3PAOA

The crystal structure of adenosine deaminase with adenine bound from pseudomonas aeruginosa
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of adenosine deaminase with adenine bound from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 123
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3paoA00
3A3XA 4H9TA 3O7UA 2R1KA 4IFKA 4H9MA 3QY6A 1UIPA 3ISIX 3LGGA 4YIWA 2Z29A 2WJEA 3HTWA 3S2JA 1YIXA 4RE0A 4BY3A 4GZ7A 1J5SA 2O4QA 1RJQA 3FEQA 1EZ2A 2AQVA 3OVGA 1UMLA 2HQAA 3MTWA 3T8LA 4IQJA 4IGMA 4WHBA 4QSFA 4DI9A 1FWAC 3ORWA 4C60A 3ICJA 1RK6A 1O12A 4IFKB 1HZYA 3F2DA 4RDWA 1V79A 3LGDA 4OFCA 1E9YB 4QS5A 3CS2A 4D8LA 1FKWA 3IV8A 3E38A 4C6LA 4IH3A 3E2VA 4C5YA 1YMYA 2VUNA 4H9XA 1FWCC 4LCSA 4C6CA 1R9ZA 2HPIA 3GIPA 2GWGA 1J6OA 1XGEA 3GG7A 3LS9A 4QS6A 1A4LA 2FTYA 3MVIA 3NURA 3K5XA 2OOFA 4KEUA 1P6CA 3IGHX 1M65A 4J2MA 4C6QA 4CNSA 4B3ZA 3IACA 5G4HC 2D2HA 5E5CA 3LSCA 1K6WA 1A4MA 3LSBA 4C6NA 4IGNA 4M51A 1FWGC 1BF6A 1M68A 1A5MC 1P1MA 4H01A 3JZEA 4PE8A 4XD3A 5FSEC 4QTGA 3PNZA 1NDYA 1R9XA 4DZIA 4HJWA 4V1XA 2VHLA 3URBA 2ANUA 2O4MA 1A5LC 3GRIA 1EYWA 3E0LA 3WYZA 3F2CA 2HNHA 4IF2A 3RHGA 1KCXA 1V77A 1KRCC 4KF1A 4H9UA 1EJTC 3IRSA 1RJPA 2FTWA 3CJPA 3S2LA 3AU6A 1I0BA 2EG7A 4IFRA 2I5GA 1ITUA 1GKPA 2QVNA 3GTFA 2Y1HA 3S4TA 2AQOA 3TN4A 3GTIA 2I9UA 1EJUC 4DZHA 3O0FA 1KRMA 2ADAA 2HBXA 4NG3A 1PSCA 4CQBA 3B40A 4H9VA 4C6EA 5HMEA 2G3FA 4LAMA 4C6DA 3BE7A 2Z27A 4L9XA 4F0SA 3PAOA 2OGJA 2XIOA 4EPKA 4H9YA 5HMFA 4EP8C 1RAKA 2YZ5A 1QW7A 4C6MA 2PGFA 5CH9A 4B90A 3F4CA 4BJHA 1NDVA 2FFIA 3QGKC 2QPXA 1NFGA 4C65A 1PB0A 3OQEA 1A5OC 1K70A 4NI8A 2DVTA 1I0DA 3B0XA 4KEZA 2VC5A 3E3HA 3PNUA 3ID7A 3SFWA 3QY7A 3K4WA 4GC3A 4ERAA 4DLFA 3UPMA 1S3TC 4UB9A 5A6TC 4R85A 3R0DA 4R88A 4C6BA 1GKRA 1IE7C 1PTAA 4BKNA 3AUOA 2Z28A 4CEUC 3MJMA 3UF9A 4DYKA 3F4DA 1O5RA 2AMXA 2F6KA 3NEHA 2YB4A 3OODA 2ICSA 3URNA 1POJA 4DIAA 4LCQA 1YRRA 3OOQA 3QGAC 3A3WA 4IFOA 4ICMA 5AKQA 1RK5A 4H9ZA 4CNTA 3E0FA 2EG8A 4EPBC 3GTHA 4PBEA 4LCRA 1FWIC 3IPWA 3LY0A 1M7JA 3OJGA 2HPMA 2FVKA 4GY0A 1FWEC 2E25A 2YB1A 4G2DA 1ZZMA 4G7EB 2QS8A 2VM8A 1E9ZB 1GKQA 1XRTA 2OODA 2OB3A 1DPMA 1FWJC 4XD5A 4JOMA 2GSEA 3WMLA 3PBMA 2BB0A 2PGRA 2R1PA 1V7AA 4R7WA 4I6VA 2E1WA 1YNYA 4EPDC 1JGMA 4IG2B 1WXYA 4LAOA 2A3LA 2Q01A 1NDWA 3LNPA 3V7PA 2GOKA 3IJ6A 4LH8A 4KEVA 1YBQA 3T81A 3RYSA 1J79A 4INFA 3GU1A 4H00A 3A4JA 1PO9A 4RDYA 3LA4A 1UBPC 2EG6A 3NQBA 3N2CA 4DI8A 4CQDA 4V1YA 3FDKA 3K2GA 1FKXA 3PANA 3TN3A 4J35A 1FWBC 3AU2A 4RDZA 1NDZA 2BGNE 2D2JA 3WZ0E 2HBVA 1J6PA 1K1DA 4GX9A 4LALA 1EJWC 4AC7C 4F0RA 3S2MA 3KM8A 3G77A 4KQNA 4P5UA 1XRFA 4XD4A 2CZVA 4RZBA 3HM7A 1V51A 2FVMA 4RDVA 4C6IA 4DLMA 2P50A 3UBPC 4NP7A 4HK7A 2OQLA 3MDUA 2DVXA 4XD6A 2WJFA 1ITQA 4C6FA 1P6BA 4MUPA 3SO7A 4QRNA 4B92A 3GIQA 2R1NA 4PCNA 5HMDA 4GK8A 3DCPA 2R1MA 4ERIA 3OU8A 4C6PA 2PAJA 5LXXA 2KAUC 3GU9A 1ONXA 4C6KA 3CAKA 3UR5A 1RJRA 1POKA 1YBQB 4I6KA 3TNBA 4PCPA 1QXLA 1VFLA 2D2GA 3D6NA 4GY7A 1A5KC 4KERA 4GY1A 4KETA 4HA0A 1FWFC 2UBPC 3LU2A 2RAGA 1FWHC 3EWDA 1R9YA 1FWDC 2Q09A 4LANA 4TQTA 3EWCA 3E74A 4LFYA 1V4YA 4G7EA 4F0LA 2ZC1A 4GOAA 2P53A 4ZSUA 4B91A 3F2BA 4CQCA 3EGJA 2Z25A 4HK6A 4L6DA 4XAYA 4GX8A 1RA5A 1EJXC 4J5NA 4PBFA 2YXOA 3GU2A 4IG2A 4Z42C 2Z24A 4DO7A 3RCMA 4KESA 3URQA 5FSDC 1ONWA 4ERGA 4C6OA 1EF2A 3QY8A 2R1LA 2Z26A 4XAGA 3URAA 2VR2A 3T1GA 1A5NC 4UBPC 4CEXC 3MDWA 4E3TA 1KRBC 3HPAA 2Z7GA 3FDGA 2PUZA 4LAKA 2WJDA 3IARA 3TN5A 3MPGA 3MKVA 4GYFA 2GWNA 3B0YA 3TN6A 4WGXA 2IMRA 1W1IE 2PLMA 1WXZA 1ADDA 4ZSTA 3ITCA 4KIRA 4C5ZA 1EJVC 3MSRA 2WM1A 1EJRC 3GUWA 4C6JA 2QT3A 4CNUA 3DUGA 3MVTA 2GZXA 4AQLA 3RN6A 2DVUA 1UIOA 1KRAC 2Z2BA 2Z2AA 3UR2A 4EPEC 1RA0A 4HK5A 2W9MA 4WVXA 2Z00A 2Z4GA 4QROA 3DC8A 4LEFA 1XWYA 4GXWA 1EJSC 2VC7A 4XAFA 4DNMA 3S2NA 4XAZA 2UZ9A 4GBDA 3GTXA 3C86A
chains in the Genus database with same CATH superfamily
3R10A 1YYAA 1KXHA 1M01A 4YMZA 2GQAA 4H1ZA 2ZFAA 1BXNA 1VBGA 1JDCA 5I3FA 3E96A 4J28A 3UCQA 3CV1A 4J2PA 1FY6A 4X22A 2PDCA 3IVSA 3BAXA 3L2IA 5AHEA 3NQDA 5PTDA 4NXKA 2J24A 4GYPC 4IGMA 3RR1A 3TCSA 2GUUA 2E6YA 2W0UA 2WWDA 5LA0A 3F2DA 2W66A 1VCFA 4LW7A 1I2OA 1W9BM 4Z2KA 2WM0A 4JPGA 3CS2A 2VC9A 1PL9A 4AIEA 5C8BB 2GGEA 4LJ3A 4V27A 4LY8A 2VUNA 2VGFA 1BXCA 1OF6A 3P84A 3S1UA 2OPJA 1K8XA 4IQEA 1BXBA 3DFYA 1FHVA 3WNKA 1J9YA 1Z69A 5F7UA 3MV11 2F6XA 3OPSA 3RPMA 1H7NA 4QJ4B 1AZ1A 3S6OA 2BG5A 4GVFA 1R47A 5DXYA 3TOYA 6TAAA 3ZJ7A 4LQ1A 2TYSA 4E4PA 2P0IA 1YXYA 4X9SA 2AAMA 1PAMA 4Q3MA 3VNIA 2VD9A 4YCOA 1P1MA 3MWCA 3PPHA 4DWSC 4BI7A 5I0DA 3HZ3A 1CGVA 3AHYA 3W27A 4C7DA 2FPYA 3URBA 1OB0A 1E43A 1JQVA 2PDJA 1MRAA 1E70M 3FJ6A 3NL2A 1Q6CA 2VZVA 4DRSA 4LGXA 2PGEA 1DXIA 3PUDA 2GVGA 3RR4A 1BYAA 3AWNA 1U22A 3L4WA 3EWWA 2I5GA 4ZL1A 1YPFA 5KMYA 1O94A 2ZBTA 4JHOA 1XSIA 5CPOA 2ZRXA 1DYSA 1YXDA 4NSBA 1XLHA 1ME8A 1E5NA 1P7TA 4LV4A 1AMYA 3ITXA 3TR9A 1GOKA 4QEEA 3SN4A 3CHCA 3EWUA 3KP0A 3W7NA 1B3WA 2I57A 1SVDA 3EB2A 2A7PA 4F2BA 1B9BA 4YTSA 3LHYA 1CCWB 3T8QA 3A22A 3VIIA 3G1AA 4EP8C 1R8LA 3LD5A 4B90A 4WF7A 1ZBCA 2FFIA 2GDUA 1GGOA 6CGTA 3P82A 1H1YA 3KTSA 3H22A 1TV2A 2A1YA 3VGFA 1ZLPA 5K9XA 3SGGA 4XIMA 3PNUA 3EDFA 3W2NA 1UQZA 2XFFA 2CLHA 1WQ5A 5HR6A 1U5JA 2IUZA 2X7WA 3WQEA 3PZUA 4MPQA 3SCPA 3DYPA 3AUOA 3TQPA 1UMYA 4JIEA 1S5WA 2DZTA 4UFMA 2FPTA 2FYMA 4FOJA 3OODA 4NILA 1DIKA 2PTWA 1U33A 1UR9A 3AYRA 1OFBA 3E0FA 3IVUA 1XYBA 3ZQ9A 1KFJA 4WJ8A 3WDJA 1NF0A 1KFBA 4FSAA 4EIVA 2J9YA 2V82A 2VM8A 3IRDA 1RD5A 2DZWA 4GRSA 1FWJC 5I00A 2MANA 2NV2A 2XIJA 4Y2WA 3LMZA 4RCXA 4M29A 3UWQA 1GK8A 2A3HA 4AISA 4EPDC 1JGMA 3LHZA 4X2PA 4I9AA 1NEYA 1BF2A 2BXVA 3WUGA 4LH8A 2DFAA 3W72A 3GHRA 4JN7A 1WBHA 5HPCA 4IWWA 5FJOA 2ZRWA 1IYXA 4E2DA 2XN2A 3G22A 3MMTA 4LVFA 4PTWA 2FQIA 2QDEA 5LXEA 1P6WA 5GQBA 4XD4A 3T0CA 2FVMA 4DLMA 1QFEA 5AHIA 1F8MA 3GXIA 2KZHA 3NO3A 5D2WA 4JDYA 1FWWA 4J27A 1J8VA 2QJNA 4CKQA 5D2VA 1LZOA 1A0DA 2ZXAA 3LPFA 1CGYA 1RALA 4WDTA 2OX4A 1EP3A 3WJXA 2WBGA 4DUXA 4JZ5A 3PBUA 1XM3A 3SJ3A 2DT0A 3TWAA 1TIWA 3NPXA 2CLFA 4GQRA 3T0BA 3OVRA 4TV5A 1UUOA 4JTSA 1D3HA 3LCXA 2F2HA 2XTKA 3W1TA 3UR8A 4PUDA 1BKHA 1G5AA 2P53A 2J7HA 2Q02A 2V67A 4IXXA 2PWEA 1EZWA 3FS2A 1EUAA 4XAYA 3WLLA 5H1WA 1LM1A 4KRUA 3U2OA 3VA8A 4GG9A 6PTDA 3PZTA 1J10A 3TW6A 3HPXA 3DI0A 3WQ4A 1W54A 1US0A 4NYYA 1XR2A 4ZB0A 3NEVA 5B7YA 5C55A 1TPVA 2CKRA 1AQ0A 4HMEA 3E5PA 2ZUTA 3N25A 4PA8A 2VENA 2W61A 5BRQA 1QBAA 2WO5A 1H62A 3V75A 4MKVA 3TN5A 3QV7A 3WCZA 2RKXA 3FIGA 4IPLA 1Z32X 1E55A 5DEZA 4D6JA 4X63A 1JZ5A 1JAKA 2XVNA 2PSNA 1FDYA 1MQQA 1SPQA 4UTUA 1C29A 4CNUA 3LI1A 4G6CA 1LQ2A 4WEVX 3GZAA 3RN6A 3S5NA 1XBYA 5A6BA 3PULA 3VNZA 4IMCA 4XWUA 1E1CB 5KINA 2CFFA 4GXPA 1UWAA 2W91A 2HVOA 5AECA 4D1JA 3C2EA 3QKZA 3MSGA 2VC7A 1GOOA 3OG2A 3C86A 3C8FA 5BYWA 3ZS4A 1FA2A 3DHPA 2R1KA 2C91A 1O5XA 4NAFA 2VEMA 1UIPA 3BV4A 4FB7A 2R24A 3KUMA 1DJQA 4JFVA 1JZ8A 5K2ZA 1DV7A 3WKZA 2R6OA 3SUVA 4RE0A 2J62A 3I68A 3PVFA 1VFOA 4GZ7A 4O14A 1CLVA 3OVGA 1UMLA 1Q6LA 4FLRA 2PDNA 1JXKA 3VMOA 1QK0A 2PP0A 4RE2A 3NVDA 4HHLA 3M46A 4TVUA 1B90A 1QHZA 1DOSA 3HGJA 3KFTA 4F4RA 1C9DA 1DWHM 4YXGA 3UXKA 4W85A 3CU2A 3KOFA 1N82A 4R5EA 3WL0A 5XIMA 3CO4A 2OT0A 3GIPA 3GG7A 3MBDA 3HG2A 4IGSA 5G2HA 3VOJA 2HROA 4GA8A 3ARRA 4PGLA 1XDMA 4ZB2A 5FEWA 4CU8A 2WQPA 3LCLA 1XH1A 5E5CA 2O9TA 1BYCA 1RV8A 3L66A 1TR1A 2XFYA 3HJZA 3EKZA 2FHFA 7XIMA 3N29A 2GYIA 1WDPA 1A5MC 2JK2A 2Z1KA 4GYKA 3I6TA 4PH6A 4O1AA 1TQXA 1I2QA 1NDYA 5A2CA 3H2OA 3N12A 5DXXA 4DZIA 4WCJA 4V1XA 1K3UA 2CBJA 5HQEA 4PB5A 1D2KA 2VFIA 4QQUA 1H0IA 3LOTA 4WUIA 4H7CA 4IMEA 5HUOA 2Y7FA 1L8PA 2KX9A 1KRCC 4AHQA 3WEOA 1XBXA 2G4JA 2JF7A 2Y63A 3DKJA 4HNVA 4ZA0A 4DJEC 1DWFM 1GVEA 2Z1BA 3V5CA 2JEPA 1WAUA 2QUNA 1Y5VA 1O1HA 3UXLA 1Q6OA 5H8MA 4RW3A 1KRMA 4GVGA 3BANA 3BLDA 3W7RA 2PDBA 1W3NA 1PTGA 4F3HA 1WKFA 4H9VA 3PBYA 3W02A 2VMFA 4OE7A 2EPMX 3QLDA 4JTDA 2XGIA 2XIOA 5I24A 1RAKA 4AHOA 2PGFA 4M1RA 4WDWA 5JQ9A 4HD5A 1E1FA 2NQZA 1WAWA 3QVQA 1LBMA 2OZ8A 4K7YA 1Q6DA 1K70A 2DVTA 4NQ1A 3FHQA 5L6UA 2A6LA 4RNHA 3LNMA 2Y8VA 1JYWA 1Y5XA 3DFQA 2WC3A 3ARTA 1ZAHA 4IZGA 1VJZA 1AJ0A 5A6TC 3MCOA 1VAHA 1EQPA 3AIBA 3GH5A 4CCCA 4C6BA 2DEPA 2ABBA 4X60A 2Z28A 4CEUC 2ZUWA 2EPLX 3LYEA 2CC0A 2QQ6A 4TIMA 1YHTA 3A3WA 2VKZG 1RK5A 1CXFA 4ECLA 1E51A 1KKRA 2VCBA 2PDPA 2V2HA 4FLQA 5DF0A 1M7JA 2J7DA 3OJGA 1BYBA 4JX5A 1ZJBA 2HSAA 4O50A 1JDDA 4G7EB 3SECA 1N55A 1XX1A 3KOYA 1KXVA 5C9XA 1W1VA 2X0SA 1DJNA 1TPUA 4FHAA 4E0CA 2PGRA 4H8HA 5K9DA 1WOAA 4HNCA 3IJ6A 3R25A 2BVTA 1ODZA 4KEVA 5BRPA 1DORA 3O05A 3E12A 4AD2A 2C8NA 3U2EA 5HQLA 2P88A 3UETA 2Q6ZA 1H50A 2E9BA 1MWOA 1UH3A 1SSGA 3ZR6A 1N2VA 3U7VA 1I1WA 2DJXA 3GHTA 9RUBA 1WOBA 4HKPA 4WQ6A 1J01A 5BNKA 4X61A 1ZALA 2VEIA 3KM8A 3QKEA 1K02A 2J6XA 2RGMA 5C9ZA 3LM7A 4AVFA 3WMSA 1X7IA 5MHBA 1VEOA 4Z0JA 3MA8A 1J4EA 1K8CA 3V0SA 1DJHA 4TO8A 4XV0A 3UY8A 2XWEA 3LBMA 2DW6A 2V38A 2W6RA 1Q2SA 3IS4A 1RJRA 2QDDA 2FLIA 3LZ3A 1KBKA 3RILA 2NT1A 3W23A 4PCPA 4E2OA 1FWSA 2PRLA 3GB6A 1A5KC 1PYFA 3L4YA 3GDLA 3JVAA 2RAGA 1E9LA 5D05A 3M0LA 3KS6A 2HVNA 4F0LA 1OWQA 3LRKA 3EB3A 3LERA 1UHVA 3S0CA 5CPQA 3P6LA 5EGRA 1VRXA 4R3UA 4ZXOA 5KZDA 1EJXC 3A23A 4QDPA 1SJBA 2ISSA 1D9EA 2HRWA 1VD6A 3K1DA 2CZEA 2Z24A 4A2RA 3MI3A 4I3GA 4CNPA 1GJWA 3CHEA 3ZVHA 5T9BG 4QLLA 1WZMA 2ZOXA 4LXFA 3QFWA 1R2SA 3WFZA 1S39A 3IARA 1IGWA 3ITYA 4AB4A 4PTXA 3UA3A 2DZVA 2HWGA 1MUWA 3SCOA 3TJ4A 1BEUA 4UOJA 3GVQA 5EL1A 4KKXA 1QNQA 3PZ9A 4TOQA 3AYVA 1IWBA 5BMXA 4GIRA 5CC3A 5FEZA 4US5D 1LOLA 4EPEC 4UR8A 1W5OA 3TP4A 1Z3NA 2WSRA 2AKMA 3U5YA 3DC8A 1CLKA 2F38A 1K6AA 2G95A 1SSDA 1E71M 1PX3A 3HPSA 3WY1A 1MZHA 4RW5A 3S2NA 4L9ZA 2V0TA 2RDUA 5A8PA 4AZCB 4Q6XA 1TVNA 4RE4A 5LNUA 4O12A 2QPUA 2DSWA 3QY6A 5D30A 1QVBA 1DHPA 3SCTA 3BQ6A 3GXFA 4XKMA 3RGTA 1TB3A 5IM51 3HTWA 4OIFA 5U4NA 3V16A 5EB8A 3UQNA 3RMEA 4HOXA 1VENA 4L4MA 3BPWA 4XK2A 5CBJA 1ONEA 1OGSA 1GTHA 1IEXA 2CWNA 1PVNA 1YW1A 1BTCA 3M5YA 2FH6A 4RDWA 3ARZA 5DT5A 5D02A 3HURA 2J9ZA 3NZGA 4XG1A 5BXTA 1QI5A 1DQXA 4Z2JA 2GLKA 1YMYA 4C5YA 3MUXA 3W83A 4FK9A 2VJXA 2GDQA 3KBMA 1P6CA 3B9DA 1Q6EA 3N3TA 1P0BA 4MAVA 3LPPA 3PHAA 2RJGA 4AZBA 4BZYA 1QNRA 3REQB 4OOUA 1ZPTA 4CGTA 4IQLA 2BGQA 3E2RA 1VCVA 1VCGA 3M0IA 2POTA 1JZ7A 1NWSA 5CJNA 1H41A 3K30A 3RX2A 4KWOA 2CHOA 4BQ5A 1JXJA 1SM9A 1B2YA 2OJPA 2O4MA 3WD0A 3LHVA 1R3RA 3O2LA 4P8WA 3ARQA 2X7VA 1NWUA 2GDVA 2C6QA 1JIBA 5LIUX 4D6GA 3TC6A 3PPFA 1IQ8A 3SB0A 1CEOA 4H8VA 4JTLA 4PR4A 2QVNA 2GJXB 3P74A 2GSHA 1SQ7A 1SZNA 3CAQA 2WSKA 3H53A 2JFEX 2QKFA 4JHMA 2YA2A 1X1NA 3GVWA 4TU1A 1NFPA 2IQTA 3IJLA 4PFMA 4NUWA 4GIYA 1QO2A 4GQ0A 3W01A 4C6EA 4C6DA 2XZ9A 4PMXA 4B4FA 1GPWA 3TZNA 3EMQA 3VTRA 1AJZA 3GG0A 4QITA 1MDRA 4X3ZA 1KM6A 1Z9AA 3WK2A 4DAIA 1OZQA 1F5ZA 3SSJA 3B0XA 3HQNA 1GVFA 3PZNA 3QV6A 2ABAA 4B3KA 3EX2A 4JX4A 3QY7A 2C0AA 3K4WA 1IWPA 1KQYA 2OGYA 4C91A 4GI9A 3R0DA 3VIMA 4AWSA 3MP5A 1TMQA 3AXKA 2O56A 2VDIA 2E0PA 1L2UA 4MLJA 3B0PA 1ZP3A 3H7VA 4LC8A 3UWVA 4X0NA 3P61A 4YTTA 2AMXA 3UYCA 2GPTA 3NEHA 1KXQA 3GFZA 1F7BA 2YDQA 4WY0F 2Y5EA 1DJXA 1TV3A 1GVQA 2YBVA 1IZKA 4H9ZA 1HG3A 3SQLA 5CEWA 3U48A 2HK0A 1WBJA 3LTSA 1VKFA 2PWVA 2OSWA 1BAGA 3H23A 4F9DA 4UZSA 5A6MA 4AMAA 3W37A 3QYQA 4AVNA 1CGWA 2NX1A 3NYZA 3ARSA 2Q01A 1NDWA 3B05A 3F4WA 5FL1A 3DBPA 3A13A 1PV8A 1E1EA 4FX8A 4Z1CA 2PDMA 3F5KA 1UR3M 1XDLA 3WELA 1K8YA 4TXEA 1KGUA 3NQBA 3CM4A 3TROA 3LTYA 1ZRQA 3APTA 4S3CA 4GIAA 2ZICA 3TW9A 4AC7C 1XYFA 4RLIA 4LUJA 1EBGA 2QHAA 3G77A 1LRTA 4HHMA 2EXOA 4O13A 3NZRA 3UBPC 4FNTA 1R3WA 3OBEA 2G41A 1VPYA 4C6FA 3MSYA 1CPUA 4QRNA 3NSXA 1IXNA 5CLTA 2E8YA 5KEZA 3M43A 1HIZA 2VL4A 3R13A 2GJPA 1ZBVA 3UR5A 4AD5A 2AGKA 4PCSA 1R3YA 5AOUA 1YBQB 2QCHA 2Y85A 2H9AA 1UROA 3T44A 1DL3A 2NSOA 3PZQA 3RPDA 4KERA 1MNSA 2WK2A 3QSTA 4KETA 4QM1A 1ZL1A 4TX8A 1FWFC 1MEIA 1W1A1 5DMMA 1JD7A 1LOQA 4ZXLA 4HNLA 3OLGA 5LHEA 4MTVA 3CQIA 4ZSUA 1ZCOA 2ACSA 5G4EA 4LNCA 3EGJA 3IGXA 4IPIA 1TREA 1PX8A 3AXIA 1B30A 4GX8A 2WVUA 1GORA 2ZZ1A 1TJ2A 3IIVA 1VEPA 4TTUA 3V0UA 2OMAA 1QI4A 4C6OA 3CWOX 3WLTA 3WQ5A 4UBPC 3DHUA 1H7RA 3ONBA 3USZA 3ZLFA 3WBYA 2FPVA 1OC6A 3E2QA 3KVJA 3I65A 3GW0A 1VIWA 1YXCA 4Q8MA 3Q58A 2NVCA 3UJRA 3WJSA 5HBFA 2ZRZA 3BAYA 4M6VA 1WXZA 2YDSA 4PYSA 1DQWA 3TQ0A 3ZVIA 5G2IA 3QTPA 3KX6A 3BSGA 3UG4A 2ZRVA 3ZMRA 3KS5A 4HSHA 3MVTA 3ZVHB 1H3GA 4HN4A 3ES7A 1HJWA 2C1IA 4QHRA 1CXIA 1L9WA 5E0FA 1FHUA 1ML1A 2Z6JA 3WNNA 2FDMA 4DJFA 3CTLA 4DF0A 4MB3A 2FVLA 2OO0A 2J7GA 3ENLA 1R87A 3M4HA 1P5BA 9XIAA 3VNKA 3MI6A 4QE4A 5GPRA 4IPJA 3E0WA 1XBVA 3GQYA 2PI6A 1VB9A 3KAOA 1JF5A 2D3LA 3WMCA 5BWAA 4ORIA 2P1FA 4K38A 3M47A 1ICSA 3FJNA 3ZLGA 2CPUA 4PFHA 4BY3A 3M1ZA 1S38A 3W7PA 2PDWA 1JULA 1XLAA 3CZJA 3W73A 2TSYA 2IPFA 2ISWA 5GVJA 4GFSA 5LA1A 3BMVA 3SRHA 1LL6A 5REQB 4FNUA 3S1WA 2DSUA 3ARYA 1V03A 1D7FA 4KH2A 3E38A 2R9RA 3IJ7A 4UTIA 3CAWA 4A29A 3VO0A 1OABA 1FWCC 1H11A 3AZTA 1V08A 4OWGA 4BK9A 3S5YA 5G1YA 2HVMA 4EXBA 3NJ3A 4TVDA 2D22A 1FXQA 1KGWA 2C0HA 2YFNA 1KW1A 3R8HA 4M6PA 5G5IA 4X0VA 2WNQA 3CC1A 2ZZ6A 4RX0A 1RY0A 4U10A 2YCLB 1D3CA 1QBBA 2RUSA 1QCWA 3O06A 2H9AB 4M7SA 1PTDA 1ENUA 5CKSA 2GK1A 1YX1A 5FSEC 5ECVA 1KFWA 3FW6A 5FF4A 3HMJG 5CJ5A 1KNWA 1MXDA 2CLLA 3QM3A 3CQHA 5HR7A 2JKEA 2V5KA 5I23A 2ZRYA 3AISA 1G01A 1Q13A 1XLFA 3Q45A 1D3GA 1FFQA 1Q4NX 3RHGA 1GHSA 4DO5A 3U5UA 2E77A 5E6ZA 2OZTA 1YTEA 3CJPA 2L5HA 3LCHA 2YZRA 1I0BA 2FMOA 4DUWA 2DUAA 3ANVA 1NTHA 1IXOA 3NWRA 3PY2A 3GTIA 3RG6A 2YBUA 4R33A 3EX1A 1JJKA 3WUBA 3JW7A 4E8GA 3G1VA 1GVOA 1U30A 4XZNX 2ZZ2A 3CTTA 2FMNA 5EYWA 7ODCA 3KBSA 3VDGA 2DDXA 1GQIA 3GTNA 1PJ9A 5CH9A 2YW4A 1TPDA 2OEJA 3AMGA 3TWBA 3N9SA 3UG3A 6A3HA 3N1AA 2F7FA 1OT2A 3MUIA 1I0DA 4I9TA 4EXAA 4H83A 3L0NA 4HGXA 3MV01 5C2XA 1V3JA 4GNJA 2JGQA 4JTEA 4AX7A 1VFTA 1UR4A 2FZ9A 3VOHA 4DF1A 1I6NA 1E6ZA 1WUFA 2E9LA 3MS8A 3RCYA 1B57A 3NGFA 1CZ1A 1XLEA 2JGYA 5I6SA 4PC8A 4W9TA 1AL8A 3LLFA 5RUBA 3TOPA 3UJ2A 1YLVA 1EDGA 1FWNA 4U28A 2BV9A 3B9AA 3HMCA 2VQUA 4XO6A 1GKQA 1XH0A 5AHFA 4YTRA 4AIBA 5CSRA 1B54A 5J8LA 2BB0A 3DFOA 4K8HA 2CWXA 2FH8A 2A5HA 2DZSA 3BGJA 3LRLA 4B5UA 2GOKA 5FA5A 2HXTA 1DJGA 3OYZA 4ZODA 4NX0A 5LIXX 4IP5A 4CN6A 1M9HA 2EG6A 3ITLA 5FJIA 3T78A 1XIHA 3FFSA 3AU2A 4LU0A 2BGNE 4GINA 4LALA 3NOYA 3AS2A 2DUXA 2EKGA 2HDJA 3OA3A 1OFAA 3SCUA 4NJHA 1A3XA 4RZBA 1TJRA 2P50A 2DVXA 2AMGA 4ML4A 4XD6A 3W70A 4E5TA 5JXQA 2YLAA 3DGBA 5HMDA 5HNUA 4PCTA 2Y24A 4Z2HA 5D9MA 3GNDA 3BO9A 2GJXA 3I4KA 2DIKA 3LV6A 2A3EA 3G0XA 4AUBA 1PE1A 4JXCA 3UWEA 3C61A 3TNBA 3ZYZA 3STGA 3WQOA 3POCA 2D2GA 2Y8UA 2VGBA 3TAKA 4F66A 3EA3A 4FI4A 3BLOA 4Y9NA 1FWHC 2CLKA 4A35A 1FRBA 3UCCA 2GJRA 4FA3A 2UY2A 3A64A 4D6CA 3VNDA 4ZB5A 1TWSA 3WBWA 5HJYA 4WLCA 4RV8A 4GFIA 3PJUA 4FX7A 1LLZA 5DBTA 5LSMA 2BVWA 3VC6A 4O1CA 5JBEA 3N2MA 1EYEA 1F4HA 3MMUA 2Q3OA 1PHQA 4WDUA 4JTCA 1SO6A 2AAAA 1W1PA 4N0RA 3MDWA 1PKMA 2XIQA 3FDGA 3HQ1A 4XZMX 5E9AA 2PDYA 3LB0A 3SI9A 1UR0A 4ZENA 3B0YA 1RSCA 2INEA 2WVVB 4AEEA 3W7QA 5EKYA 3OLEA 1OFOA 2XIIA 5HJLA 1UOKA 4IIHA 3DFHA 2VR4A 1EL3A 1TPWA 4DBSA 5GNZA 1TVPA 5CPLA 2Z1VA 3UPBA 4AQLA 1KRAC 2F61A 3G2GA 3V4BA 3O63A 1DIDA 2VYOA 1BPLB 2Y7DA 4S3FA 3MJYA 2PDFA 3KTCA 4UFHA 1EJSC 5A8OA 5GJMA 1V3HA 4Z1YA 4DNMA 4YYFA 1QK2A 1ESWA 1KBBA 3A9IA 1CXKA 2QUUA 3A3XA 3BCJA 2PB1A 4GQQA 4A3RA 1ME9A 3P2VA 6XIAA 5C2CA 4MJMA 8XIAA 2QVHA 3GBEA 1ODUA 5I3KA 5KTLA 2O4QA 3AIUA 2QJHA 1PWMA 5F2GA 1W9PA 3MTWA 1I9CB 3WLHA 3MY9A 2UY4A 4C60A 3TTEA 4GQGA 4XZBA 4AVOA 3HGSA 2HTMA 3BAKA 1BG4A 4D8LA 3IV8A 4HCDA 3TDFA 5BOEA 1Q6FA 4FOKA 4YVVA 3E2VA 1XCWA 4H9XA 1E0UA 3VIGA 3WDRA 3B8VA 1G1YA 1NVMA 2CLMA 4HMNA 4I9JA 1VFUA 4LF1A 4ATLA 4GGHA 4NAFB 4REQA 5A2BA 4D72A 3EA1A 4B5WA 3COTA 4AWEA 3WF4A 3DFPA 3NQAA 3RRAA 1MW3A 3GR8A 4WIWA 3ZJ8A 2DY3A 3QXBA 3MANA 2PF0A 3W71A 5K4ZA 1R6WA 2AKZA 9CGTA 2Z7KA 4O1FA 4U31A 1OK6A 5T8GA 5A6SA 2XHYA 4GQBA 1XLCA 1A5CA 1UZDA 2UY5A 3TK7A 2DQWA 3UWUA 1I60A 3N6JA 2VFGA 4V2XA 1A5SA 3KHJA 1HKKA 4KF1A 2BASA 1EJTC 4MJ4A 2C79A 4H6KA 4D6HA 4P8VA 4JL1A 4AZ6A 4CQAA 1HO4A 4KWVA 1KO0A 3DFSA 3S4TA 4HPHA 4GPNA 5AC4A 3DXIA 4HPNA 2I9UA 2FIQA 2D73A 4FR1A 4GH1A 3O0FA 3CIXA 4IJCA 1IIGA 3FGCB 4ES4A 1X1ZA 2G3FA 3DGRA 4JEJA 2Q3RA 2WVVA 4KCWA 3CIWA 4F8XA 4DELA 3PJWA 3GHUA 4EPKA 3W2MA 4N6FA 4IOTA 1K9DA 2PWDA 3L2LA 1J11A 2QEZA 1JUEA 1SJDA 3W24A 3RJYA 4B2DA 2I5IA 1ZU8A 2WHJA 2WZIA 1IZCA 3G1XA 3ZWTA 1QW9A 1W3LA 4PMUA 2EPHA 1OYBA 2ZUNA 3T6CA 3F4DA 1DJZA 2DT3A 3OOQA 2IQ0A 2YX0A 2MUCA 2QLYA 1V6WA 4ZQNA 3EKLA 4EPBC 4B5SA 1DQUA 3W84A 4V28A 1Q85A 3ITOA 2HPMA 3T4WA 4Q8TA 4JX6A 5FD0A 4O53A 3U2CA 3IGUA 3UPWA 1E9ZB 5C9RA 1U1HA 3U57A 3IJIA 1K7EA 5BW6A 2BVDA 3UA4A 4GZJA 2R1PA 3FYOA 4JBRA 3P81A 2W63A 2Y7EA 4LAOA 2NV1A 4PBGA 1FVPA 5M17A 1KQZA 4UQDA 3U9IA 4U3CA 4H00A 5CGMA 5G1TA 1RY8A 2HEJA 1UBPC 3TVAA 3S1VA 1S5MA 4I9MA 2VWSA 4V1YA 2F2KA 1EQCA 1FDZA 3SZ8A 1S2AA 1QPRA 3L23A 4HNUA 2HBVA 1XI3A 4KFOA 1WX0A 4L5ZA 1MEWA 2GQ8A 3WLIA 1ZSXA 3VZZA 4RDVA 5IFPA 4LYQA 1EEXA 3AROA 7TIMA 4UXDA 4RUBA 4UOQA 1PX4A 1BWVA 3AHVA 3NIYA 4MY9A 1LDCA 3BDKA 5CAKA 1DEDA 1QI3A 2VRKA 1K77A 1KFEA 5AYIA 4C6KA 1CWYA 5J04A 2EBNA 2GVYA 2QCNA 3NQMA 1OFPA 4JICA 3VDHA 4YN5A 1BVNP 5E70A 1HVXA 4RZ5A 4A8RA 3FX4A 4GY1A 3UZYA 4FLSA 3CK5A 4W88A 1E3XA 2CLEA 4LS2A 1JG9A 3AS3A 1EBHA 1FWDC 5IBXA 1S3HA 3VM5A 3BUVA 2NXHA 3W2UA 2GGGA 1KCLA 3DFTA 3EBVA 4PBFA 3NQFA 4WSKA 2WPGA 4MOZA 3B04A 4X2RA 3CV7A 4NZ1A 3ATZA 3T0AA 4ZO9A 4JTUA 3AJ7A 3MU7A 1ZBWA 5FEXA 3MHUA 3IJDA 1UJPA 1UC4A 4R34A 2IMRA 4F0KA 5KETA 2ZDRA 2XN0A 4KPLA 3R89A 3GUWA 3THDA 1UIOA 1EP1A 1MQRA 4YHGA 2BDQA 2PBOA 3AS1A 4PTVA 9XIMA 1UKOA 5TD4A 4YTUA 2OSXA 5C6MA 1HJUA 4R9OA 1SW3A 1DWJM 1TZ9A 4F2TA 3LGGA 1LL4A 3S83A 2PD5A 2Z29A 4K8EA 1YDNA 4DM2A 2CCRA 4M6QA 5FAJA 4IMFA 1UWTA 2HXUA 4GUIA 3KEHA 3TW7A 3P5ZA 1REQA 4N9DA 5CC6A 1EZ2A 5IHSA 4KGLA 5I78A 1X6UA 1BVZA 4IQJA 3EPOA 3L65A 2IPJA 4QSFA 5D2YA 2GVJA 4JNYA 3ICJA 1KXTA 4IFKB 2NXIA 3FV9A 1V79A 3LGDA 5C7HA 1E9YB 1XUUA 4CNOA 3R8GA 3BV7A 2GFTA 3GAKA 1VQTA 3G8EA 1PCWA 2P8BA 5I02A 2WSYA 2Z1XA 1GJUA 1J6OA 1XGEA 1TA3A 3HN3A 1BHGA 3SADA 4AXNA 3N34A 2GQ3A 4KEUA 5F2LA 4RL3A 2H6RA 3EOUA 3OG3A 3ZWSA 2XH0A 1OFRA 2D2HA 1CB2A 2OWCA 4IMAA 4NAEA 3H4GA 5GJNA 5DY3A 1PYMA 3OO2A 1TPFA 1BF6A 1LUCA 3MUY1 2XM2A 5I3JA 2CETA 5DANA 4ZR8A 1YE6A 3G1FA 1F4AA 1ZNNA 2QIWA 3FNDA 5HK4A 3UG5A 3CUGA 4JTTA 1OX4B 4E2BA 3WQWA 4QSHA 1F73A 4HPXA 1E5JA 2ANUA 3U2ZA 1NOUA 3WK1A 2WKJA 4CLMA 3RX4A 1A5LC 4F0MA 2PWGA 3FAWA 3EYPA 3PB2A 4P2VA 1OY0A 1C8XA 3XIMA 4RV3A 3PSVA 1MEHA 2X0YA 1LRQA 4M24A 2CYGA 4V33A 4UTJA 1LUCB 3UVAA 3WEZA 3C2VA 4NHVA 1QNSA 1GKPA 2YCKX 4AIOA 1IR1A 1GQLA 2WMKA 1EJUC 3OEXA 4YWSA 2QAFA 1L8NA 3RLVA 1SMAA 2ISFA 3E0VA 2IPWA 1JDFA 3TONA 2VDHA 1IR2A 4LAMA 4ACZA 2JIEA 4PTMA 3WQVA 4H8NA 4HU4A 1PZ0A 4J4KA 5JIWA 3IJ8A 1JF6A 4WK9A 4BJHA 4W8AA 2CZFA 5EY5A 1PB0A 3W22A 1M04A 1EHAA 3CB3A 3KLLA 2XFWA 5CBBA 1C91A 1XGDA 2J25A 2VFEA 1NQ6A 3GG1A 1WCGA 1OK4A 4HTYA 1NF7A 1RQEA 2CXEA 1TUFA 5DRCA 3BC9A 4FXSA 3TKFA 2WV8A 1LJYA 4NY2A 2F6KA 3VILA 4U5KA 2X30A 4GYJA 5I2UA 4DX3A 4LCQA 1LOSA 4XZWA 4ICMA 4OT7A 1BQGA 3ONCA 4N7QA 1JYNA 1OFQA 3BWWA 3I7RA 4NNBA 3UWZA 1EPVA 1JD9A 4KWUA 3KBVA 3PF3A 3CYJA 2Y7GA 3R6IA 4GY0A 5C7VA 1D8WA 2VDGA 3UW6A 5TIMA 1XRTA 1R7OA 2OODA 5A3HA 3NPWA 1Q66A 3S3GA 2V2DA 3D5HA 1FWTA 2VUYA 3HF3A 2Y5SA 1S1PA 3LNPA 3TYDA 2ZWYA 4MG4A 2A3AA 4O4WA 4KWWA 1OBAA 3DIPA 1JRCA 5HATA 3A4JA 4N9BA 3LA4A 2XUCA 2YA1A 3NM1A 2CIPA 1VS1A 4NZJA 4PUNA 1AVAA 1QPOA 5C5YA 3VIKA 3N15A 4UFJA 2VGIA 2DUZA 2XVPA 1Q63A 1RH9A 3IVTA 4GWEA 4QJ5B 1OCBA 1OQFA 5H8UA 2D0HA 3GNXA 4JIIX 4LVAA 1XL9A 4QDMA 5EFDA 3MYOA 3BLPX 1FUYA 1G4PA 5A69A 4DVOA 4A4AA 1P43A 3VIJA 1VRDA 4YLWA 4ERIA 1UD2A 3BZJA 5BXRA 5DMNA 4MMWA 4CN4A 4JR5A 2HZGA 4WXZA 3VFCA 4UOZA 2G0WA 1K7XA 1FDJA 3MCNA 4K8GA 3MP4A 2PDHA 3TYBA 5A2AA 2YA0A 2I9EA 3V0TA 5CSUA 1OC5A 4B2DD 5HWNA 4JFUA 1IZJA 4NIRA 2D2OA 4LFYA 1VFSA 2WHLA 5FCZA 4N4PA 3H2EA 4CQCA 5FAGA 3GLCA 4PCFA 1MI3A 1PCKA 4EF9A 2DP3A 4AY1A 4J5NA 4BWLA 4BCEA 1D7KA 4WOQA 1W3TA 4NASA 1NSJA 4PB4A 1B1YA 5I3IA 4XAGA 3TUUA 4U33A 1PEZA 7ENLA 3SAZA 2LLEA 5ABFB 1SJCA 1LQ0A 3OIXA 2CHNA 1ISWA 3P60A 1KM1A 3MSDA 2CBUA 1ADDA 5E9XA 4KIRA 3MSRA 2REQB 1J0HA 3W76A 3CUJA 4C6JA 2PODA 1KM4A 1VGAA 4NI3A 2QCCA 2GZXA 1OHLA 3L7RA 3USBA 1SW0A 3IWPA 3LLDA 5C0QA 4QROA 5E6YA 2FFCA 3LV5A 4LEFA 3F4VA 3DHFA 4WJEA 4TMBA 2C16A 2SFPA 4AU0A 1VPXA 1HKVA 1K8ZA 3A4AA 1H1ZA 2NT0A 4ZOEA 4WKAA 1QOXA 4IIBA 4WD0A 2G37A 4XQ6A 5D9NA 2DSVA 1UWUA 4G1NA 3L5MA 1QNPA 3UEQA 3W6MA 1Q4WA 1QNVA 5JBFA 3D3FA 4EAMA 1W9VA 3GFXA 5DCEA 3VK5A 1RJQA 1VYSX 3VOFA 2NX9A 3CAVA 3WDIA 1GCYA 1HJVA 4MKSA 3K8KA 3FA3A 4ZQPA 1HL9A 1RK6A 3SQMA 3KCOA 3NOEA 3GC5A 3A4WA 3DESA 3ZM8A 1E3ZA 3VNJA 1G69A 1W9DM 3PPCA 1GQJA 1VP5A 3OA5A 3W75A 3MMDA 3M6YA 2WMFA 3GXTA 4LCSA 3VIFA 3B9OA 1M5WA 2GWGA 5F1VA 2VO5A 3BURA 1C8QA 2WZHA 1BD0A 1JCLA 1UBSA 2FTYA 3NURA 2QDGA 3K5XA 2FGLA 2FZ8A 1UWSA 3I6RA 3NFUA 4ZO8A 4HCLA 3BLFA 3LCIA 4W4QA 2VCCA 2JBMA 3BOXA 1FTXA 4JYEA 3QQ0A 4M51A 4TX9A 5M2FX 4HYVA 4HU8A 1FWGC 3VNYA 5EMKA 4GUGA 3VKJA 1HL8A 4DWSA 1MW0A 5D09A 3ECQA 3CT7A 4K6AA 2OQHA 4ZO7A 2QCGA 2Y88A 5BRBA 4Y9AA 3PNZA 1TX0A 5BCAA 2VHLA 3EXRA 3GKFA 5I03A 1VEMA 1AQHA 3OHIA 3CMFA 4H2HA 4IF2A 1SYTA 3BJTA 3QQWA 4LB3A 1B3VA 3GKAA 3ANUA 5D38A 2NW0A 2CW6A 3FXYA 2PPGA 3KRBA 2X16A 2V3FA 3NDOA 4PMDA 4NYUA 3RX3A 1JFXA 4K68A 3IIOA 2QV5A 4I8YA 2QJMA 3GDTA 4FLOA 4Z17A 1Y65A 4TUFA 3OBAA 4YJ5A 3OB8A 1B31A 1AD1A 4UTHA 1KM3A 3KOWA 3SIMA 2YFOA 3U4FA 5H8PA 3QR1A 4CCDA 4DJEA 2NQ5A 4A05A 3UZJA 4AW7A 3AXHA 2VI0A 3PG8A 4QBXA 3TXVA 3KZPA 1C3FA 3PBGA 3HG5A 4JTAA 4KFPA 1RCQA 5M03A 4R85A 2ZUMA 1QMLA 2OCZA 2QMKA 3G1HA 4ADUA 4UQCA 4DF2A 4P7OA 3SCSA 2OO6A 4OVXA 2ZX5A 5IDIA 4BF7A 1UZ1A 4AWTA 1F2JA 2WLYA 4UTWC 3AQUA 4R27A 4J7RA 4ZOCA 2B7PA 2V3GA 3BG9A 1O68A 4MADA 1X6LA 2QR6A 2OB3A 1DPMA 5U7SA 3NCOA 1KBLA 2XVKA 1V7AA 1SR9A 2QCMA 1EA0A 5H91A 2VVSA 5EMUA 1H0GA 1B9ZA 4JQ1A 1YBQA 3T81A 1U83A 3HQPA 1SFLA 4K1WA 3S9ZA 3U6WA 4O28A 3PSWA 2YSWA 3PUOA 1MYRA 4RDYA 3H2MA 1KV8A 4DI8A 1JGIA 2C1GA 2J9XA 3PANA 2YKKA 1VJIA 1PUDA 2Y0FA 2I7GA 4IMDA 4JN6A 4DPPA 4Q4MA 3UCDA 3U0HA 1LROA 3M64A 4LWWA 3ITVA 3N6QA 3S2MA 4YS1A 4WDXA 4DWSB 4MNLA 4MHBA 2Y2WA 1BWKA 4S2BA 4GUFA 2C7FA 4OV9A 4YTQA 2V6AA 3VUPA 4BS0A 3VKDA 3TFXA 1E4NA 2WPBA 4DN1A 1S2CA 2EQDA 3GVGA 1BKSA 3M0YA 3MKCA 2WXDM 3HV9A 2OEMA 1XGZA 2YYTA 4DEFA 4UTTA 3KOXA 3N4EA 3CPRA 3L4XA 4NJIA 2I16A 3T40A 4P8UA 3PB0A 3FSUA 4MDPA 1TV8A 5TNVA 1R9YA 2Q09A 1J93A 1OT1A 3E74A 3HFTA 4QEHA 1AQFA 3QPZA 3VI2A 3LUTA 1ME7A 1QNOA 1V6VA 3QYSA 3OYXA 3WD1A 1WDQA 4UTFA 1DE5A 3GU2A 4IG2A 4Z42C 2ALDA 4KESA 1FP9A 3VAVA 1UQYA 1TKKA 3M07A 2GJNA 2JEQA 2VR2A 4CEXC 4DQWA 4BEQA 1KRBC 1YDYA 4PZVA 2XYLA 4EAYA 3PAJA 4TVCA 4FNSA 3UR7A 1UC5A 3WSUA 1N8IA 5AHLA 4CCEA 3EWZA 4BI5A 4F2UA 3SCWA 3VKAA 2DZAA 3VFLA 1QASA 3UJSA 4ZSTA 5FJTA 3EPNA 3BXWA 3B06A 3GH4A 3LGEA 1SFSA 3TJXA 2PC4A 2Z2BA 1HQTA 1UASA 3TC7A 2IKHA 2VQTA 3FA5A 2Z00A 4ZGYA 1R2TA 4MPKA 3MKKA 1JYVA 2VOMA 3MZ2A 5D32A 1X6NA 4AMCA 2G50A 1Q65A 2A21A 4DM1A 4H9TA 1M7OA 3BAWA 3CBWA 1NIUA 1ZBKA 1P0KA 3PS7A 4NRRA 3RM9A 2P0OA 1K4GA 3WH6A 2PGWA 5A6JA 4C7FA 5C71A 1OYAA 1IIHA 3P93A 3M0VA 4U5IA 4JTGA 1RQHA 5AN7A 3UXDA 3GXDA 1NAL1 5I09A 1O12A 3AXMA 4F40A 3M7SA 4MZ8A 5ENLA 3FVMA 3WENA 4HOZA 3FYYA 2QJJA 1IXQA 2PMQA 1VBUA 3CO8A 1T7LA 1YKWA 4U2YA 3LTPA 3HGRA 4BR1A 1QHOA 4L1XA 1M03A 1MSSA 1XSJA 4JCMA 2ACUA 2O55A 2FTPA 3L5AA 1V02A 3S9YA 2P10A 1HGWA 5G4HC 3IACA 5H2ZA 2CBVA 4E3VA 2VX7A 4J3XA 3EXSA 1T41A 2E5CA 1XLKA 1K6WA 3LSBA 3CUFA 4G7FA 3S2CA 4BWLC 5CAHA 1DWGM 4JTJA 2X40A 2WCSA 3MMWA 3REQA 2G4FA 2V30A 3QW3A 1EC9A 2XPKA 4HJWA 1F3XA 1AH0A 3KL3A 2AL2A 3ITTA 1TSIA 3E0LA 4BF5A 4ZEPA 3FJLA 3OGSA 5C9WA 2OZ3A 2R14A 3UXAA 1H7PA 4XAPA 3DC0A 1JNEA 1K9EA 2PS2A 5A6KA 4FO4A 4AY7A 1X98A 1AW5A 3UZ5A 5FF7A 4HPGA 4M3PA 3P0WA 5J5RA 4LOCA 2V68A 1YNPA 2BVYA 2VTFA 3N2XA 2W4XA 3BGGA 4MUZA 2H8XA 1YPIA 4O17A 4ROPA 1K4HA 3QRHA 4W89A 4ZQCA 1F3EA 2PU1A 2PTYA 4YL2A 4IIEA 4L9XA 4N42A 5KZMA 4RXFA 4MB4A 5AZ1A 3ZLHA 2XU2A 5E0KA 5FI8A 3P62A 4GBUA 4WXYA 1QI0A 1E72M 1OC7A 3L4UA 4QDWA 4S3EA 5D2XA 1GVRA 3AMDA 4GCXA 1LYXA 3MO4A 2INFA 4DO6A 2BHZA 2BMBA 2NVDA 5G2WA 3P67A 3P80A 3GDMA 3WLKX 1I1XA 1CX9A 1H09A 2ZX6A 3WQ8A 1KLZA 1EHNA 2VFHA 4AYSA 1G0CA 2XH4A 4D6EA 3K46A 4A3HA 1TWWA 3EX6A 4I5RA 1WA3A 3A6OA 4Y7EA 3GR4A 2EG8A 4LVDA 1JZ2A 3CZ8A 4CU7A 4NZ4A 3S6DA 3DG7A 4L4PA 2FVKA 4E8DA 5A1AA 2QAPA 2E25A 3PM6A 1RLCL 4NNCA 2Y6ZA 1IT7A 3QV8A 3EX4A 4NXSA 1H61A 5FF3A 3GY1A 2NV9A 4B3LA 2A0NA 4GKTA 2WW5A 4MYAA 1HNYA 3GBDA 4JNMA 3TA9A 2Z0IA 1UG6A 3QOKA 1QR7A 2AL1A 1CB7B 3ABQA 2BX7A 2ZXQA 3NA8A 4Y9PA 3GU1A 5D04C 4QG6A 1BVWA 1ZFJA 2G3MA 3CMGA 4FOUA 3GWQA 4EK7A 2EJ1A 3B97A 1XCXA 1PBGA 2E09A 3W7JA 2ZTJA 1EJWC 3HGOA 1V7YA 3RU6A 1BFNA 3WL1A 2PD9A 2D20A 4LUYA 3P3BA 4Z2LA 3QPEA 3UT0A 1QOQA 5FKYA 5I77A 1XISA 4DY1A 3QPYA 3AZSA 3WLJA 2NZLA 3N11A 4IIFA 1ITQA 4IT1A 3ZO9A 1X38A 4B92A 4Z08A 4DO4A 1P0NA 2R1NA 4ZMGA 5KZEA 1HGYA 1T96A 7REQB 2ZADA 3S1GA 2QYGA 4Q4RA 4NT0A 1JAEA 5AVNA 1DXEA 4HMDA 4PMZA 5ABEA 5FF0A 4HNOA 1HKIA 1J0JA 2V69A 3QQ1A 1RQBA 2VFDA 2WC4A 4JYFA 2A7NA 2JIWA 1TZZA 4MAZA 1RLDA 2RJHA 1HP4A 3AJXA 1J0ZA 4B91A 3KL5A 2Z25A 4HK6A 3RITA 2G8ZA 2FHBA 3OZPA 3RRXA 3P7YA 4JEQA 4D6FA 2E1DA 2WJZA 2J13A 2NQHA 2YXOA 1ZY9A 3VCNA 3UJEA 1ONWA 3I3BA 3CZEA 3NSNA 1Q6QA 4DWSD 2AL2B 1WKDA 1BQCA 1JPMA 1RBAA 2VEGA 3P5YA 1H1NA 1Q7MA 1UYQA 4H4IA 1Q2RA 4LAKA 1JQXA 5F2MA 2OU4A 1E6NA 3LCGA 1P0EA 2XSXA 3MHGA 1TA3B 3J7HA 2TAAA 4DBDA 3HU7A 3B8DA 4P7QA 4RR4A 2PLMA 3CIVA 4M8UA 2CLIA 3PBWA 5BXSA 3T42A 3SGZA 1DIEA 1G7VA 3B8WA 3LX9A 4I7VA 4XBKA 4IMGA 4N02A 1EWEA 4JFSA 4GUJA 4L1GA 2JQXA 3TFCA 2PDXA 5CPTA 1IWAA 4LBSA 4ROQA 1RA0A 1JPHA 5AYBA 3VD7A 4O8AA 4WRHA 3TA6A 4JS3A 2CEQA 2J8FA 4GXWA 4S23A 1XW8A 4GIEA 4DAFA 1TCMA 2WZMA 3D47A 1H4PA 1PWLA 1W3HA 2D0FA 1W1ZA 1CXHA 5FJPA 1FH7A 1YIXA 3MQTA 1XH2A 1UJQA 1TV4A 1EH9A 3ME3A 1S2TA 4XZIA 1UH4A 1WYIA 3BLIA 1UP3A 1AA1B 3W1QA 1J5TA 1TX2A 3CEUA 2Z1SA 1HZYA 3QMRA 2YXGA 4GI6A 2E5BA 4AAJA 3W7KA 3BJSA 1E0XA 1TE1A 4WY0A 3DHDA 2EO7A 4OTKA 2X1RA 1Z48A 5CC5A 7TAAA 2DT1A 4ML9A 2EF9A 2DIEA 3DYMA 4ASTA 4L1WA 3AMLA 3VD9A 1FCUA 3FLUA 4M6UA 3UY7A 1JCXA 1FX6A 5EMJA 1G94A 4FNQA 4C6QA 3PP7A 3UJFA 4QIUA 2J66A 4IX2A 1HKMA 3AHZA 3CHFA 4QGCA 1YPXA 3FN9A 1GW9A 1PDYA 4QJ3B 3M0KA 4US5A 3JZEA 1A47A 1ECQA 2E6FA 1WDRA 4ZOBA 4GJ1A 1IEQA 1WZAA 1JZ4A 3RLUA 5D33A 3NVTA 4ZTYA 4L4LA 3SY8A 2WSQA 1OF8A 4PRRA 3EWBX 2OT1A 3DU0A 3SM0A 4S3GA 3WFLA 1XIEA 1GW1A 4Y96A 1XV8A 3L12A 4QLKA 2ZWZA 1A0EA 1XHGA 3B8IA 3AIEA 5C2GA 4XKYB 5D4YA 2WANA 3TEVA 3BG3A 1GYMA 5E93A 4YYCA 1UKSA 4Q8QA 2ADAA 4GC4A 3RNDA 4AHPA 3O6DA 4NG3A 2VEPA 4HYRA 1O6IA 4PEEA 4LBRA 3VUSA 4W5UA 3FKRA 3FY1A 3NL6A 2J7CA 5HMEA 1PKYA 4DJFC 1SZEA 4JFWA 3KBJA 3T2PA 3W87A 3HOJA 3C4UA 4QISA 4AZHA 5AC5A 1QW7A 3PWGA 5ABTA 3NM3A 2J77A 5FJRA 2VZOA 4C65A 3QHNA 3CWNA 3DG6A 4H7VA 5IXEA 3TMLA 1RP8A 3V18A 3K8LA 3O16A 4HMCA 2GGIA 5CZTA 4EKJA 3CZLA 2TPSA 1CGTA 3MCMA 4JY9A 4DLFA 1S3TC 1I2RA 1W5QA 1GKRA 1PTAA 4WY0B 4W7VA 1TTPA 1EXBA 3R0KA 4HP5A 4GD0A 1XLMA 3BW3A 2ZQ0A 4AH7A 3C0SA 4UNKA 3IIXA 5FF2A 4PL2A 2ACQA 2PDQA 2ZX7A 4HZ7A 4PODA 4L6HA 1L6WA 2QF8A 2A7RA 2EPKX 1GG0A 1S2UA 2HK1A 4PMNA 4M5PA 3TH6A 3OTRA 1ZUAX 3DEQA 2WCAA 1R3TA 5AZ0A 1R2RA 4G2DA 1F6YA 5DX7A 5L9FA 1OD0A 3G1YA 3B8SA 3K4AA 4JOMA 4E4UA 1PIIA 1S5VA 1FCVA 2FZDA 2XISA 3G6MA 4JQAA 4R7OA 3N2BA 2O92A 4P7RA 3RYSA 3W2LA 3CHDA 2DIJA 2TODA 3LZ5A 4FNPA 4QLJA 4CQDA 4J3WA 4RDZA 1J96A 3NDYA 2NUWA 3O6YX 3W2KA 4JNZA 1V3KA 1VF8A 1XINA 1HW6A 4WJXA 1G67A 3D46A 2CZVA 4C6IA 5BROA 2VWTA 2ZA1A 2OQLA 2I14A 3GYCA 3W1XA 5JMUA 1W1YA 4IQDA 3Q37A 2ASHA 3MI2A 3U3HA 4DJDD 6REQA 1C8VA 3SFKA 4Q4OA 1ELSA 1XRSA 1TUXA 2XSBA 1F8IA 3IK2A 2KAUC 1JVNA 1R3QA 4FPSA 2OFJA 5BWFA 3SURA 4L80A 1UUQA 1CBGA 3DKLA 3AIQA 1JZ3A 3FYPA 1O4UA 2NSXA 5CJMA 5AC6A 3D6NA 5AC8A 4QCEA 3R94A 5JVLA 2V81A 3TMQA 1EA9C 3OQ8A 3RO6A 4JKKA 4TQTA 3LHWA 3S6TA 4GACA 3WBAA 1KKOA 2OELA 1W9UA 4AIUA 2ZDSA 2G5WA 4ATDA 1G7UA 4MNMA 3DDMA 4LX4A 4RPPA 2G3NA 1EOMA 4UTMA 8CGTA 4DO7A 3GD6A 4ERGA 4UTTC 2E3ZA 4M81A 4L4OA 1PIGA 3SDOA 3GR7A 3LXBA 2WJDA 4OOZA 4J3UA 4PUWA 3MPGA 2QF7A 4M56A 1JUBA 1ZS2A 4XTDA 5AFDA 2YYUA 3PWAA 2ZE0A 5D9PA 3PTKA 1XFBA 1TELA 3N6HA 3ITCA 2GGHA 2YJQA 1JR1A 3T0TA 3LBCA 3EMCA 2OWXA 2F84A 1ZENA 3S8HA 4ILSA 1QAPA 4RPQA 4O11A 3APGA 2W9MA 1HUVA 2YBTA 4L65A 2WSPA 4XVEA 1F07A 1RVGA 4RZ6A 3W1PA 1T6MA 4PB3A 1DTUA 4C7GA 3KL0A 4N9CA 4XX6A 2G97A 1R5YA 5I3GA 1UD4A 1ZAIA 2PTDA 2IW0A 1XSKA 3CHVA 3N9RA 1QTWA 3SBFA 1XKYA 1J2WA 3WJYA 4PUMA 5M5DA 3ZXWA 3ISIX 5C70A 2X1SA 1KC7A 3S2JA 3M5VA 1ZTVA 3KRSA 3E0IA 3R79A 2PRHA 3KRUA 4Q8NA 4OZOA 4I5UA 5I79A 3ARPA 4ZBCA 2AQVA 4ADTA 5SWUA 1X7FA 3W1NA 4WHBA 4HNNA 3TX9A 1ICQA 3S5SA 4LEQA 1UKTA 1RHCA 4JD4A 1E4MM 1IEIA 2OYMA 3WBEA 4B16A 1V6YA 3NQVA 4Q8PA 2E28A 3WN6A 1FQ0A 4K2SA 2WHKA 3W7OA 1X1OA 2NWSA 3VGHA 3O07A 3SRDA 1A4LA 1JPDX 3MVIA 2OOFA 5DN1A 1NWTA 5ABFA 4Q7NA 3CUIA 1WV2A 2JF6A 4JQ3A 7CGTA 1XPGA 2PWHA 3W4RA 1JCYA 3ALGA 3W82A 5AYYA 2XM1A 4S3AA 3RXZA 2F9RA 1HJXA 8A3HA 1KM0A 1PZ1A 1UD3A 5T91A 1XRVA 3VDAA 4CVWA 4H01A 4LAZA 4XSLA 1WZLA 2HS8A 5CC7A 4DJFD 3QV9A 4YNGA 4Z1AA 2X1UA 4O8RA 4QJ1A 3TYCA 3CNYA 3SN1A 1R9XA 1NARA 1H7XA 3SRKA 5LIWX 2REQA 3V1PA 4IJRA 4Q7IA 3SCRA 3MC5A 4BA0A 1V02E 1V77A 4JFTA 2W3ZA 4KRTA 1JUKA 4HSNA 1C9WA 1W3KA 3WG6A 3G1RA 2EPNA 4ZCWA 3GTFA 3DZ1A 3N04A 2E9MA 2WQDA 5DT7A 1ZHAA 5B80A 1MZRA 4DZHA 4A8LA 5HANA 4OQVA 5MKGA 2J88A 2WMJA 4AZIA 3QR0A 2DGAA 3RJXA 4FXRA 5HA7A 1LBLA 3WH8A 5H6HA 1RP9A 1EGMA 1RPKA 4QP0A 2Z27A 3O0KA 3PAOA 3QZEA 4MNJA 1XP3A 1VBHA 4A6GA 1NOFA 3JR2A 3R11A 5A6LA 3AYSA 1LLWA 1NFGA 3EDKA 3KCLA 5A8GA 4IM4A 5GNXA 1UR8A 1X8CA 3QZ6A 1YEYA 2RHGA 4U3AA 3BTNA 4W5ZA 1JCTA 4EWND 4OBSA 3KVKA 3SQSA 4A8IA 4L56A 2E40A 3B8TA 4XVDA 2OEKA 5DELA 2RDTA 4ZOAA 3TSMA 4UIOA 3UFYA 3KWSA 1HXJA 2V3DA 5EMMA 1IE7C 2C1HA 2V8ZA 2DU2A 2BHYA 2WNWA 2EPOA 3UF9A 3W7HA 4WR3A 7PTDA 2VEKA 2QNEA 2QCEA 2YB4A 3H55A 3GG8A 5HWJA 1X39A 4IFOA 3W1LA 7A3HA 4CNTA 3OGRA 4LCRA 5KZ6A 1H5VA 2NVAA 3KDOA 5ECUA 1W3IA 2YB1A 3IJ9A 4TV6A 2HCVA 1LTDA 1Q6RA 3VIPA 1Z7AA 4GLEA 3QH2A 3BLLA 4QE5A 2FGZA 4F79A 3W7CA 3YPIA 5CCZA 3T05A 4K36A 4R7WA 4I6VA 1ECEA 5AYZA 3OZMA 3QR3A 5IRPA 2JE8A 3DN5A 3II1A 3ARVA 2PRMA 1Q8AA 1GEQA 1MFVA 1M53A 1KFKA 2JKAA 3WH7A 3UYIA 3B9NA 1BGAA 1EPXA 3EOSA 2P3ZA 3PZMA 2BBFA 1UD8A 2OG9A 5CXPA 4DJED 1EO7A 3GSMA 1SR0A 3WLSA 3LXCA 4S2CA 4URIA 3BG5A 3PFRA 3SSZA 6ENLA 1SO3A 3N17A 1GWJA 4HK7A 1PS9A 3EAUA 1AQMA 1W56A 1XIBA 2J27A 4FX6M 7REQA 1DP0A 3IGSA 4EE9A 3AXXA 1YADA 2XIBA 4C6PA 2J6VA 3GU9A 4YHEA 2X1IA 2GVLA 4GY7A 3VU2A 2XVGA 1HX0A 2QZRA 3M41A 3GYEA 3QOMA 5FJJA 1N8FA 4HA0A 3SCQA 3V1HA 1NH6A 4QNEA 3LHUA 1C7SA 1V0NA 2DH3A 4KCVA 1V4YA 4XBJA 1CDGA 4L6DA 3CLMA 1LG2A 3K1GA 4UC5A 2YXXA 5HXMA 2WB5A 4B5NA 4L9YA 4NVTA 4FR6A 4HU3A 4M0XA 2R91A 3CL6A 1KTNA 3T1GA 5D03A 4EANA 1U5HA 1EUNA 1UH2A 1KB3A 3CV2A 4HA1A 1JDAA 3V36A 4D6IA 1SW7A 4FS9A 3N2TA 3MKVA 5CPSA 1XICA 1XLGA 4AF0B 4WGXA 1Q5MA 5ABGA 3POHA 3EXTA 4C5ZA 2WHMA 4E38A 1EJRC 3DOPA 3UP8A 2B7OA 1LG1A 1DJIA 4HHPA 4H19A 1O5KA 2OQYA 4G8TA 3IANA 3BZGA 3NGJA 3TZFA 4L7ZA 3EA2A 5HJXA 3W7LA 1HO1A 4JTQA 1H49A 1M3UA 1W5PA 2OKTA 1OIMA 4XAFA 2BFGA 3C56A 4KWSA 3M44A 4WKHA 3AMCA 1KM2A 2FKPA 1JL8A 3GX9A 4W7UA 1GJPA 2VRJA 3O7UA 3DBNA 4IFKA 3W26A 2RDXA 3GDRA 3VX0A 2P76A 1H60A 3DX5A 1LF1A 4JTRA 4QNWA 4UR7A 4YIWA 1TR9A 1O1ZA 3THCA 3THUA 1KWGA 4GABA 1J5SA 4IXHA 8TIMA 3UNDA 1GOXA 3STFA 4AD1A 1E73M 4OGZA 1B5TA 1XUZA 4XUGA 3AIVA 2OWWA 2Q71A 1TRIA 1MW1A 3NYDA 3CUHA 3W7DA 2V63A 1E56A 1A5BA 3OVQA 1DVJA 3MHFA 3ATYA 1TCDA 1SGJA 1EB3A 4AG0A 1Y0EA 1F6PA 1H5YA 4O52A 3M5XA 3PTMA 4D8ZA 1TJ0A 4XKYA 1A4MA 4RXGA 1ALDA 4HZMA 3IV3A 3SUUA 5MF5A 1GVSA 1S5TA 1W3JA 2C18A 1R30A 5AC7A 1WZKA 3WQGA 3GS6A 2NLIA 3LK6A 3M0JA 2X8RA 3F1QA 3GO2A 1P7TB 1KGXA 3I3DA 3PZVA 2YL9A 2PZ0A 1NP0A 3NPUA 3GRIA 1F3TA 4I7WA 3VINA 2YLLA 3EOOA 5ABHA 2HNHA 4AY8A 4F0HA 3KCJA 2ZTKA 1OX5A 4ZE4A 3A47A 1S5NA 1SUXA 3R12A 4DJDC 4IIDA 2CU0A 1XIFA 4J9JA 1C8YA 2QUVA 3FJ4A 4PUEA 2PURA 2D3NA 2OYKA 1GYLA 4K3ZA 1YQ2A 2NQLA 3N4AA 3VM7A 4PTNA 4NZFA 2I56A 4AC1X 2Y4SA 2H3BA 4CQBA 1VYPX 3B40A 4DJDA 2DSKA 1RD6A 2W92A 1VYRA 4KGJA 2E68A 4NU7A 1UA3A 4PRTA 2Y62A 4H9YA 2W62A 2YZ5A 1A80A 1THFD 3BAJA 1XYCA 1W32A 2ZUUA 4PSRA 3OQEA 4MWAA 3VIHA 5HWMA 4AYGA 2QW5A 4LRSA 2FZMA 6ALDA 5IBXC 4WX2A 1RVKA 3E3HA 3NL3A 4Y8EA 2QUMA 3NQEA 4E2VA 1O60A 4GC3A 2BY0A 1U1JA 1H7WA 2WC7A 3APYA 3ARXA 3KHDA 5HNRA 1KFCA 4XZ9A 4JQ2A 2QMJA 3BSMA 1TE6A 4YCPA 2B31A 3QMTA 3IAQA 1M41A 4YPJA 3KZSA 1AW2A 4UNIA 2CKSA 2WMIA 3MJMA 2YL6A 4HOWA 3WQFA 4MY8A 4PRWA 3UWWA 2R94A 3AHTA 3MWAA 4K39A 3XISA 4AX6A 3ABZA 1JZ6A 2D24A 2IKIA 4AWUA 2Y89A 2HE5A 3C52A 4MM1A 4EOUA 3LG3A 4HB7A 3IPWA 3TTYA 5LGXA 3NO5A 4Y9MA 4U4MA 3BICA 4Q33A 5AY7A 1GTEA 1ZZMA 1WPCA 1A3WA 2A3BA 1J0YA 2WMIB 4D9PA 2Q8LA 4IP4A 4L64A 4CVUA 5EPDA 2E4TA 1EXPA 5TAOA 3PUEA 4IG2B 4A2SA 4ENLA 4PMRA 2A3LA 1OCQA 3V7PA 2R82A 4HZ8A 2C19A 5HPOA 2YIHA 2O9OA 3HFYA 1QU4A 3D3AA 4KEMA 4AEOA 1WNOA 1PXGA 4Q8VA 3K2GA 1FWBC 1GYNA 5IDZA 3EEGA 3BVJA 1LRNA 1W8GA 4HA3A 1EKOA 3E49A 2X1TA 3G8RA 3KRZA 3O9NA 2ZZ3A 3ZZ1A 2J8TA 3A21A 2PU0A 4KQNA 3O15A 1EIXA 3BOFA 3DECA 4NL1A 3UGRA 2ZZ5A 1QHPA 3S42A 4LY4A 1T8XA 3Q94A 4O0ZA 1I75A 5JIPA 1BWLA 2X0HA 3GXMA 1F74A 1LT7A 5I06A 2QCLA 3H4WA 4TR9A 3BW2A 2IKGA 5B7ZA 1LQAA 2IXUA 1GT8A 1WUEA 1QXLA 1RCXB 2P3EA 3CUXA 1MRQA 1R38A 1GVIA 4UQAA 4LS1A 3WLOA 3CYVA 5FJUA 1F76A 1VBRA 3S47A 2ZCGA 1VFFA 3QZAA 3QGVA 4MWAE 1LLOA 3TLLA 3VOCA 1ISYA 2FZNA 2OLAA 4NJJA 1FFRA 2QGYA 1OX6A 3P8IA 3URQA 2YDAA 3QY8A 2R1LA 4LBUA 2G3IA 3NZQA 4MVAA 1SFTA 1XPYA 3MYPA 3UXIA 3GNRA 4YVPA 3W7IA 3S5ZA 3LCFA 5JUVA 2ZVRA 3HPAA 3KWXA 1NWRA 4Q4QA 2PA6A 4CCZA 3RAOA 3DAQA 3JUGA 1GONA 1Z42A 4HCHA 3T55A 1UPMB 4D1IA 1F61A 1B3OA 2IQDA 1ZB5A 2FGBA 2AOSA 2EHHA 1OG6A 3STCA 2CZDA 4FF5A 4EWJA 2ZXDA 1EJVC 1TPB1 1JEZA 1WP6A 3WK3A 5CPMA 3C0JA 5BU6A 3W3OA 1OIFA 3EKGA 3QSRA 5M1TA 3MW7A 4ACZB 2XG9A 1XWYA 3NQ6A 1XIIA 1WDDA 2FDSA 1VFHA 2WLZA 1PKNA 3GTXA 2PLJA 4MSSA 1X8FA 2O7QA 2CLPA 1US2A 2A79A 3ITGA 4ZE5A 3ABOA 4H9MA 4G9PA 3HA1A 1P0DA 2D1ZA 4ZFCA 3HJEA 1HP5A 4MJ2A 4LUSB 4O1DA 4KRZA 2Y8KA 1XIJA 3JRKA 2HQAA 2GJLA 1FWAC 2TMDA 2VELA 4WGHA 3NZ1A 4J3SA 3RM4A 2GGJA 1MNZA 3L2MA 4LC6A 2JALA 1V0LA 4C1KA 1Z8AA 4PMJA 5D9OA 3UZXA 3M6DA 2V5JA 3N9KA 3B8UA 2DH2A 2WNNA 4GISA 1TZ7A 3LS9A 4JIRA 2ODOA 2AGTA 2PF8A 3BL3A 1A49A 4Q4SA 1RBLA 1M65A 1TVLA 5CGQA 1DWIM 3N4FA 4CNSA 4A3QA 1KD0A 1R46A 2I17A 4KCTA 2H3DA 3C0LA 2BWGA 4ZFMA 1LWIA 4RJEA 4B5TA 1VLWA 1MO0A 5K7JA 1KCKA 4PE8A 3IJQA 1W2PA 1W91A 3AI0A 3VKKA 1E4LA 4DZ5A 3BLEA 1Q3NA 2YL5A 3Q4DA 4O1EA 1IT8A 4WOZA 1EYWA 1KLYA 3PWIA 4I90A 1MDLA 3KVMA 1HJSA 3VKBA 3FKKA 3CV6A 1R0MA 1HT6A 2QDHA 2Y1HA 3VD5A 2HS6A 5EA9A 3BCDA 3CT2A 4IJBA 4LVBA 2FZBA 3BK0A 1XIGA 1QWGA 2W27A 2C15A 3S1XA 5HMFA 2BXZA 1V3IA 3A12A 3UWYA 3G24A 6XIMA 4JAWA 5I5RA 2WAGA 4NI8A 3FHAA 4GVIA 2NX3A 3ZT7A 4QAWA 4Z1BA 3M7WA 2W79A 5FOOA 3SFWA 2NXGA 1REQB 1JPKA 2HMCA 4JTKA 3WIJA 4DXKA 2ATMA 4D2JA 4CD4A 2D23A 2VVNA 3WDQA 3NR0A 2Q8ZA 1CGUA 2BY2A 1BSLA 1W1B1 4R9XA 2QJIA 3URNA 1POJA 3KDNA 3ABXA 4ALDA 4NZ5A 3HQOA 4IPNB 3FXGA 3A4XA 3AS0A 2GUYA 1ONRA 1V8EA 3KP1A 3NXFA 2MNRA 2BOFX 3AO0A 4MB1A 2QS8A 4MDOA 1TRDA 4MWAB 3T9PA 3RO8A 4EXQA 1WDWA 3O3RA 4MJZA 2GSEA 3PBMA 3GK0A 3CMJA 1VH7A 1E4IA 3HB9A 5EMYA 3W1UA 3VZYA 2CXGA 1XBZA 3HV8A 4V15A 5HOSA 4W8LA 4EACA 4O1BA 2DT2A 2BLEA 3M0MA 5EBUA 4INFA 1UOZA 2ESCA 3SCNA 3N2CA 3AIRA 1HJQA 3G1DA 2B7NA 3WZ0E 2OXNA 2ISVA 4AD0A 1OG0A 4F0RA 4JTHA 1BG9A 3I7SA 4P5UA 3FOKA 3SEPA 1NQKA 1ZGDA 3NQCA 1XG3A 1IEVA 2AQWA 3TJLA 4NP7A 2Q8XA 3VGEA 5EMLA 1FHDA 1EF3A 3GAYA 3NSMA 4MUPA 4OUIA 4ZQMA 4W7WA 4B15A 3OU8A 5AYXA 3CAKA 1OEPA 4JN8A 3WLRA 1V93A 4EF8A 1OZMA 1POKA 2J8GA 3LQGA 1QPNA 1RCOB 4O0QA 4N9EA 3W74A 2NQJA 1KR0A 4UQ9A 3UERA 2E7FA 3L0KA 5CG0A 3NQ8A 3NTYA 1Z44A 2NWRA 2I1OA 1B4EA 3EWDA 4DBWA 5DQPA 2XZ7A 3GHSA 4LANA 2V5LA 4BI6A 1V6XA 3N18A 1XLIA 2QCDA 4O0KA 1FOBA 1CECA 3OP2A 4HJFA 2R8WA 1TYGA 3KVLA 2PDGA 1O66A 4UFIA 1HF6A 3NQ2A 3INPA 3URAA 2Y70A 2WZTA 2Z7GA 2FJUB 1A0CA 4S3DA 5GJPA 4JYDA 2GK1B 4XSMA 2PC8A 1T8QA 4GYFA 4GNVA 3WDPP 1KCZA 4HZ6A 3QJAA 2ZE3A 4J3VA 3KW3A 3CEPA 3C5QA 3E1F1 2GOUA 1IGSA 1GNXA 1V0MA 3KTXA 4PULA 4S3KA 4XB3A 4JCLA 3LPGA 2QT3A 4LYKA 3W00A 3DUGA 3G3DA 2A2IA 3C8NA 2E5DA 4FIRA 4QG9A 3GZ3A 2H8ZA 2D0GA 3Q65A 3UZWA 5E0CA 1FCBA 2PDIA 3W29A 4DPQA 1XC6A 4L61A 3D0CA 1TJPA 4ZTXA 1UR2A 3R4IA 2ZVIA 4XAZA 2UZ9A 3T08A 5LNSA 1XC4A 2Y61A 2DV0A 2ZZ7A 4O19A 3W81A 3H24A 4NNAA 1L2QA 1N7KA 2WJEA 4IICA 3WD4A 3W7GA 3U4AA 2ZYFA 4MWAD 1KTBA 2RGLA 3FEQA 3PJTA 3W88A 3N2OA 3ORWA 5EFFA 4Q22A 5LNVA 3NDZA 2ON3A 2YPIA 5CZ0A 1G4EA 3V3WA 4UTLA 5D37A 3G18A 1FKWA 4FAMA 1T99A 4NZCA 4IIGA 4CUCA 5CZKA 3RUBL 2V9DA 1MMFA 3SRFA 3JU2A 4UMAA 4MWAC 3AICA 3WBXA 1EEPA 1UCWA 4GKLA 4PMOA 2PDKA 3T09A 1GHRA 4PMYA 4UTKA 4GYPA 3NL5A 3CUZA 2E6DA 3DYOA 1SMDA 3EDEA 3KOZA 4JTFA 3PZOA 3A5VA 4UMCA 4L6OA 1J0KA 3Q67A 4HIBA 3TYEA 1UWQA 1DKWA 2WBKA 3NZPA 1QPQA 2POZA 2IS7A 1F6KA 4BFAA 2OLSA 4XD3A 4FXFA 4GJJA 5AHNA 2EEXA 3A9BA 4GO9A 4A22A 4ORMA 3TU9A 2NQ9A 1GEHA 3SR7A 3F5JA 2OR2A 1VFMA 1GZ1A 3WX7A 3G1SA 2WNZA 3GH7A 3L0GA 1FHLA 2YOCA 4E4FA 4GNKB 3G0SA 1OINA 4PEKA 1AZ2A 1QRQA 1RJPA 3IRSA 1AJ2A 3K8MA 1PZ3A 3FK4A 3FEMA 1JDEA 3C2RA 4IFRA 3HG4A 3RPTA 1Q8JA 3CZKA 5REQA 4IISA 2XFRA 3OVPA 1CENA 3LQLA 1GZGA 3W0KA 3W1MA 3R2GA 3ELFA 3AYTA 4H6QA 5TF0A 1ADSA 3H21A 5CLWA 4OHQA 5AB3A 2HBXA 3VNMA 4GGBA 4MFEA 3ZT6A 2VZUA 1V0KA 2DW7A 1UZHA 3BE7A 5LKYA 4AFYA 1B3ZA 1EC7A 2UWFA 5A6AA 3F4CA 4GMEA 3H2CA 2O9PA 2QXWA 4UTWA 2QPXA 4PUJA 1F9CA 4QAIA 4G1KA 1A5OC 4GZIA 1C93A 1XYLA 4LF2A 1A50A 4ZVJA 2WMHA 1UZ4A 1C90A 3VIOA 4ERAA 3C2OA 1OSEA 3BOLA 4UB9A 1LT8A 4Q4KA 2B81A 4MY1A 3RF9A 1ITXA 3IEBA 2V3EA 4A21A 1WXJA 2XJ7A 1NELA 4GI4A 4EX4A 1OVDA 1VIZA 4DHGA 4W84A 1O95A 3CB8A 1TG7A 4P7NA 4RNJA 1YRRA 3OGVA 1L0PA 4I8DA 5FIPA 4TTGA 4E8CA 3XINA 1IXPA 3GTHA 1VLIA 3W85A 3EOEA 1LWHA 2XVLA 1TV5A 1MUCA 1FWEC 2IPGA 1IV8A 4JIQA 3IIZA 4MLRA 1OADA 4QQ3A 3GE7A 2C71A 1HN1A 2V5CA 1CW2A 1C92A 5HULA 2VX4A 1ZJAA 1HFBA 2YW3A 4HN8A 5LA2A 3NUKA 3L67A 1M7PA 1KV5A 2BZNA 1UUMA 1WXYA 4ACYA 2X42A 2GUBA 1Z41A 3W9ZA 3CL7A 3KXQA 4C1NA 2DORA 1J79A 4HU0A 1ICPA 3JS3A 3UU0A 2DQXA 3PJXA 2BY1A 4KCUA 3DG3A 4HBKA 1FKXA 3WQPA 1QUMA 2ZIDA 4UFLA 1CIUA 1J6PA 1K1DA 2ZA2A 1UPPA 2J4GA 3BMWA 3EWYA 3SGUA 4ZZ9A 3L4ZA 3TAOA 3B0VC 3WUFA 3EDDA 2A85A 1KFLA 3A24A 1JI1A 1EOKA 4DYEA 1E6SM 1ITCA 3EB4A 3VDCA 3OLIA 3BMXA 3NNTA 2V2CA 4JIPA 3ANYA 2OKOA 4UFKA 1EX5A 3R5EA 1XYZA 4BF9A 2P8CA 1SO4A 1SFJA 3WDHA 1T0OA 1EC8A 1H2JA 3IIPA 5LIYX 2UBPC 1I8JA 1DBTA 4H7ZA 1PPIA 4FP1A 5TQLA 3JZUA 3I3EA 2UY3A 1SO5A 3EWCA 3RMJA 4GOAA 4N2YA 5AHMA 2QPSA 3V5OA 2Z1WA 2XH7A 3ZSTA 1BLIA 1Q7ZA 3WNLA 2E8ZA 3PZGA 5I7GA 1FH9A 2WCGA 4QE1A 2VC6A 2EGZA 4ATWA 5FSDC 4X9YA 3W7MA 1FWRA 3T2OA 1KA9F 1EO5A 2BOGX 4Y90A 3QC0A 2OX1A 3VPLA 2UV8G 2PUZA 3SUSA 4D8AA 4RE3A 4HT3A 3TTSA 2FB3A 1SZFA 3CH0A 3K4DA 3RK8A 2BNJA 4OECA 4D6DA 4XZHA 3AIWA 2OTDA 1XDJA 2XN1A 1KBJA 4F48A 1TIMA 2CITA 5CPNA 3SY1A 3H4XA 2OSYA 3R7MA 1XD1A 3O6CA 2B7QA 1GOIA 1G4SA 2Z2AA 3GFYA 1GQNA 1MXGA 4J1OA 2Z4GA 3I4EA 2ACRA 4DB7A 3PFMA 3L21A 1TWZA 3LBOA 4UZUA 1EJ7L 1AD4A 4OBRA 4MIMA 3CH9A 3WUEA 1X96A 3VGBA 4WZHA 1E9IA 2EAWA 1UKQA 2VXNA 3AUJA 2DJLA 3G3MA 3MUCA 1HL2A 1U1UA 1C7TA 1TV7A 1H63A 2DZPA 3PC0A 5M3WA 3I10A 5AVHA 5DY2A 1XKJA 1KR1A 5A8QA 3T2QA 4Q32A 1ZJIA 3C3UA 2V5BA 1WKEA 1MUMA 2PCEA 2QGHA 4CU6A 3S9IA 1LL7A 2X05A 3W07A 2IXVA 4OUEA 3LDVA 3R0UA 2NUYA 3GXNA 3B4UA 4C6LA 4IH3A 3I6EA 1EDTA 1JPIA 3IAPA 3F7JA 1XIDA 2P5NA 4HTBA 2HPIA 1QO5A 4KW2A 4QG8A 4LUSA 4QS6A 4J2MA 1X97A 3VKCA 1GVYA 4GI8A 3H26A 1SJAA 2ZKMX 1P1XA 3H8AA 4MZ1A 4PUUA 1BRLA 3M0XA 1WE5A 2WZEA 5T9CE 4S39A 5DO8A 1M68A 1ZCCA 5K9CA 1XD0A 5JBDA 4O18A 5BZAA 2DZXA 1AH3A 5F4XA 5CG7A 3MZNA 2O9RA 4AD3A 3PPGA 1Q6GA 3QW4B 2HE8A 5LIKX 3ABSA 4K1GA 3M5ZA 3BSHA 4I7UA 2GSJA 1S2VA 2J47A 1E6XM 3WQCA 1M1BA 2PE4A 4LUIA 1FCQA 1KCXA 3VOIA 3CZGA 2F8QA 4Q7BA 1NP2A 4DZAA 3S2LA 4K7VA 3RCNA 1BGGA 2CNCA 1J0IA 2EG7A 2DSZA 4O16A 3M9YA 5GNYA 5DFAA 4YWIA 2GQ9A 4LT9A 5T26A 3VDBA 2J7BA 3F4NA 3B4YA 2EKCA 1YE4A 4GJIA 2DPEA 1PSCA 3L4VA 2VZTA 1YNQA 2CBIA 4M80A 1E1CA 4F0SA 2F6UA 3R43A 1NM9A 2OGJA 3AWOA 3VE9A 1AW1A 1E15A 3GXPA 1QJWA 4ICNA 3LEPA 1AMKA 1NDVA 5DMLA 1DJYA 1W5NA 1W0MA 5KSWA 2PWFA 5F1UA 4AZCA 1YTKA 3H7RA 1FP8A 5HDRA 4KEZA 4GHRA 5CSYA 4IP7A 2RH9A 3BARA 2E67A 1LWJA 4W93A 1P48A 3WD2A 5BOOA 3PZIA 4NJGA 4AF0A 5G4WA 4BQ2A 3ZJ6A 3UPMA 4JDBA 2HV5A 1UD6A 1US3A 3NQGA 3W1RA 3WMBA 5I07A 3L4TA 3AOFA 3WLNA 4ZO6A 5LNWA 4H2CA 2VFFA 1BTMA 2GVEA 3KBNA 4GXMA 1O5RA 1IEWA 4CD7A 1W9XA 4CQ8A 4FALA 2ATSA 4QFUA 4DYJA 1VC4A 3CL8A 1DTNA 3TSBA 2VP8A 1B3XA 4B9YA 4B4HA 4B5XA 3LY0A 1WKYA 3V5FA 3E2SA 3THAA 4FEZA 1N8WA 1NFBA 2GL5A 2X2YA 1I4NA 4DXVA 2PDUA 1M6JA 5FEPA 1GUVA 1T40A 4BQ3A 4ZQOA 3VNLA 3PG9A 4XD5A 2WWCA 4NF7A 5CZJA 1J18A 1O7AA 2E1WA 3WK0A 3N19B 1TFVA 1WB0A 4PL1A 5HQMA 3FAXA 5HMSA 1D8CA 5JH1A 2QV4A 5I3HA 1F3WA