3PAOA

The crystal structure of adenosine deaminase with adenine bound from pseudomonas aeruginosa
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
313
structure length
313
Chain Sequence
b'YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title The crystal structure of adenosine deaminase with adenine bound from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 123
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3paoA00
4KESA 1UIPA 4G2DA 1ONXA 3RCMA 3O0FA 3TN4A 1EJSC 3RN6A 2ICSA 1FKXA 1FWCC 4GK8A 2Y1HA 3IV8A 3UPMA 4Z42C 2PGFA 1ITUA 1GKQA 3LGDA 4C6JA 4C5YA 4H9MA 2OB3A 2WJEA 4G7EB 1POKA 1RJPA 3MVTA 4ICMA 4WGXA 2EG6A 4G7EA 2OOFA 4ZSTA 1M68A 2WJDA 4MUPA 4BKNA 1YNYA 3T1GA 4GXWA 4C6PA 2UBPC 4J35A 2VHLA 3CS2A 2YB1A 1FWHC 3QY8A 1XGEA 2BGNE 1J5SA 4RE0A 4PBFA 4XD3A 4DNMA 3F2DA 3CAKA 3PNZA 5HMDA 1FWJC 1YIXA 4QS5A 4DO7A 4HA0A 3ISIX 1FWEC 2I5GA 2ADAA 2YZ5A 3LGGA 1I0DA 2Q09A 2Z27A 4IGNA 4C5ZA 1EZ2A 1FWIC 2Z29A 4HJWA 2R1MA 4GYFA 3IPWA 4LFYA 4EPEC 1XRFA 4DZIA 4ERAA 4V1YA 2YXOA 3DCPA 3FEQA 3GU2A 4CNSA 4DI8A 5G4HC 4C6QA 2UZ9A 2Z2AA 3QY7A 4DLFA 3MDUA 2AMXA 3AU2A 4KETA 4CNTA 4IFRA 2HPIA 4H9TA 3EWCA 4EPKA 2FFIA 4DZHA 3B0XA 4M51A 4OFCA 4KEUA 4C6LA 4GY7A 1FWAC 1P6CA 4GC3A 3UR2A 1EJVC 3IARA 4QRNA 3FDKA 3HPAA 3F2BA 3SFWA 4GX8A 4UB9A 4ZSUA 4C6NA 2FTYA 1HZYA 3SO7A 1KRMA 2QPXA 3A4JA 3N2CA 4NI8A 1NFGA 4RZBA 3PNUA 3RYSA 3URQA 2R1LA 4BY3A 4C6KA 3G77A 2FTWA 4EP8C 4DI9A 1K70A 1YMYA 4V1XA 4LAOA 2Z24A 3LSCA 3B40A 4LAKA 2FVKA 1V7AA 3T81A 1ZZMA 2IMRA 3GU1A 1YBQB 4LCQA 1FWDC 1YBQA 4H9ZA 3MTWA 4C6EA 1FKWA 4PCNA 3T8LA 3OODA 3LY0A 1KCXA 2Z25A 1WXYA 3KM8A 4H9UA 5FSDC 2R1KA 1EJWC 3ORWA 1JGMA 1NDZA 4H00A 2F6KA 2OODA 4WHBA 2WJFA 1XRTA 1QW7A 3IRSA 3GIPA 4GX9A 1VFLA 3MDWA 4RDVA 4HK7A 3WMLA 2D2HA 4C6MA 3QGKC 4LALA 3GTFA 4C65A 3LS9A 3GTXA 3TN5A 1A4MA 3OVGA 2E1WA 4WVXA 4XAFA 2VR2A 3K4WA 1RAKA 3F4CA 4IH3A 4RDZA 1V77A 2A3LA 3LSBA 3K5XA 4H01A 1FWBC 1EF2A 1FWFC 4QROA 4LANA 5FSEC 2D2GA 2Z4GA 2GOKA 2DVUA 4B90A 4LH8A 1R9XA 2HBXA 4H9YA 4HK6A 2AQOA 4PE8A 4GY1A 1GKPA 3A3XA 3GTHA 3E3HA 4GZ7A 2Z7GA 4GBDA 2CZVA 3UF9A 3S2JA 4CQDA 1V51A 4HK5A 2QS8A 2VC5A 3F4DA 3E0FA 1S3TC 1KRAC 3NURA 4IG2B 1EJTC 1A5KC 1J6OA 1FWGC 4QSFA 4B92A 2GSEA 4B3ZA 3S2MA 1M7JA 4IG2A 2W9MA 1KRCC 3EWDA 1RA0A 3S2NA 3PAOA 4LCSA 4D8LA 4QS6A 3D6NA 1UMLA 3PBMA 3E0LA 2HPMA 3CJPA 4F0SA 1A5NC 5E5CA 4XD4A 2E25A 2KAUC 4KERA 3GTIA 2Z26A 3FDGA 1RJRA 1M65A 3HTWA 1J79A 3DC8A 4CQBA 1A4LA 3URNA 4AC7C 1QXLA 3PANA 4IF2A 3S2LA 2FVMA 4EPDC 4F0RA 1A5MC 2OGJA 2WM1A 5HMEA 3MJMA 1EJUC 3OJGA 4INFA 1BF6A 2QT3A 3QY6A 2HQAA 3MVIA 5HMFA 4I6KA 4IFOA 2PGRA 3HM7A 1E9YB 1K1DA 4P5UA 3RHGA 2PAJA 4DLMA 3IGHX 2OQLA 3K2GA 2VUNA 3O7UA 5CH9A 2GZXA 3MPGA 5AKQA 4DIAA 2Z2BA 4C6DA 1POJA 4J5NA 3GG7A 4CNUA 1NDWA 2HNHA 1RK6A 1PO9A 5A6TC 4CQCA 4F0LA 2P53A 3E38A 1E9ZB 2PUZA 1RA5A 3LA4A 4C6FA 2R1PA 2GWGA 3F2CA 3NQBA 3URBA 4XD5A 1V4YA 4NP7A 3S4TA 1ONWA 2G3FA 3IJ6A 2RAGA 4CEUC 2PLMA 2AQVA 1IE7C 4L6DA 2VM8A 1R9YA 2O4QA 4KIRA 3MKVA 4C6IA 1UBPC 4C6OA 1PSCA 3UR5A 2Z00A 4ERGA 4IQJA 3DUGA 4PCPA 2ZC1A 3B0YA 4C6BA 5LXXA 3OQEA 3IACA 3ICJA 2Z28A 2DVTA 3LNPA 3WYZA 3A3WA 2ANUA 1V79A 3QGAC 4XD6A 3TNBA 3V7PA 2YB4A 4R88A 1P1MA 1J6PA 4B91A 1UIOA 4GY0A 4R7WA 4LAMA 3MSRA 3GRIA 1PTAA 1YRRA 1NDVA 4TQTA 1ITQA 4KEVA 4XAYA 3GUWA 4DYKA 4JOMA 1A5LC 1A5OC 4H9VA 2GWNA 3GIQA 1EJXC 4UBPC 4LEFA 2BB0A 2O4MA 4GOAA 4KQNA 3UBPC 1R9ZA 1RJQA 4L9XA 3ITCA 4RDWA 1O12A 4IFKB 4R85A 1ADDA 4PBEA 4AQLA 4CEXC 4XAGA 3AUOA 1O5RA 1DPMA 2HBVA 4H9XA 3WZ0E 4IFKA 3BE7A 3GU9A 2QVNA 2EG7A 1W1IE 3EGJA 4NG3A 1EYWA 4C60A 2DVXA 2R1NA 1GKRA 4QTGA 4BJHA 3E74A 3OOQA 3JZEA 2XIOA 3NEHA 3AU6A 2Q01A 3TN3A 4LCRA 3LU2A 3TN6A 2P50A 2I9UA 4J2MA 1I0BA 4ERIA 1WXZA 4XAZA 1EJRC 3E2VA 4IGMA 4E3TA 4RDYA 4KEZA 3C86A 3OU8A 3ID7A 2VC7A 2D2JA 2EG8A 4EPBC 3URAA 3R0DA 1NDYA 1RK5A 1XWYA 1PB0A 4YIWA 4C6CA 1P6BA 4KF1A 4I6VA 1K6WA 1KRBC
chains in the Genus database with same CATH superfamily
3QR0A 1ZUAX 3ZR6A 4KT2A 3TN4A 4LY4A 1I2NA 4CNNA 2V38A 4OU1A 2YBTA 3SQSA 3UJSA 3UWWA 1XJBA 4O1DA 1XG3A 5EMLA 2EJAA 3W23A 2FGBA 3UPMA 1XS2A 3OLDA 3W1PA 1FWNA 4EVZA 2OFJA 4IP5A 3W3OA 1ITXA 1M68A 5D02A 2ZFAA 1CGXA 3WLNA 4DB7A 2VURA 2E67A 4P7QA 1XR2A 2JGYA 2CHNA 1V0NA 1TPFA 4CD6A 2W66A 3G1YA 4DWSB 5DY2A 1IXPA 3LZ5A 1OBAA 4CD8A 3TSBA 3MMWA 3T07A 4UOQA 2V8ZA 4ENLA 1H49A 2DW7A 1XBZA 2JEQA 3TK7A 2DU2A 1KXVA 1YADA 4Q8QA 5DCEA 3U2OA 3TSMA 4DJDA 3UZJA 4AZ5A 4JIRA 3QY7A 3P93A 3N2OA 1US2A 2PSNA 3CZGA 3AU2A 3N3TA 3GIYA 3MMTA 4US5A 3CB8A 3ARWA 5CZKA 1Y5WA 5CBBA 4NNAA 1AQMA 3GXDA 5EMMA 1DBTA 1JULA 2WANA 3NDOA 2XGIA 3SCVA 5BRPA 1XIHA 3ARZA 2DSVA 1Q66A 4OKDA 2ZUWA 1ITCA 4GQ0A 4I8YA 3A4JA 4KCVA 2PCQA 1J5TA 1XH2A 3TKFA 1WDQA 1H7PA 3H23A 1OD8A 1F9CA 2F6UA 1I2RA 3H2OA 5I77A 4HCLA 3CUFA 5LA2A 2BDQA 3YPIA 3J7HA 3H2EA 4HNCA 1PKMA 3GXIA 5FACA 3VO0A 4RR4A 3FSUA 4MFDA 2WVUA 3AIQA 1FHUA 4E2OA 3QYSA 3KZSA 5C9RA 5KINA 1YE6A 1RXOB 4TX8A 4MAVA 1MQPA 5DELA 1S5WA 1Q4NX 2FZNA 1D9EA 1OK4A 2WJFA 4TO8A 2QDEA 2O9RA 2QDDA 3UJFA 4RXGA 4HK7A 2D2HA 4IZGA 1SZGA 4Q4MA 5CPQA 2DZTA 2F84A 3SBFA 2ZZ6A 3K4WA 2R91A 4JIHA 1WAUA 3LM7A 2D0HA 1IIGA 3AXXA 4K8EA 4XK2A 1VB9A 3SN4A 1DQXA 5CZJA 3OZOA 2FHBA 3PBUA 3IWPA 3PZGA 4MUZA 4PE8A 4QXIA 3S47A 3DDMA 3A3XA 1UA7A 3VM5A 3CQIA 3W2LA 1GOQA 1V51A 3L2LA 1A3WA 3H7UA 1FP8A 2POTA 1F6KA 4LYRA 2QS8A 4R27A 5A6KA 3H4XA 2Q8XA 4HJFA 1EJTC 3W7KA 2OO6A 4JXCA 3AROA 3TYDA 4A3RA 4PCTA 1NFPA 5BRBA 5A1AA 1J2WA 1BSIA 4ZB5A 3GKFA 1CDGA 4QE4A 5FJRA 3U4AA 3IIXA 5BWAA 2Q6ZA 3PBMA 2ABBA 2D23A 3GDTA 8RUCA 3M43A 4QM1A 1V3LA 2JIWA 4ES4A 3FGCA 1XIGA 2H3BA 2XUCA 3C6CA 4WY0A 1AQFA 3UXLA 4QGCA 4M0XA 1UP0A 1OCNA 4WQ6A 3UPBA 3T7VA 3GK0A 6XIMA 4IMDA 3EWYA 2NQJA 4BWLA 1DORA 4I6KA 1N8FA 3DN5A 4C1KA 4BZYA 3HM7A 4U3AA 2ASHA 4JAWA 3NQAA 1JYVA 2E3ZA 4NJHA 1F7BA 3LUTA 3BAXA 4JGDA 3WK0A 2VDGA 2NX9A 2OSXA 4N7QA 3XISA 1K77A 1ME8A 4Z2HA 1JEZA 4CUCA 5F1VA 2P53A 3CIVA 1HXJA 3K30A 3IV3A 1TWWA 2BXYA 4JFWA 4FLQA 3LCGA 2IPWA 4NQ1A 1MZRA 3OA3A 2MNRA 3REQB 1XYBA 1VZWA 3T2OA 1K9EA 3GZAA 3NQMA 1A5SA 2KZHA 3EWWA 3SUSA 1C7TA 2G95A 3WDIA 4AUBA 3GNPA 3UY8A 4BF5A 1WKDA 3W70A 5AHFA 4KWOA 3RM9A 3TNOA 1GQIA 3LHYA 2CYGA 1JXKA 1SJCA 2YGYA 1UIOA 4WKFA 4QX4A 1TIWA 4IPJA 4PTVA 2WKGA 3Q2DA 4AIOA 3MP3A 4JIQA 2WCSA 4LOCA 4P8VA 5ABHA 5EBUA 3PAJA 4D6CA 1HKVA 1GZGA 4IIEA 4DJEC 4RDWA 2QCNA 1V5XA 1D7KA 2J8TA 3BGAA 1U33A 3R43A 5KSWA 1HKJA 1QNOA 4RCXA 1PCWA 4UTLA 3BMVA 2F2KA 2G3JA 1W1IE 1V0LA 3TXVA 2YFOA 3QKEA 5AZ1A 3VE9A 2E6FA 4DJFD 1ZCOA 2QJMA 1GOWA 3PZVA 2P88A 3JZEA 4Y2WA 1RV8A 3SSZA 1MEIA 3PC0A 4H8HA 3BJFA 4UTJA 1XBYA 2ZTJA 3NDZA 2PF8A 1XQLA 1UWSA 4JZ5A 5A2CA 4X60A 1JUBA 1Q13A 4UQEA 4OIFA 5HR6A 4XUGA 2QUVA 4IQLA 3TAOA 4X61A 2CLHA 1EC8A 5H1WA 5U4NA 3RN6A 3FSTA 3C0LA 4E2VA 4GWEA 4CU6A 2CLLA 3HFTA 4S3EA 5EFDA 3THDA 3PTDA 3W2JA 3HQPA 1G1YA 1LBLA 1UKOA 2V5KA 2VHLA 3BJSA 1TCDA 2YB1A 2DZXA 2BGNE 2WAGA 3FAXA 1ZL1A 3F2DA 5IHSA 1V0KA 3DHFA 3QLDA 3PNZA 2CFFA 4KWSA 1DV7A 1FWJC 3C56A 4A2SA 7ODCA 4LUIA 2B31A 3D0CA 4M8UA 3GE7A 3NWRA 2V6AA 4UFJA 1B3OA 3CV1A 4ZFMA 2R1MA 1PL9A 1E6PA 5B80A 1TUFA 3VDHA 3AIUA 3QZ6A 3VOHA 4RZ6A 3WUEA 2UZ9A 4R3UA 5JMUA 3QFEA 4DPQA 2PBGA 2YL9A 4KETA 2NSOA 1GJWA 1S2UA 4H9TA 5F2GA 1QJWA 4HOZA 1GZJA 2F9RA 3IANA 1W6TA 4K8HA 3NO5A 3QV8A 3WD0A 5IDIA 3UR2A 2CLKA 3UWVA 3ZLHA 1W1VA 2YXXA 4LF1A 3Q37A 3G8RA 3ABSA 1BQCA 3WLLA 5HXMA 1DTUA 3SO7A 4IMEA 3ZSTA 4PRTA 1IGSA 4KEMA 2YR1A 2R1LA 3BAWA 1VRDA 1YDYA 3L21A 1SO6A 3MUCA 4N6EA 1YMYA 1JI1A 2XFRA 3HV8A 4PRRA 5BU6A 3VGDA 1ZZMA 4Q8UA 4XBKA 1W54A 2IMRA 1JNEA 2RDTA 3NL6A 3U8GA 1YBQB 4L61A 2VCBA 3OLGA 3W1TA 4ICCX 3W7JA 3O8AA 1WX0A 2EO7A 1UUQA 3FIGA 4PCNA 3AUJA 1X6LA 2RFGA 2WC4A 3UZWA 2GVEA 5DRCA 7PTDA 3EWXA 2F6KA 4NZ5A 2A21A 1BVZA 3OVQA 3P67A 3EDFA 2P8BA 1J0HA 2OR2A 3TC3A 2W62A 3GIPA 4TTGA 4QR6A 4TU1A 4OV9A 4TV6A 1H1YA 1F61A 2CHOA 3ZR5A 2Y7DA 1SPQA 3P61A 3TN5A 1BF2A 1P5BA 1RAKA 1GYMA 2G4FA 2VWSA 2VCAA 3ALGA 3IAPA 3TC6A 6REQA 1ZBKA 3KZPA 4PMZA 4J7RA 2J25A 3U2EA 3WMBA 1Q4WA 1T99A 1GKPA 1XICA 4DBEA 2J7DA 3EXTA 1QCWA 4GZ7A 3ZO9A 4W87A 4GBDA 4FEZA 3CUHA 3RM4A 1MW3A 2CHRA 4HK5A 1JQXA 3CQ0A 3SCOA 4DJDC 1A3XA 1QVBA 4GQQA 3S5OA 2CLFA 3DYPA 3FA3A 4FF7A 4NSBA 5HQLA 4B92A 4MG4A 1AUSL 3WF1A 1L8PA 4AHPA 3KOWA 3EWDA 1RR2A 4GVHA 5F2IA 1KLZA 5C9WA 4XX6A 4QNEA 3CO8A 3IIOA 5DEZA 4HT3A 1BG4A 2NW0A 3BH4A 3B8DA 4QLJA 3K46A 3HGRA 5CPTA 3SN1A 3V16A 2C71A 5D32A 4LS0A 4M7TA 4A3YA 4ALDA 1KFEA 2E4TA 4FX8A 4MZ1A 4QG9A 2XTKA 3OPSA 3NFUA 4N42A 5DN1A 1K1DA 2POZA 3RHGA 1OG6A 1LRTA 3W84A 1UR1A 2GVYA 1E9IA 4D9PA 4PODA 2FHFA 1C92A 1JAKA 2EGZA 4JQAA 4NAFA 2GWGA 1UBSA 2R9RA 5CPOA 2PCEA 3WEZA 3T40A 3LRMA 3S4TA 1UASA 4PFMA 2RAGA 3QTPA 2VM8A 1QNQA 4NKCA 3MKVA 3KX6A 3HIJA 4U5IA 2BODX 5F4WA 2TSYA 3B0YA 4C6BA 3ANUA 2QAFA 1XLJA 3LNPA 3VX1A 3RCYA 4XD6A 1PPIA 1YQ2A 1B4EA 4ADTA 2Q3RA 4GY0A 3BCFA 4AY8A 3H24A 3TR9A 2IQTA 1OX5A 3IUDA 4L4LA 1GJUA 4RV3A 1V3JA 3RPTA 4LWWA 5XIAA 2VCCA 2YBUA 3B0UX 2QCDA 4ZB2A 2XVNA 4XZ9A 3TJ4A 1Z32X 3L4UA 4XAGA 1OX4A 4TMBA 3SCRA 1OCBA 3APYA 1EGVA 5PTDA 2NSXA 3WFAA 3NG3A 3BAYA 4B5XA 1W9UA 3AZSA 3GUGA 5EA9A 5I3JA 2J9YA 3GHTA 2QF8A 2ZUSA 3S1XA 3GDLA 4OBRA 3HA1A 4MZ8A 4IISA 5DQPA 4WXYA 3L5LA 5H2ZA 4O10A 4EPBC 1QPOA 2Y8KA 3SI9A 1IZJA 4BWLC 4HYVA 1KRBC 2ZUVA 1JUEA 2OX1A 4Q4PA 2GQ8A 4RPPA 1EJSC 1FDYA 3TZFA 4MY1A 1FWCC 1KGUA 4CCZA 3SEPA 3H2NA 3SR7A 5CZSA 2WJEA 1M03A 1KKRA 2QDGA 4G7EA 4LS1A 4M3PA 4DX3A 5REQB 1Y0EA 5AHNA 3BVJA 3ANYA 1K8ZA 1E4LA 3WBWA 1D3GA 4AZGA 3M0ZA 3WLQA 4ZOCA 3VGEA 1L2QA 4DNMA 4GKLA 3NSMA 4I8DA 2HJPA 4TOQA 4GQRA 1CB7B 1XCWA 4YVPA 1VFUA 2GJNA 3G24A 1XLEA 3WKZA 1UCWA 3BOLA 4BI5A 1G4EA 3MMDA 1RSCA 3G1AA 2YDRA 3T0DA 3UZ5A 3G3MA 1I0DA 1R3SA 3VD3A 5CAHA 1QPKA 4IGNA 3BSHA 1B1YA 2ZXAA 4HYWA 1W1ZA 3QW4B 2ZXQA 4GJ1A 1FWWA 4J9JA 2Z2AA 2IKGA 3N11A 3VIGA 4Y7EA 3H8AA 5AC8A 3PWIA 5I3DA 4OOZA 4NNCA 5D37A 3W53A 3H2CA 1IZKA 4XTDA 4GC3A 1QHPA 3TDFA 3H6OA 2JFEX 2C3ZA 1PDZA 1MNZA 3VC5A 4Z1DA 3HPAA 2BZNA 3PPGA 2YX0A 4I7WA 1R2SA 4HSOA 1F6PA 3G1XA 5ABFB 3EAUA 4S38A 5HWJA 4B9YA 1F3XA 3FJLA 3N18A 5K9DA 3TQ0A 3PZMA 1Q7QA 4YN5A 3BAIA 2X0YA 1PVNA 3FYYA 3TTQA 2Z24A 4Z17A 4HPJA 1SZFA 3W27A 2WHKA 4GI6A 1CLXA 3QGVA 1H41A 2WPBA 3NYZA 4IIFA 3LXBA 2VFIA 2TYSA 1QOPA 3SUTA 4S3JA 3LZ3A 3UWEA 4JCMA 2I56A 1RBOB 1TELA 3H53A 2BHUA 4F2TA 3DFHA 1ICQA 3IK4A 3KS5A 3QGKC 1JDAA 4HIBA 4W8BA 2ESCA 1I8JA 2PGEA 3TVAA 3EA2A 1EJ7L 2Y85A 3HG5A 3S1GA 4IH3A 4M5PA 3F7JA 2RDXA 5A6BD 3FV9A 4J3XA 5HAOA 3NPVA 3ARSA 1P4CA 4ACZA 1E6RA 4J3UA 2XDFA 4IOTA 2PI6A 4LVGA 1RLDA 4AISA 1E40A 5K3VA 1VBUA 1BYDA 1IEXA 1AH4A 4PN2A 1FRBA 2H3DA 1GZ1A 5HUPA 3IJ8A 2E8ZA 1W1B1 2GSEA 1J9YA 3WY1A 1DJNA 2G37A 3DGRA 3GHRA 2QW5A 1KRCC 3O16A 4QE5A 9RUBA 3TYEA 3WBEA 1EP2A 1TV4A 3OA5A 4LCSA 2Y88A 1KO0A 4N4QA 3N13A 3O06A 3G6MA 3NVDA 3M7SA 3V0TA 1W9XA 1E1EA 2PGWA 1NSJA 1J79A 4BI6A 3URNA 3V18A 4AEFA 4ZOAA 1JDDA 3L12A 2PDIA 4QEHA 5D03A 3BV7A 3RMJA 1A5MC 1KBIA 4MJZA 3WDHA 3TMLA 3PUGA 2NQHA 3MJMA 3VDCA 2CCRA 5AHLA 4LVAA 1CGWA 4ZO6A 5M2FX 5HMFA 2INZA 4FMVA 3H4GA 1LQAA 5FJUA 1CXFA 4CVWA 3C2OA 3C2RA 3G0UA 2PWDA 4UQDA 3E2RA 3WK3A 4XZIA 5LZLA 5LA1A 2VYOA 2V63A 5M3WA 5HNUA 4IIGA 3HQOA 3H70A 3RLHA 1FDZA 1SGJA 4I9AA 1F73A 4AMCA 1Z41A 5JBDA 3PG8A 2A6LA 4ICNA 4PULA 1CEOA 1D8WA 4HP5A 3R10A 3HGOA 3SADA 1SJAA 3WH5A 3CQHA 5CPLA 1Z89A 3PWGA 3M0XA 2DT0A 1F07A 3B9DA 1NFBA 4GCAA 4X63A 1JCXA 3FK4A 3W6MA 4U28A 1P1MA 4F66A 2JK2A 2C79A 3AJXA 1UKTA 3I4EA 3IJLA 4FIRA 4QCFA 2B7NA 4I9JA 1OIFA 4W93A 4A8RA 3BC9A 1A5OC 1R85A 1QPRA 3TH6A 2GWNA 3UG4A 2BB0A 1OYCA 2AAMA 1RJQA 2W0UA 4HVXA 2QYGA 3LERA 3GFXA 5CXPA 1GK8A 4FO4A 4IWWA 4JBRA 1W32A 1O94A 3LPPA 3W74A 3ZJ6A 1GKRA 5A6MA 4K8GA 1DTNA 1UA3A 5HDRA 1KWKA 3W2NA 1OFAA 3MU7A 1XCFA 1N8IA 3OU8A 1HKWA 3QW3A 3ID7A 1ZHAA 5LHFA 4FNTA 1F3EA 4JS3A 5I3HA 1DYSA 3N6QA 5FA5A 4RNIA 3CLWA 4C1NA 3CAVA 1EDGA 2WYSA 5I09A 4A29A 5TIMA 3N6JA 3HJEA 1BPLB 3OLIA 4UOJA 4CLMA 1XLFA 1YNYA 2H8XA 2ALRA 3A4XA 1GVQA 2DUXA 4ZQRA 3C2EA 1J01A 2PLCA 1ZPTA 1AG1O 1J93A 3MHGA 2NUYA 1RALA 3TTEA 5FF2A 1BFNA 4F2BA 5DCDA 4OTKA 1ISXA 5HBFA 3W1RA 4QIUA 1BKHA 4KFPA 1B3WA 1FWEC 1K6AA 3XINA 5A94A 4FLSA 2VENA 4DWSC 4NJJA 1QBAA 2C13A 3VMOA 4OV4A 2HEJA 4PB4A 3NZPA 1HJXA 3UG5A 4ERAA 3KOYA 4WJ8A 4HPGA 3FEQA 3TTSA 3SJ3A 1C7SA 4G7FA 3V4BA 4N4PA 2WXDM 4QJ4B 4YU1A 3UFYA 1PV8A 4IP4A 3WD4A 4I5XA 3EWCA 2FZ8A 2C1HA 4M51A 4CN1A 1JZ5A 1WXJA 2WW5A 5HWNA 1EKOA 1ICPA 2Z7KA 3V0UA 3GDRA 2Z1WA 4RE4A 3GC4A 4E8DA 3RU6A 3N2CA 3DI0A 2X05A 1Q5MA 1KXTA 3FAWA 4MWAD 3RITA 4WR3A 3ZMRA 1FTXA 4V27A 4R53A 4RUBA 1EFZA 3NA8A 4N02A 4M24A 2NUXA 1OADA 2DSUA 2D1ZA 3BZGA 5HMSA 1OJXA 3CMGA 4OHQA 1SFSA 4M29A 4H04A 1FWDC 4ACYA 1XP3A 4EF8A 1GHSA 3F4WA 3MI3A 4WDUA 1JGMA 3W76A 1ECEA 1QRQA 4E2BA 4LBSA 2EPNA 3L4TA 3IRSA 3C3NA 4LALA 1S39A 4NJGA 1NM9A 3VMNA 1SMAA 3DH7A 3EPOA 1YNPA 2Y7EA 2XM2A 1E72M 1JF6A 1TE1A 4UWMA 4H01A 3V1HA 4UCFA 2D2GA 2JKPA 1GQJA 5G4WA 1GVOA 4GY1A 3EWBX 3VKAA 4XKYB 1KGWA 3OGSA 5C2GA 2BP1A 3WQDA 1A5BA 3WQOA 3BICA 4D6HA 1GYLA 1KRAC 1XQKA 2B7PA 1IEIA 3CUIA 2J24A 1V6TA 1U1JA 1T40A 3R89A 2DT3A 3T78A 5FF3A 2C18A 3EZ4A 5D30A 4BF9A 4UCGA 2GGGA 3G2GA 1LWHA 1P0DA 2EJ1A 4H7VA 3A47A 4XD4A 1JCLA 3STFA 3CC1A 3R8HA 3GTIA 2Z26A 2UV8G 1XDLA 4RZ4A 1YTEA 1VEPA 1QPQA 3RK8A 4EK7A 5K9CA 3W1NA 5C8BB 3E0VA 2PLKA 3KBVA 3WJXA 3CV6A 1S2CA 3MBFA 1ME7A 2BGSA 4LEQA 2XIBA 3FW6A 1LOSA 4RNFA 3EOOA 2V3EA 5C0QA 1Q8JA 2WSPA 4FALA 3A21A 4E4UA 3TFCA 4PUNA 4W7VA 2QJNA 3O7UA 6PTDA 1G7VA 1TJPA 3SRFA 1UR8A 1P1XA 1L6FA 4UOZA 2NX3A 3AIRA 4QE1A 4GLEA 2YZRA 1OFRA 4AD0A 1OWQA 4ZR8A 1U2YA 4XD5A 4NP7A 4QJ5B 3DZ1A 2WMKA 5M17A 1Y5XA 4CEUC 3CWOX 1TR9A 5BU9A 4L6DA 1HVXA 1IIHA 4OBSA 3NQVA 2CXEA 1BWLA 4ZFCA 2Z00A 1R46A 4NVTA 2OGYA 2XU2A 4UTTC 1K7XA 3GXNA 2Y8VA 1NH6A 1VBRA 5TF0A 4FF5A 3F03K 1Q6LA 3GNDA 3WYZA 3M6YA 1W9VA 4JTFA 4AEEA 4YTRA 5M1TA 3FN9A 4YTTA 3SDOA 4UC5A 3AZTA 4AXKA 2PTWA 1ODUA 1PTAA 1HKMA 1MW1A 1NDVA 2YA2A 4XAYA 4DYKA 1MDLA 4TX9A 3TFXA 1A53A 5HPCA 5LA0A 2VEIA 4IPLA 5KEZA 4H9XA 1GW1A 4MMWA 4AD3A 2WZIA 1VCFA 2FMOA 5DT5A 2W6RA 2MANA 3VIHA 3V36A 2CIPA 4GFSA 3VD9A 2QCEA 1IXNA 1Z8AA 1J0YA 3UWZA 1J0ZA 1MQRA 1CBGA 4JDBA 3E2VA 1UUOA 1LT8A 4F8XA 5ABFA 3PHAA 3NQCA 3NR0A 2EG8A 3MV11 4HQVA 1UR4A 3GZ3A 4H8VA 3P5ZA 3S6TA 1BHGA 2GK1B 4YTQA 4DUWA 1MYRA 4EXAA 3OEXA 2NZLA 4J40A 4PMRA 3O6CA 1VPYA 1TA3B 4PSPA 4AHOA 4RKAA 3D5HA 3QHMA 3D46A 2HRWA 1GKQA 2QMJA 3PULA 5CPMA 4C5YA 3KRUA 2VL4A 2X30A 1S5TA 1KM4A 3AYRA 2HTMA 1GVYA 1YPXA 2GUYA 3ABZA 4NHVA 3SRKA 4AXNA 1V03A 3E5PA 3KOZA 2GPTA 1LWJA 4QLLA 3MKKA 4EWND 1GQKA 4J35A 2XSXA 4UMAA 3VOJA 3USBA 2O55A 1MUWA 1GCYA 1V7YA 2NV2A 1OSEA 3R6IA 2NLIA 4LBRA 3LHUA 5AHIA 1EOKA 2VR5A 1H2JA 4D6JA 2PRHA 3AO0A 3KWXA 1GHRA 3W4RA 4W4QA 4NNBA 4ROPA 2A85A 2X1RA 3VGHA 2QJJA 3TE9A 1JNDA 3M64A 3NOEA 5FL1A 1TREA 3AMDA 4WRHA 4KS0A 1M04A 1HQTA 1HP5A 1XC6A 5E1QA 2F61A 4O12A 2W4XA 1VEMA 1NARA 4FXFA 1G0CA 2PZ0A 4D8AA 3I65A 3KL5A 3B0VC 3DX5A 1PZ0A 1MMFA 3UQNA 1P6CA 2UY5A 5KZEA 1ONRA 1TJ0A 1TUXA 1Y65A 2DSKA 2A0NA 4B3KA 1OFQA 6TAAA 4XO6A 3SFWA 4WCJA 4UB9A 3OZYA 3FJ6A 2ISVA 2WZMA 1WDPA 2OSYA 3NXLA 3G1SA 1OIMA 1AW5A 5LIYX 3TQVA 2XJ7A 2YFNA 4DWSD 2QJHA 2ZRYA 1TIMA 3CNYA 1Q85A 2VD9A 3TEVA 1QWKA 2IKIA 1LT7A 3M4HA 5HATA 4E38A 4RE3A 1C8QA 5G1TA 1W9PA 2W63A 2CBJA 2QCHA 2XH4A 4GG9A 3CUZA 4PUEA 2CZFA 2Z25A 3KM8A 3UWQA 3QV6A 2WB5A 2A3EA 3MI2A 1LUCA 1F76A 1XRTA 3WQPA 2VTFA 1RVKA 3SW6A 1TJRA 2NWSA 4K37A 3MCMA 3WL0A 4A21A 1FH7A 3SQMA 4DYEA 3T42A 5LHEA 2VR2A 3AJ7A 4KWWA 1H09A 3R8RA 4LVBA 4RDZA 3SM0A 3A5VA 3KL3A 1K4HA 4HU4A 1Q6QA 2PWFA 4QQ3A 2JGQA 5H6HA 3TXZA 2G97A 4LANA 3LRKA 2ISFA 1GOIA 4LH8A 4S39A 5EMUA 1A5AA 1LBFA 1DP0A 1SZEA 2CESA 1ICSA 2HK1A 3L4YA 1YDVA 5C7HA 2PA6A 3GC5A 3WLKX 2PD9A 4UXDA 2RGMA 1ZJAA 4AF0B 2DPEA 3KP1A 5BROA 1S3TC 2HVOA 2NVDA 2ISWA 1W3LA 5G1YA 4B3ZA 3W7RA 4LSBA 3D3FA 1NVMA 4ZO8A 3SN0A 2W9MA 1KM6A 3POCA 4NT0A 2GVLA 1XSIA 2B7OA 1RA0A 1PKNA 3GH5A 3EEGA 3PUOA 2J88A 2ZDRA 3A64A 2XFWA 4HN8A 4H6QA 4KERA 2DZBA 4F40A 2CLEA 3O2LA 1LZOA 2CLPA 2Y5SA 4O54A 3D3AA 3M0MA 2IW0A 4CNPA 3SRHA 1KD0A 4REQA 3NTYA 4JKLA 4UTFA 4HMEA 3UR7A 2YL8A 1XLMA 5HMEA 2VX5A 1KBJA 5E9AA 1XLCA 4B2DD 2Y0FA 5A8NA 4IFOA 4M6UA 5JBFA 2X09A 3PZUA 4HHPA 4DO6A 1K7EA 2P8CA 4E8CA 1XIIA 3PBWA 3LB0A 2VUYA 2Z2BA 3M47A 1KR1A 3W7GA 2X0HA 4O11A 4JNMA 1E3ZA 3EKGA 3BGJA 1AL8A 3R0UA 2E6AA 3F2CA 4IJCA 3RNDA 4XBSA 1RP9A 2ZVIA 3VFLA 3EOUA 3KE0A 3VPLA 2NLYA 2ZDSA 3WLJA 3M1ZA 3GR8A 4JPGA 2WSKA 1S2TA 1UB3A 4C6OA 5DMYA 1TRDA 2PPGA 1KV8A 1GJPA 3ICJA 2ACSA 4GIAA 3VZYA 1ZQ5A 3IS4A 2OLAA 4OOUA 5A5WA 4LJ3A 1E6XM 3CUXA 4P8WA 3BLEA 3PBVA 3MUZ1 2ZA3A 4KIEA 3ITGA 3AHYA 6ALDA 3GY1A 3WQEA 1G5AA 4O0KA 4ZCWA 3VCCA 3LCLA 3DHPA 3GRIA 4GUGA 4PTDA 4FS9A 1PE1A 4WSKA 4UTUA 5XIMA 2QR6A 4GMEA 3NYDA 2JALA 1LBMA 1UD3A 4LEFA 2DIKA 4KQNA 2BXZA 3ZT6A 2QUTA 3UVIA 2EF9A 2HBVA 1W1A1 5AECA 5JH2A 4NG3A 1R47A 2H9AA 2R94A 1DWAM 4C60A 1RCXB 3DG3A 3I6EA 1ZSXA 1JYNA 1B9ZA 5ABTA 4Q4RA 1H1ZA 1VD6A 2FIQA 3CZJA 1RP8A 2PDKA 1W0MA 3N2TA 4MB1A 5J5DA 2PDQA 4IGMA 1QW9A 4DXVA 1X39A 4GVFA 1EBHA 1X1ZA 5CSUA 2CBIA 3K8LA 2EHHA 4F3HA 4GPNA 4JTCA 1G4PA 3R4IA 4G56A 3AIVA 3BANA 1XISA 4NZJA 1O1HA 3I7QA 1JCMP 2YCKX 7A3HA 4JQ4A 4IX2A 2CKSA 1DHPA 4H6EA 5L6UA 3VM7A 1ISVA 2VZUA 1D3CA 3M0LA 4JY9A 3QHOA 1TE6A 1G6CA 2OOFA 1RPKA 3KDOA 4ILSA 2Y6ZA 3U6WA 3WLRA 4E5TA 2BOEX 1PKLA 4BQ2A 4NRRA 3ZT5A 1EUNA 2ZX8A 1E43A 3VUSA 5F1UA 1VLIA 3TYAA 3TU9A 4LUTA 3B8WA 4TMCA 4ZXOA 3U5UA 5I2UA 2CNCA 4WIWA 3BZJA 3R12A 1S1RA 4UMBA 1WUEA 4R7JA 4J4KA 1KB3A 2UY2A 5FAGA 4IXXA 3MMUA 2OYKA 1ZP4A 5FIPA 2Z27A 1S2WA 1JRCA 3EA3A 4YYFA 4AB4A 1JUKA 1ELSA 1GONA 2CC0A 3PF3A 1GWJA 3WLOA 2FLIA 4C6QA 4DLFA 5BCAA 2ZC8A 5D8ZA 3EMQA 1BTMA 4JIPA 2WKLA 3VGFA 1VLWA 2P1FA 3H7RA 4D71A 3MT1A 1QTWA 1XIFA 3UW6A 3FXGA 4JX5A 1NWTA 1OCQA 1QOQA 3DU0A 4MGGA 2R82A 4O8AA 3W7DA 4AYSA 3KVJA 4PUUA 4FXJA 3FYOA 4R34A 3UCQA 3URQA 3G18A 1YEYA 2JE8A 4MB5A 3N2BA 3W85A 1TPEA 2DGAA 2ZVRA 3GVWA 2QDHA 4GYJA 3D47A 4XIAA 4GACA 3PS7A 1BEUA 4AD5A 4JTHA 1NJJA 1X96A 2HISA 3ARTA 4LAOA 1AW2A 4LAKA 2FVKA 3EDJA 1B3XA 1KTCA 4EACA 4L1GA 4YMZA 3IGUA 1J0JA 3B04A 1MXGA 4FOKA 1FX6A 5DX7A 3OODA 5K2ZA 1FQ0A 4H9UA 2OZ3A 4GI8A 2ZZ2A 2NQ9A 4F2UA 1AW1A 4NASA 1XDMA 2CWXA 2IQDA 1OZQA 1F4HA 2VVNA 4V33A 2NXIA 1MSSA 4J2PA 5CPSA 1PKYA 4EKJA 4PL1A 4UUIA 2FZDA 2E1WA 3LD5A 3R5EA 1F8MA 3TW6A 4DWDA 3CH0A 4JCLA 4B4FA 1A50A 4ZGYA 1SW3A 4QROA 2Z4GA 3O9NA 4HPXA 2DVUA 4EXQA 2HBXA 3HOJA 2IUZA 3QR1A 1TB3A 2BASA 2Y61A 3MCOA 4QHRA 2X1IA 4NZFA 3UF9A 2CZ5A 1TVPA 1D2KA 3ZLFA 3HPZA 4HHHA 3GDKA 4HYRA 4LVFA 3FS2A 3S2MA 1KM2A 3AALA 3KDNA 2DFAA 2NVCA 3CL8A 3VDBA 4Q8TA 5DLCA 4EXBA 4M1RA 2FJKA 1KC7A 3WH8A 4ZMGA 4ATWA 1DXFA 1W5NA 5GJMA 3TLQA 3CAWA 3RIKA 4PMDA 1T41A 2PDJA 3I3EA 2BNJA 1W5MA 4MKSA 1Y7VA 1F5ZA 1ZJIA 2OQYA 3P8IA 5D9NA 1OINA 4XV0A 1EX5A 3PZIA 1VBHA 5DMMA 3QY6A 4CKQA 2PP0A 1OF8A 3VOFA 1TPB1 4B5UA 4QISA 3OO2A 4PC8A 2WM0A 1GGOA 1JCNA 3IGHX 2ZRXA 1M5WA 1QATA 2VNCA 3TA9A 1NAL1 3MPGA 5AKQA 2R14A 1K02A 1V0MA 4JIEA 1POJA 4J5NA 1LL7A 3CU2A 4FNSA 3QZEA 1RK6A 2J66A 2V2CA 1ZU8A 3TYZA 3TYUA 3GHSA 2V9DA 5A8OA 3ENLA 3GXPA 1FCVA 2WVTA 3VD5A 1H5YA 3M0JA 3W1AA 2XIJA 3M0KA 2ZE3A 4ML4A 4UMCA 4XUYA 1NU5A 4DUOA 3UCDA 2J6XA 4KIRA 3JZUA 2QV5A 4JQ1A 3UYIA 1TWIA 4IMFA 4PR4A 2YCIX 2R6OA 4K68A 3TJIA 4OJYA 3ATYA 4NXSA 2YLAA 1QHOA 1ZP3A 1V3MA 2GJXA 3QR3A 2A7RA 2E6YA 4X3ZA 2YB4A 3V7PA 3NGJA 3BLKA 3PN8A 3ES7A 4Z2GA 1LL4A 2O0TA 4L65A 1XLAA 3UG8A 1J4EA 2XIMA 1UD8A 5BXRA 1VFOA 2V0TA 4A4AA 4L64A 1W1TA 3COTA 3GTNA 4GI4A 1Q6OA 3U3HA 3B4UA 3QFWA 1R8LA 5F4SA 3WZ0E 1XYCA 3DECA 2VEGA 3WNPA 4GIRA 1O4UA 3W2KA 5T91A 1R7OA 5LIUX 2R1NA 1W37A 3GVGA 3NEHA 1H7NA 3VNIA 3E0WA 2P50A 1W5QA 4ERIA 2HROA 2BHZA 3FLUA 1KBKA 1HO1A 2VOTA 1JZ7A 3BK0A 4PTMA 1HO4A 5C71A 3R1ZA 3S6DA 2HS6A 3Q65A 1U5JA 5M5DA 3LV6A 4FX6M 1FHDA 3GB6A 3KCLA 1PZ3A 3RCMA 5LNRA 1V6VA 4JEQA 2QJGA 3QVQA 1F3WA 2VFHA 1DIDA 3S5NA 1ISYA 5CZ0A 1WDDA 2Y1HA 3BG9A 2PGFA 2C0AA 4JN6A 1ME9A 3B06A 1POKA 3USZA 5LXEA 4ICMA 4WGXA 1EGMA 2XWEA 5IRPA 4HNTA 2BBFA 3LPFA 4HOXA 1L8NA 3LEPA 2PDXA 3FVDA 1XSKA 4WSJA 1ZLPA 5CLTA 2E77A 2E9BA 1V6UA 1CGTA 2VGBA 3WLTA 3R25A 1CXHA 3IUHA 3B9AA 5CGMA 1M6JA 5GNYA 4G1KA 5D38A 2BHYA 1OFDA 4Y8EA 3WQVA 5C2CA 1TRIA 3QV9A 2VKZG 3RRXA 3W00A 3AWOA 3PB2A 4J1OA 2VGGA 3NZGA 1OZMA 4GYFA 5XINA 1R5YA 3DCPA 4DI8A 3G3DA 3GNXA 1YPFA 3LQLA 2HK0A 4IQEA 5AFDA 1KM1A 1KFJA 2Z6JA 5KZMA 3SCNA 2VP8A 4EPKA 4JHZA 3SQLA 2FFIA 1XIJA 1C93A 1VHCA 1KNWA 5CQ1A 4OFCA 3PUDA 1LYXA 3T0CA 3DBNA 3DHDA 3CIWA 1P7TA 3GS6A 1B0IA 1SM9A 2NT1A 4TR9A 3GLCA 2FPVA 1ZS2A 2QPXA 1IQ8A 3EPNA 2J8GA 1BVWA 5TD4A 4Q32A 3H2AA 4FAMA 2A3CA 4MVAA 3W82A 1HG3A 1EC7A 5I06A 3MWCA 2J74A 3W29A 3PJXA 3CLMA 3A5FA 3GVVA 3PJTA 3C61A 1UP2A 4PEKA 3T81A 3E1F1 4ZQPA 1XIEA 3GU1A 1SR9A 1ZBCA 4QAWA 4PRWA 2ZE0A 2WMHA 1E5JA 5CKSA 1UWRA 1LOQA 1WE5A 2VFGA 3G1RA 2V5DA 3DIPA 3FX4A 4AD1A 1LROA 4MM1A 4O19A 2NXHA 2J7EA 5TAOA 3N2XA 2J77A 1S5NA 4NL1A 1VFLA 1Z6KA 4WLCA 4XSMA 3WMLA 4C6MA 1HUVA 1Z9AA 1IF2A 1L6WA 1E4MM 4Z2IA 3CMJA 4FR6A 1V3IA 3G5EA 5U7SA 3LSBA 3RXZA 4XZMX 1Y5VA 2XH0A 4MY8A 2VEFA 3W7QA 1YXCA 4OUEA 2VD8A 2FZ9A 3MC5A 3WJZA 3I10A 3GQYA 2J8FA 1MNSA 4QP0A 5C5YA 1MRQA 3L65A 3U5YA 2A7NA 2Z7GA 3NAVA 4KPLA 1UH2A 3CT2A 2REQA 2Q8ZA 1GEQA 4MPQA 4POCA 1UOZA 4UFMA 3ZWSA 1O5KA 3ZJ7A 2ISSA 4HMCA 2AL2A 4CU7A 4GUIA 4Y8FA 1OABA 4JQ3A 1VAHA 3MUAA 4UFHA 3SCSA 4HNOA 4O28A 1GEHA 2J47A 4ATLA 2E09A 4H2HA 4MB3A 2VQUA 2DIEA 4E2DA 1HTIA 4UFIA 1O60A 4HA1A 3FDGA 1UMYA 3QYQA 5TNVA 2CETA 4HNLA 4CQBA 4ZQOA 3IGXA 4IF2A 4O0QA 1KCKA 4F0RA 2OLHA 1UD4A 1UD2A 1TV7A 3CM4A 4RE2A 5AYYA 3TCSA 3OZPA 4YS1A 3ZVHA 4LUJA 7REQA 2VELA 3TZNA 2QT3A 3M7WA 3ITYA 4G8TA 1VHNA 5A3HA 3WFLA 1UH3A 2I9EA 2J6VA 2D0FA 1WAWA 5C9XA 1R3YA 1LDCA 4AW7A 5HANA 3LLFA 3KXQA 2W67A 5DCBA 2GLKA 2F7FA 5EPDA 1LLZA 3V5FA 1P6WA 3NM3A 3DGBA 3VIOA 3I7RA 4UR8A 3W87A 1OC6A 1WUFA 3BLIA 3E38A 4NAFB 3VMPA 4IICA 1SU5A 1MZHA 3LLXA 2WNZA 1L9WA 4K38A 4MB4A 2YW3A 5HNNA 3NQBA 3W7HA 4G5DA 4MAZA 2GDVA 1WPCA 1GORA 2AQVA 2X40A 3G0XA 3PZOA 1W3JA 1N2VA 3EWZA 4C6IA 4NX5A 3SY8A 5DY3A 1U5VA 1DWGM 3NPWA 5G1MA 2VC9A 2B0MA 1G01A 4MNLA 4PUDA 3A23A 4JHOA 3IACA 4P7NA 3T2PA 1SFLA 3M5VA 1JD9A 4GE8A 4DBDA 4ZEPA 4UNKA 3E0IA 1V79A 3QTGA 2QQ6A 1SVDA 3TNBA 4PH6A 1LG1A 1J6PA 2QIIA 3NSXA 2QCLA 2FVLA 1GNXA 3LLDA 5FEWA 2VEKA 4R9XA 2QCMA 2QCDB 1RH9A 4W88A 1DE6A 3CIXA 1TSIA 1GT8A 1OX4B 1F2JA 1I4NA 4AD4A 4PBEA 1P0NA 3LPGA 1O5RA 2JF7A 3W1MA 2GGJA 3EDEA 3BE7A 3GU9A 3NL5A 2XIQA 1DWFM 1LCOA 1UROA 3P7YA 4UQBA 5LIWX 2DVXA 3FNDA 3CL6A 4PUMA 1OG0A 4XWUA 3TN3A 1T5AA 1H7OA 2PDWA 1WXZA 4F4RA 2O9PA 1TX0A 3R2GA 3MA8A 2VRKA 3H7VA 1XLKA 2C1GA 3L0GA 1XBXA 3R0DA 3WLIA 1NDYA 4YIWA 3S5ZA 5E0FA 2QPUA 2OKOA 3O6YX 4KESA 1IEQA 2YCJA 3CWNA 3O0FA 1O1ZA 2FZBA 2V82A 3ALFA 1FKXA 1X7IA 4CD7A 4A8IA 4FB7A 1ITUA 4I3GA 5KZDA 3EWUA 1I1XA 4G7EB 4XG1A 2I16A 3C0SA 2DZPA 1BAGA 3ARVA 3S1WA 1FCQA 4UTKA 4Z2KA 2GQAA 4IGHA 3M44A 3ONCA 1EA0A 2WK2A 2UBPC 2J7GA 1JJKA 3UJRA 3TIMA 1KW1A 4C90A 2FGZA 1TPUA 1FWHC 3MWAA 1B30A 1XM3A 2YPIA 4XD3A 3WBXA 3RUBL 3NOYA 2D22A 1XHGA 1YIXA 3CQKA 3LHTA 2P3ZA 4B5NA 2OPJA 4LPCA 2XFYA 1TQJA 2VVSA 4WF7A 4PB5A 4WKHA 5TQLA 3A3HA 1EZ2A 1FWIC 1L6GA 3VUPA 1H3GA 2INFA 5BXSA 1DOSA 4F9DA 1TMHA 1O6IA 1R86A 4EPEC 5D9MA 3EOEA 4M6PA 4V1YA 2YXOA 3AHZA 3ZLGA 5LYRA 3GU2A 5HJLA 1UR0A 4JTUA 2FHCA 2V5LA 1JZ3A 4BFAA 2AMXA 2E1DA 3B0XA 1VFMA 4O1CA 4DEFA 4GY7A 1EOMA 3E2QA 4RV8A 1T0OA 1T7LA 2DIJA 3ZT7A 1FWTA 1KRMA 1W31A 1NFGA 1IT8A 3RYSA 2D24A 4IJBA 4O16A 2XIIA 3HPSA 4JHMA 3DG6A 2W61A 3WH6A 3DFPA 3EDKA 2CU0A 4NJKA 4DI9A 1IZCA 4B15A 2C0HA 5EFFA 1X97A 4TTUA 1C3FA 1XINA 3TOPA 3ARQA 5HNTA 3ITLA 1BXCA 1VFFA 3R8GA 3CZKA 3AS3A 1ZAIA 3UT0A 4BQ4A 3WBYA 1XXXA 3CYVA 3QZAA 3SCTA 2G41A 4GYKA 3VKDA 3N17A 4JTQA 1XYAA 3L5AA 1P0EA 1XYFA 4C7DA 5EMKA 1JZ4A 1KM5A 1C91A 3NL3A 1CZ1A 2FTPA 3ARUA 3GTXA 1A4MA 1OF6A 2Y62A 1R87A 3LN3A 1EF2A 4ACZB 3WF4A 2WQPA 1UPPA 4Z0SA 2XH2A 2G8ZA 3W72A 4FPSA 1WBHA 3E3HA 4L56A 2OSWA 1L6SA 4TIMA 5CCZA 4P2VA 2BVDA 2E5CA 3OG2A 3UGRA 4IHCA 2XPKA 1X6NA 4GZIA 3O15A 1I2PA 5LIKX 3MB9A 3UNDA 2VDIA 1E1CA 2JF6A 1SZNA 1IEVA 3LK6A 3O0KA 2QLYA 1BTCA 4ZODA 2ABAA 4O52A 3N4FA 1M7JA 4IG2A 4FA3A 3IJIA 5BOOA 4AFYA 1FP9A 3VCRA 2WPGA 3QSRA 3BV4A 2HPMA 4AZ6A 2ZRWA 1WZMA 2PP1A 1LLOA 2YDQA 4M7SA 5A69A 1OHLA 5CJMA 3UEQA 4E6MA 4D6DA 3N9RA 3ABOA 2QNEA 2XHYA 4YJ5A 1Q6GA 2OT1A 2WM1A 3PJUA 2DZUA 2DORA 3WFZA 1WOAA 4XKMA 1EDQA 1W8SA 3NUKA 4F0KA 3EA1A 2PGRA 5C6MA 3EB2A 3W81A 2PAJA 1XD1A 4WOQA 4WKAA 5FJJA 4IMAA 1S5VA 1GPWA 2D0GA 4NILA 1OFPA 3THQA 4V15A 3NZRA 1VYSX 1RA5A 4G9PA 4HGXA 4DBSA 2BY2A 3URBA 3DBPA 3S46A 4AWUA 3OG3A 1R6WA 1ZNNA 3WQCA 2PRLA 1SO5A 1GVEA 1Z3NA 5LNWA 1O5QA 2PWHA 4NF7A 2GUUA 3BTNA 3PFRA 4WEVX 3C5QA 4ERGA 4LC8A 3A12A 2HNEA 1TV8A 3V3WA 4EOUA 2WSQA 2E5BA 3VD7A 5LXXA 4HB7A 1WO2A 5DT7A 4L5ZA 1UR3M 4KWVA 3A3WA 1HJVA 1R7AA 3IVTA 3RF9A 3M0HA 2WNQA 4R88A 1OM0A 2KX9A 2MUCA 3WUFA 2OOGA 2GQ9A 1E70M 4LAMA 3BXWA 5J8LA 2Y7FA 5AB3A 3RX2A 5H8MA 1VPXA 4KCWA 2GFTA 3KBWA 5CC5A 3AIEA 1WDWA 2V5JA 5I23A 3LOTA 4LRTA 4HCDA 1R9ZA 3P60A 3C4UA 1QPNA 3STEA 3A22A 5AVHA 2FYMA 4M80A 2E6DA 3KTSA 2V67A 1Y8BA 4C91A 1U1UA 1UD5A 1XGDA 4I7VA 1G4TA 3VXGA 4LU0A 2Q01A 3MP5A 4MIMA 5DMLA 1E6NA 2UY3A 1O7AA 1KCLA 1IR1A 1MQQA 3WNNA 3DKLA 2PDGA 1PIFA 4URIA 1R3WA 5FL0A 2EKCA 1JPIA 4KEZA 4YLWA 3GX9A 1NOWA 1BGGA 1AD1A 1N8WA 4Z08A 1TTPA 1EIXA 1P6BA 1UKPA 4NYYA 1OYBA 4KF1A 4C6FA 2XWDA 4IIHA 4DF2A 1A47A 2P0IA 2RKXA 4C1NB 3A24A 3IJ9A 1XUZA 2FB3A 1EQPA 4Z1BA 3NPUA 3B05A 2FDSA 3UPWA 1VIWA 2A1YA 2PDLA 3NQ6A 3DYMA 3OGVA 1M53A 1M41A 4AWSA 3W01A 1B9BA 7ENLA 5AVNA 3CL7A 2J27A 2ZA1A 4X2RA 4LTSA 4O15A 2BG5A 4WK9A 1RQBA 3QY8A 2PDBA 1J5SA 3UR8A 3W1LA 3DHUA 1AK5A 4Q6XA 4OGZA 3CAKA 1KR0A 3AXKA 4LGXA 1JDCA 4WSHA 2Y5JA 3QJAA 3S9YA 2WZTA 1JQVA 5I02A 3ISIX 1Z7AA 1DWIM 2G3NA 5I7GA 3V5CA 5KITA 2V3FA 4G6CA 2VZTA 4L9ZA 4K2SA 3MO7A 1J0KA 2D20A 4JFUA 4DVOA 4Y9PA 3FJ4A 1O95A 5I03A 3WENA 3UNTA 3QPZA 1FWRA 2V68A 2P76A 5AN7A 4FOUA 4ZVJA 2Z6IA 1UD6A 1GQLA 4E0CA 3IAQA 4DBWA 1K4GA 1RCQA 3CV2A 3MZ2A 1XRSA 3BO9A 4MNJA 4HOWA 1WA3A 3AC0A 3BQ6A 3PTQA 3W38A 1DWJM 1IT0A 2ZUMA 1XLDA 4MY9A 2WV8A 3FDKA 3F2BA 4PYSA 2XG9A 1KXHA 4OWGA 2PDCA 2J7BA 3G1FA 2VXNA 2EPKX 3RMEA 4S3KA 4ZO9A 1VYPX 3CV7A 2PP3A 1VYRA 3OLEA 5GVJA 4AY7A 3EMZA 4WY0F 5FESA 4JDYA 3K1GA 3PPFA 3UU0A 3B4YA 3DC0A 3AHXA 3RPMA 3QQ1A 2OU4A 1UR9A 4Z1YA 5FSDC 4ZOEA 4EANA 1JPHA 4GI9A 1H62A 1GOKA 1QW7A 3L2MA 3DESA 3GNRA 1BRLB 4U10A 2O9OA 4JYEA 4K3ZA 1L0PA 3U9IA 4V2XA 2BS9A 4GABA 3TQPA 1IWAA 3NQ8A 2GJLA 3STCA 4TXEA 2GOKA 4N0RA 1E0XA 3T8QA 4HZ8A 1RCOB 4Q7NA 2Y4SA 2PU1A 1KM3A 2E7FA 5C2XA 4LXFA 4GVGA 1PBGA 1ZAHA 3JS3A 2VC5A 4GJJA 5HULA 1CI1A 3DAQA 1JI2A 2ZUUA 5G5IA 2RUSA 2EBNA 3SIZA 3AICA 1BVNP 3I7SA 1QK0A 2C6QA 3C2VA 4H7CA 2ZX5A 3ME3A 5EU9A 2WHLA 3W7IA 2YA0A 1W8GA 4W89A 5BMWA 2C16A 3CZ8A 2HE8A 1US3A 2O92A 1PHQA 3WG6A 1BGAA 4GVIA 1EO7A 4FK9A 4UR7A 4AG0A 4DF1A 1YDOA 5EMJA 3QMSA 2YDSA 2ZXDA 1WP6A 3R11A 4S2CA 2VC6A 4JTDA 1M65A 3DC8A 4MJMA 3W7MA 3PANA 4AWEA 2JEPA 3LNMA 2VGFA 3CPUA 2WO5A 4DM2A 5K4XA 1L2UA 2Y2WA 3JVAA 1QI0A 3MVIA 3M0VA 3VKBA 2IPFA 2IXUA 3CEPA 4E3VA 4JNZA 4MNMA 3W7CA 1QI3A 3PFMA 5DFAA 3L67A 2ZZ3A 1AJ2A 1K9DA 4DIAA 1XGZA 3RLGA 3LCXA 3LX9A 4M6VA 2W91A 2VGIA 1O5XA 2FH6A 4DJED 1HJUA 2PUZA 4NAEA 2PDHA 3N15A 1KFWA 4H6RA 3IEBA 1I6NA 4ZQNA 5C7VA 2BWGA 1V4YA 3ES8A 1W3KA 2CITA 4H8NA 5HINA 2J62A 1KFCA 2O4QA 4MLJA 3MZNA 3M0IA 3P74A 4DHGA 4PBGA 3BSGA 1CGYA 3PR2A 5DRIA 1AVAA 5I78A 4RZ5A 4X2PA 2GSHA 3OW1A 1UJPA 1Q63A 4L80A 2CEQA 4IUOA 3IK2A 3QM3A 3OP2A 4O18A 3F4NA 2V3GA 1RVGA 1FVPA 2AQWA 4KEVA 4D72A 5IHRA 3IIPA 3GSMA 4H9VA 2HWGA 2GUBA 2X7WA 4AHQA 1AMKA 2PWUA 4DO5A 3VIPA 1HL2A 5T8GA 4YTSA 1O12A 4Y9OA 1QFEA 3TR2A 1EPVA 2HSAA 2VT0A 4L4PA 1Z42A 1IV8A 1VBJA 3H54A 4Q4OA 3UERA 4TV5A 4GXMA 2C8NA 1J8VA 1N7KA 3TMQA 3OIHA 3TTYA 1XCXA 2QCCA 3T44A 4XZHA 2WQDA 2GOUA 3CAQA 2FB2A 4L9YA 2VC7A 3CTLA 2AKZA 3URAA 1RK5A 2ZWZA 4R33A 4GA8A 1YW1A 4WOZA 4ZTXA 4NI3A 2Q02A 2DW6A 2E0PA 3SGUA 3EOLA 3GBDA 4FHAA 4H9MA 4MADA 5H8PA 3NQEA 2EG6A 4TUFA 2JIEA 4GINA 3V75A 2BOGX 3GBEA 2FPYA 2BLEA 5T9BG 3O1NA 2UWFA 2YCEA 2ZZ1A 7XIMA 3AXHA 4QITA 3WLMA 3RAOA 4RE0A 4MKNA 1XYMA 1MW0A 1T6MA 1PXGA 1UYQA 4Y6GA 2D73A 4QS5A 5FOOA 2G3MA 5I3IA 1JRBA 1TWDA 2I5GA 1OK6A 1DHKA 1K8YA 1TVNA 1DE5A 3P2VA 3IPWA 1QK2A 1ONEA 1H61A 1THFD 1DVJA 1TV2A 3L66A 5LGXA 4GUFA 2WBGA 4JFTA 3WF3A 2VWTA 4FNRA 3BG5A 1HNYA 5A6AA 2W5FA 2QPSA 3TX9A 4Q7IA 2EPHA 4ATDA 2BX7A 2ZTKA 1QI5A 3AIBA 4YWSA 1JDFA 4KRTA 2J7FA 1ZENA 1FWAC 4HA4A 3O6AA 3VGBA 5IFTA 1YHTA 1EJVC 4O0ZA 2WHMA 4GX8A 2F8QA 4ZSUA 2FTYA 4GHRA 3TJLA 5AYBA 4KGJA 1PUDA 4RZBA 3H4WA 4Y90A 2HMCA 1Q6EA 3OIXA 1I2QA 3KVLA 5D2WA 3EX2A 5A6BA 3VDGA 4JNYA 1X8CA 1E0WA 4BS0A 4D6FA 3GW0A 2XZ7A 5TBOA 3QQ0A 3TSDA 4GGBA 3WD1A 4HU3A 1FWSA 1U83A 3KBJA 3B40A 3C3UA 4RNJA 3LHVA 1Q45A 4P7OA 2FFCA 4DJDD 1U5HA 3PSVA 3SCUA 4LCQA 2C1IA 4HA3A 4PL2A 2W27A 4I7UA 3WDRA 3B9OA 1KCXA 4US5D 3NO3A 1XSJA 4AD2A 1LUCB 2E40A 4U33A 1ZGDA 4LC6A 3GH7A 1BXNA 3II1A 4ZQMA 4WHBA 1CB2A 3VIJA 4AU0A 3W73A 4NXKA 3AYVA 1YNQA 4CVUA 2PRMA 4L1XA 4O13A 2BY1A 3G8EA 3LS9A 1E55A 2YCLA 4P8UA 1EUAA 1GTEA 1GPFA 4IP7A 1ZBVA 1P48A 1V77A 4MHBA 3AS2A 1K9TA 1NF0A 1RQHA 3B3DA 3LXCA 4ZO7A 3QRHA 1H7XA 4QG6A 1LOLA 1LRNA 3QKZA 2VOMA 3Q58A 4V28A 4A3QA 1WB0A 4HNUA 9CGTA 1XL9A 2ZA2A 1OFEA 4I9TA 4AX6A 3RLUA 4CN6A 4XVEA 5AC6A 2HXTA 1ZRQA 3NQDA 4QSFA 4O1FA 1E0VA 3L68A 1HKIA 2E9MA 1TV5A 1EO5A 1XLLA 4PUKA 4U2YA 2XVKA 3S2NA 1VKFA 4HTBA 4YXGA 2PTDA 3VIFA 1OFOA 2BY3A 1I1WA 3W25A 3BLFA 2EAWA 3M16A 2AGKA 2PWEA 3W26A 4REQB 3PSWA 1JZ8A 2DZWA 3WMSA 4BEQA 4PUJA 3GVRA 4BQ5A 3I3DA 2GVGA 4DYJA 2YA1A 1JXJA 4Q33A 4NYUA 5AY7A 3EPMA 4QAIA 3RJXA 3WELA 2E28A 3VIMA 2E68A 3THCA 4CQAA 2C15A 3MSYA 3K13A 3KCJA 4H83A 1VH7A 3TWBA 3R0KA 3ELFA 5C70A 1XIBA 4INFA 4GIYA 1NQKA 3W7EA 4XISA 4MYXA 1DXIA 4AZCA 4LY8A 4O53A 1XX1A 1V3KA 2E9LA 3G1DA 5I3GA 3FJNA 3CTTA 5JBEA 5JIPA 2WLYA 1JL8A 1OGBA 5A6TC 3GXMA 4JFSA 2OXNA 2OO0A 1IXOA 3VU2A 3U0HA 4PMYA 1DXEA 3BOXA 2DP3A 3K8KA 2QIWA 4DQWA 3VNMA 4NY2A 3S5SA 4XSLA 3ERPA 3P0WA 3WIJA 3QC3A 5AZ0A 3CYJA 4HMDA 2G50A 1XIDA 1GG1A 3R13A 1JR1A 1PSCA 3UR5A 3DYOA 2I57A 3UA4A 3VD4A 1H63A 3DI1A 4IMGA 3C0QA 3CQJA 3EXSA 2QEZA 5I24A 1TR1A 2CLIA 3GR7A 4PB3A 4ADUA 3ATZA 5AOUA 4QLKA 4B5SA 3RR4A 2A3HA 5GJPA 4ONVA 1E15A 1MXDA 5RUBA 2WC7A 4MDOA 2CZEA 3GAKA 4E4FA 4H7ZA 2WVSA 3W1UA 3PM6A 3UGVA 1ITQA 4JOMA 3A9BA 4UFLA 2GDQA 1EJXC 6XIAA 4I9MA 3RO8A 8CGTA 4EF9A 4L6OA 1WQ5A 4L9XA 3BMWA 1KFBA 1TV3A 1CW2A 4GXPA 1EA9C 1XG4A 4U5KA 3HBLA 3CK5A 2H9AB 3VI2A 4O1BA 2IPJA 2RDUA 2TODA 1JFHA 1WZLA 4ZA0A 5EKYA 4UZSA 1X7FA 2XIOA 4IPPA 4YWIA 4JL1A 1MO0A 3A13A 2I9UA 3DFSA 1I0BA 4S3BA 2BVYA 5HK4A 1JDEA 5D2VA 3IRDA 3BL3A 4YYCA 3QH2A 3RJYA 3VAVA 2HVNA 4OBTA 2XSAA 1K6WA 1L6YA 1TX2A 2FMNA 1ENUA 2TAAA 1A0EA 4G2DA 3T2QA 3FOKA 3GC2A 1CLVA 1IXQA 4GNJA 2PZNA 2ICSA 3UY7A 3V1PA 1AZ1A 2XZ9A 2QHAA 2ZXBA 1Q2RA 3WLPA 1RJPA 2ZOXA 2VZVA 4WGHA 3AMKA 2H8ZA 3WJWA 3MJYA 1EWDA 3GW3A 2E8YA 3E12A 3Q4DA 3UZXA 3W37A 3EB3A 2OEJA 4LUTB 4HU0A 3SFKA 1E6SM 1S46A 4NX0A 3VFCA 4P7RA 4H19A 3CT7A 1FA2A 4WXZA 1AZ2A 4EIVA 2PU0A 1BRLA 4GO9A 1Q6FA 4AIEA 5AHEA 4MWAA 1X8FA 4PMQA 1G4SA 1OT1A 2INEA 3LGGA 3LXAA 3TYCA 1F3TA 3CBWA 5JQ9A 2BVTA 2LLEA 1F74A 3N04A 1EH9A 1QT1A 3E6EA 4DZIA 2X8RA 4CD4A 3TA6A 1EBGA 2V30A 5CSYA 2XISA 2VZOA 3UZZA 2DJLA 2PDPA 4J28A 5FEXA 4IFRA 4EAMA 1E5NA 3PBGA 1TJ1A 5H91A 1E73M 3T55A 1J10A 4KEUA 2Z1SA 4DY1A 3UG3A 2DSZA 4DELA 2QMKA 4AZBA 1EL3A 4W8LA 2GL5A 1UWIA 1OT2A 1TPC1 2YYTA 1JPMA 1XD0A 2HE5A 3Q45A 4IIDA 2X41A 3DKJA 4YHGA 5E70A 4O4WA 3OQ8A 1PDYA 1IGWA 3PNUA 2VDHA 1ISZA 3C2YA 3TROA 2ONEA 4WJXA 3W6YA 5MHBA 2VX6A 2GGIA 3M5YA 3KW3A 3CGTA 1YKWA 3PBYA 3LPOA 1V7AA 1I75A 1FOBA 1KBBA 4FIQA 1XDJA 3AS0A 3W22A 2OQHA 4Q8NA 4S23A 4YHEA 1FKWA 2PDUA 1WXYA 4A05A 2R1KA 3M6DA 4BR1A 4FOJA 1UJQA 4HMNA 5BXTA 3AS1A 2GQ3A 4PCFA 4RDVA 3ZWTA 3F5JA 5D04C 2QJIA 1PEZA 4WVXA 1EQCA 1EP3A 1W5PA 1US0A 3K4DA 3B8VA 3PVFA 3GYEA 3KCOA 1A3HA 2X2GA 1SQ7A 2IXVA 2D3LA 2G0WA 1VFTA 2O7QA 2RHGA 4MJ2A 1OGSA 1V93A 3VOGA 4B3LA 2FZMA 4YTUA 1A5KC 1IEWA 3GR4A 3LDVA 4ORIA 1LG2A 4GQBA 3SCQA 1S2VA 3GAYA 2WHJA 3LHZA 4IMCA 4O50A 3PJWA 1GOOA 3CZEA 1TZ9A 3KAOA 1E6QM 3GO2A 3ONBA 5EY5A 2ZRVA 4AYGA 3G6LA 4FXSA 1NF7A 2X2YA 2VO5A 3DG7A 3BG3A 3ITOA 1ZJHA 2J7CA 1CGVA 4DAIA 1E71M 5EBAA 3W02A 1GOXA 2DZSA 1JG9A 3GH4A 2FVMA 5BRQA 2WMIA 4EPDC 2AMGA 3W07A 1V6WA 4AVNA 2J13A 3KHJA 5CLWA 2X1TA 4DBUA 2WWCA 1QNRA 4J3VA 2Q71A 1WNOA 2C7FA 3WDPP 2UY4A 4LB3A 4KKXA 4B5WA 4H6KA 3EOSA 2OYMA 4PZVA 2GZXA 3KL0A 1HW6A 3APGA 5DANA 1P0BA 4H41A 2GGEA 1NDWA 3AYTA 5G2WA 4ML9A 1UUMA 4F0LA 3KUMA 4IL0A 4W7WA 3FYPA 4D1JA 2A3AA 2R1PA 1CXLA 2Z1BA 2WNNA 4UIOA 3V0SA 3GD6A 4MSSA 2XSBA 3CUJA 1JPKA 3M0YA 4UZUA 5CSSA 1RY0A 3MS8A 3WD2A 3SB0A 1PHWA 3C8FA 1MDRA 1M9HA 1MEHA 3U57A 2YL6A 4AY1A 2IPGA 4PCPA 2XN2A 5DO8A 5IFPA 1VJIA 2CKRA 2GJXB 2DVTA 3RG6A 3LM3A 1TZ7A 4ZOBA 3QGAC 4D6IA 1TPWA 4DZ5A 5CEWA 3O6DA 2CWNA 1Q6DA 4O1AA 3OVPA 1LWIA 3KBMA 4BEUA 3DFQA 3M9YA 3TAKA 5AC4A 4CN4A 5B7ZA 1SJDA 4ZL1A 3P14A 3SY5A 4K7VA 3BMXA 3WF0A 6CGTA 1LTDA 4EX4A 3ITCA 2IQ0A 4R85A 5FF0A 4CEXC 4QEEA 5ABGA 2NUWA 3VVGA 5J5RA 1UKQA 1XFCA 4IFKA 1V02A 3BW3A 2PTXA 1YX1A 4RX0A 1NOUA 2DDXA 3EGJA 3PP7A 1HJWA 1AQHA 4BK9A 1LL6A 4J3WA 4QFUA 1SW0A 2A79A 3ZR4A 1LJYA 3W24A 2PS2A 2Z1XA 1MWOA 5FI8A 4J2MA 6TIMA 1CNVA 1T96A 1BG9A 4LF2A 4XAZA 3CHDA 3RLVA 4DNHA 1NELA 3FKRA 2D2JA 1AJ0A 1QOXA 2ACRA 3KRSA 1PB0A 3HPXA 2XGBA 3RPDA 2QXWA 1UIPA 1JZ2A 1ONXA 1IR2A 1H60A 2YIHA 3FHQA 3WQ6A 3VNJA 4TVCA 2ZRZA 4Z42C 3DOPA 4MLRA 4TX6A 4ZSTA 4FNQA 3QMRA 2ON3A 3WDJA 2QVHA 2YL5A 4PA8A 4K6AA 4ADSA 2GGHA 4Z0JA 3FA5A 3GYCA 2DQWA 1UW9A 2GJRA 1E6ZA 3Q67A 3QQWA 1Q7MA 4ZE4A 5LNSA 4JTRA 4DWSA 4HA0A 4H2CA 4US6A 4A8NA 5EMYA 1CLKA 2BVWA 2EPMX 1XRFA 3GXFA 1PX8A 1WKEA 1JVNA 2D3NA 3AISA 1S1PA 3LMYA 2J9XA 4KRZA 4MPKA 4X0NA 4KWUA 1LF1A 4XZNX 3FVMA 1VP5A 1J12A 5D8WA 1BD0A 3VGGA 3BSMA 4B5VA 3THAA 1XFBA 2OG9A 3R79A 3TP4A 3KHDA 1U30A 2ZQ0A 3Q94A 1P7TB 4JY8A 2J79A 3NCOA 8XIMA 4JL2A 4N9EA 2W3ZA 3IARA 4QRNA 4GH1A 5GJNA 2GVJA 3LYEA 1HZYA 3PZQA 7TAAA 4S3DA 4AEOA 5H8UA 1UH4A 1DQUA 1W3IA 3WJYA 1K7FA 5BW6A 1GTHA 3LSCA 1ESWA 3VNYA 5BYWA 3T6CA 4GFIA 3T08A 4D6EA 3QMTA 4AZHA 1SFJA 3CMFA 2CW6A 4D1IA 3KLKA 1AFSA 3HF3A 3AWNA 2H6RA 1EJWC 4J3ZA 1UC4A 1NDZA 4K1GA 3HG2A 3DFTA 3APTA 4PMUA 4TVDA 3AOFA 2ZWYA 4IPIA 5A8GA 5E6ZA 4Q4QA 2Y5EA 4JICA 4GYPA 3LMZA 5BXPA 1JCJA 4Q8OA 1B3VA 1RBAA 3THUA 1BYBA 1P43A 3OVGA 4XAFA 1QNPA 1QAPA 4G1NA 1AD4A 1RLCL 4TVUA 1FWFC 3SGGA 3KVMA 4MWAC 1QR7A 1KV5A 2I5QA 3U7VA 4HK6A 2AQOA 1RY8A 3XIMA 4QBXA 3W88A 1FY6A 4LYPA 1O66A 3AHVA 5GQBA 3GTHA 4S3CA 5IDZA 2REQB 4XTIA 1M7PA 4F48A 3TTOA 4B2DA 2QGYA 2DY3A 2AL2B 3E0FA 3I6TA 1REQB 1FWGC 1J6OA 2PTZA 2NQLA 1CYGA 4AX7A 5DBTA 4HSHA 1IHIA 1LQ2A 3W9ZA 5MKGB 1C8YA 3S9ZA 4M19A 4W9TA 1XH1A 3N4AA 1DJHA 1X1NA 4GISA 1QNVA 3BWWA 4D8LA 4ZXLA 1UMLA 3UYCA 4F0SA 2XN1A 2E25A 2V2HA 3IGSA 1FH9A 3S1UA 5HR7A 3SCWA 3LG3A 3EBVA 3TONA 3H2MA 1UWAA 4MJ4A 3MP4A 2E5DA 4JTSA 3ZVHB 7REQB 3TV8A 1MEWA 4Q22A 4UQAA 3MYPA 3BW2A 3L2IA 3VIIA 1TPH1 3NQ7A 5I3FA 1WBJA 5KZ6A 1E9YB 3W7OA 3U4FA 4DLMA 4FNUA 3ARYA 4AZ7A 2F2HA 2TRSA 4XZWA 1SFTA 3N14A 1H0GA 4MNKA 2Z2UA 5GPRA 3VILA 5CZTA 5D33A 2VFDA 1M3UA 1OFBA 3ABRA 5A6LA 3HU7A 1C8XA 1ZFJA 3LA4A 1PTDA 1B54A 2CPUA 3H21A 1H1NA 1DIOA 2G3FA 1JCYA 3NQ2A 4KW2A 3H26A 1WOBA 3GWQA 4RL3A 1R9YA 1YPIA 2Z0IA 4OECA 4OE7A 1DJQA 1RD6A 4GIEA 4GH3A 4UTTA 3REQA 4K7YA 1W3HA 1CX9A 4YNGA 3P62A 2G4JA 3BW4A 1DIEA 4NZ4A 2Y70A 2ACQA 3W2UA 1W1YA 1XH0A 2NQZA 3LRLA 1ZAJA 1SR0A 3QBUA 5KETA 3PK7A 1FXPA 4R7WA 1Z44A 3UJEA 4KFNA 3JUGA 1C9WA 3BURA 5AYXA 2GJPA 2PEVA 1WKFA 2C19A 1A5LC 1A80A 4GCXA 5CC3A 2ZCGA 2WSRA 4LAZA 3LTYA 3UWUA 3UBPC 3ARPA 3H12A 4P61A 1CPUA 3NNTA 4FZIA 3T05A 3LV5A 4DUVA 3AYSA 3TW7A 2EXOA 4UQCA 4Y96A 3IUIA 3NSNA 3AU6A 3OOQA 1I9CB 1SW7A 1VF8A 1W3NA 1EXPA 3MI6A 4PGLA 2JKEA 3K8MA 2YXGA 4E3TA 3AIWA 1TZZA 4WX2A 4HBKA 1IWPA 4RK8A 4I6VA 4LV4A 5HUOA 1TPDA 4JX4A 1PX4A 1ZCCA 1XKYA 3OHMB 4H3DA 1E9LA 3LGDA 3NZ1A 3DFYA 2ATSA 3HG3A 3WN6A 2O7SA 3MVTA 4Z2JA 1RHCA 4HN4A 3MHUA 3T1GA 3W86A 3ARRA 1BXBA 5EGRA 1UZ4A 1WZAA 3VA8A 2BGQA 3QPYA 1H50A 5AYIA 1QNSA 1KTNA 3IJ7A 4AVFA 3N19B 1K8CA 4JTAA 2WCAA 5E93A 4PBFA 4M82A 3L7RA 2HV5A 3KOXA 3ABQA 5LKYA 5MF5A 5E6YA 4XIMA 3B8TA 4C1LA 2TMDA 4C5ZA 3DFNA 1V3HA 1DQWA 4QJ3B 1BSLA 4DZAA 3KRBA 5K4ZA 1XKJA 3QOMA 4CNSA 5G4HC 3HFYA 1EYEA 5D2YA 1U1HA 3NL2A 1RZMA 4AIUA 3HURA 4L7ZA 4I90A 1M01A 1EF3A 1VFSA 3T4CA 3GNNA 1VPQA 1UPMB 1XI3A 4PFHA 1ML1A 2PDFA 1HGYA 3MY9A 3ZOAA 4AAJA 3I6RA 3W7LA 4GJIA 3VKJA 3RCNA 4XO7A 3LGEA 2R24A 4UTIA 4C6NA 3S8HA 1PCKA 3GNOA 3STGA 3FXYA 1HL8A 3W0KA 5JU6A 1W1PA 3TJXA 1TVLA 4DXKA 1MI3A 1DJGA 3G77A 2WOQA 2ZZ5A 2NQ5A 1VQTA 3CHFA 1K70A 3NPXA 4QNWA 4V1XA 1HJSA 2IKJA 3RILA 1MFVA 4DXXA 1CTNA 3R7MA 1S38A 2YOCA 3CWHA 4NZ1A 1YBQA 4H9ZA 1F8IA 2X42A 1LQ0A 4HKPA 1ECQA 1VFHA 4ORMA 3B03A 4JYFA 4F0HA 1EHAA 1TMQA 3LTSA 1YXYA 5I07A 1ZTVA 2OODA 4JFVA 4MF4A 1JGIA 1M7XA 3QF0A 1GOMA 3MDWA 3I3BA 1WDRA 4OZOA 4W8AA 1HGWA 2PB1A 3PUEA 3GTFA 4RXFA 3OYXA 5E9XA 1D7FA 1GUVA 2EPOA 2VFFA 2QZRA 3OGRA 4LBUA 2QUMA 4M81A 4AVOA 2P10A 4CU8A 3HMCA 2ZKMX 1FWBC 2VJXA 4UNLA 4JN8A 4UTWA 5IM51 4LT9A 1FBAA 4BI7A 1CECA 5G2IA 3KEHA 3SUUA 2OLSA 3P82A 2XINA 3GKAA 3LQGA 1EZWA 4B16A 1GVSA 3MYOA 3C0JA 2CZVA 3U2ZA 2CLMA 3WLSA 3ZFHA 2ZZ4A 4IX0A 3MBDA 5I5RA 4HZ7A 1E1CB 3PTKA 5BOEA 5DXXA 1EGZA 2NT0A 4Q7BA 1H7RA 4IG2B 1SJBA 3NDYA 5A6SA 4Q8WA 3LCIA 3BGGA 5HPOA 1FHLA 3PZNA 4WUIA 5LGZA 1RUSA 1SSDA 1AODA 1UOKA 1XPYA 1YLVA 3NQGA 4GZJA 3OVRA 4HU8A 4N9DA 3CHEA 2AKMA 1A5NC 1A0CA 3B9NA 2Z1KA 1R30A 3GM8A 5FCZA 1E4IA 2DSWA 2DUAA 3VABA 1OYAA 1RJRA 1E3XA 4CCEA 1NEYA 2OX4A 2V5CA 3N34A 4LB4A 4Y9NA 2YKKA 4MWAE 4JR5A 3HQNA 4RW5A 2I17A 1EJUC 2QF7A 1NY1A 4OVXA 4RPQA 1TPVA 5FAJA 1A49A 2DQXA 1PS9A 2H90A 3OBAA 3BLPX 2OQLA 4X9SA 3AZRA 2DT1A 4KH2A 3SY1A 4PMVA 1W17A 2J7HA 5BNKA 2G5WA 3SCPA 1PJ9A 4Z1CA 1M1BA 3POHA 4C6DA 3BLLA 3LENA 1LM1A 3WNMA 3CHVA 3MHFA 4LW7A 1VBGA 4A3UA 1SYTA 1MXSA 2QULA 1RQEA 4GYPC 4CCCA 3KOFA 3P81A 1HJQA 2RGLA 5GNZA 2BV9A 3HZ3A 3OBEA 4L4MA 2AL1A 4JTKA 1PZ2A 1CGUA 3W83A 1J2BA 3W1QA 4W86A 3UA3A 2X1UA 4IQJA 4LX4A 5D4YA 1K3UA 3DUGA 4Q8VA 2V81A 1QI4A 2ZC1A 1MW2A 3OQEA 2WZHA 5E0KA 4S3AA 5I00A 2ANUA 3H55A 5IBXA 1GYNA 2QV4A 4B5TA 3B0PA 3LTPA 1OVDA 4B91A 3OYZA 3N4EA 4GGHA 4JN7A 3TWAA 1YRRA 2ZBTA 3QEZA 1J11A 2SFPA 3B8SA 3GG0A 3I68A 1TQXA 5HQEA 2OZ0A 3SZ8A 2Z1VA 4ZZ9A 2O4MA 4GOAA 2WVVB 4CNOA 3WCZA 4LQ1A 1ADDA 3K1DA 4QJ1A 2I1OA 1UWQA 2PWVA 5JVLA 3FHAA 3W7NA 1AL7A 5HJXA 2P5NA 3VZZA 3O3RA 1E56A 2WMJA 4PTXA 4F9JA 2OZ8A 5CG0A 1TKKA 3WQ4A 2OEMA 3UXKA 4PCSA 3FA4A 3M07A 3N9SA 3WQGA 4HZ6A 4QDMA 2BTMA 1HP4A 1VIZA 1M7OA 3TN6A 4MFEA 1QUMA 4AMAA 3HB9A 1K8XA 4XBJA 3VYLA 1EJRC 5ENLA 1VGAA 1HFBA 4RDYA 1A5UA 5F2LA 1H7WA 1XLBA 4C6CA 5CC7A 1OB0A 5FD0A 5CBIA 3M5ZA 3WH7A 3ITVA 5DMNA 1QI2A 2G3IA 3S1VA 2CERA 2VEMA 4FXRA 2PC4A 3BUVA 1P0KA 3PTMA 1XUUA 2Q8LA 3IV8A 4AC1X 2XGZA 1AJZA 4DUXA 2PLJA 2OB3A 2HZGA 2Y7GA 1PYMA 5CSRA 2WCGA 3LBMA 2X0SA 1EWEA 2WJDA 8A3HA 4P7LA 4BKNA 5KTLA 3ZS4A 3TYBA 5LSMA 3LI0A 5REQA 2BY0A 2QUNA 3RU8X 3LCWA 1Q65A 2OYLA 2YW4A 1XGEA 1CXKA 3JW7A 1UC5A 4DPPA 2CXGA 1C9DA 3LBCA 3DXIA 1Q6RA 5HMDA 2YSWA 3PPCA 4WDWA 1UQYA 3PY2A 1MUCA 3WEOA 3E2SA 3M41A 3FFSA 2ADAA 4B4HA 3KTXA 4LUYA 1CXIA 3T09A 5A8MA 1YE4A 3VK5A 4WJEA 1XC4A 3WBAA 3AMLA 2PE4A 1H11A 4GNKB 2ISDA 1ADSA 4GD0A 1CXEA 3L23A 1VC4A 2FH8A 1DJXA 4GO8A 5T9CE 2XVPA 1B31A 4QQUA 4CNTA 2VMFA 1YTDA 5CAKA 3RX3A 3CXOA 3CPRA 3UD6A 1REQA 5HNRA 1UG6A 4C6LA 1EEXA 1TYGA 1VCGA 4YVVA 4F79A 5MKGA 4D2JA 2FGLA 3E49A 3N3MA 3P8JA 1QMLA 2OWCA 1QASA 4Q8MA 5FJTA 4NI8A 4FNPA 3CASA 1DJIA 4N6FA 3NM1A 3TC7A 5LNUA 1T8XA 2NV1A 3PZTA 1WV2A 4ZB0A 1G9HA 4OQVA 1Q3NA 3V5OA 3TCEA 3NEVA 3MSDA 1I45A 2RH9A 3UXDA 1PAMA 4LUSB 3L5MA 2JBMA 2QCGA 1QBBA 3UJ2A 3N73A 3N25A 3MTWA 3VZXA 4GBUA 9XIAA 4UR9A 3LY0A 3ZZ1A 4S1FA 3VINA 1I60A 3ITXA 2QKFA 1CENA 3RM8A 3WK1A 1UHVA 1D3HA 3F5LA 1UZDA 4GX9A 1OQFA 3SRDA 1DIKA 1V02E 1Z69A 2WMGA 3F4CA 2YYUA 5A95A 1PWLA 2VI0A 3MCNA 1KTBA 5F7UA 3A9IA 2WJZA 3K5XA 5G2HA 1UR2A 3GDBA 1U22A 3AXMA 4PMOA 3ZJKA 2OCZA 5A2BA 4D6GA 1KQYA 3G22A 3NIYA 4M1BA 1UP3A 3AFBA 3N1AA 4WZHA 3WH9A 4Y9MA 4QDWA 3UZYA 1VS1A 4A6GA 4A2RA 1AH0A 3S2JA 2VQTA 3HQ1A 3N2MA 4IQDA 3W7PA 3SSJA 1UZHA 3SGZA 3NURA 4H4IA 3R58A 1ADOA 1HKKA 4HSNA 3MUIA 2OWWA 1JD7A 3N29A 4XB3A 1F6YA 4MYAA 1R3TA 3BJTA 2GYIA 2WNWA 2JKAA 2DH2A 5M03A 1B57A 4XZLX 5CG7A 1OC5A 4BCEA 3ZJ8A 3T0TA 2KAUC 1BWKA 1SO4A 1H0IA 4U4MA 1LLWA 1OX6A 1KFKA 2GDUA 5FF7A 3ZYZA 2OMAA 4CQ9A 2NV9A 1QXLA 2WLZA 3S2LA 2F38A 1HN1A 4U31A 5BOFA 3GHUA 3IJDA 3ZQ9A 4D8ZA 1DJZA 1E1FA 3GFZA 2OKTA 5FEZA 1C90A 1GG0A 3S9IA 2JQXA 1V6YA 3KTCA 4W85A 5E09A 4RW3A 1BYAA 2EKGA 4P5UA 1TFVA 3O05A 1F05A 4CD5A 5ECVA 1Q7ZA 1FDJA 3M5XA 4E4PA 3GG7A 3MSGA 1PWMA 1IWBA 4GNVA 1PO9A 4NAEB 1R0MA 3QHNA 3HN3A 5JIWA