3PB3A

Structure of an antibiotic related methyltransferase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
199
Chain Sequence
LILKGTKTVDLSKDELTEIIGQFDRVHIDMGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESMPFELKNIADSISILFPWGTLLEYVIKPNRDILSNVADMAKKEAHFEFVTTYSDKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSMWAKRLAFGRKRSFFRVSGHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the methylation of A1408 in 16S rRNA by a panaminoglycoside resistance methyltransferase NpmA from a clinical isolate and analysis of the NpmA interactions with the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 16S rRNA methylase
total genus 67
structure length 199
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.1.1.180: 16S rRNA (adenine(1408)-N(1))-methyltransferase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3pb3A00
2WA2A 4C05A 1QAOA 3MCTA 4MWZA 4A6EA 4IV0A 3HCFA 3MTEA 4FSDA 4R05A 5DXAA 2F8LA 3S68A 3EVFA 5DM1A 3BWYA 5FA5A 3C6MA 2ZWVA 3GNLA 2NXCA 2PVCA 3G8AA 1M6EX 4FSXA 4OQDA 5FHRA 5EEHA 4E70A 4RTLA 5HILA 4E2XA 1NW5A 3ANXA 4FZVA 3M4XA 4KDCA 5EMJA 2ZZMA 3OZRA 3GO4A 2ZBPA 4FT2A 1SKMA 4KIGA 4RV9A 3RODA 2VDVE 2B25A 3CGGA 2Z6UA 2O07A 3FPFA 4BLUA 2ZWAA 3A26A 4PONA 5CVUA 2AVNA 3GGDA 2ZIFA 3NJRA 1L3IA 4HTFB 5CVJA 1DL5A 4LWOA 2JHCA 3B3GA 4XUCA 4P7KA 5FWDA 2Q41A 3BWBA 3LECA 5HIMA 5LQJA 5FUBA 1T43A 2PXAA 4EKGA 4H0NA 3G7UA 4QDKA 5K0CA 5DM4A 2V74B 4HSGA 3EVEA 1INLA 3K0BA 3CJQA 4RVGA 3CBGA 4V0QA 2IFTA 1R00A 5EQJB 4RTQA 4RTSA 1JQEA 4QVKA 3OPNA 1ZGAA 2AS0A 3FTEA 2R3SA 4HGYA 3MB5A 2ZSUA 3FUTA 2EG5A 4FGZA 2BH2A 1Q0SA 5E8JA 3NVKI 4MIKA 3A7DA 4KDRA 1R8YA 3B5IA 1P91A 2WK1A 3ID6C 3O4FA 3UJCA 4BLWA 3NDIA 3ELYA 3TRKA 2IH2A 2JG3A 5K0GA 2KW5A 1JG4A 3CCFA 3CKKA 2P35A 3HNRA 3AY0A 3ER9A 4DZRA 5EKXA 5EGSA 4HRAA 1R6AA 5CVEA 3QOWA 1AV6A 3G2MA 2AR0A 1VPTA 1BHJA 1NBIA 2AOUA 3A4TA 3SVZA 5E1MA 3LDGA 3HVHA 3LPMA 1HMYA 1WXXA 4RVHA 5FQNA 3H2BA 5EKUA 1YZ3A 1RJDA 3LL7A 1O9HA 3UJAA 3AXTA 3BZBA 3HCAA 4PYJA 2G1PA 1VE3A 4DA4A 2QYOA 2AN4A 2G8NA 3PB3A 4PYLA 5E1DA 5IH3A 3UJ6A 2FYTA 3ELWA 2Y1WA 3GWZA 2PSSA 1NBHA 1N7IA 1X1BA 2PT9A 3VSEA 3KQSA 4R8SA 3R9XB 1YUBA 2CL5A 2I6GA 2GAFA 3HCDA 2B2CA 1JQDA 5GM2A 3KR1A 3CVOA 2VS1A 3OU7A 1N7JA 4EVIA 3GCZA 4QPNA 1RJGA 2C7RA 1F3LA 1IM8A 1I4WA 4CKCA 5DX1A 2VP3A 1R18A 3TLJA 5E9WA 1D2CA 2I7CA 1L3BA 4PYQA 3P9CA 3SSMA 3M6XA 1JR4A 2CWWA 4M37A 2IPXA 4ER3A 3CJRA 3GXOA 1V39A 2ZFUA 2PKWA 2QY6A 4RVDA 4DCGA 4UOEA 2YX1A 4PWYA 1UWVA 3LDFA 2HR1A 4AZVA 2OO3A 4PCAA 1EIZA 2PT6A 3G2PA 3KPUA 2JHPA 2WA1A 3C0KA 4QQNA 5CUQA 3E05A 5B1SA 3MQ2A 4POOA 3TM5A 3GRUA 4E30A 4YUVA 2OXTA 3UA4A 3FPHA 3UJ9A 5FWAA 5E9QA 2PX2A 3P97A 2OYRA 1SVUA 1VIDA 2FPOA 2QRVB 1I1NA 2AOUB 3KR9A 4RSRA 2YXLA 4C08A 3LSTA 3ERCA 3DUWA 3ELDA 2PX8A 3QV2A 1JTEA 1EQAA 4CWAA 5K0JA 3LCVB 5FA8A 5GM1A 1VL5A 3PS9A 2I9KA 4E2YA 3LBFA 2NXEA 3P71T 4GUAA 4AZSA 4C03A 5F2NA 1EJ0A 3DMHA 1BKYA 1KPGA 1O9GA 2GB4A 4X60A 4HTFA 1RJEA 5C1IA 5ICCA 4BLVA 2YXDA 3FUXA 5F2KA 3THSA 2EJUA 3EPPA 3IV6A 2K4MA 4DMGA 2V7EA 4RVFA 3BGVA 2ZBQA 4OQEA 5K0BA 3BT7A 4JXJA 1WY7A 3O31A 2NYUA 2JH9A 5C9ZA 1X19A 3BGDA 2ZBRA 2PXCA 3SR4A 2HV9A 5EC8A 1XDZA 4PIPA 5CM2Z 4YV0A 5LSAA 3V8VA 2XYQA 3G5TA 3LDUA 3FTCA 4F86A 1XXLA 1FP2A 4LG1A 3FTDA 4RYLA 3SM3A 1MHTA 3EMBA 3KQYA 3LGAA 3FPGA 2ORED 3B7PA 3KQQA 4P58A 4ATNA 1L3CA 1NW7A 2AOTB 2G70A 3KQPA 1XTPA 1G55A 2QM3A 4ER0A 1YF3A 3R6TA 2P7HA 1Z3CA 4WVLA 5K0LA 1MJFA 3FRIA 3C3PA 3SSNA 3NW9A 3NWEA 2ZIEA 4XUDA 5P8WA 2P8JA 1G60A 4KIFA 1SQFA 3X0DA 3FYCA 2FHPA 4PINA 3TM4A 3PLAE 3ME5A 5LQUA 3U81A 5HFJA 1YFJA 2O06A 5EIFA 5HIIA 3PFGA 3UJDA 2GLUA 1VQ1A 1N2XA 2NNWB 1NT2A 5EMMA 4GQBA 4U7TB 2PJDA 3FTFA 5DM0A 4E2WA 3FPEA 4LECA 3I58A 5EHIA 3KQMA 5HIJA 3G8BA 3BWMA 5EIWA 3NTVA 1JSZA 2ZVJA 2BM9A 3UA3A 3FUVA 4HGZA 2NXJA 4WXHA 4DF3A 4HC4A 4EQZA 4CKEA 5K05A 5KYGA 1XVAA 3A27A 3PVCA 4KRGA 2AOWA 5DX0A 5EOVA 2YTZA 4M38A 4PNEA 3WSTA 4PYOA 3P2KA 3PTAA 3SSOA 3TKYA 2H00A 1IY9A 3B3FA 4QQKA 1XJ5A 4OA8A 3TQSA 5FULA 4IV8A 5GP1A 5LQRA 3SX0A 4O29A 5DT2A 4EKIA 3TOSA 5GIOE 3I64A 3EGEA 3ELUA 4M36A 2P7IA 1Q0TA 3AJDA 3KQTA 4QDJA 3HTXA 1M6YA 1X1CA 4ER6A 3M6VA 4RWZA 2NP7A 2HWKA 2IGTA 2PBFA 4Y2HA 2AVDA 3JWJA 2C7OA 5DX8A 3DLCA 2P3OA 3NMUF 4GOLD 2CMGA 4AZTA 4GF5A 2EJTA 1WS6A 1L1EA 3ORHA 3V97A 2IBTA 3D2LA 2BM8A 2G71A 2H1RA 2VDWA 2Y1XA 3HCEA 3M70A 4PGGA 4BP3A 2OY0A 1RI4A 5CCBA 5HIKA 1KHHA 3DXXA 5E9JA 5G02A 1EAMA 2GS9A 3DTNA 3E7PA 3QOXA 4IWNA 3BWCA 5DLYA 4RX1A 4ISCA 1R74A 1BC5A 1RI2A 5EMKA 1XDUA 1RI3A 8MHTA 1VLMA 2PWPA 5E8RA 5ICFA 1PJZA 2B3TA 3HA3A 1BOOA 1AQIA 3I5UA 2B9EA 5GIPE 5M5BA 5ICGA 1RI1A 3DXZA 3LCUA 4L7VA 5U4XA 4C04A 5DXJA 2ZCJA 4PYMA 2YR0A 2NP6A 5KQSA 3HCBA 2N47A 1KXZA 4QTUB 3GRVA 3P9IA 3P9KA 3EVZA 5T67A 3A25A 3B3JA 3LBYA 3M6WA 1UFKA 1ZQ9A 3KPYA 3KQWA 4FS8A 4OBWA 4P7JA 4ZTBA 5C0OE 5LQKA 2QRVA 3FUUA 3OFJA 5CCXA 4FT4A 2UYHA 2FRXA 3VYWA 4DCMA 9MHTA 3OZSA 1ZG3A 2ZIGA 3LHDA 4HH4A 1DUSA 5EMLA 2PV0A 5KS2A 5LR6A 5T6BA 2JJQA 3HVKA 1JG1A 3EMDA 4KVZA 2P3LA 4MTLA 3E23A 2JH8A 5CVVA 5D1HA 5ERGB 1EG2A 3K6RA 3RW9A 3E8SA 1SQGA 1XCJA 5GWXA 3TFWA 4V0RA 1H1DA 1RI5A 5EG5A 5BP7A 1KR5A 3HVJA 5HZMA 3L8DA 2FK8A 2BR3A 2CKDA 3PFHA 4OX9Y 2AOVA 3AWIA 2P1DA 3REOA 3EVAA 4GOMD 4OA5A 4CXMA 3EVCA 5FQOA 5DM2A 1I9GA 1KP9A 3KQVA 2ZTHA 3BGIA 3O7WA 4PIMA 5LQAA 3KPWA 4HG2A 4R6XA 5FTWA 5GOZA 3GJYA 3G2OA 1NW8A 3KHKA 1XCLA 3MERA 4KWCA 3EVDA 1EJ6A 2YUIA 3C6KA 3NWBA 4GEKA 4EK9A 4RTMA 1QANA 3RIEA 2R6ZA 1P39A 4YV2A 4XCXA 3DLIA 1WXWA 3M6UA 2IH5A 3LCCA 5FHQA 3KQOA 4F85A 2UYCA 2AN3A 10MHA 3MCZA 4E32A 1X1AA 5DTQA 3MHTA 3IHTA 2E5WA 2PXXA 4RTNA 5E2BA 5T64A 1QAQA 4E31A 2Z6AA 1VP9A 2GA9A 5K0FA 4DM3A 5FADA 1G8AA 2ADMA 3FZGA 4Y30A 1NKVA 2FCAA 2NXNA 1TPYA 2AOXA 1D2GA 1RJFA 3BKXA 2AN5A 3M33A 3P2IA 4GOND 4OBXA 5D1NA 1G8SA 2ZZKA 2ONYA 3FRHA 1D2HA 4YUZA 3AXSA 3T7RA 1ORHA 5K8VA 3EEOA 5IKMA 3OE5A 4DKJA 4CTJA 3FYDA 1KPHA 1X1DA 2O05A 2HNKA 3DMGA 4AX8A 5EVJA 5FCDA 4YMGA 1AQJA 5HEKA 1KYZA 2HTEA 5H02A 3UJBA 1FP1D 1JQ3A 1OR8A 4MQ4A 2FK7A 3CJTA 3VC1A 3P9NA 3PX2A 3GU3A 3TR6A 1QYRA 5LQCA 4X1OA 5E1BA 2BR4A 3F4KA 5JUWA 1WG8A 4GC5A 3SGLA 3KPVA 5GINE 3LKZA 5DRYA 1AF7A 3UFBA 2ZULA 5EZQA 2P3QA 2I62A 3HP7A 4YUYA 4RTPA 1ZHFA 3NVMB 3Q87B 3UJ8A 1KYWA 1G6Q1 3P8ZA 3HM2A 2IDKA 5DSXA 3FUWA 3PX3A 4M7RA 3HVIA 3G88A 3P2EA 3PT9A 2YVLA 4CTKA 1WZNA 3C3YA 3VC2A 1KIAA 2UYQA 2PY6A 4R8RA 2OKCA 1JG3A 3GIWA 4B17A 1TW2A 3THRA 2IH4A 1NV8A 2IBSA 3OU2A 4U7PB 1JG2A 4QVGA 3G89A 3OCJA 4YUWA 5MHTA 2PWYA 3HCCA 2A14A 3OFKA 3UZUA 4X63A 1NW3A 2H11A 1XDSA 3DP7A 1SG9A 5DWQA 3IEIA 1FBNA 4C4AA 1P1BA 3TPZA 5EPEA 4EMSA 4RTOA 3TMAA 1QAMA 4P7GA 3TKAA 2VZ9A 4P7FA 3JWGA 2OPBA 2XYVA 2UYOA 1HNNA 4GBED 2PX5A 3NDJA 4FP9A 2ONZA 3JWHA 2OB1A 2P40A 3EVBA 4YMHA 1YB2A 1ZKDA 2XYRA 3BXOA 3A7EA 3DR5A 3MGGA 3GRRA 3OE4A 3T7TA 1L9KA 3FPJA 5K0EA 3UBTA 1M0EA 4GOOD 3R0QA 3SMQA 1PRYA 3OZTA 4CKBA 3LX6A 4RTKA 2VDUE 3MAGA 3EVGA 4FR0A 1JTFA 2Z6QA 3CC8A 1FPQA 1KPIA 5K0NA 4X61A 3UWPA 2UZ4A 4G56A 2JHAA 2B78A 2ZLBA 3JWIA 3BUSA 3KR2A 4XUEA 5DTMA 4GC9A 1SUSA 1ZGJA 3G2QA 5DSTA 5E1OA 3DH0A 4Z2YA 2ERCA 2ZZNA 1Y8CA 4PGHA 4C06A 3DULA 4F84A 3EGVA 2XVAA 1VP3A 5CVDA 2P41A 2HMYB 4E33A 4DQ0A 2YXEA 3LKDA 3B89A 3I53A 5JR3A 4BY9E 1NE2A 3DMFA 5K03A 4YV1A 4R6WA 4PYNA 1R8XA 1YZHA 2BZGA 3OU6A 3UJ7A 3KPJA 4PYKA 3Q7EA 3GRZA 3HA5A 5EHGA 2O57A 4X41A 2C7PA 3KU1A 1ORIA 2PGXA 3DXYA 2EX4A 2OBFA 2IP2A 2ZW9A 4ER7A 2BR5A 1QZZA 4PYIA 1O54A 5F2OA 3GDHA 5CIYA 3IYLW 2XBMA 2G72A 2AOTA 2GPYA 3BKWA 5K09A 2DPMA 5BXYA 3ER8A 2GH1A 2O0LA 4NECA 1F38A 5EZSA 5E2AA 5BW4A 2CMHA 7MHTA 1B42A 3HA7A 5K01A 3SXJA 3R3HA 1U2ZA 5HOQA 3DOUA 4E2ZA 5DTRA 3HEMA 1P1CA 1TW3A 1FJXA 3T0IA 2OB2A 1NV9A 3MTIA 4AUKA 3I9FA 4IKPA 4MHTA 4BP1A 5LQNA 4QTTB 4AZWA 1VBFA 2YQZA 4KW7A 2AZTA 2PX4A 2C7QA 2IDJA 1G38A 2DULA 5CD1A 2LD4A 3T7SA 3KR0A 5KVAA 2EFJA 2XVMA 3R24A 1SUIA 5DPMA 2QE6A 4ER5A 4C07A 4YUXA 3G5LA 4A6DA 1NW6A 3KKZA 5ICEA 5EEGA 4RTJA 3EGIA 1UIRA 4K6MA 1YFLA 5KQRA 2IIPA 1DCTA 4RTRA 1JSXA 5BW5A 3EEYA 2OZVA 3GRYA 4QPPA 2ESRA 2PLWA 4PCLA 5DRTA 4LWPA 1IXKA
chains in the Genus database with same CATH superfamily
4U7GA 4D8WA 3IJEB 3UBMA 1K2VN 4A6EA 1N36B 3MT7A 4K9OA 1E7YA 1GUYA 3HCFA 3HR4A 1QCDA 2ID7A 2E55A 1E3LA 4KIWA 3PQCA 5JAPA 4JYCA 5J59A 3G8AA 4RKFA 5EE3A 5BMVF 2CXOA 2WSMA 5I4CA 4UTXA 5BSWA 4RULA 2VNJA 3OZRA 3FKJA 1H2AS 3AHIA 3DE4X 3K1YA 4FT2A 2VYQA 4G5RA 3V32A 1RBMA 1FU8A 2ZR7A 1ODIA 1L7MA 2IZ0A 2FA9A 1CETA 3VPCA 2MT9A 4RY8A 3JQAD 2XGGA 2ZE7A 2AFRA 2YV1A 1N6HA 2GBGA 3H5LA 3AESB 3KYCA 2RAFA 1ZD4A 4I1PA 2OSVA 1VGQA 5EWLB 2WWIA 4U8GA 3AOGA 5J2UB 1W4RA 1WXHA 1H22A 2BL4A 1VPVA 2CLCX 3L7YA 4WY2A 4KQ1A 1V1MB 4OGGA 3Q9NA 4F38A 5JFTA 1I6MA 4YN3A 4EPWA 1E9EA 1YUMA 3OX4A 4UHDA 4BRSA 4FE3A 4AP9A 2CK3A 4FQ7A 4CLOA 3GRFA 2J08A 3ZH2A 3VPAA 2OEPA 3QP9A 1IPFA 1SXJD 3QI7A 4JLUA 2HEGA 3KEMA 1DAIA 3CS3A 5SZIA 3KDPA 3B48A 4Y7DA 1U1CA 3MJRA 1E2NA 3FBWA 1N9GB 1WRBA 2QD5A 3MS7A 3PUHA 2HJHA 4X6UA 1UXKA 1Y1RA 2P9ZA 2FDCA 2AWNA 1O58A 3P2YA 3KSMA 5K09A 3NNNA 4GXNA 3W7BA 3ZE6A 1KU0A 3TWOA 4BE9A 3CUVA 2QG9A 4AVYA 1IOZA 5C4IA 1T10A 4ZJPA 1GL3A 3A4TA 4TXHA 1PKEA 3IOMA 3LFTA 4YO7A 2FWRA 2DKOA 2H4HA 4M76B 4ITUA 4OQNA 5FV7A 3SF8B 3GMDA 4BX9A 5KDOA 4IDDA 5FQNA 4RKYA 4GSKA 1YZ3A 3AVYA 4XGRA 4ZGGA 3AFOA 3U7IA 5BWNA 1KJYA 2F6RA 2HREA 3D7KA 3QBVA 2AN4A 4KXQA 4LOJA 4DJTA 5I7AA 4N0QA 4Y9DA 3GWZA 1Q7CA 5GJVC 1N7IA 1RCFA 4WEOA 5ALSA 3O4JA 1P73A 3BK7A 3ENNA 3PJDA 2H2GA 4N5IX 3U17A 4AULA 2YFQA 4TS4A 3DV9A 2P9JA 3WA7A 2A9PA 4JQCA 3HB4X 4HRYA 4LV6A 3ZVKA 1R0SA 3JQBC 2BZ1A 2Q0QA 3F5DA 3HPQA 2KLBA 5A6SB 1OXUA 2TMDA 2WVAA 4KBYA 3C7AA 3Q8XB 1NDHA 1R18A 4BO9A 5EPOA 1R0XA 1W87A 5T8KA 1KO1A 1HDZA 1BEZA 4BKOA 3N2ZB 4TZKA 4B74A 1QCYA 2P4UA 2ZJ7A 1A9QA 1E2EA 4US1R 4KGVA 4D97A 5IT4A 1UBKS 5D5HA 4JI7B 2XF8A 3QV1A 1OKKD 3E22A 4BVEA 3ER6A 2NV0A 3TECE 2B7CA 3H7IA 3I9NA 3L7IA 4I6EA 4KK3A 1A50B 2ZYVX 1P1IA 1RWWA 2JLQA 1Q0HA 3BWXA 2C2GA 4K6KA 4OKIA 3X43A 1GRCA 4BLSA 4F46A 5LWQA 2D7JA 5JJCA 2OAQ1 4CMGA 4CI0B 1USKA 3CLSD 1EBUA 3UATA 1V1RB 1SBHA 1UADA 3QKIA 2IEGA 3R77A 1NR5A 1Y5RA 4COKA 5BR8B 2Y1DA 3OJLA 4DIKA 1EJ2A 4ROSA 5IVIA 3WFIA 1N2HA 3FWNA 3PGJA 2HJGA 1IJBA 3DUWA 1ZSVA 3SHFA 3V4VB 3H9QA 1T29A 4QFMA 4MI9A 3LCVB 3QQ5A 4MPTA 4NJMA 4PGMA 1JHPA 4C4RA 1B8OA 3GLRA 4Y0NA 5K3SA 3IQFA 1E79D 2F1KA 4R2HA 1P4RA 5LQMA 2PX0A 3TLGA 3FZEA 1H2BA 5AUPB 1NRJB 3G8DA 4RFLA 1XJQA 4D8VA 4YMLA 3PD0A 5IKOA 5CMLA 3BSSA 1XD8A 4BWYA 1YBVA 1E9SA 1LLUA 2RGDA 4UU8A 3PUVA 1M34E 2JAQA 4MX8A 1R8JA 1YXMA 3TRIA 3SHWA 2HYDA 5EXSA 1R0BA 1L5NA 1ZP6A 4TN1A 2HF8A 5TQ0A 5A9SA 5IHXA 3DBOB 3A70A 3IEXA 2GVNA 3BIWA 1KSJA 4G1MB 3MS4A 4DAOA 3NHSA 5EC8A 4Q3NA 1Q15A 3QXSA 3CB4A 3KVYA 2Z8XA 5ALNA 5G41A 4B4KA 3U7QA 2ORIA 4X1IB 1ORDA 2UXBB 3CVJA 3LWNA 3HRHA 3LGAA 1GLVA 3KQQA 1L3CA 1J5XA 1V3VA 2ZAGA 3KQPA 3ANSA 4BTLA 4YRFA 1HZJA 3ASYA 3FNQA 1XVUA 2AZDA 5JCJD 4N3AA 2GNPA 3C3PA 1NDQA 4KXMA 4OHBA 2ZIEA 3TJMA 4PC2A 4XOUA 4QAQA 4KRXA 1BN7A 3R7WB 4DRXA 1AE1A 2O2JA 4RENA 4X64B 3UJDA 2K2QB 3BE5A 4PRLA 1N4AA 1HE1C 2JVKA 2YDXA 4FWIB 3GT7A 3KU4A 3WZMA 3QKRB 4AZ0B 1PZMA 2J3JA 3I58A 4UDYX 1KY4A 1M2KA 2W22A 1KJWA 3CH5A 3FHOA 3NBZC 1DFIA 1V0JA 4P4UA 1JIIA 1CS0B 5ILOA 4WW0A 2R1VB 3HB0A 2VCHA 3LHFA 3O3OB 3SM9A 2O7QA 1QPZA 4K6CA 2KHZA 4D98A 3C6QA 3NHKA 4WA8A 5DI9A 1NQ5A 2IXEA 3TVDA 3GB9A 1RNLA 4MWEA 5DHRA 3PTAA 3ICVA 3OAAA 3RWBA 3NDBB 2DOKA 4CIBA 1HYHA 2R11A 5L6MB 2COEA 4K0RA 3N2GB 1XJ5A 4OYLA 5EXPA 4H6WA 3JYPA 3Q12A 4IV8A 1JSRA 2JIZD 5EYPB 3TQSA 1HO3A 4ZT6A 3RSGA 2YVAA 2XNKA 2A5DA 3AETA 4O29A 4XX0B 4ZT7A 5J40A 3PX7A 1QLWA 2Z2IA 1UEXC 5JZVA 1RWNA 5JDIA 3VX3A 1VDMA 1OYVA 2RBGA 3AUXA 3E9CA 5CTJA 3ENQA 3WGJA 4W9NC 2ZRLA 4WKGA 1PFVA 2HRCA 2JEYA 1RADA 2RHJA 4D4JA 5MGBA 2QTFA 3EG9B 1UWKA 3KSDO 1SBZA 1E0JA 1Z73A 3R44A 5HCNA 2GTIA 3GHHA 2JPDA 3DLBA 1G8KA 3G0CA 3D9QX 221PA 3EQZA 3HWRA 2P4SA 4MS4B 2FFBA 4PGGA 4U7FA 4RD1A 1ESDA 5BVHB 3CIOA 1KHHA 3DXXA 1EAMA 3VFDA 2XDQA 1UQUA 1CZHA 1JNXX 2UVDA 2WT8A 3O8DA 4N7RA 4TLEA 5TJ9A 4NZNA 1DELA 4DG9A 4BNIA 4BNLA 1DEXA 2HJ9A 2FMUA 4B76A 2FPRA 2WD7A 3FNIA 4B3BA 2W0SA 4QJ3A 1CUWA 3EH2A 3R75A 2F1IA 4LSGA 4FCTA 1RKBA 4NNJA 3BXEA 1D2MA 3H5WA 3W78A 4MVJE 2CFTA 3CXUA 1FJGB 3E9MA 2FP4A 3NFYA 2XWPA 1UM9A 1SKAA 2JKZA 4OBWA 1WUHS 3GUUA 4IDFA 1SXQA 2DCMA 4RPJA 4WFKA 2ZWMA 4C2AA 5ABPA 1KS2A 4RE5A 4EGCB 4DMRA 5JD6A 1QVRA 4Q4JB 1GZ3A 3HJCA 4OFXA 2A4KA 1CP2A 1T6ZA 4HLNA 3F49S 2EX0A 4PPFA 3RU7A 3DDUA 4IXNA 2PWAA 1L5GB 2O48X 2XDYA 1O5OA 2JH8A 1FJHA 2XQIA 1UCFA 1QO0A 1V7QA 3K9GA 1RYBA 1SCBA 1NVVQ 4QKQA 3L6CA 2J45A 4W7IA 1H1DA 3BMOA 3S7ZA 1KR5A 2GUWA 5T4EA 5HZMA 1JIKA 1DC8A 1VPLA 1ZK1A 5HMLA 2W90A 2CJWA 4B4VA 2OBBA 4HXYA 3HZRA 1BWSA 2FFHA 1WBJB 2ID4A 5D84A 5B1HA 2ECQA 3IO3A 2VXYA 2XMGA 3KB1A 4PO1A 3B53X 3IELA 4R8LA 4Y6RA 2WB4A 3QKRA 4ZZ3A 2CZCA 4LS3A 4TUYA 3C8MA 1KP2A 1ZHHA 2H52A 5EUMA 5HJEA 3UCFA 1ZR2A 5FUYA 4AYXA 1Z33A 3KM0A 3DMRA 1G0OA 1O57A 5AKZA 2UUAB 1GPYA 2GYVA 3ETJA 2MSEB 2NWQA 4F85A 1T2AA 2F59A 4WK0B 3BIXA 4AP5A 4AY3A 4Z3OA 1P29A 1RDFA 1WSBA 3PQ5A 3FTQA 4FZ3A 1T0BA 2FP4B 1AX9A 2AJCA 2D06A 3T34A 5LB4A 3S5JA 3OT1B 1XZAA 1PUXA 3VR3D 5KTKA 2GZ2A 3BD6A 4E31A 1TZCA 2B8TA 3X1JA 4LDRA 3JYOA 5KYYA 3T0FA 1F1JA 5GONB 5AVTA 1I4OA 1D2GA 4LHXA 3RLFA 1QIFA 3GLFB 4HATA 2BGKA 5JZBA 2X1LA 1S2MA 1Z4IA 3WLMA 3PNPA 5DM70 1E3TA 2HQRA 2JBWA 1JAHA 3FRHA 2PS3A 3JD1A 1D2HA 4LXIA 2H3HA 1DAEA 2PT5A 3SSAA 4K88A 1ECGA 3HVRA 1VL2A 2ISSD 2HDNB 1EA7A 1GZUA 2UZAA 3OF3A 1NTOA 4JSRA 5BQFA 3ZHSA 3PR1A 3VJMA 1LJ8A 1Q95A 5IULC 3S2GA 3AF5A 5B2FA 3CZRA 3MWYW 3VI4B 5HF5A 4JQYA 4JSTA 3DOFA 2X19A 3OIVA 3UB3A 3QPCA 4F9TA 4HV4A 2QN9A 1L5SA 2JANA 5KOJA 2ZDQA 2JBAA 1F9EA 1Q12A 4E15A 3RU3A 4RVSA 4WGGA 1BFKA 4OXRA 3UFBA 2CHQA 1ZL0A 2YC2C 3HWWA 4YDQA 3IXQA 1N8KA 1YRQA 1G5FA 3K8YA 4KJZA 1G6Q1 1K7SN 2IOHA 3SX2A 4U8HA 2OENG 1TTPB 4WK4B 4LC0A 3V9AA 1PLLA 4QGFA 2IU0A 1R3UA 1WZNA 2F64A 1RKUA 1KIAA 4YWJA 1CUSA 4KPEC 2VSXA 3D8RA 2FPKA 2VHCA 3N76A 4KLNA 4JL6A 2IBSA 3ZUPA 4QFDA 2OBNA 1NSYA 1ZD8A 2ZB7A 2OCGA 4EEXA 1C1DA 1K2WA 4IOJA 2BN4A 1FJ2A 1JFFA 1Y7TA 2DRIA 4UEJA 1PK8A 1AKVA 4NJEA 3TEMA 3FJOA 3CTPA 4UU0A 2O2GA 2H11A 3DP7A 2VQSA 3HFRA 2OVBA 1HBJA 1I4EB 3CEAA 4UCWA 5KWJA 4RTOA 3K73O 5CK4A 4P1ZA 1C1HA 4LQ4A 1QQBA 1U0EA 3IDOA 1RXEA 1Z4KA 4MYTA 3ZZMA 2AR9A 4DIEA 4KPYA 2F4VB 3HB9A 5I4BA 3FBGA 3EDOA 1ADYA 2ONZA 3NDJA 5C3UA 5JNSA 2UYHA 1PLKA 1YB2A 2IK8A 3OIUA 5EE5B 3H4VA 3GRRA 5T3UA 1IUOA 3SLKA 5AW4A 4ERNA 1AQLA 1CT9A 3JARB 3SMQA 2W0MA 4DLPA 4HTAA 2ADFA 2FOLA 1DQSA 1U3TA 1TCVA 3HA2A 4FCCA 4YB8A 1OH8A 4UBKA 4B6GA 1XLWA 3ZE2B 1R9NA 3GK3A 1EUQA 5BYAA 4MTCA 4F60A 3TG2A 1QP8A 2NU8B 4OK3A 5CB4F 4X62B 3IPRA 1JHDA 3PUIA 1QG0A 1NUHA 3HN6A 4IQ0A 2PSJA 1E4OA 2P0YA 4BPRA 1P17A 2WIJA 1O4WA 3WLAA 1PZFA 4KOAA 1U8AA 3B89A 3RYIA 5JJBA 2BM0A 3R7WA 4V03A 1M1XB 2VK1A 3AKEA 4DJFC 1R8XA 5HSGA 1G8FA 2PS1A 5F3DA 4LXXA 1SXJE 4QJBA 3LA8A 2ACEA 5COAA 5G4KB 2IUSA 5A3VA 4EFMA 3ZJUA 1JFTA 3KU1A 4BO2A 2ISCA 3B20A 3DKVA 2EX4A 4GI3A 4QO8A 4Y3UA 4DNXA 4PC3A 4MUAA 4Q1EA 2C88A 1NAHA 4INPA 5F2OA 2RJNA 4GLOA 1OB5A 2BH9A 4R5HA 3MCAA 5AJTA 4Q1BA 1SHKA 4CV0A 1M2GA 4ICIA 3LP5A 2HJVA 3PTZA 4YWHA 2RC5A 1RRVA 3PGKA 1G20E 3B1XA 4V0KA 5ALIA 5KNBA 5HZGA 2NZXA 1KO5A 4G01B 1KF0A 3KZCA 3HEMA 2RJOA 4B71A 1AB6A 4G4SP 4IM7A 2H4YA 4N7BA 4G5YA 2HPHA 1HLDA 2J3MA 5B3KA 4U7DA 4IMJB 4AJNA 2AZTA 4KAXA 4RNDB 4LKOA 3RVSA 2ONJA 2QDXA 5MDHA 2DFDA 5FD8A 3IMCA 4B3CA 1V43A 3L6OO 5ANRB 5T67A 3RHFA 3ROFA 2PQ2A 3U40A 3OQOA 1YE8A 3G5LA 2FH5B 3OIWA 4BFWA 3SC6A 3P4XA 4NMXB 1UIRA 1DIRA 1I4DD 1DSSG 3OFNA 2AT1A 2EJCA 4KLAA 1UOQA 3A1VA 3G59A 1Z12A 3IP8A 5BW5A 2LV8A 1ZJ6A 2YXPX 3FR7A 3UMSA 3IXLA 1JKMA 1RT9A 4JQOA 3EIEA 3OQHA 4YAKA 3ZCQA 1TCBA 1T8SA 2FSIA 2GYWA 2Q5FA 3O93A 3R7DA 2NPIA 1MJNA 2WDPA 4MIEA 1ZGGA 2FQQA 4P9NA 2OCLA 4C9BA 4R05A 1V5EA 1XDDA 3K7EA 5HKAA 3JPWA 2PAFA 4JNKA 2LCQA 3UKJA 1KR2A 4PLTA 1TUBB 1Q1QA 3LCRA 1A8SA 2CD7A 2CXRA 3LE8A 3QF7A 1UT8A 3NAQA 4MQEA 1EGMB 5CCDA 5A5FA 5FBWB 1BXGA 2Q4OA 1F5SA 1H05A 2TYSB 3CE6A 1KTVA 2GCOB 4KIGA 3WGMA 4Y6OA 4DHWA 1N25A 3ABRB 5T5QA 1MOZA 2PSHA 3R23A 4E6EA 3FY4A 5CVUA 2CBXA 4B9AA 5CVJA 4Q6BA 3WNVA 1UBRS 3F97A 5FNZA 1II8B 4LISA 2N42A 5DWDA 4B3HA 1T9BA 1DX9A 2J0QA 3RGGA 4AFNA 3B6IA 1NN1A 3AEUA 1KSGA 1DHTA 1Z45A 4DILA 2I3GA 2VTKA 5K0CA 4EO4A 1XYYA 1O9BA 4EF6A 1EX6A 1OGYA 3VX4A 4S35A 3DDNA 1T4CA 1NLMA 4JB2A 3L92A 4RD0A 2QRUA 1KS9A 4V0QA 4EJSB 4IHQA 4BVJA 4OHCA 1P9WA 2I33A 2GTPA 5BR4A 3PNSA 4QQFA 4KPGA 1D1QA 4MYHA 1GQOA 2A8YA 2BDUA 2EG5A 4FGZA 1QCZA 1Y4UA 2X0KA 3B6KA 3STWA 2XCSB 2JCSA 5JXIA 5U1PA 1TZJA 4DSZA 5K0GA 1L5QA 5KTRA 2EKPA 5JDCC 1T2UA 3JQCA 4ZD6A 4BNMA 1UPBA 1Y0BA 1QFZA 5IM4A 3VNBA 2X22A 1ZWKA 4JI5B 3WGKA 3ZNOA 3I3SR 4EO7A 4PG8A 4JDUA 2ILVA 2V96A 4MVJD 1F17A 1XLUA 4CKEB 1XCGB 3T06B 2X41A 4OJTA 1C0KA 4IH9A 5F52A 5PNTA 2W2XA 2W4IA 1SVIA 3HCAA 4PLHA 1MRSA 2G8NA 3PVZA 2VKQA 5E1DA 1DINA 4L8YA 1C81A 1EUCA 4KQCA 1NPYA 2NYVA 2XR1A 3AP2A 3PENA 4MQBA 1YZNA 4MQFB 5ECGC 3DNFA 4I1UA 1ZCZA 2VRWA 1TT5B 2B94A 4FGJA 4H7IA 4IKOA 5DULA 4BXOB 4W9NA 2EQ5A 4EI8A 2AYYA 4KWEA 4G1BA 1Q19A 3GCZA 4LJYA 4L72A 1WVMA 4HEA6 4MKHA 2HXSA 2WWTA 4KYUA 4XGNA 2Q3JA 5AFSA 3AKCA 3CLTD 5KSWB 4RPLA 1YIAA 5HR5A 2CVZA 4XGKA 3RS3A 3HXMA 4UUNA 3QXHA 2Y6VA 4M9RA 1MTOA 4LDQA 4AK9A 1Z16A 3LW7A 4HDAA 3VKUA 1V8ZA 2IUYA 1P2TA 1GO2A 1UWVA 1MTZA 2CY0A 5JJKA 2FWMX 3M4ZA 3KV1A 5CB6A 4DCCA 3G23A 2FAXA 4QUIA 5TT1A 3B1VA 3K3PA 3GFSA 3VMMA 1N2SA 1V1RA 3QMPA 1YH3A 4AZ3B 2B36A 2HF7A 1SG0A 2RH8A 2JFXA 2Y0CA 4JUBA 1VG9B 4RY0A 1YDWA 2INGX 2Y9MB 1P2BA 2PRSA 4YT4A 2RGCA 4RSRA 5FAKA 2WINI 1TCCA 2C2WA 1VPEA 1UBCA 2RI6A 1TMYA 3NATA 1QFSA 4H77A 3W2EA 2XBLA 3WGLA 4BEVA 5K0JA 1OPRA 1UEJA 1G4HA 3P71T 4A15A 1SD5A 4K9SA 1FYVA 3CG0A 1MC5A 3DYIA 5F5LA 3LBAA 1RZUA 3HMKA 2H8GA 3ZV6A 5FWYB 1O97C 2FWIA 4FJ1A 2AD1A 1ABBA 1C9NA 4EYSA 4QAJA 1ZCBA 4R1QA 5E9AA 2AIRA 5K0BA 2NO4A 2W42A 5EQTA 5HKBA 1EK2A 1SGWA 3BGDA 2NOAA 1COWA 3ON5A 5BY2A 1TYBE 2F9LA 1IQUA 2MYTA 4RZSA 3HZZA 3TLXA 2NGRA 5JNTA 4TYYA 3WKEA 1W94A 1NATA 2N1MA 1XUOA 3KE8A 2QD2A 4II2A 3L4BA 3MB8A 3RSSA 4B79A 3RI3A 4CKWA 2QZSA 1F7VA 2G70A 1HNXB 1GPDG 5HFNA 2QVGA 5HNKA 2LUOA 2Q5OA 2OQ2A 3CLUD 5EHXA 1ID8A 4PR0A 1KC3A 2P7HA 3DF9A 2QN2A 1JB9A 1MJFA 1R50A 4JITA 2F8TA 2OBXA 5LDHA 1CHDA 1MV5A 1BVRA 1W5FA 3OCZA 5TMPA 3ZCXA 2W2OA 2AMLA 3ES9A 5FFNA 1RVDA 4HO1X 1Z4QA 4HZIA 4PINA 4TSFA 1W36D 5HFJA 1YFJA 3TUIC 1OZ0A 4PLCA 4Y2PA 3DHNA 1G8YA 4LCEA 2GLUA 4EA9A 3KEGA 4F7WA 5B6JA 1DRVA 5IC5A 3BIOA 3RTAA 1A7AA 4P32A 2QRNA 1JAZA 2PH5A 3IP1A 2DUMA 1RQRA 1BVYF 1LK0A 1NM5A 1V5GA 1NRWA 2ZYWX 1ZX1A 3KQMA 1K8RA 1NP6A 1K9VF 1V45E 2VYND 4D41A 4M1EA 1JSZA 3KJIA 4EHJA 4H7KA 4EIWA 3GV0A 4TYWA 4GRIA 5HJ2A 1GILA 1A9RA 4EW2A 2YFKA 3G0GA 3LK6A 4OQXA 5BURA 2QSZA 5F3RA 3LIPA 4NFYA 1I2AA 2JL1A 2CLMB 2V55B 3LDAA 4YLGA 4YRZA 4PNEA 3DLTA 2O8CA 3E27A 3CWZA 5LD2C 4TV8B 3PFBA 1S96A 4QSHA 1U31A 3UK6A 1KEUA 1O8BA 5FULA 5EWMA 2MOKA 4RKEA 4R83A 5GP1A 4JI1B 2JAWA 1W4AA 5CT8A 3TFQA 2PX3A 4FBLA 2UYGA 4PHGA 1IEWA 1EX1A 2LGJA 4IJQA 3I05A 1GY8A 1KZ7B 2Q27A 2FY8A 2NAFA 2W6JA 3IERA 1MO6A 4US0R 1L5KA 3ONNA 4F3RA 2HWKA 3PXAA 1UDXA 3CEHA 4X71A 5LYJF 1I3CA 1L4EA 3DLCA 2BDTA 1T4BA 2H2IA 3HSSA 2P3OA 4MGZR 1SVNA 2QP4A 4MVJA 3EA0A 2IYVA 1O95C 2ZJAA 1WCYA 2GCNA 1T5BA 1VKJA 3ORHA 5ALJA 2Y0EA 3DZKA 3JCZA 3WBKA 2C1ZA 3PFIA 2C5BA 4CQLA 5E9JA 3NB0A 3RSQA 3IKTA 1RE0A 3U4CA 3L8EA 2CBGA 4G26A 2QTZA 2X1VA 3Q6IA 4NNOA 1XZCA 1CY8A 1M7HA 1QIHA 4KIUA 4RX1A 1FFHA 5DJ5A 4N03A 4NABA 3PQFA 2X86A 2ZXEA 1TVKA 3CRRA 3CUSA 3QPVA 2QHXA 5TMEA 2ZQZA 4CW7A 1A2OA 1KGSA 5CXUA 1NZDA 3DMNA 2GZRA 3STUA 3U7GA 1W96A 3PE6A 4FBMA 1OFUA 4E4TA 1C8BA 4Z4QA 2J9YB 4KWHA 4LXYA 3HYSA 1A9XB 3MS2A 4BNVA 3ET4A 3DZIA 1DC5A 4HYYA 3TGPA 3AEUB 1LRKA 4RLHA 1SC4A 3BSYA 4JT2A 4C1BA 4TL7A 3PE4A 3C6XA 1B16A 3PHGA 1KJ9A 3OZDA 3V8RA 2QP3A 4NJOA 4EG0A 4I4TB 3ZK9A 4P5EA 2C2BA 5GWXA 4BO6A 4NSNA 1RI5A 5BWBA 5AH0A 4J76A 3L8DA 9GPBA 1ZBQA 1TKCA 4QBTA 3TL6A 1FDOA 1N8NA 2IF0A 1Z18A 4TVBA 2BZ0A 5IDYA 3TTYA 4JOBA 1BCRB 1QONA 1UBJS 3HLYA 2UZ0A 1CFJA 1WD5A 5HS6A 4BGUA 1O95D 2DUNA 3PR2B 1EEXB 1FDVA 1W2HA 4IWYA 5BPHA 4PRKA 2PYZA 5I7OA 1FDTA 3TMKA 1XRLA 4KN8A 3H2SA 2DJIA 2DUUA 4QSMA 4FFNA 4JASB 3P2JA 4RJIA 1P9RA 2R6ZA 5K5EA 3E9YA 1ZVQA 1BVUA 1GGNA 1OV4A 4BFXA 2OCIA 2VUIB 3DMPA 1H3NA 2XADA 1R9JA 2WT9A 2Y67A 4XD7A 3PQ7A 1O03A 1E61A 2AN3A 3IR7A 4PBRA 2OO5A 4V2UA 4Z7QB 2BI7A 3L82B 5EE1A 2ORVA 4ZAVA 4ALNA 5KNDA 2MSNA 1PGJA 3ZUGA 3KLBA 3CX3A 4B0OA 1QAQA 1BFDA 1VP9A 2QQGA 2Q07A 3BMOB 3TX2A 3MWKA 3MJHA 1H0SA 2WIAA 5J9FA 3T3EA 4C3OB 2FCAA 3P2IA 3PC8C 3LRXA 4WL0A 2C57A 1ULSA 2C9MA 2OFWA 2B69A 5SZKB 4QX6A 3V8NA 1MPTA 5KBYA 1BGVA 1RLTA 2ZZKA 3CN9A 3DHVA 3NOOA 4RELA 5C8DA 3IDQA 4WAUA 1KBZA 2XB4A 5H3HA 3WP1B 2O8VA 3L9XA 1Y9EA 1FTSA 2KSQA 4PVDA 1S01A 2MU1A 1JU3A 1LPNA 4HNQA 3AIKA 5FA6A 3S2SA 3VR0A 3VSCA 3AGQA 3R0JA 1Z07A 2DY1A 1D7OA 2GJ9A 2O7SA 3AHJA 3E9EA 3EFEA 1P5HA 1OHHD 3NEYA 4LRYA 4RADA 3VC1A 2VHTA 4J0IA 2UKDA 2HUNA 4D8TA 1W2WB 4DBVO 5LP6B 5AXCA 1IHDA 1U1IA 5ECYA 2IEIA 3U0BA 1QKJA 5JXWA 1K6IA 1RAFA 2P91A 2XA9A 1ECBA 3S6JA 4XEUA 3F6PA 1ZHFA 1HLFA 4FNOA 2F9MA 1A4IA 4BNFA 2HB6A 4B3JA 5KCMA 3G88A 3GH1A 4F97A 2BFCA 2ZTUA 2ODQA 1XU4A 4ZCQA 3VC2A 1ISHA 2UYQA 3L79A 4OREX 2H08A 3R5KA 4KQFA 2IH4A 2EC5A 1QH8A 4JVLA 5AT1A 3OU2A 3PXEA 3ZZ0A 1XMQB 3ACDA 3KLPX 3A8TA 4MSUA 1W25A 2HU8A 3HBMA 1X80B 2AG5A 4BASA 2C4VA 4KV9A 1M2NA 1Z2AA 2GR9A 3KX2A 4UW9A 4XB2A 4A2WA 5C1DA 5IDQA 3T1HB 3GJ5A 4CLRA 3IJ5A 2VK4A 4DLUA 1CIPA 3RUAA 3WB9A 4DNPA 5EJ7A 3SPXA 1ZOSA 3U3ZA 2JI9A 4MA5A 1YTLA 3T9DA 2JLUA 4W5OA 2PA0A 2V5UA 2VHWA 4ZZ2A 5TPZA 1HDXA 3TNLA 1LSOA 1AKQA 1N7GA 3V1YA 1NSTA 2XUHA 2Y05A 4QASA 3K5HA 4ZGBA 1QLJA 1U9IC 3MF4A 4OAPA 1ADJA 3FPJA 3NHZA 3KJHA 3OKPA 2BV3A 4PQYA 3MRTA 4I4CA 4N41A 3L1UA 3NIWA 2IELA 2VP9A 3QENA 4XI9A 2DERA 4D8UA 3DAYA 4U4AA 1OYYA 4RM2A 5JFGA 3MAGA 3DO8A 5KOHA 4RTKA 1H94A 3FYTA 1TVMA 4CLEA 2J3HA 1GG5A 3O84A 4LNUA 5CNJA 2FRDA 5B2EA 5ICMA 4YRRA 3KR2A 5E1OA 3G9TA 1WBBA 1KMQA 3U9TA 3PVSA 2AX4A 3FWYA 4U6QA 2WTBA 3RVNA 2PKEA 1T3GA 2B35A 1SVOA 3QVOA 3U7HB 1PK9A 4N7MA 3QYAA 1MAVA 2Q3EA 3IODA 4YC7A 3DEZA 2HMYB 3KKOA 5D6OA 3PA6A 3RF6A 3FXAA 4HQKA 1GA6A 5AUOB 3R6GA 2A88A 3K9BA 1JAYA 1LU9A 2EP5A 3C41J 3G0HA 1EQUA 5EY5B 2A5FA 3GCXA 4QNRA 1MOSA 1UXOA 2B4TO 3ASZA 5DN6A 3W4JA 2BC9A 421PA 1XZQA 1ZK3A 1LBTA 1RMQA 3EXAA 3KPJA 3TN7A 1GNPA 2OCPA 1P2GA 1CJVC 1Z8FA 3BD8A 1MB4A 2JGRA 2DPGA 1IZYA 1IATA 3OAAD 3KB8A 4LGVA 3FMOB 1NFFA 2G25A 3TINA 1SUWA 1ACMA 4EG5A 5HJ5A 1DG9A 4KMSA 2ZT6A 2IHKA 3FPLA 1WR8A 3GMSA 2GO1A 2WM8A 3IPAA 1OVMA 1A5SB 2CL7X 3PD7A 1I10A 4HAZA 4JLWA 5BNZA 5CG2A 4MWGA 3AVUA 1A97A 1ZD5A 4OJNA 7MHTA 1UBOS 4KFCA 4BNKA 1NVTA 3LKBA 2FWJA 4KEAA 4NYIR 4C2TA 3I30X 2J9FB 2VDOB 5FTKA 3WIDA 5CBKA 4MR8B 3GJ8A 4PM4A 3L0DA 1A8QA 1KAHA 4J1TA 2VHJA 3BL6A 5LVAA 3JYNA 5LP1A 4DV4B 2IXTA 3MOIA 2LRHA 2JLCA 2NG1A 4AZWA 3AJ8A 2NW6A 2VH2A 2YQZA 2RDMA 3RTGA 4I6GA 3TLEA 4AZ0A 2O8EB 3VR3A 2Z3WA 4HNVA 3I01M 4AF8A 2O52A 2NZJA 1MT3A 1PJ4A 4KQHA 4M1QA 4M9UA 2P30A 1LRJA 1UEIA 2YWGA 3F0TA 2YNMD 3L04A 5ALWA 5KYYB 1A95A 4PSVA 4EG3A 2H17A 4UCXA 2V5VA 1GKKA 1QSGA 2RI0A 3G8CA 2JS7A 3N8GA 4K9MA 1NFRA 3DV2A 4HDOB 1RC0A 1S8OA 1L7PA 2LDXA 3M1YA 4RETA 1GCIA 1PKXA 2V5AA 2W4MA 4NZPA 4KVGA 4XWTA 5I8PA 1CF4A 2XQKA 1RSZA 3GRYA 4MS1A 1UXHA 2ESRA 4N5NA 1VSVA 2GT1A 4IO1A 4RSHA 4I4TF 5SYMA 2AZXA 4M22A 4BLRA 3DD1A 3ASVA 4AECA 3PQ3A 3ILXA 5J4LA 3PFFA 5F1PA 3NEAA 3UV7A 1C4OA 1HSOA 1N6OA 2OMEA 4HDKA 2QQEA 1M2JA 4FZVA 2J3LA 2H1IA 3R4VA 2RGWA 3GGSA 1VYTA 2KWIA 4TKVB 5FBQB 4C0BA 4BKMA 2N75A 2YWRA 3EULA 4DFDA 1J07A 2I6UA 1N6IA 4GL4A 3UEOA 3UYLA 1HURA 2YIJA 3BK2A 3COVA 3L6BA 1YK1A 3WWOA 1KARA 1EU1A 1N57A 2XD9A 4F4UA 3V46A 4HT3B 1U7TA 2WNHA 5JSZA 3K09C 1M1NA 1GZDA 2CJFA 1FS5A 1CZOA 2XCOA 2D5AA 3QX7A 4R98A 3E6AA 4BBAA 2FR0A 1J1IA 1YZQA 4NJMB 3CX6A 5DYTA 2R5NA 3FOAA 1X3LA 4TS9A 3TBHA 2PXAA 4P4TA 4EKGA 5F7OA 5LFAA 4HXGA 1EFUA 5GJCA 1P6QA 5CA1A 4AU1A 2ASVA 2V74B 3WYFA 2P9QA 4L7QA 1VMDA 4WNCA 1ZMBA 4LHYA 1V96A 1GNTA 4ZYLA 1V9CA 2VPWA 1G8PA 2AXNA 2OCAA 3ZBTA 3D4IA 1VL6A 5EVCA 4RTSA 4QT4A 1Q0UA 1RWKA 1YK0A 2P4HX 2HAEA 3BB4A 2VWHA 4OATA 1Y5IA 3RD5A 4UC0A 4BWFB 4BFVA 2IU6A 2O8BB 3WHLA 3WXBA 3ZGLA 1Q91A 4Y9UA 4Y0VA 4BLWA 3DR3A 3CQ9A 3TUZC 2WBLC 3CR8A 4WERA 2J32A 3PZRA 3QJ5A 4M0PA 3STXA 4BJ3A 1J8VA 1O89A 3LRTA 1BGXT 1U9IA 2XKAA 3MMSA 5CVEA 3G2MA 1WKCA 3VR4D 1SO8A 1WSAA 2WUFA 4TTIA 5LP6F 3B5JA 4NNPA 3KYDA 2VTBA 4BMOB 3P0EA 4Q3KA 2NXWA 3OTGA 1PJ8A 4IJKA 5INTA 1KZ6A 8ADHA 1IE3A 2ETXA 1ETHA 1VLJA 1PZHA 1XT6A 4Y67A 5DHAA 4Z9XA 4ZMBA 4RGYA 2C5LA 1W30A 2V7PA 2ZRKA 3I9MA 1E77A 5DK4A 1FS6A 1PCXA 3SQDA 3TQOA 2Y1WA 1PYOA 1Q74A 5EJFA 3EOAI 2B0CA 1AQNA 1OH6A 5LJIA 3FMFA 1YUBA 3CX8A 1E3QA 3HCDA 2QBYB 2YUTA 4LE2A 2AMYA 4M1MA 1D7AA 1VE9A 2VNHA 2VO1A 4WWHA 3CEMA 1PWZA 1EE9A 5AW2A 1SAYA 4FGUA 4L6AA 5JZSA 3TE6A 1EDBA 4OHZA 2W58A 2FJUA 3N2YA 3C8HA 4ZI3A 4DA7A 3ZW8A 3AHEA 3EF3A 3IDZA 2O6HA 3CJRA 3L0CA 1DJOA 2C5GA 2O3RA 3UOGA 4FGWA 1EZZA 2OHXA 1H9AA 3KVVA 1KA9H 3MJFA 5KPJA 3KJZA 3E05A 4YQZA 3TAUA 5IU6A 4BMCA 4XCVA 5TF0A 4P08A 2P9EA 2CK3D 3M9LA 3QJYA 4ND4A 4ZRDA 3AFIA 3Q7SA 4QGSA 3MN1A 1ZIXA 4HUJA 3WGQA 5JE8A 2GN0A 4XYBA 4CCYA 3O0TA 5I7VA 5DISB 5LLDA 4BFZA 5EJ9A 4D79A 1MCZA 1ZUNA 2JB9A 2P4EA 1DP4A 1JTEA 3QVWA 5ESXA 4H16A 4OQZA 4TKLA 2Z1NA 5CCEA 4A82A 3VI3B 1UF9A 4BNXA 1T2CA 2JEOA 3ETDA 4QPDA 2CFRA 4R1NA 3TW4A 1KI8A 5FKJA 5F2NA 4BXOA 3B3AA 5E7QA 3V1KA 3PDIB 2GB4A 3A3OA 1DHRA 1SCJA 3OOEA 4N3CA 5ICCA 2C4WA 3ROXA 3WGYA 3AL3A 4Q18A 3NFRA 4QXRA 1Y4SA 5C37A 4PZ9A 3BT7A 3CV3A 1UKZA 4UREA 1P2SA 4LQCA 1H2WA 3IKLA 4O2AA 4EEKA 5MN6A 4YFVA 3C6BA 4FOTA 4V1CB 1XJCA 1LX6A 5DNYB 2FX5A 3NKVA 5FI0B 4OHRA 3ZWYA 1W48A 3N3AC 2QU7A 2G06A 2OZEA 2W2LA 3CKMA 5TQ0B 2CCKA 4PQFA 3L07A 1A5BB 1WDTA 3BMXA 1YQDA 4HX2A 1EVEA 4S1OA 1NKSA 2XB9A 3K05A 2PU7A 1SD1A 3RG2A 1E2IA 1UXIA 3KJXA 3FWHA 4FDAA 3DM9B 4Q1AA 2F55A 4KQKA 3IQIX 3FCYA 3TAXA 1DPFA 1TCUA 3M4YA 5K0LA 3FRIA 4D82A 2IKSA 1H65A 3JAKB 3LQ1A 3TZCA 4DXAA 1UFOA 2FQYA 3O1LA 1NUQA 4D44A 3EDMA 1KI4A 3AR7A 4JX8A 4DB4A 1KEEA 2NZVG 4HJRA 4MO2A 1Y3FE 3EUWA 5CXXA 1EZ4A 3OQJA 1A04A 3PFGA 2B3DA 3VH4A 4ZCTA 3DAGA 2NUPB 2PUDA 3MINB 3TJRA 5JT1A 1O3YA 2ZBDA 4LF9B 4ENTA 3QA3E 4UDNA 3LGSA 5EHIA 4E51A 3IULA 3JQ9A 3BWMA 2Q3LA 3OTOB 3MD0A 4BYMA 3F73A 1RIIA 1TTTA 3DKIA 3LK7A 3A6LA 4IGAA 4K28A 2LW7A 4KE6A 4NE7A 1YB6A 1UDAA 3FMVA 4TSFD 5AMXA 3TDNA 3UMJA 4YRKA 3EPKA 1G8JA 1GUAA 4FHFA 2RHLA 4CU5A 5TC4A 1ZJ4A 3MMXA 1HORA 4E07A 2YTZA 1KFJB 4M38A 4F45A 1NX9A 1I7SB 1P3Y1 2ZPUA 1E9CA 1AUQA 1B8NA 1GP2A 4G5FA 3ZJ5A 3ZWVA 1RBZA 1PR3A 2UZ1B 2GF9A 4TL8A 4V3CA 3I5AA 4TT3D 3WYEA 3HJRA 2C9YA 2I3DA 4OSOA 1U99A 4OV6B 2VZ0A 4C5CA 2AKAB 3F8TA 1N0WA 3CW2A 1KOFA 1ESMA 1MNQA 3G0IA 3ML1A 1O2DA 2WMOB 2XCQA 5DT2A 5J1TB 4A2CA 5HW0A 1YOVB 4XEHA 1KH3A 3LXUX 3UK7A 1OC2A 2C8VA 3O0DA 4IIDA 2A0FA 6REQB 4WZAB 4KREA 2D3WA 1QRDA 3T3HA 1CY0A 5IS2A 1NMYA 3W6ZA 2C2OA 3QIAA 4WZ6A 1CUCA 4UE6A 2DU8A 1LF5A 3NMUF 1ZAKA 1BWQA 1CQJB 3MSCA 1S2OA 2FWAA 3HACA 2BFAA 5E6UA 5FOTA 1QJCA 2JFGA 3R3UA 4Q05A 1SVMA 4R1SA 1HZZA 2VDWA 5G1PA 2O4UX 4I99A 1RI4A 1Z2PX 3EZYA 1GOTA 5DHPA 3QOXA 1NQWA 1WF6A 2V7QD 1LI7A 3F90A 4GRAA 4MS1B 3UOAB 1XTSA 4ZOLB 1UPTA 2R60A 4E5YA 4ZHSA 4AQ7A 2YHIA 4OKSA 4V0ME 4EY6A 3RRNA 4MQ5A 5BT8A 1RP1A 3V3TA 1QVAA 1MC1A 2DTXA 1SXJC 2C96A 1G1MA 3I0NA 1CHNA 3Q9UA 4L7VA 4R3WA 1IVSA 3IP9A 2Q8PA 1KK1A 1L5HA 4DSTA 1Y6GA 2NP6A 3QWBA 7YASA 3FCEA 2EZTA 1BYUA 2X0IA 1GNSA 4FNMA 4TLBA 4TYNA 5FBKA 5JH7F 3URMA 3W7AA 5TQJA 4ACBA 1LDMA 2R47A 1GSOA 2WHRA 4EENA 1U1DA 1ZM4A 3V8QA 5JSZB 3GLVA 2Y1EA 1U02A 1TM3E 4RF2A 3AQ4A 5BQ5A 3ECSA 2VP2A 1QIIA 2Z2XA 3T9EA 2QEQA 1C1DB 4R1OA 3HU2A 4ED9A 3GOQA 1P75A 1Q7RA 2C4NA 4IF6A 2EHDA 4KVZA 4I0WB 4NZOA 1DS6A 4PQEA 5FPTA 5IJXA 3OUZA 3ZWOA 1G5RA 3T9FA 1THGA 3EGCA 1KI2A 3IAFA 2X8LA 3UO8B 1L4UA 1BSVA 3CUTA 2QV0A 4LK2A 2XDWA 5D8DA 3WJ1A 4XKJA 1EB8A 1XJ0A 3PFHA 3ZBQA 4OSPA 1GLGA 4DCVA 2GEBA 3DAOA 3LOUA 4YIKA 4D57A 1AMNA 2GNOA 1UOEA 3VU9A 5ARDA 4C3VA 3D4OA 3GDWA 3HLTA 5LOVB 3STYA 1GPUA 3TIVA 2J4FA 4CLHA 2VJAA 3QVXA 2JAHA 1IZ0A 1P2UA 1J8QA 4RPHA 3MERA 5K3BA 4I9GA 3SEAA 2RK6A 1NN3A 1PSDA 2GHQA 4NTZA 4PHTA 2Q1WA 3LPAA 5B4TA 4DV2B 4KAFA 3GN2A 4FIZA 1KYXA 3KQOA 5AI9A 3HYTA 4C3UA 4GX1A 2F48A 5SZHB 3ET5A 5ESDA 4G97A 4LSZA 1QFMA 3KYDB 5BN4A 2VTBB 3TCXB 4Y1RA 3AFMA 3EC7A 5HP4A 4GYKA 4NCHA 4Q9JA 1WNFA 2QGNA 1X7DA 2OV3A 2XRZA 4R1UA 4Z9AA 1TZKA 3UPTA 4P53A 3OX2A 3W05A 4BKQA 3FJ1A 1GPWB 1W75A 1NRXA 4Y30A 2Z3ZA 4YMSA 7REQA 2AN5A 2BKLA 4M0LA 2QMUA 5ALVA 2EZUA 4RD2A 3W7VA 3ZDBA 3K0SA 2EW8A 4AO8A 2YXBA 5ALZA 5F5XA 1U9ZA 5IKMA 4L57A 1RWPA 4URYR 4BEBA 3IJPA 1HFEL 4XGIA 2O05A 3C3XA 3SXUB 3GAMA 2EDCA 3SU8A 1IC6A 2JKVA 3F6SA 1YHZA 3P9PA 4B6SA 5LUAA 4BZWA 5EJ4A 2H7XA 1KAQA 1ZJZA 1U0RA 2H5IA 3JQ8A 1NMXA 4KPFC 4MQ4A 4GUDA 2BSAA 3RT1A 4D6YA 2WFMA 4BBZA 2ZJ8A 6PFKA 4JI3B 1CUUA 2X5OA 1WLYA 1CDOA 2A3RA 1QYRA 1R88A 1EHCA 2C3OA 2HQ1A 1E3JA 2J9XB 3IP3A 3TR6A 4F4IA 2DBYA 3ICEA 2ODNA 4FMCB 4YRAA 3I2JA 3VA7A 2PUWA 3FN4A 2YN4A 4RTPA 2G4CA 3O1JC 4E5SA 1LPAB 1P9OA 1YZLA 2A94A 5LU8A 3CGWA 2QT1A 4PPQA 1J70A 3HDTA 4FNGA 4G0NA 5CK5A 3WBBA 4QM6A 4Q1DA 3A36A 1RJ9A 2ZATA 4E03A 1GPMA 5B7QA 4Z0PA 5L95A 3PRHA 2DUJA 3LQQA 1E94E 2HI0A 3GELA 3QELB 4L51A 4Q4AB 5J5CA 3UT0A 1J2JA 4F4FA 3GIWA 5JTUA 4KOEC 3ZIUA 2YWEA 2WJWA 1GA4A 2Z2YA 3FF4A 4TVSA 2P2LA 3OCJA 4FZJA 3HB5X 4U2FA 1LTQA 1N2IA 2PWYA 4U3JA 3OICA 2VPYA 3INRA 3OFKA 4I9FA 4PLYA 1CUFA 3NIBA 2Y4OA 4BFSA 5IG2A 3UH1A 5KTSA 3V5NA 2EYQA 3HJNA 4C4AA 4Z8YA 3A06A 3AR5A 2FMXA 2VI5A 1UM9B 2H1OA 2XYVA 4GE3A 3JQ9C 1ZXBA 1C2YA 3DVSX 4MAMA 1VLVA 2A5YB 4FP9A 1UMCA 3A31A 4RNCA 2UXDB 4MRNA 2PKXA 4TROA 4J0KA 4QWWA 1P44A 3UT5A 4MKRA 3LPNA 2H7VA 3A6KA 4US2R 4KR6A 2YWHA 2JFWA 3R0QA 2FEWB 4I1SA 1RKXA 2REQB 3ZQJA 1XXHA 1YJQA 3MTGA 4CKBA 3HJBA 4FDVA 3LX6A 3WL7A 3EVGA 3H04A 1S9DA 1J8DA 2F3TA 2R25B 2VXOA 1L7OA 1BXRA 1ZBDA 2ZU0C 1HFWA 4KQMA 3VZSA 5JHGB 4Q4LA 2JBHA 3G2QA 1DKLA 4YMIA 3SE0A 3SOZA 1YV9A 1JEYB 2WP8J 3P7MA 5BNIA 5AM2A 5A2GA 4X91A 1P2VA 4QXMA 1WXQA 1XL1A 1JECA 2B20A 2NNLD 3ND9A 3QLUC 1H4SA 3UPDA 2R9VA 3W0LB 4PYNA 4AJLA 5EJAA 2IXGA 2BZGA 4LY9A 2NU7B 2A9FA 2GK7A 3QF4B 3ZU6A 4X41A 4DSNA 2C7PA 1W5SA 4LPSA 1EE1A 1YQQA 4JBHA 4XFKA 4E1AA 5BORA 1ISRA 1EHYA 2IYRA 4UMVA 2H2AA 3QMVA 4Q37A 3SJ7A 3K94A 5BXQC 3X2FA 1TAHA 2PR7A 3U3OA 4F4DA 4MROA 3GDOA 5KC9A 1Z9BA 5CIYA 4F92B 3VZCA 4A36A 1TUBA 5ENVA 1M33A 3T9BA 2PGOA 1CUBA 2BUBA 4R8VA 1EXWA 5E2AA 5JARA 1LK7A 3N7TA 3RRXA 4D9HA 1US8B 1K7XB 1U2ZA 2JDIA 3O8NA 4NBKA 2DR0A 2VRCD 3SHTA 4QUJA 4TWIA 2G8LA 3MT9A 1JEYA 4XTRA 1FCJA 1N0UA 5DASA 2CE7A 5D3KA 2FUG6 2ZJ0A 4D4LA 3PDHA 4Z54A 1LW7A 3MSXA 4FHEA 4PQRA 1P0IA 3O8RA 1GZ6A 1CV2A 1JX6A 5KOHB 1VBFA 4JJZA 2MYUA 3DJYA 1RLJA 4YASA 3BXFA 3UK2A 5CD1A 1F8XA 1ZCAA 1GQ2A 4LOAA 4C7XA 2TMKA 2RI1A 4Q3AA 5FBVB 1I1QB 3IE2A 1O6ZA 2X3UA 3JQDA 2E5LB 1E2MA 3ZDAA 1E3MA 1OTHA 1X8JA 2ZSBA 4JVMA 4RFVA 4EB6B 1UWLA 1DCTA 1CEQA 4R9SA 1CZNA 4MEJA 1ZH2A 2RBEA 2CLEB 2OLJA 2Z2ZA 4MYRA 3WK9A 4JP5A 5B5SA 5DRTA 7ABPA 2WSLA 3FHLA 3LCMA 4NMMA 5DM4A 1NJ6A 4J6FA 4NARA 4RHXA 3MYRA 3MCTA 4MWCA 1SZPA 1QIMA 2GEKA 4XWYA 3CW9A 3H6HA 3FZQA 3AMVA 3WDLA 1NY6A 3M5PA 3FSJX 3B7GA 2ILTA 3M82A 3VYSB 4OQDA 3V6MA 4NBNA 3UGTA 4K3UA 4LXHA 4GVLA 3ZKWB 4CNBA 4CTNA 1YI0A 2IODA 2LCFA 1DAPA 2REQA 3M4JA 5D86A 5CBPA 1B6RA 2YJNA 3AONB 4HLQB 3IRUA 4NOLA 4QPJC 3OZ7A 4GAEA 2OGTA 2NLOA 3ZCSA 3GH3A 3UWMA 1Z7BA 3I8OA 5KTOA 1YO6A 2WJ6A 1CUYA 1TM7E 1W581 2X7XA 2QUKA 4PONA 3QX9A 4UBJA 3AVQA 2D59A 3O21A 1SUAA 4MKZA 5HK8A 1FFYA 5I9LA 1KKLA 3GOHA 2BTQB 3EWNA 4W6ZA 1VKZA 5F33A 3VNVA 1EIWA 4XYLA 3VKHA 4E22A 1PJQA 1FRZA 2PX6A 2X23A 1WZCA 2YHAA 5IMSA 5LBIA 3UG7A 1BQ4A 2GPJA 4Q1VA 4U3JB 4HQRA 1A5ZA 4OIFA 1BXKA 1QVVA 4R2KA 1C9KA 2HV8A 1U63A 3K1AB 5D5QA 1R6DA 2HJSA 1PYDA 1TYZA 1UC9A 2C4HA 4INOA 3R3XA 1OA0A 2NYAA 3ZD8A 3P9RA 5BSVA 4AURA 2DFVA 1H2YA 1PL7A 1X0VA 4GP7A 5I5GA 4QUDA 1USWA 1N2CB 4B4OA 5K2OA 3P9ZA 5E8JA 1LB1B 3DZHA 3EA4A 4G07A 3ID6C 4I55B 2F4NA 5DVZA 4B3MB 4A03A 4IZOA 1QF7A 1U6JA 2O3QA 2PEZA 2VAPA 1E59A 1JG4A 2KW5A 2RHGB 3BJEA 3VHXB 4P86A 4HRAA 4BV3A 5L7TA 2DF8A 4B7AA 3IAXA 4XVQA 4QUAA 4YMWA 4M9ZA 5JI3E 5AICA 2UUOA 3OQVA 4FMCF 4KPUA 2RCNA 4A5SA 2BBSA 4ZKDA 4JODA 8ABPA 3UJ6A 4PYLA 4DA4A 5K8TA 3AVTA 1US8A 1P4JA 1NBHA 4XSHA 3DFKA 1MBZA 3KEFA 1W88A 3JR3A 4TMKA 5DHTA 5FXMA 4F6RA 5AM3A 4V0SA 1YB7A 2B2CA 1U94A 1O96A 2YVUA 2IYAA 2YOGA 2GARA 4KX5A 1KQNA 1XZLA 5TGTA 1V71A 3PRJA 3L1JA 2NO9A 4ZN6A 2ODTX 4P35A 3RVPA 2HHHB 1M1YB 1E2UA 4F6LA 3CYFA 1V7PC 1DKQA 2GCIA 4YMVA 1IM8A 3RJTA 5MN5A 1FDWA 4YQEA 1S7GA 1W4LA 2XMRA 2X2PA 3RSOA 4GEGA 3CO5A 4QTXA 3NTUA 3WE7A 4PYQA 4XVUA 5HUQA 1FY2A 3O83A 4MYCA 2ZI3A 4CL8A 2IPXA 3N6XA 1EVYA 1VXRA 5JATA 1CLEA 1DXOA 2HLNA 1XZMA 2YFHA 4WUVA 4Z9FA 3WNQA 1BKDR 5DTEA 2OO3A 5IP5A 3UXYA 4GKJB 4J2HA 1E1CA 3PFCA 1AD2A 5CXSA 3RVJA 2HGSA 5HVNA 1NYTA 1P60A 3KJFA 5H83A 1TRKA 5AJWA 2H4XA 4B5LA 1Y3IA 4H1UA 3BXZA 3ADPA 1WB5A 4NF2A 3N8KA 3KR9A 1T8RA 2YXLA 4MVJI 2IIBA 4YJGB 4YONB 4WCDA 3RHZA 2R44A 1WSDA 1Y5LA 4C0WA 1DBQA 1FP7A 2C7BA 1AXGA 4NOMA 3UFXA 1CQZA 3PPWA 3H0EA 3PS9A 4NE9A 4R40A 3ZDCA 1E1KA 1WHTB 1YQWA 5KYUB 2L82A 1ESZA 3TQHA 1DMRA 4WZZA 3AIMA 3KBBA 3OMWA 4WNYA 5DF1A 5E0OA 3B6MA 3AYXB 5K0TA 2OZPA 2QYSA 3EPPA 3Q6NA 4CQLB 4OGKA 2AFHA 3CEJA 2BTEA 3KZNA 1O0SA 2WSYB 4Q3OA 1ZH8A 1MX1A 1TA0A 4BO0A 5KNDD 3I4CA 2ZKIA 2G1AA 4GLLA 3RANA 4Z86A 5ALRA 1Z5GA 3V8EA 3DYVA 3BDIA 3PIIA 4INJA 5KC8A 4R1PA 2SNIE 4O0MA 1L6RA 1Q83A 3R7FA 5AVVA 5ERYA 4UHFA 3LDUA 3KSRA 3FTCA 1ZD1A 1RLUA 4MZXA 4FLEA 2ZI5A 3QX8A 2X76A 1Y98A 2CMDA 4GVXA 2FSHA 4JUAA 1XNGA 2H3EA 4C4YA 2BUAA 2VAMA 3R6TA 4TMWA 4I5GA 2XNDD 2RMKA 3TLGB 1S3SA 1J9EA 1ULUA 2GBFA 3GA0A 1HE4A 1Y7HA 2Q1XA 1JGTA 1AURA 1LPSA 2I34A 1EXMA 2A86A 2BP7B 4F9EA 3HXPA 1DTSA 5LQUA 3SG0A 3ZI0A 2QRZA 5D3MA 3TOZA 5JAMA 3LVRE 3BS4A 4BO4A 3ADCA 3FJYA 3EGXB 3ICPA 4GQBA 3HY6A 2YVKA 2RGXA 5KTYA 1QWSA 1J99A 2GGSA 2G9RA 2YZ2A 4RVUA 4ZVTA 1BX1A 2IHZA 1SCUA 4M89A 4MWOA 3IAEA 2Q45A 2ZVJA 1KJQA 3SXUA 1HFJA 2XUIA 1K5GA 1G64A 3PD1A 4IIBA 4AJHA 2VSFA 3UIEA 2E85A 1MKYA 2EGHA 3WK4A 4HC4A 4TMZA 3HBNA 3HU3A 3LHSA 1QK5A 1ZI6A 4FOLA 1TLTA 4TWBA 5HDBB 3KUCA 4MYDA 1C9MA 1VE6A 5CT5A 2CNWA 4R69A 4DSAA 5DT9A 4UMDA 2AMVA 3PNYA 2Z43A 4XOIA 5BNWA 1IN1A 1FSPA 3E15A 4BUCA 4G4JA 2SECE 3PKIA 1C8VB 4WSOA 3GMTA 2FB9A 1EDEA 4XR4A 5CB4B 3VKGA 3BQ9A 3C45A 3FYUA 2GKSA 3PXCX 1QYXA 2G83A 3EFOB 3VAZA 5BV1A 5JV5A 3F9CA 1YS4A 2DETA 3LWDA 2FPIA 1DDGA 4Q34A 2V59A 5H3LA 4D3YA 3O2SB 4BNUA 2GPNA 1I2MA 2H9AA 1M34B 3H16A 2ZJ2A 1J00A 3AF4A 2V6MA 2PGAA 3GJZA 4Z3DA 2GCOA 4ER6A 5FLYA 3G02A 4ZYZA 1CS4C 1ZO8A 3KALA 3VR4H 5CDTA 1OXVA 1A9ZA 2ZJBA 4P4GA 5ITZB 3DUFA 3EGOA 4GOLD 3GG9A 5MGNA 1J42A 1P72A 3PUYA 3CNEA 3PUKA 1R4NB 2YW9A 4PNHA 2XITA 3KB6A 3LOQA 1G1AA 4DR3B 5J2TF 4RY2A 1T91A 1Y3HA 3KQNA 2W6JD 2OTCA 1YCGA 4NPCA 1IFXA 3N2GA 3THWB 1PGNA 4FCWA 4X20A 4DIBA 4UPVA 1I2ZA 3KTFA 4F3KA 1RI3A 8MHTA 1EWKA 5ICFA 4OHPA 1HK7A 1T4CB 2HBRA 4NE2A 3LUFA 1AU9A 4PLPA 4OLFA 2DHCA 4WNAB 3ORYA 4O1HA 3O4RA 1MB9A 1NL3A 3LHIA 3H8VA 4OUDB 2J6IA 3TBKA 3TKAA 3WLIA 4D99A 3B3JA 1CJTC 3KQWA 1XHEA 3IKJA 3PG5A 3BJMA 3Q0TA 5AVKA 4WOCA 5C0OE 4BX3A 3O2JA 4N3NA 1E9DA 1PT9A 2FEPA 2PIAA 2PD3A 1KH2A 2AG1A 2WTAA 4G4IA 5BSMA 4JI4B 2QVYX 4GMHA 2QJFA 1U3VA 2HLHA 4RLQA 4BMPB 4OF4A 1VJRA 3OA0A 1RLMA 5EQFA 1J90A 5J2UA 4HRVA 1JG1A 2OZLB 4IMIB 3U4MA 2GHTA 1UPAA 2AKYA 5ES3A 5GZ6A 4EL5A 3ZCPA 1EG2A 3QFTA 2L2QA 2J30A 5AKEA 4CT5A 2ZCJA 2EKZA 4UBIA 1IBSA 4LGYA 2WYUA 4IDEA 3W6NA 3ZG6A 1Z4JA 4MJ3A 4H3SA 4JVNA 4J2OA 2VWQA 5LCXA 3QE3A 4H1HA 1HDEA 5FQOA 1YIDA 1AHNA 2G9QA 4J0GA 3SFVA 4AJ1A 4PX3A 1U98A 3M2PA 2GKOA 4RHFA 5B1IA 3LAWA 4FYYA 3WYAA 2VA8A 1BFUA 1UDCA 4HLCA 2QLTA 1DOZA 1GAWA 4ZI7B 5M34A 1NOKA 5AOAA 4RTMA 4K6GA 2WKRA 1BMDA 4GDMA 3QLJA 4YV2A 4ND8A 3GUCA 2E7ZA 3H2YA 3TZ6A 2QLNA 4TKMA 3DZFA 4JU8A 1QQ6A 2QTCA 3CA8A 3GWGA 4HGNA 1RYZA 1QQ5A 1KDOA 4HAUA 5KQPA 1F8UA 2E5WA 2D13A 4RK0A 1VCMA 2COKA 2Q4RA 2J7PA 3RUHA 2OXIA 5C7IO 3H8WA 1LZLA 4L4SA 1D1TA 4TLCA 2BSQA 2P0EA 2FW6A 3FHJA 3F7MA 2G63A 1S3FA 1I5RA 5DI3B 4BX2A 4RBNA 1JA0A 4XD2A 1RJFA 2IU4A 2QVCA 2ZRIA 3M33A 3PGVA 1I3MA 3AO0B 3TLAA 3OWHA 2LIPA 4A8JA 4PZYA 2QG6A 4QOGA 5DDIP 5DBHX 3MBOA 4R2XA 5I7EA 1P5JA 2G1JA 3EIOA 2A0WA 2MR5A 1SK9A 3DMGA 3UYKA 4LFCB 1J1ZA 1IY0A 4HDRA 2CXHA 2R6AA 3UMBA 1F6DA 2AW3A 2C9CA 4G65A 2DFLA 3SQXA 4PICA 2LPMA 3RFFA 2H2DA 5ARCA 1PZNA 2QJWA 3E2MA 3CZMA 3E22B 1E20A 4YCAA 5IDWA 3P0FA 3W2IA 4KNYA 2ZUEA 3A4LA 1BXZA 5H4HA 2QPLA 3CUUA 3KPVA 2X8WA 3IT0A 3LKZA 1EGHA 4YRBA 1IK4A 3AU8A 3EDCA 1GVNB 2XUFA 4M8SA 5E4YA 4HH0A 3THWA 2QN3A 4AD8A 3DYBA 4ZCMA 4RQBA 4Y2QA 4CM9D 1VG1A 2Q0SA 3BRQA 5FIUA 1VLLA 2HU7A 4FW9A 1CE8A 4QE3A 3FX2A 1SBNE 2FR8C 2MTBA 2XRYA 4CNQA 2AFIE 3L5OA 4AMZA 4LF4B 5G3YA 1HE3A 2QAGA 4TKVA 4YAGA 3EC2A 3AJ9A 3DHWC 4I1IA 4ENQA 1GPAA 1WX1A 5A5GA 5JXGA 3AC0A 2HZ7A 4EBBA 3K0HA 3KEOA 1B4DA 1MJHA 2LP4Y 3AL2A 5EP3A 2GETA 2AH5A 5CJ2A 3UXEA 3IPYA 1UMDA 1HT0A 2VNKA 1IHYA 4FYWA 4RU1A 3K9FC 1EZ1A 4QEZA 3HDYA 5IZ4A 4NXMB 3WO0A 1QRSA 4GKAA 4D6PA 2ZBFA 1VKOA 5CA0B 2C61A 3QUTA 2G9NA 4D3FA 4RS3A 2CNWD 2W2KB 1G4AE 4R31A 2WUEA 2PX5A 4R3UC 5DLPA 3GAZA 3BWEA 5F64A 4B3DA 4DR6B 3L8GA 1YR7A 1LTHR 1ZQ1A 4G8CA 3ENZA 3ESBA 3IHKA 4UZEA 3CF4G 1W5EA 5EWJA 1LPBB 2B1QA 1KAEA 3JQAB 4QUBA 5A71A 3CPEA 1TAGA 3SR3A 3T7DA 3TQFA 1Q20A 1U8UA 4IS2A 1V26A 2OKGA 4CCSA 4DLBA 4Z4CA 2FFRA 1IRIA 3MD9A 1QZUA 3SJUA 2CDAA 1GV1A 2HRZA 1JHXA 2H4JA 3OQIB 4EPVA 4EP1A 1UJ4A 3C70A 2O8EA 4GMDA 3CC8A 4CHGA 5CP8A 1WUJS 3ORFA 4G5SA 2ZM5A 1W49A 2BM1A 5I9TA 5TE9A 1KDRA 1LSJA 4ZDWA 4F7DA 3P2OA 2GI4A 2OYSA 3DULA 3E7FA 1NIJA 1UANA 3MUNA 4GE0A 3OZUA 4QA9A 5CVDA 1TU4A 1NP3A 2AE1A 4QXQA 4E33A 1TU3A 4Z1OA 2GZAA 4E11A 2JFFA 1U0JA 3KB2A 1OAAA 2WPNA 2ZWIA 2XNDA 3KE9A 4WKOA 4ZVVA 3TQQA 4R2LA 3ZR4B 4R6WA 4UFOA 1G2IA 6NULA 1E1RD 4RMGA 2R2GA 3D2BA 5FP0A 4BNJA 3Q7EA 4FEAA 2QU8A 4UNPA 1L4HA 3IVMA 3KVRA 1QRRA 2VWGA 5F21A 1CQXA 5ULLA 1U2TA 1ZUHA 2OBFA 3BB1A 3N7UA 4BAZA 4CMBA 5BVGB 4DGSA 2F8SA 2BR5A 2P11A 3LQRA 1Z0DA 1DRJA 4G5HA 1L5YA 4NIMA 5ECDA 5TB5A 2QTGA 4X3OA 5DNCA 4JUCA 3GAFA 5I3CA 1KI7A 3DPIA 4KU4A 2FQ1A 1VFPA 1GKIA 5CH5A 4ZO7A 5ALTA 4ENPA 3OT5A 3ZC3A 2QUBA 3O8BA 4HQOA 3EY9A 4ND2A 3R3HA 3LUGA 3A9CA 3NHYA 4IDBA 5HOQA 3JAMA 3W2GA 1XROA 4WFQA 4JDPA 4AMUA 1E7WA 1FJXA 1W35A 4G25A 3DZJA 4GT1A 1XEAA 4HVLA 2HA2A 4M7WA 3I9FA 4XSGA 1SKYB 5ILQA 1OF1A 4CJXA 2K7FA 3J7TA 4BP1A 3WX0A 2IDJA 6GPBA 4IVNA 3IIKA 1KOLA 1K8YB 4PX2A 3D5TA 4ER5A 4IVPA 3TLYA 3SYKA 1NW6A 1TI7A 2FWNA 1T6YA 2XUQA 4KRFA 2QVLA 5EEGA 1XAGA 2XIQA 2QRKA 2J5QA 2RB5A 2XWQA 3KUUA 1NSFA 4X9XA 5A4DA 3TR5A 4W9MC 3P0HA 3THYB 1T6XA 3WB0A 4I19A 2HRBA 3NOQA 1KZ9A 4ZO9A 3L02A 2B4KA 1DI0A 5I7FA 4P3OA 1J5EB 2I4NA 3D54D 3MBIA 3VPFA 2O8NA 5BQXA 1F6BA 1RACA 4TV8F 1B14A 4YP1A 2RK3A 4C6TA 4IV0A 2HF2A 1UK8A 7AT1A 2R86A 3CUYA 3FOBA 5DGHA 4DMUB 2WQ6A 3TRJA 2R6JA 1UC5B 4V0MA 2PUBA 3M89A 1ABFA 1XFDA 4YRPA 4H3VA 1AS0A 2P68A 2VRBA 1SVLA 4A2PA 1TA9A 2IEZA 3ANMA 3ESDA 2FSFA 2ZBPA 4KN9S 3H42B 3WOVA 1IY2A 1Q0ZA 1PT7A 3D2AA 3QKSA 4IYRA 1CUJA 2FWPA 3DWFA 2ZSAA 2XNJA 2ZWAA 5CB4A 1S8NA 5TT0A 3JR7A 5LYJB 1RBQA 2BCJQ 3AOEA 3AT1A 4REOA 1BDHA 1K7FB 2O3TA 5D6NA 3I5MA 3BWBA 1XNHA 1YL7A 4QYTA 1WHSA 4B9EA 3BHNA 3QVMA 1BKSB 1IQPA 2R68A 4ND5A 1ENPA 5FUBA 4F8EA 5CA1F 3PDWA 1B43A 3G7UA 4DUPA 1N9KA 2X3YA 4HADA 1X80A 2VHEA 3MLBA 1CYEA 2OXFA 4RH3A 4CM1A 1Y81A 4KQ2A 1T5LA 1E62A 5IXSA 4LVOA 2WZQA 4D6XA 5C7OO 1BROA 2CYCA 1O8CA 1R00A 2FNAA 4RTQA 3ZNQA 1SC1A 4QELA 4GYWA 3HSKA 1PEAA 5DNWA 2GXSA 3BTUA 3MB5A 2CJWB 1Y1TA 1Y89A 2V54A 5D3MB 5BOVA 2DFPA 2PZKA 3TAHA 5HYVA 1JH9A 4FFMA 3O4FA 1NFQA 1XPJA 3TRKA 3OTIA 2JG3A 3GPLA 3CVVA 2GWRA 2DBQA 2XWSA 1BG6A 4TRRA 1E3SA 3REFA 2ZS9A 4N5LA 1ZWLA 2AR0A 3I2IA 2I3BA 2QMQA 1FRNA 3HUDA 4MOWA 3LDGA 4ES6A 2J87A 3LPMA 2FKAA 1E9AA 1N7HA 4DVJA 1HRKA 2CDNA 2PHZA 3GEPA 4MV6A 2ZYDA 3GLHA 1WCWA 3BZBA 2YWXA 1E1MA 3ZZUA 5ENDA 2EAUA 4EG8A 3ZJVA 2Y8EA 3FZNA 1NJ1A 3V4LA 3U1VA 1XR3A 2QXYA 4A8TA 4OHYA 1XZJA 2WVJA 3GX1A 3HUEA 1G6HA 2I2BA 1GM5A 3R9XB 2V98A 2C3MA 1NE7A 2G88A 3ETEA 2RHRA 3PEVA 1I3KA 2B4YA 3CCCA 1K7YA 1PIWA 4HNSA 4JLAA 1MUUA 2W11A 5BWLA 3L1VA 4R8KA 4EX7A 4F3NA 4WBNB 2YHUA 1GGFA 3AR8A 4I2NA 1PTJA 2AJTA 5SY6A 1R27A 1SZJG 1Y4ZA 4GZ5A 3ICOA 4I9UA 4CQMB 2GXQA 2R2AA 1D2CA 1I13A 3IAS6 4G2TA 2AN9A 4P80A 1L3BA 1OYOA 1T4MA 3NKFA 3UMRA 1T0PA 1K0FA 3TGLA 1NT4A 1T2FA 4PFSA 4F2HA 1A9PA 2P27A 2PE5A 1NJ5A 1VJ1A 3M4NA 2E6UX 1P33A 1ZVJA 2RIRA 4HAXA 1K4YA 2Q5HA 2XTNA 3G2PA 1YU6A 4CTMA 5CBPB 3ZKWA 1E0AA 4XQGA 5DN6D 5FLXA 3CPJB 2REBA 3MJEA 3SC4A 3AINA 1NF8A 1UK6A 1TD9A 2PKQO 3ZGVA 3MJ4A 4GSYA 2H5EA 2KB0A 1W1IA 1OBHA 4DG8A 4YRTA 3TEFA 5CFNA 2QRVB 1DIHA 2AOUB 1USUA 4C08A 2W83A 1AHIA 1Z38A 3E18A 3IOBA 3HR8A 2NN3C 2OLKA 3P5SA 4CGYA 1ZI9A 2PX8A 3ELDA 2QTMA 1E66A 4X84A 5KYUA 4E0BA 3G2HA 4OGLA 1T25A 2QA5A 4YXFA 2VQDA 4EABA 3DKRA 3N28A 1PGOA 3LHKA 1PJLA 3PC8A 1BS1A 1OGJA 4NK4A 3HRIA 5C80A 5JAZA 3WIVA 4HWGA 4X60A 5DIZA 2X0DA 4IDQA 4XR9A 1I6KA 1U0LA 2P79A 2YMLA 3R3ZA 5DHQA 1N8TA 3A9RA 4DMGA 4ESOA 1FX1A 1S6YA 1Z0FA 3GZJA 4XW2A 1M0WA 3BGVA 4BZZA 4TVKA 1HGXA 2NSLA 4OMFG 3RWMB 3VR2A 1I3OA 1VFNA 2NYUA 5C9ZA 4WADA 1X19A 1VG8A 5TPZD 3LT0A 2R7MA 3P96A 1UBHS 2HFKA 4RUKA 1FEZA 2D1RA 3N2NA 3VR6H 5A6VA 1VPDA 3U31A 2E3JA 3F9RA 5IF3A