA 3R8HA 1XRFA 1YRRA 3PSWA 3ZR6A 1RJRA 1XISA 3N15A 3WMSA 2E5DA 4JX5A 1DQUA 1WO2A 3N3TA 1KTCA 3SZ8A 1MEIA 4H9MA 3PANA 1QI3A 4NZCA 3TEVA 2CLKA 3SRDA 1FWRA 4AC1X 2YL9A 5I0DA 4Q8QA 3W53A 4NG3A 1AJ0A 3UJFA 3LU2A 3T8QA 4XZHA 2WSKA 4UTLA 2DIJA 2WM1A 1WX0A 2BFGA 2E6DA 3UXAA 1IQ8A 4ZO9A 2OJPA 4ZTXA 4IGNA 2VEKA 3SM0A 2CBJA 5BYWA 3V3WA 2GVGA 1JR1A 2F2KA 3GYEA 3NNTA 4NJJA 1AMYA 2OQHA 1ZJBA 2XPKA 2CZDA 2KZHA 4W89A 4ZQOA 2C91A 2C0HA 3SN4A 3M9YA 3NZPA 3OU8A 4G7FA 5BW6A 2QXWA 1SJBA 2BZNA 4QE1A