3PBGA

6-phospho-beta-galactosidase form-c
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
468
structure length
468
Chain Sequence
MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITENGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 190
structure length 468
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pbgA00
1V6WA 1WCGA 3ARUA 3WF4A 3CBWA 2ZUNA 5E09A 4QAWA 1KQZA 3UG5A 3F5LA 1B3XA 2D20A 3WNLA 5A2CA 2E40A 2DGAA 4ACYA 4J3XA 2Y4SA 4AZ6A 4QCFA 2WM0A 3WH5A 1CEOA 1GPFA 3T08A 5BXTA 3VGEA 3WELA 1C92A 4TX6A 2ZUUA 4GI8A 3WQWA 2TAAA 3SUSA 1FP8A 4NRRA 4QCEA 4NRSA 3W24A 4DUXA 4A3HA 2ZX5A 1XRVA 3PZQA 3RPMA 1NOUA 3AZTA 3BAJA 4GZJA 4J7RA 1QVBA 1W1VA 2J75A 1TG7A 1ECEA 2V5DA 5C71A 1LLOA 3RJYA 4CN1A 3WDIA 1XYFA 4KGJA 4FLQA 2A3CA 1BVNP 5JBEA 2GK1A 5A8QA 2YKKA 1HJUA 3PZTA 3JUGA 2WKGA 5AYBA 2JEPA 5I3DA 1WPCA 8CGTA 2VCBA 2W4XA 1GOIA 3AZSA 2EQDA 2D0GA 4L4PA 1CDGA 4JFSA 3FN9A 3WEOA 1R85A 3VX1A 2YA1A 4F9DA 1KGXA 1ZBWA 1WZAA 1J01A 2CBJA 4UQCA 1C93A 1RD6A 2D1ZA 2GDUA 2GK1B 5TD4A 3J7HA 4H8VA 5ECUA 2Q8XA 3WDPP 1XSIA 1W9DM 5HNNA 3VD9A 1J0YA 1J0JA 2FH8A 4PSRA 1GOMA 1QHZA 3VOCA 3MUZ1 4EK7A 1J11A 1W2PA 2X0YA 3VPLA 3CMGA 3VX0A 4H04A 4JAWA 4LPCA 4XX6A 4W5ZA 1UA3A 4M56A 5A95A 3WY1A 2EPOA 3PZNA 1YHTA 1UR8A 3DYMA 1EGZA 3AIVA 1GJWA 5I6SA 3UCQA 1EDQA 4D6IA 4WK9A 1VFUA 1WDQA 1H09A 3ECQA 2D0FA 1E72M 4LQ1A 2V5CA 3PZ9A 2GDVA 3WD0A 5I5RA 4MDPA 1KCLA 1GOWA 1QW8A 1J0HA 3HU7A 1XYZA 1HJXA 4JFTA 5HOSA 2YBTA 1QNQA 3AMKA 3PZGA 1J0IA 2WC4A 2J7HA 3I3DA 4P8UA 5DEZA 3MMUA 4U3CA 3RCNA 2XIBA 4D6EA 4PTWA 1KQYA 2J8GA 3ARPA 3L4WA 3EMCA 4ACZA 4GQRA 2WLZA 4RE2A 1V3HA 4HMCA 4HPGA 2EBNA 1XH2A 5GPRA 1C8XA 2V3DA 4JCLA 3WKZA 3GZAA 2Z1SA 1C7TA 3WF0A 2BHZA 1JZ5A 3WDJA 4HP5A 3VDBA 1XV8A 4HOWA 2WHMA 4U3AA 2PWHA 1LG1A 4GZIA 2EJ1A 3ZJ7A 5LA1A 4HPHA 2DT3A 2CEQA 2OWWA 3IJ8A 4XV0A 2NSXA 1JD7A 3WF3A 4ACZB 2GJPA 2J7DA 1TA3A 1JZ6A 1MQRA 2E3ZA 4DWSD 2E0PA 1Q4NX 8A3HA 4TX8A 2VUYA 3WD2A 4C7GA 2GUYA 1UG6A 4D1IA 3MMWA 1B31A 2XSBA 4KMQA 1WZKA 2YLLA 1R8LA 4DM2A 3WL0A 5A2BA 4AC1X 5CLWA 1US3A 2VO5A 4CUCA 1JI2A 1TFVA 3THCA 3RIKA 2V3GA 4LYRA 4MJ2A 3WNKA 3M7SA 1KXTA 3PN8A 4UR9A 1TA3B 3M07A 5A69A 3WD3A 3W29A 2DEPA 3PHAA 3QHMA 4MADA 4CCEA 1E0XA 1UKSA 4BQ5A 1RP8A 3WEMA 3TOPA 2W91A 3WQVA 5CPSA 2VOTA 4GIAA 4PTMA 4W85A 1X6NA 2XSAA 1ITXA 4DM1A 4FLOA 2OLHA 2D24A 1VFFA 3AHZA 3W38A 2WWDA 1GCYA 1HJWA 3CLWA 1HJSA 3AXHA 1G1YA 4JCMA 4W93A 2BY0A 2PWFA 4PSPA 4HU0A 1CXHA 1UYQA 5EFFA 2EO7A 4MPKA 1FH9A 3MMDA 2WBKA 4M82A 3ARXA 4ATWA 3ZT7A 2VVNA 1K9DA 2BXZA 3OB8A 2WAGA 5BCAA 4HA3A 4AXNA 2WW5A 5GQBA 3CMJA 4Z2IA 5C70A 2XVNA 1NP0A 1GOOA 3GBDA 3MO4A 3CZGA 1JNDA 4A4AA 2VZVA 3BLKA 4TVUA 1W3JA 2QHAA 2BXYA 3BAIA 2DH2A 5CLTA 4HMEA 4TVDA 2NT0A 2UY2A 2JF6A 1JZ7A 1E1FA 2WWCA 1J0KA 1DWIM 5M3WA 4M24A 1HJVA 1KR0A 1CECA 4B15A 4GINA 2QPSA 1NWSA 2YLAA 2G41A 5FOOA 3O6AA 1UD8A 2VMFA 1OM0A 3AIRA 1QNPA 4BQ4A 5CSUA 1WNOA 4QLJA 4GZEA 1V03A 2O92A 3T0DA 7CGTA 1AMYA 2CBUA 3G6MA 4AZGA 1NQ6A 1WKYA 3AHTA 5AYIA 1WO2A 1UH3A 4KRTA 2J7BA 4JFVA 3ZM8A 4PYSA 3A6OA 1UD2A 3MUAA 1J0ZA 1KGUA 2E9LA 1WAWA 1GQJA 4JIEA 2V3EA 3AXIA 3UR7A 4HU8A 4MB3A 5FIPA 2XIIA 1UD4A 1BYCA 4UOZA 1HKKA 1EDTA 3EMZA 3AYSA 2DIJA 5E0FA 4PTXA 2DDXA 2XGBA 2CERA 5LA0A 4AMCA 1E71M 1NOFA 2G3IA 4MNLA 1KGWA 3WNNA 3W26A 1E4MM 1KXVA 4OZOA 1VBRA 1CIUA 1TCMA 4EKJA 3WDHA 3OLDA 1HVQA 4P8XA 3VNZA 1MWOA 3T0BA 2FHFA 3SIMA 4JL2A 4ML4A 1XC6A 4KRUA 2YA0A 3AI0A 4M1RA 3AZRA 1ZJBA 6CGTA 4AZCA 4EANA 5BWFA 4LX4A 1UR9A 3T0AA 2V3FA 3BSGA 4H41A 1CZ1A 4R5EA 1KWKA 4UFHA 3PZMA 2YDSA 4E8DA 1VRXA 1OWQA 4CU8A 3VDAA 1MW2A 1TVPA 5A8MA 1X6LA 3EYPA 2Y8KA 2DT2A 4D6DA 4KH2A 2EXOA 3VM7A 3TONA 2X8RA 3GM8A 4P8VA 1GHSA 4NZCA 4FF5A 4IUGA 2ZE0A 4AZCB 4CN6A 5DO8A 4PMVA 4WSJA 2FH6A 3ZMRA 1GW1A 2BHYA 3WUBA 4AW7A 3WNPA 2DH3A 3LPPA 3U7BA 3RILA 2BHUA 2BVTA 1OD0A 4AD1A 1VAHA 2NW0A 2C7FA 3SCSA 3UERA 1B3VA 2XG9A 3W0KA 3ZQ9A 2UY5A 3T2OA 1E6QM 1ZBVA 4QP0A 4CD4A 3OA5A 3A47A 2PF0A 2WMGA 1B2YA 2YIHA 1E40A 1TZ7A 1XSKA 4PTVA 4TVCA 3OZOA 1NWRA 3L2MA 3NUKA 1DP0A 4TTGA 2VCAA 2ZWZA 3U57A 1HN1A 3WUEA 4WIWA 4WKHA 1PAMA 3W53A 1CGUA 5JBDA 4J3VA 3WMSA 3AROA 1GOKA 4S3JA 3BCDA 1IZJA 2DT1A 2PC8A 3AFBA 3DYOA 2RGMA 4FMVA 3QHOA 2WK2A 1I75A 3OBAA 4JHZA 5E6YA 3MSDA 3TTOA 4TTUA 1H2JA 2WHKA 4P7QA 2G3MA 5D9MA 4GI9A 2J78A 3PTKA 4HZ7A 2JE8A 1QOXA 2DSZA 4WKAA 5CSYA 3VGFA 4M8UA 3POCA 4A3YA 1D2KA 1XD0A 4W7UA 3EDDA 3T09A 2PWDA 2CBIA 4PMOA 4PMYA 3VNYA 4YHGA 3W81A 4GO8A 3CZLA 1FH7A 3BLPX 2WXDM 1CTNA 2W5FA 1W3LA 1JYVA 1V6VA 1VB9A 2XGIA 2AAAA 5EFDA 1SR0A 4JL1A 1IT0A 4X0NA 3AICA 5D8WA 2D3NA 4GKLA 3EBVA 4F9JA 5I79A 2VTFA 3MUIA 4J3TA 9CGTA 4JHOA 3RMEA 1XHGA 3NYDA 3BAYA 4M29A 3VIJA 1E6PA 1DTUA 3WQ4A 1WDRA 2G4FA 4ZFMA 1EIBA 1QI0A 1BQCA 1K6AA 4W89A 1OGSA 3CUGA 3DC0A 3EDJA 4AEEA 4W84A 1F4HA 4TXEA 4W8AA 2VURA 3DHPA 3G6LA 3DHUA 3L4ZA 3CUJA 1NOWA 3CIVA 3UR8A 4OJYA 1JZ3A 2ZX7A 5BXPA 1Q6DA 1DEDA 1VEPA 4MDOA 3ZJ6A 1ISYA 2W92A 1J9YA 5DT5A 4BF7A 4B9YA 4PMNA 2XHYA 1V6XA 4UFMA 3WBAA 1V02A 3SCWA 4MNMA 3CZJA 4IPNB 2J79A 2YL6A 3SCNA 2D23A 4UQAA 1MW0A 4HZ6A 5FCZA 1CGWA 5CZKA 1HX0A 1WZLA 3BSHA 3TTQA 5BXRA 3WBEA 1FP9A 2ZUTA 3POHA 1UWQA 5E6ZA 1MFVA 1UA7A 4AZHA 3GXIA 3K4AA 1QNOA 3WL1A 1NH6A 5I2UA 4F66A 1EHNA 2MANA 3WF2A 1D7FA 1J18A 3N13A 2VI0A 1TUXA 2QMKA 1CGYA 2WSPA 4J27A 1MVYA 1XCWA 3CHDA 1GQKA 2A3HA 1HNYA 2OYMA 4J3SA 2VT0A 4URIA 2WMJA 5A2AA 4J3WA 4GQQA 2VX7A 1C8QA 1UR2A 4CCDA 4FLSA 1B90A 2PWEA 2XM2A 2QPUA 5ABGA 2XFYA 5EBAA 3SCVA 1OD8A 4KGLA 1BYDA 2W66A 2VQTA 1OCQA 2WHJA 2EPLX 1GNXA 4WJXA 3OIHA 5I77A 3I3EA 1UQYA 3GNPA 3O9NA 1V3IA 4W87A 3GXDA 3WFZA 3MU7A 2J77A 4TOQA 3AS1A 5LYRA 4M81A 1LJYA 2D3LA 4D6GA 1GVIA 2OSXA 3BAXA 4H2CA 2VVSA 2VR4A 2CPUA 4AD2A 3L4XA 5EB8A 2VCCA 1A47A 3OGVA 4E4PA 3QOMA 3FY1A 4WKFA 3MSGA 4XUYA 2WYSA 1V0NA 2HVMA 3NSXA 4UFLA 1WE5A 2OSYA 1BYAA 2W61A 2YOCA 1JYXA 4CD8A 1B1YA 3A4AA 2CKRA 3T2PA 2IXUA 3APGA 2WCGA 4X9YA 1ISXA 4V27A 2BY3A 4Y7EA 1NARA 1UH2A 4PRWA 1MXDA 1UR1A 4OKDA 2VL4A 1HF6A 4H8UA 5EMYA 5M5DA 1ITCA 1DWGM 3VIHA 1EO7A 5AC4A 4CD6A 3W82A 4CCCA 2CXGA 2VX4A 3WF1A 1W1TA 2XWDA 1S46A 3RDKA 2ZXDA 2Z1KA 3ZR6A 1JL8A 1ZJAA 4NI3A 4ZE4A 1SMDA 1OINA 4Z2JA 5BYWA 3UG4A 3VGHA 4AEFA 1CXKA 1CPUA 1G94A 4CN4A 2VRQA 3CZKA 5D4YA 2C8NA 2UY3A 1SYTA 1UOKA 2O9TA 3N15A 3ARQA 3VO0A 4AYSA 2WLYA 5GNXA 5DMYA 3CUFA 1E4NA 1XSJA 1E15A 5JBFA 5E70A 4AWEA 3VU2A 2DT0A 3CGTA 2ZUWA 3W4RA 1FFQA 2O9OA 3WH9A 3AS3A 3OGRA 4H8HA 4AZIA 5A8NA 1NP2A 1MFUA 1W9PA 1R7OA 1LWJA 1J10A 5CJ5A 2JIEA 4UNIA 2Y2WA 2VC9A 4JKKA 4W88A 3WDRA 2RGLA 3DYPA 1DWFM 1G9HA 5GNYA 4UFJA 3CTTA 1L0PA 1VFOA 1UWUA 3VD4A 4BCEA 1R7AA 2VRKA 5I0DA 2HISA 3CPUA 3D3AA 3AMGA 1LF1A 1QI4A 2CHOA 3GYCA 2E9BA 3I3BA 2J7GA 3F4VA 2EEXA 1OB0A 4UTFA 1B0IA 3U7VA 1GONA 5DF0A 4D6FA 3WNOA 2WVTA 4U33A 4U2ZA 1GVYA 1W3HA 3KL3A 1OBAA 3SUWA 4IISA 2CBVA 3PZIA 3BMVA 4N42A 1GOQA 3PTMA 1W3KA 3EDKA 3N04A 4HTYA 1KBBA 4UQ9A 2ZX6A 1V0LA 1Z32X 1R87A 1UKTA 1EXPA 1C3FA 2WZIA 3W27A 3KZSA 1OGGA 2ZIDA 4MTVA 2CETA 4TUFA 1A3HA 3CHCA 3VIPA 4Q22A 4CD5A 3GTNA 2DIEA 1GUVA 4OIFA 3QHNA 4XZWA 3EDEA 1W2VA 2F2HA 5BRPA 4UFKA 4MB5A 3U5YA 1B3WA 5HBFA 3ARWA 1VEMA 1JFXA 1ZB5A 3BCFA 1GZJA 1C90A 1RH9A 1PPIA 5HDRA 3ARVA 1CLXA 5A6KA 1UZ4A 3LPFA 5FKYA 1UHVA 1EA9C 1PEZA 3CH9A 1CXFA 4UQDA 4X0VA 1GJUA 2J62A 1RP9A 1B3ZA 5DFAA 4YN5A 1BYBA 3ALFA 3WH8A 3PZVA 3AIUA 2VNCA 1PJ9A 1HP5A 1W91A 2BV9A 1GHRA 1QNRA 3SUVA 4P7LA 2UWFA 3UEQA 3LMYA 3S2CA 3KE0A 2JF7A 1LL7A 5CGMA 4M80A 2BVDA 3ARRA 3GNRA 1E3XA 4HZ8A 2W62A 3EDFA 1JD9A 2XYLA 1E3ZA 1LL4A 4PMZA 1O7AA 5A6BA 1E4IA 5M03A 1PZ2A 1W1YA 2WPGA 2D0HA 4PN2A 1QW9A 4CU7A 1XD1A 2XM1A 3VD3A 1HVXA 1PX3A 2PI6A 3VGBA 2ZUSA 1W9VA 3ZJ8A 3TP4A 3SCPA 3ALGA 5KZ6A 1CXIA 1CGXA 4P7NA 1UKPA 2X2YA 1W32A 1CWYA 1WB0A 2O9RA 4OUEA 4NF7A 3CZEA 3OLGA 1E43A 1E70M 1UKQA 1E5JA 1EOKA 1JDCA 3L2LA 4QLLA 1VJSA 2X1IA 2WMKA 1OIMA 4B3KA 4UCFA 1JG9A 4K68A 4OOZA 4S3KA 4YHEA 2X05A 3MV11 3IAQA 2ZXBA 1HXJA 2VJXA 4MB1A 4PCTA 1O6IA 1LL6A 5A6MA 1ESWA 1BG9A 1VEOA 2J47A 3VGDA 4C7DA 1PZ3A 1MQPA 2YDQA 3VM5A 2X0HA 2CKSA 1UQZA 2IXVA 1EO5A 4EAMA 3ARTA 3HMCA 2VZOA 3VVGA 2A3AA 3VMOA 2J8FA 2VX5A 4F79A 1JZ8A 1B9ZA 3L4UA 1JIBA 1UWSA 1QBBA 5IFTA 4HOZA 1JGIA 1UWRA 4UOQA 3VIGA 1N82A 1U33A 1H49A 4NSBA 4L4OA 1PIFA 1JDDA 2YA2A 1F4AA 3SCQA 1E6ZA 1KBKA 4PMDA 4PCSA 4B3LA 3N12A 2OYKA 4HA4A 2WZEA 4AY1A 1EOMA 5CPTA 2J7EA 3K46A 1UR0A 2GSJA 3GXFA 3M6DA 1V02E 3OZPA 4RE4A 3ZOAA 3FHAA 1ISWA 3THDA 1V3MA 1DWAM 1QHOA 4U2YA 4W7VA 5A8OA 5CPQA 2FHCA 5A6SA 1ISVA 4AD0A 1BF2A 1NWUA 3A3HA 2J25A 5BRQA 5D9NA 3VUPA 1BLIA 3GH4A 1KXHA 3VIOA 2WZHA 4UQEA 4B9ZA 2XPKA 3FHQA 3RM8A 4Z2GA 5A8PA 3WD4A 1LWHA 4MAVA 2XJ7A 4U31A 4UFIA 3IANA 1GQIA 3VDHA 4BS0A 4WF7A 1V3JA 2G3NA 1M53A 5I23A 1JI1A 3W6MA 4PEEA 1QNSA 2CHNA 1Y7VA 5IXEA 3WH6A 4D71A 2XTKA 1VENA 3VMNA 1H4PA 2EPMX 3WN6A 2OWCA 4W8BA 2AOSA 3AJ7A 5FD0A 3A4WA 3N11A 1GQLA 1L8NA 3WMBA 5IHRA 2XUCA 1FA2A 3OGSA 3WUFA 3PZOA 1H0GA 1V0MA 1QI2A 6A3HA 5C8BB 2WCAA 3WQ6A 1BSIA 2E8YA 4CKQA 3AISA 3VD5A 4E2OA 1W9UA 3BAWA 3FAWA 3N1AA 4V2XA 3UESA 2ZUVA 5FL0A 1C7SA 2EPKX 4Z2LA 5D9PA 5JIWA 6TAAA 3WSUA 1CENA 1W1PA 1HP4A 1WP6A 4LYPA 1V3KA 5IHSA 1AVAA 1AQMA 3SUTA 1M7XA 1UKOA 1KR1A 3BXWA 3A4XA 3RM4A 2PB1A 2CNCA 2OWXA 2WMIA 3D5HA 4YPJA 2BNJA 4Q7NA 1QI3A 1G01A 1TVNA 3AXXA 3FXYA 2WMHA 2YL9A 3BC9A 3QGVA 4PMXA 3FW6A 1XCXA 4GPNA 4FLRA 1AQHA 5HXMA 4UZUA 3VIMA 3VIFA 3IAPA 4AZBA 2YL5A 3B9DA 4ZEPA 1FOBA 2WCSA 1U2YA 3AMLA 4ZXOA 2BS9A 2WHLA 2WMIB 1X1NA 4IPLA 3RM9A 3VKKA 3HN3A 2ZXQA 5HPCA 5BXSA 1Q6CA 2Y24A 3M46A 1E1EA 1JF5A 3KL0A 3ZSSA 3WEZA 1OIFA 5LA2A 2ZOXA 1B30A 3E1F1 3NCOA 4JZ5A 1V08A 4J3UA 5A6JA 3QR3A 5A6LA 1JF6A 2X09A 3AIEA 1LQ0A 2J7CA 1FH8A 3F5KA 1HIZA 3MUY1 3WMCA 1XH0A 1H0IA 1UZ1A 3BH4A 1H5VA 1TR1A 2WVUA 3N17A 3SCTA 3NSMA 1IV8A 1SFSA 2CIPA 3AYRA 1HL9A 1D3CA 4H7VA 2XVLA 3OLIA 1QHPA 3WQ8A 1M03A 1JFHA 3AIQA 2WVSA 4GXPA 3KWXA 2E9MA 5ABFA 3NSNA 3KEHA 1E6XM 3VIIA 1H41A 4ZENA 4OOUA 1VIWA 1PX8A 1NM9A 2WC7A 2A3EA 4CVWA 1UD6A 7TAAA 2WBGA 1FHDA 1JNEA 1JYWA 1KB3A 4GI6A 4W8LA 2YJQA 1EQCA 1H11A 2B31A 1JDAA 1EHAA 5ABFB 3II1A 2J4GA 1WDPA 2F8QA 2BY2A 2VZTA 1HL8A 1BHGA 1EH9A 2PBOA 3L4YA 1V6UA 2DPEA 3MS8A 1PBGA 1KFWA 5GNZA 4JFWA 1V6YA 2NT1A 2XVKA 4PUEA 3W25A 1EQPA 3K8LA 1I1WA 2D22A 3AOFA 2ZX8A 5A1AA 2Y8VA 2E4TA 2DSKA 3K4DA 3WUGA 1OGBA 3S6TA 4P8WA 2CYGA 3B8SA 3GDBA 1VF8A 3VDCA 2OSWA 4AZ7A 4PUDA 4GO9A 3N18A 3W28A 2Y5EA 3ARYA 1JYNA 2UY4A 3VMPA 3AS2A 4D6JA 3CHFA 3FNDA 1FHLA 2JALA 2FDMA 1FFRA 1V3LA 1ZBKA 3NDZA 4WLCA 5DT7A 4AIEA 2XFRA 1H1NA 1J12A 4JKMA 4MNKA 4LXFA 3OLEA 4IM4A 3PTQA 3AIWA 2PWGA 2V38A 3SCUA 1CXLA 3GXMA 4BQ2A 4RE3A 5CQ1A 1ZBCA 1QBAA 3B9AA 4JKLA 2WVVA 5CXPA 1VFMA 3U5UA 1E0VA 3L4VA 1U30A 4E8CA 1DHKA 2G3JA 1E6RA 1CGTA 3IJ7A 1E6NA 2EPNA 5E9AA 4HOXA 3W6LA 7A3HA 2A3BA 1ZS2A 2ZUMA 1HKJA 1YQ2A 3MKKA 1G0CA 4KWUA 3LPOA 3OG2A 2WVVB 2E8ZA 3SCOA 3UG3A 1QPKA 2VRJA 2J7FA 3VGGA 5E0CA 1AQ0A 3N9KA 3VD7A 1WZMA 4XZBA 3WQ5A 3QOKA 3ZJKA 4AD3A 3NDYA 4JFUA 2DSUA 3UETA 5AY7A 1E9LA 5KEZA 1XGZA 2XVGA 3B9EA 1CYGA 4CU6A 2VX6A 4PMQA 3GH5A 4Z2HA 1CBGA 2G8ZA 1E4LA 2CESA 3AMCA 2YL8A 1M04A 3BMWA 3AMDA 1E5NA 1E0WA 2W67A 4D6CA 1H3GA 5A6BD 3F5JA 3CZ8A 3PBGA 1BGAA 5A94A 3GH7A 3K8KA 4DWSA 1P6WA 1TMQA 1PIGA 4MJ4A 4ATLA 2QF8A 1NWTA 1KWGA 3L4TA 3SUUA 2DSVA 3K8MA 1WDSA 3HJEA 1BTCA 4BA0A 1DWHM 1JAKA 4W5UA 2DQXA 2GVYA 2FHBA 2XWEA 5BROA 1BVZA 1VJZA 1ZU8A 1I1XA 1BG4A 4UQBA 5FL1A 1RPKA 1MQQA 4DWSB 4UOJA 4DWSC 4HA1A 1JZ4A 2O9PA 3ZR5A 5JIPA 1CGVA 1CLVA 1IZKA 4N0RA 5ABEA 5I24A 3IJ9A 2BY1A 1E6SM 3ZSTA 4AZ5A 5I78A 4QLKA 1B3YA 2JIWA 1M01A 1MXGA 1ISZA 1EDGA 4P7RA 4BZYA 2ZX9A 5JUVA 1GORA 3DECA 1OSEA 3CO4A 1R86A 3ZO9A 2WB5A 5M17A 4DUWA 4F8XA 3AHVA 1JZ2A 2XFFA 1UUQA 2BVYA 1E56A 2BFGA 1MW3A 3VINA 1XH1A 3AHXA 3GNOA 1TE1A 4U5KA 4HMDA 1DWJM 2C0HA 2WANA 4UZSA 1JXKA 3FAXA 2JEQA 1UD5A 4R27A 2JFEX 4B16A 3T2QA 4U5IA 1K9TA 4AIUA 3AIBA 2WC3A 4ZE5A 3VIKA 3NJ3A 2VQUA 4W86A 2FGZA 3MANA 1ZL1A 1CXEA 1C91A 2YBUA 3NIYA 3ZT6A 3TTSA 4EE9A 1JXJA 4AIOA 2D2OA 3CHEA 5ABHA 3AS0A 3SCRA 3TTYA 3ZT5A 1G5AA 1KXQA 4PMUA 2ZICA 4V28A 4J28A 3WNMA 3WD1A 3AQUA 3KL5A 1K9FA 2VR5A 4OBRA 1PX4A 5D8ZA 2PBGA 3VILA 5F7UA 4DUVA 2VZSA 1UR4A 1UWTA 1ODUA 4CGTA 1KCKA 5A6AA 3ARSA 4MB4A 4MAZA 3WFLA 4LGXA 1ODZA 1C8YA 1CNVA 3BGAA 4D72A 1SMAA 2WSKA 2W63A 3VTRA 4CVUA 4D1JA 1OT1A 1BFNA 3RJXA 1Q6EA 2GJRA 2ESCA 1QI5A 2CITA 4FK9A 4OBSA 3SURA 4RL3A 2GJXA 4ZXLA 4PMRA 1HJQA 1E73M 5IFPA 3BAKA 5CGTA 3GBEA 2VZUA 5IDIA 3MV01 3RO8A 1W9BM 3ZIZA 3K1DA 1BPLB 3AHYA 4W7WA 1JAEA 4D6HA 4XB3A 3PZUA 2YDRA 3LPGA 2QV4A 3CUIA 5CG0A 2AMGA 1W9XA 1HT6A 1HKMA 4LYQA 2XVPA 3WIJA 4ATDA 2GJXB 1K9EA 3EMQA 1Q6FA 1UD3A 1BAGA 4PBGA 5D9OA 3WH7A 1E55A 4QDMA 2ZWYA 4C7FA 1UH4A 1V0KA 2QLYA 2FGLA 1MYRA 2DSWA 5A3HA 4AD4A 2IUZA 4WSKA 5AC5A 4QFUA 3TA9A 4P7OA 1LG2A 3SEPA 2QMJA 3CUHA 3O2LA 2J74A 1BGGA 2GFTA 1US2A 1HKIA 3ARZA 4AISA 4BQ3A 3WENA 3W37A 2WMFA 2ZXAA 4MNJA 2F61A 1Q6GA 3IK2A 4AD5A 2WNWA 4CD7A 4Z2KA 5HPOA 1VBUA 2OYLA 3WDQA 1OT2A 1MW1A 2WKLA 2CCRA 1UWIA
chains in the Genus database with same CATH superfamily
3ARUA 3CL7A 2VDIA 3WF4A 3W86A 1VLWA 2ZZ3A 4JGDA 1A4LA 1XC4A 1LROA 4MFEA 3FSUA 2PU0A 3DENA 2YZRA 2Y4SA 4QCFA 3CT2A 3WH5A 3PWGA 2ZFAA 3ISIX 1GPFA 4ZO6A 5BXTA 1N8FA 2FPYA 2X42A 2TMDA 4R53A 3U4AA 3BG9A 4GI8A 3WQCA 2TAAA 3SUSA 3G1SA 4NRRA 4QCEA 2FFCA 4B5VA 4R33A 1OG6A 5FJPA 3TYDA 1Q4WA 3EWUA 3DFPA 1M6JA 2BTMA 4Y6GA 3TQ0A 4C1LA 5XIAA 4AHQA 4J7RA 2PWUA 3TAKA 2C13A 1QVBA 4RDVA 1YADA 2V63A 2GQ8A 1ECEA 2V5DA 1XYFA 3U48A 4MZYA 5F2LA 3E0FA 2GK1A 4FNUA 1LUCA 3PZTA 2Z6JA 3DGRA 4DYJA 4QEHA 3Q67A 1RVKA 1L6YA 2VUNA 3BJSA 2ACUA 4IIFA 4L4PA 4JFSA 1FBAA 2YA1A 1O1HA 4BI7A 1D9EA 1XGDA 2CBJA 2GDUA 2GK1B 1W6TA 5TD4A 2GUBA 4JNMA 3RNDA 2QQ6A 1LUCB 3N6QA 5ECUA 3CH0A 5IOBA 3TW6A 1EC9A 2A21A 5HNNA 1QHZA 2O4MA 3MUZ1 4EK7A 2X0YA 2BASA 4X9SA 3VPLA 3VX0A 2WV8A 4H04A 4LPCA 4W5ZA 4HGXA 4S38A 4N6EA 3GG8A 4IGSA 4YCOA 3WY1A 1GKPA 3OP2A 1YHTA 4O28A 1UR8A 3LSBA 4M6PA 3AIVA 1GJWA 2ZADA 2QCCA 1S2UA 3A9IA 1EDQA 3UCQA 4D6IA 2WJZA 3IIXA 2D0FA 1QR7A 3M0XA 4LQ1A 3UA4A 2PTWA 4JICA 2FTYA 5I5RA 1KCLA 1GOWA 1TIWA 4OUIA 3HG5A 4JFTA 1J79A 4JQ4A 2WC4A 1MNZA 4GBUA 3V36A 1W17A 1K4HA 1MEIA 4DXXA 4U3CA 4ACZA 1UCWA 3H4XA 4HMCA 1DE5A 3KRSA 1XH2A 3SQMA 3WKZA 3W1PA 1SFTA 2BHZA 1JZ5A 4GIRA 3W7RA 4NZ5A 4G1KA 1XV8A 4Q6JA 5TF0A 3EOEA 4KFPA 4GZIA 1WXJA 4B5XA 3IJ8A 3A64A 4LS0A 1UZHA 1JD7A 4ACZB 3B8DA 3LI1A 5DBTA 1DPMA 1TA3A 1Q66A 1JZ6A 1S3HA 7ODCA 3W7QA 4DWSD 5FF7A 1Q4NX 4HPNA 4Y96A 3D6NA 2G50A 3GUWA 4JHMA 1B31A 2XSBA 3MMWA 3EWYA 1XL9A 1K7EA 2ALRA 3HGRA 4O18A 4PUKA 5CLWA 1A5KC 2AAMA 1R9XA 3GUGA 2Z1BA 3THCA 3UZWA 3WNKA 2VEFA 1OHLA 3PN8A 4GNVA 3ITCA 1TA3B 5BU6A 3M07A 3GWQA 2QYGA 2NQJA 4AHPA 4AUBA 1QPQA 2ZE3A 2X2GA 3EEZA 4MADA 3SQSA 3UWWA 1E0XA 4BQ5A 3KUMA 3TOPA 2VOTA 4W85A 3QC0A 1ITXA 3SADA 3H55A 3CO8A 4Q8VA 4D8LA 3ITGA 3M9YA 2OLHA 2D24A 3M5VA 4KS0A 4I90A 4XUGA 1F6KA 1GCYA 3D46A 4Y9AA 3S0CA 3CLWA 4XSLA 3V0SA 1G1YA 4GVFA 4JCMA 5CC5A 2BY0A 2G3FA 3NYZA 4HU0A 3LTSA 1UYQA 4JN6A 2YFNA 4GC4A 1X96A 1IEIA 3MJMA 4YVXA 2WBKA 3RU6A 5BCAA 4QXIA 4A21A 3QW3A 1NP0A 1GOOA 3GBDA 4A4AA 5H2ZA 2VZVA 3BLKA 4TVUA 2QHAA 2BXYA 1KV5A 3BAIA 2Y85A 2DH2A 3UJ2A 2BWGA 2UY2A 2KZHA 3EB4A 1J0KA 1DWIM 5M3WA 1A3XA 1KR0A 1XICA 4A3RA 4GINA 3MCMA 2G41A 5FOOA 3O6AA 1V5XA 4GZEA 3ITYA 1V03A 4M51A 4DZIA 1RY0A 7CGTA 2I5IA 3DG7A 1D8CA 3G6MA 2DFAA 5H1WA 1JQXA 4K37A 1H62A 4C6EA 1FWGC 1UD2A 3MUAA 2E9LA 1WAWA 1F3WA 2IKHA 2J88A 2NX1A 3DXIA 3SM0A 2XU2A 1CLKA 4UTIA 3RG6A 4UOZA 3HQNA 1EDTA 3EMZA 3S5SA 3AYSA 2A3LA 2DIJA 5U4NA 3S2JA 3GNDA 3QY8A 3C3NA 3K30A 1NOFA 3QTPA 3I4EA 1Z44A 1FWEC 4LB4A 3W26A 1KXVA 3B0UX 3TR2A 1CIUA 3GU1A 4EKJA 4LUTA 5FACA 5MKGA 3OLDA 3UYIA 3OTRA 4OBTA 3VC5A 2IPGA 4JL2A 1XISA 4M1RA 3AZRA 3H12A 5LSMA 6CGTA 3HPSA 4BKNA 5BWFA 4LX4A 3SB0A 1UR9A 2G4JA 3SR7A 3UXKA 3T0AA 4F2UA 1S2WA 4UFHA 2YDSA 4UTWC 4GC3A 3VDAA 4JR5A 4LUTB 5HR6A 5MKGB 3S5NA 1CI1A 2Y8KA 1S1PA 1TTIA 3S1UA 3QZ6A 3B4YA 2EXOA 3VM7A 2E09A 2PZ0A 5LHEA 4ZSUA 4LFYA 4P8VA 3GVVA 3NZRA 4CN6A 2VFIA 3DH7A 3W1RA 2G5WA 1GW1A 1EL3A 4WUIA 3RILA 4X22A 4JQ2A 4AD1A 2C7FA 3UZXA 5GJPA 2QAFA 3W1XA 1EF2A 3TZFA 1S5NA 3ZQ9A 4ASTA 4Z1AA 1LM1A 4ICCX 1KD0A 1ZBVA 1NTHA 3LU2A 4CD4A 1LDCA 1YTKA 2OMAA 3A47A 1K7XA 4I3GA 2NV1A 5HJLA 2ISDA 4PTVA 4U10A 3PSVA 1TRIA 3STCA 3UY7A 4HYWA 1DP0A 4JIRA 3FDGA 3LLDA 2VCAA 3GZ3A 2PCQA 4PL1A 3WUEA 4WIWA 1GJPA 3AXMA 4J3VA 3R89A 3OBEA 4GGBA 3WMSA 1VBJA 4K8GA 1OK4A 4HA0A 1PHQA 2QS8A 2XSXA 5HWMA 3ITTA 1P5BA 2OTDA 4TIMA 2VP8A 2HQAA 4FXRA 3TW9A 2ICSA 3CIWA 3POCA 4A3YA 3P93A 1R3VA 1MSSA 2BG5A 5F1VA 4W7UA 3DIPA 3EDDA 2PWDA 4PMOA 1ME7A 4PMYA 5BOFA 2CHRA 3UWVA 4DZHA 4XZLX 1XUZA 1G4PA 2WXDM 1CTNA 2W5FA 4F0HA 2ZRVA 5C5YA 3BLFA 4NJJA 2XGIA 5EFDA 4JL1A 4EXQA 2OFJA 3VZYA 4RNHA 3AAMA 1NDZA 1JCYA 5LGZA 4RPPA 3PB2A 2BLEA 3PWAA 3RMEA 1XHGA 1D3HA 3H70A 2V5BA 3TSDA 5HJXA 1R3WA 3WQ4A 1WDRA 2G4FA 3A3XA 3IARA 5G4EA 1OGSA 1XDLA 2HDJA 4W84A 3Q65A 3T07A 1LTDA 3TYAA 1SJBA 4QBXA 2QDDA 3L4ZA 3UR8A 1JZ3A 1Q6DA 5FF2A 1DEDA 3QTGA 1ISYA 2W92A 4PMNA 4HCHA 4UFMA 4LYKA 3SCWA 4ML9A 1ZSXA 1F9CA 2P5NA 2D23A 4PRRA 1IYXA 4UQAA 3GK0A 3BARA 2G96A 4CQ9A 5CZKA 3BSHA 4AVNA 3NA8A 3POHA 2XH4A 5E6ZA 3S2LA 1MFVA 3UW6A 2PTXA 4WQ6A 2PLJA 3N3TA 5B80A 3H8AA 1EHNA 1J18A 2GVEA 2QMKA 2WSPA 1Q7MA 1EJUC 3M5YA 1GQKA 3F1QA 1EUAA 1QWGA 3P80A 4HSNA 1QPOA 2PDUA 1V8EA 3GG0A 3L0GA 1C8QA 1UR2A 4CCDA 2V2DA 4FLSA 3S5YA 2QPUA 4K6AA 1OCQA 3DFOA 3GKFA 1GNXA 4WJXA 3TKFA 4L7ZA 2X1TA 3DCPA 4A3QA 3DFYA 1V51A 5L9FA 4XD6A 2J77A 4KKXA 5LYRA 3BJFA 3GW0A 4LAKA 2VVSA 3PPGA 2CPUA 3P0XA 3WLKX 3OGVA 1DJZA 4KT2A 3NGFA 4HHMA 4XUYA 4MY8A 1V0NA 3TLQA 3NSXA 3M0HA 4Y8FA 1WE5A 3SY8A 1WOAA 1H7NA 2OSYA 2PLMA 1PZ1A 4A2SA 4CD8A 1GZ1A 4PODA 2CKRA 1V79A 2AKZA 5IM51 1ISXA 1SW0A 4ZL1A 3ES8A 4OKDA 1HF6A 4H8UA 4NQ1A 5JH1A 3TWBA 4O4VA 5C2GA 4O15A 4CD6A 2CXGA 2VX4A 3WF1A 1RBOB 5DCBA 3SBFA 1S46A 1BKHA 2Z1KA 3MJYA 2A79A 2RJHA 5BYWA 4ZO9A 3UG4A 1G94A 5D4YA 2P0IA 2Q6ZA 4M6QA 2Q3RA 1SYTA 1V7YA 3W71A 4DYKA 1R3TA 3UA3A 1X6UA 4Y8EA 3QXBA 4AYSA 5FEPA 2WLYA 1TWDA 1XSJA 4DUOA 1C8VA 3LLFA 5E70A 3C2EA 5FJRA 3GTXA 2YXGA 4B90A 2DT0A 5JXQA 2PDLA 4FOKA 2VEMA 3B97A 4FO4A 4MLRA 2Y62A 4AZIA 1NP2A 3T0TA 1XLFA 4DJDA 4RE0A 4HT3A 3IJLA 3M0ZA 3W3OA 4UNIA 4DIAA 1KKOA 5A8GA 3V5CA 5C55A 1NQKA 3KLKA 3VOGA 4DJFC 5HJYA 3DBNA 4RR4A 1DWFM 2PWVA 4UTTC 5CJMA 3WLJA 4R34A 4E5TA 3R12A 1L0PA 1VFOA 1UWUA 3T8LA 1R7AA 5DXXA 1I0BA 4O1EA 3RR4A 3N29A 1BXCA 2CHOA 4XKYA 3MUXA 2EEXA 2FB2A 4X63A 1OB0A 3GG1A 5XINA 2WVTA 4U33A 1GVYA 3CPRA 4YTQA 3VKAA 4MYAA 3B3DA 4IISA 3BMVA 1Q63A 3N04A 3WZ0E 3T0CA 5BMWA 3N2TA 1KBBA 1I2QA 5LGXA 4XKYB 2ZX6A 2ANUA 1Z32X 4UNLA 2YYTA 3N4EA 2WZIA 4TU1A 1W0MA 4CNUA 4KWWA 5CAHA 2NUWA 3IPWA 1TPC1 2DZTA 4L5ZA 2FPTA 3PTDA 4MTVA 4TUFA 4Q22A 4MMWA 4L1GA 1GUVA 2WNNA 4HTBA 1PZ0A 3QHNA 3Q58A 3WLSA 1RK5A 2F2HA 5BRPA 3U5YA 1B3WA 5HBFA 4Q4KA 2GJNA 1XIDA 1GZJA 5D09A 4O1FA 1C90A 3W75A 3IUDA 1B4EA 5A6KA 2Y7GA 4XG1A 3LLXA 2IQTA 4E3TA 4ILSA 1UZ4A 1DBTA 1HL2A 3T05A 4GFIA 3WK3A 3JR2A 4JBRA 4QS5A 4IZGA 3FFSA 1GJUA 1XDMA 3FLUA 5DFAA 1IT8A 4DBEA 3PZVA 2VNCA 1H7WA 3SUVA 1QJWA 3A24A 1I4NA 1RBLA 4P7LA 1FDYA 2UWFA 1JCNA 1VYPX 3QMTA 1GWJA 3S2CA 5HANA 2OGJA 4M80A 3LSCA 3W73A 6XIMA 4WD0A 3AALA 4GQBA 1FDZA 1E3XA 3PPCA 3EX1A 2D2GA 3QW4B 3GAYA 5LNSA 1JD9A 1PZ2A 1W1YA 3G1FA 3GDTA 3LHUA 1E0TA 4JTLA 1HVXA 1NFGA 3VGBA 1W9VA 3L5LA 3EOLA 2GZXA 4RCXA 1CXIA 1CGXA 2B7PA 4J5NA 4P7NA 4AIBA 4QRNA 4MY1A 1UKQA 1EOKA 4JEJA 4RV8A 4JTDA 3L2LA 2WMKA 1OIMA 5E0KA 4LB3A 3MV11 3V35A 1NFBA 1HXJA 3VYLA 3BG5A 4PCTA 2NVAA 3TYEA 5B7ZA 3LHTA 2J47A 4C7DA 1PZ3A 1LP6A 2YDQA 2W27A 3NEVA 5EKYA 1UQZA 2X0SA 3ARTA 4H1ZA 2VZOA 4DBSA 3CUZA 4OWGA 1XLHA 2A3AA 3AUJA 1XJBA 3USBA 5HQLA 4JIQA 1JIBA 2V2CA 1GG0A 1UWRA 3MWCA 1H49A 4JTJA 4PCNA 4PRTA 1PIFA 3KVMA 4H3DA 1ADOA 2H8ZA 1FCQA 1EYEA 4PCSA 3S1GA 4B3LA 5I3FA 1UUMA 4KPLA 2FVKA 1G4SA 1XR2A 2J7EA 2GSJA 3VNMA 4H7CA 5K4ZA 1VBGA 3NXFA 3M6DA 4Y9NA 1K02A 4JTIA 3W7IA 1U5JA 4JTSA 3SGZA 5CPQA 4K39A 1Q3NA 4HBKA 5A6SA 2BBFA 1NWUA 3A3HA 2ACRA 5BRQA 3H2OA 2HV5A 1KXHA 2WJEA 2WZHA 1SJDA 5DCEA 3VIOA 7PTDA 4B9ZA 2PRMA 2R14A 2AMXA 5A8PA 3WD4A 4U31A 3IANA 4UR8A 1MO0A 3VOJA 4FPSA 2G3NA 3M41A 1XCFA 1M53A 3W74A 5AC6A 1NVMA 3OG3A 1F2JA 1QNSA 5CSRA 3FA3A 1Y7VA 4D71A 3VMNA 1H4PA 2E6AA 1JDFA 2PGWA 1TV8A 2AOSA 4W8BA 3A4WA 3RR1A 4OV9A 4IGMA 3C2VA 1AH4A 1FA2A 3OGSA 2WPBA 1H0GA 3KRUA 5C8BB 1A0CA 3W70A 4QR6A 4CNSA 3WQ6A 1FCVA 2E8YA 3UF9A 4CKQA 3O7UA 1RCQA 4GY0A 2CZFA 2R1MA 4E2OA 1W9UA 3UXIA 4XVDA 3FAWA 3N1AA 4PBFA 2EPKX 5JIWA 4XZHA 3SRFA 6TAAA 2VWSA 1CENA 4GFSA 5TQLA 1WP6A 3P8IA 4F2BA 4QNWA 1UMLA 1AQMA 2AL1A 1DTNA 3LHWA 4Z17A 3A4XA 3UQNA 2W0UA 1X8FA 3DFQA 2V5KA 1YE4A 4NL1A 4Q7NA 3PJTA 3E0IA 3VNIA 3LUTA 4A05A 4PGLA 1XCXA 2F6UA 1ZENA 4MWAA 4GPNA 1ZQ5A 2ZBTA 4RJEA 2EAWA 1AQHA 5HXMA 3F2CA 3VIFA 4GUIA 4CCZA 2YL5A 1XXXA 1U2YA 2WCSA 1YLVA 5D2VA 3ABRA 3N14A 4IPLA 1Q65A 4GNKB 1TTQA 3HPFA 4JDYA 2Y24A 4AWSA 1DIOA 3H7UA 4EPKA 1NEYA 1E1EA 5EMLA 1V4YA 3KL0A 4L4LA 4MWAB 4S2CA 4I7UA 1WV2A 2WM1A 4JZ5A 4US6A 3LERA 2IQ0A 3QFEA 2KX9A 4XZNX 5RUBA 3CWOX 1FH8A 4QE5A 1WYIA 1XH0A 1UZ1A 1TKKA 3N4FA 3WK1A 2WVUA 4V1XA 1WDDA 3N17A 3NSMA 1XLMA 2PSNA 2VEPA 1SFSA 2CIPA 4HNOA 3H54A 3URQA 1UP3A 4H7VA 3BLIA 3OLIA 1YYAA 4CQDA 4QE4A 2FZNA 3AIQA 2WVSA 3KWXA 3URAA 1X7FA 5DY2A 4A8RA 2WNQA 1E6XM 4MUZA 1QT1A 5G5IA 4ZENA 1F74A 4DJDD 1NJJA 2A3EA 3BOFA 3JZEA 4C90A 1JNEA 3W72A 1P0BA 3VI2A 3V3WA 1EQCA 3LM3A 4H19A 1DJIA 1VFTA 3B0VC 2VZTA 3C8FA 1F8MA 3L4YA 4XD5A 2JQXA 1PBGA 1ZZMA 3PUDA 3PJXA 5KETA 4IX0A 4KCTA 1V6YA 2NT1A 4A29A 2HCVA 3LY0A 2IQDA 2D22A 3CIXA 3AOFA 3WUGA 4YTUA 1W5OA 2XIOA 2R94A 4WDXA 3GDBA 2XH7A 1N7KA 2VFFA 1TV7A 4PUDA 4GO9A 5DXYA 1ZJIA 2C71A 3N18A 1Z42A 2Y5EA 1L6FA 1ONXA 4E2VA 4D6JA 4WXYA 1HTIA 1OCBA 2Z28A 2CWXA 4MNKA 2PDCA 3OLEA 4OVXA 3AIWA 5IDZA 1NSJA 1IGWA 4DO6A 3SCUA 1CXLA 4BQ2A 1QXLA 4RE3A 1QU4A 5CQ1A 1QBAA 2OKOA 4EP8C 1KW1A 3PP7A 5DN1A 3L4VA 4DEFA 1DHKA 4QITA 3V5OA 1E6RA 4GRSA 2H9AA 1OQFA 3VAVA 3TNBA 1E6NA 2ZUMA 2C14A 4A35A 3ID7A 3LPOA 4KEUA 2V81A 3N2XA 3VD7A 2H9AB 3ATZA 4JFUA 3NOEA 5EMUA 4ZGYA 1N8IA 3HPXA 1E9LA 2PLKA 3NPUA 4PUJA 3B9EA 3WLQA 3GH5A 4I8YA 1OADA 3NZQA 3Q45A 1E5NA 4HNTA 4L65A 3V1PA 1AK5A 1H3GA 2O7SA 2E67A 1BGAA 2RHGA 3AO0A 3I6EA 5FF0A 2PDWA 5A94A 3OODA 2QV5A 3G2GA 3SN4A 3I10A 1PIGA 3W76A 3HV9A 1JVNA 3G1XA 3PUOA 3EB2A 3S6DA 1FVPA 4H2HA 5J8LA 3L4TA 3HPAA 5AZ1A 2DSVA 1BTCA 3HJEA 3LNMA 3WBWA 4BA0A 4IFOA 2GVYA 2NXIA 1VJZA 4OHQA 5E5CA 1RPKA 3M0JA 4DWSC 1YPFA 4N9EA 5DANA 1CGVA 4NAEA 5AECA 5LIYX 3TROA 1SW3A 2DIKA 4O1DA 2Y5JA 3LBCA 4L9ZA 5LXXA 3GKAA 4O8RA 1T99A 4Q8PA 4AY8A 1R2SA 2JIWA 2E5BA 3TMQA 2PS2A 4NNCA 5FF3A 5FSEC 3CO4A 4GI4A 1O66A 4M6VA 1Z6KA 1XPGA 3A21A 4NAEB 3GX9A 3FKKA 4F8XA 3FS2A 1QPRA 2BFGA 4JDBA 4JTUA 3FYOA 1XH1A 3CB3A 3AHXA 2CC0A 1TE1A 4GH1A 1AD4A 4HYVA 3QSRA 1MXSA 2WANA 4INFA 3FAXA 1KCZA 2ZZ7A 3GHTA 5HULA 3T2QA 1UB3A 3WLPA 1VHCA 1DXIA 1TJRA 3VIKA 5LNWA 2EGZA 1D3GA 2YBUA 4ZVJA 1A5BA 4D2JA 1EP2A 4EE9A 2QKFA 4AIOA 4L1WA 3TTYA 1TE6A 4L6OA 2VGFA 2QCHA 1OFOA 3ZWTA 4V28A 4J28A 3KL5A 2C0AA 3GU9A 4RDWA 5HR7A 4J2PA 2INZA 2HPIA 2C6QA 4N02A 5F7UA 3WLOA 3DI0A 4H00A 4YNGA 3I4KA 2YW4A 3H7RA 5A5WA 4MAZA 5I09A 1CNVA 1B54A 3TCEA 3BGGA 4D72A 4XD4A 4ES4A 1BVWA 2WSKA 2B4GA 3LD5A 1DIKA 3PWIA 1I60A 1OT1A 3LGGA 1PUDA 2VELA 3I6RA 1R38A 2CITA 4PH6A 3AYTA 4RL3A 2GGIA 4RX0A 1E73M 3SY5A 3L9CA 1KO0A 3WJXA 4C6NA 2FMOA 1IWPA 3GBEA 5FEWA 3G8RA 4DRSA 1TTJA 4LUSA 2V82A 2QDEA 4ZTXA 3K1DA 3NAVA 3AHYA 2F2KA 4W7WA 1OY0A 1JAEA 2QCNA 2QV4A 5I3IA 2AMGA 3I65A 3MZNA 1HKMA 2ZVRA 2XVPA 3WIJA 3HJZA 1LT7A 4ATDA 3U8GA 3Q37A 2MNRA 2FZMA 3DU0A 3V0TA 4PBGA 5D9OA 1UH4A 4LUSB 1MYRA 5FEXA 1PCWA 3M0LA 5AC5A 1EF3A 4MWAD 3TA9A 4MIMA 3SEPA 1EGVA 3CUHA 3C5QA 3VCRA 3T4WA 5MHBA 4NZFA 1PKMA 3W37A 4R7JA 4AU0A 4CD7A 3OVRA 1QO5A 1XQLA 2OPJA 4O0ZA 3E5BA 1VBUA 3IK4A 3WDQA 1OT2A 3UJFA 1KM5A 3OA3A 1QPNA 4GISA 4IHCA 1RV8A 1V6WA 2TRSA 5E09A 1EJVC 4NUWA 2RDXA 4YCPA 4IXHA 3F5LA 3NDOA 1B3XA 2D20A 3NZ1A 1M41A 1YXYA 3B03A 4NY2A 2DGAA 4GJ1A 2GVGA 4AZ6A 4MYXA 1T6MA 3T08A 3GFXA 2Z26A 3VGEA 3APTA 2I1OA 2GQ9A 1C92A 4TX6A 1YEYA 3QBUA 3WQWA 3CPGA 1FWIC 5KSWA 1WBJA 3R11A 3W85A 1F6PA 3QMRA 5AB3A 3PVFA 1ME8A 1RY8A 3W2KA 1JR1A 3A12A 1CW2A 4MG4A 2FZ9A 2ZX5A 4HQVA 3F4CA 3NO3A 1XRVA 3HIJA 3KDOA 2FYMA 1AD1A 3PZQA 1F05A 2FB3A 3LZ5A 1XGEA 3QZAA 3N3MA 2P1FA 4GZJA 3KBNA 5CKSA 5LKYA 2WQPA 2J75A 1R3SA 3WO8A 4IIEA 4US5A 1F73A 1TG7A 5C71A 1Z9AA 1SFJA 4CN1A 4AY7A 4CNPA 4PL2A 3KBJA 1TIMA 2VEGA 4YU1A 1KM6A 1OYBA 3UJSA 1FWCC 3JUGA 4M19A 2PP1A 1WPCA 8CGTA 3L68A 3PY2A 3AZSA 4C6BA 5AC7A 1CDGA 1E9YB 1VIZA 1QK0A 4U4MA 1J01A 2J24A 3VUSA 2JKAA 4B5UA 3UWEA 4H8VA 4LSBA 3M0IA 1NELA 1X38A 1JPIA 1LOQA 1W9DM 2FH8A 4PSRA 4Q6XA 3L21A 4NP7A 1S2VA 1W2PA 2QAPA 4XX6A 4L9XA 3CYVA 1UA3A 1BQGA 1E9ZB 4M56A 1M1BA 5CBBA 4LAUA 4XIAA 1G7VA 1EGZA 3S8HA 3U2CA 2DZUA 4F48A 2I17A 4WK9A 3O0KA 1VFUA 1WDQA 2QCLA 3T55A 1E72M 1ZP3A 1F3TA 2V5CA 2Y7FA 4IPIA 2F6KA 2GDVA 5EMKA 1J6PA 1FWJC 3WD0A 4MDPA 3UZJA 3HU7A 1XYZA 1HJXA 3PZGA 3R0KA 4B4HA 3U4FA 3YPIA 4JTFA 2XZ7A 3MI6A 2XDFA 4DZ5A 3O07A 4I9JA 3MMUA 4D6EA 4PTWA 1FXQA 1JJKA 4MPQA 2J8GA 3NPWA 4O54A 2EBNA 3GB6A 2V3DA 3I7QA 4NIRA 2Z27A 3TTEA 3BLEA 3WDJA 4HP5A 1YNQA 4FF7A 4F0SA 3W2MA 1XF0A 1KFEA 2QGYA 1MI3A 1Q6QA 1YX1A 4HOWA 1W3TA 2WHMA 4PULA 5FF4A 2VC6A 2PWHA 1LG1A 1I2NA 2EJ1A 5T9CE 5LNVA 2DT3A 3S1WA 2J7DA 1TPFA 3GFYA 2J13A 1MQRA 2E3ZA 8A3HA 3P74A 3ONCA 4C7GA 5HMSA 2VENA 1JCJA 4ENLA 2OLAA 4RW3A 5AVNA 4JQ3A 1JI2A 5ENLA 3P67A 2NSOA 2NV9A 3M7SA 1XM3A 1OG0A 4UR9A 3WD3A 1BXNA 2DEPA 4ORIA 1TRDA 1UMYA 3PHAA 4ICNA 3IGHX 1UJPA 3ZXWA 1UKSA 2W91A 4XAPA 4DF0A 3IVSA 3W7CA 5CPSA 4PTMA 3GAKA 3DGBA 2XSAA 3OVGA 2O4QA 1DJHA 3ZVIA 3AXHA 5M2FX 2IS7A 2ABBA 4PSPA 3G0SA 2HWGA 5G2WA 2JGQA 5EFFA 1EJSC 3CV6A 1PDZA 4MPKA 1E51A 5H6HA 2PTZA 3ARXA 4ATWA 1LQ2A 2FZDA 3ORWA 5G4WA 3CAVA 1DJQA 4JQAA 3W1UA 4HA3A 4AXNA 3ITOA 1UASA 3UCCA 2XVNA 3U6WA 1P7TA 1W8SA 1W3JA 4W9TA 4TVDA 2GGEA 2V6AA 2CZDA 1JZ7A 2FGBA 2HEJA 1QMLA 1ZRQA 4Q32A 3KOWA 9XIAA 2X16A 2YLAA 1P7TB 2VMFA 3SAZA 1OM0A 4F2TA 3AIRA 5CSUA 1HFBA 3TUUA 1WNOA 4QLJA 4H8NA 2NX3A 1FUYA 4UIOA 3S2NA 3W1QA 2E25A 4RNIA 3GVQA 2CBUA 1WKYA 5AYIA 1WO2A 1UP0A 1I6NA 1UOZA 1YDYA 2J7BA 4HD5A 1D8WA 4GBDA 5K9XA 2QCDA 4Z08A 1G4EA 3LQGA 4WZHA 1GYLA 4OQVA 4MB3A 3HBLA 5FIPA 3EZ4A 5I07A 1OX5A 3KOXA 3TQKA 1ECQA 1F76A 2XIIA 3UG8A 1BYCA 3SN1A 1RXOB 3C0JA 2I16A 3PUEA 4PTXA 4O1CA 2DDXA 3S3GA 3T6CA 2XGBA 4X60A 1E71M 2G3IA 2PUZA 3UZZA 4MNLA 3EWXA 3WNNA 4GH3A 2QCDB 4YYCA 1VBRA 1TCMA 2GL5A 1M7OA 4TQTA 4IXXA 3CLMA 1HVQA 4P8XA 4XTDA 2ON3A 1DL3A 4LJ3A 3T8QA 3AI0A 1SZRA 1ZJBA 3C0LA 4AZCA 4IPPA 2V3FA 1ZNNA 3BSGA 4H41A 3RFAA 4C6LA 1KWKA 1R3QA 1SQ7A 2PP0A 4MGGA 3EYPA 1OFPA 2DT2A 2V68A 4IIHA 4D6DA 4DLFA 3SY1A 3TONA 2X8RA 1EZ2A 2HSAA 1U5HA 4A6GA 4ZFCA 3QC3A 1J6OA 4AZCB 4PMVA 3LK6A 3ZMRA 3WUBA 4AW7A 3STGA 4JIPA 2YCKX 3G1DA 2NLIA 2BHUA 1J2BA 1Y5VA 2VWTA 1ZAJA 1Y65A 2Z25A 3SIZA 3UERA 1B3VA 2XG9A 4C6QA 2D2HA 1E6QM 3QSTA 6XIAA 2CU0A 3EWDA 3OA5A 3GHRA 3HA1A 1TZ7A 5DY3A 4TVCA 3C8NA 1NWRA 3H21A 3L2MA 4IMDA 3R4IA 4Z1YA 3NUKA 4PZVA 5HMDA 2EG7A 2ZWZA 3VNKA 4WKHA 3G0XA 1CGUA 4KERA 3G5EA 4AFYA 3WJZA 3WLIA 2YB4A 4JQ1A 3BCDA 2DT1A 2PC8A 4E4FA 4DNHA 3RITA 4B5WA 4ZO7A 2WK2A 3MC5A 1TELA 5E6YA 3MSDA 2DP3A 2Y89A 2OX1A 1H2JA 2WHKA 4B3ZA 4AX7A 3PAOA 3HF3A 2J78A 5U7SA 2P76A 1QOXA 4FNQA 4WKAA 4M8UA 2QUVA 4XTIA 3T09A 1EWEA 3S9IA 2R9RA 3VNYA 3O63A 5TAOA 1VKFA 4US5D 3W2LA 1VCVA 1FH7A 2OXNA 4BR1A 1V93A 3BLPX 1S2AA 5JVLA 1W3LA 2DZXA 4LEQA 3EPMA 3W6YA 1V6VA 1VB9A 2OQYA 2PDHA 3T81A 3GDRA 3KRZA 3AICA 3MI3A 4DF2A 2D3NA 3OW1A 3HGOA 4GKLA 4F9JA 3MUIA 4J3TA 3RF9A 2QR6A 4M29A 4IQEA 1U83A 1E6PA 1DTUA 3CWNA 2RUSA 3UR5A 1EIBA 1W31A 3KBMA 1K6AA 3EDJA 3DC0A 4M1BA 4AEEA 4D8ZA 1F4HA 1LOLA 2VURA 3DHPA 3DHUA 4IGHA 4XAZA 3HG2A 3N6JA 4FX7A 4LC6A 1VEPA 2PDFA 4RK8A 1T7LA 1J9YA 5DT5A 4BF7A 2XHYA 3BO9A 5PTDA 1XINA 2Z6IA 2C19A 5HNTA 1A49A 3KVKA 1O5KA 1SZFA 4YMZA 1XKJA 1O5RA 4HZ6A 1FWWA 1GVRA 2HMCA 2QUTA 2DUZA 3XINA 1HX0A 3VOIA 4FNTA 1W5MA 2ZUTA 1TJPA 4F0RA 2PDMA 3BPWA 2W79A 3QLLA 3BTNA 1NH6A 4LUIA 3N13A 2C1GA 2VI0A 3HQOA 6REQA 1XCWA 4Z1DA 7XIMA 3EXRA 2WMJA 5A2AA 1IHIA 4J3WA 4GQQA 1OC5A 4S3EA 4PEKA 2PWEA 1TPVA 1XIJA 2XFYA 5EBAA 3T78A 3SCVA 4HVXA 1OD8A 1BYDA 4BEUA 3GC5A 2AQWA 1OFRA 5I77A 3OIHA 2W9MA 4IIGA 3MCOA 3GNPA 3O9NA 4W87A 5D02A 1OCJA 3WFZA 6REQB 4LAZA 4OTKA 4TOQA 4G8TA 4PUMA 3AS1A 4Y90A 1GVIA 4H2CA 5C6MA 3MP5A 2VR4A 3R13A 2Y7EA 5E9XA 2VCCA 4Q8WA 3EX6A 4I5XA 5AYYA 1NFPA 4C6MA 1R3YA 1O4UA 3BW2A 5C0QA 3UPWA 4U28A 1I8JA 5FI8A 4A8NA 1JPDX 1QAPA 4KESA 1EA0A 3U3HA 4Z1CA 1YNYA 2H6RA 3BQ6A 4FIQA 1FQ0A 1B1YA 3T2PA 3RLHA 1IR2A 4X9YA 1C29A 4Y7EA 3BE7A 3QKZA 1UH2A 1VPYA 5D03A 4PRWA 1MXDA 4KFOA 4AAJA 2ZTJA 4FNPA 4ZOEA 5M5DA 3PBWA 3QGAC 5CPLA 2A5HA 3H2EA 5BMXA 5BZAA 1EO7A 2P10A 3W82A 1XYLA 4AX6A 1A5UA 4PFHA 3WQPA 1JUEA 2ZXDA 3ZR6A 2G0WA 4P61A 4O57A 1JL8A 2V30A 4NI3A 1SMDA 3KRBA 1OINA 2NLYA 3VGHA 6PTDA 4O19A 1O5QA 4GK8A 4CN4A 1DIDA 2OZ8A 2ZTKA 3FX4A 4LCRA 3ITLA 3NO5A 3KP0A 1UOKA 3N15A 2VFDA 4GKTA 2CLMA 5CCZA 4GIEA 1RLCL 1E15A 5JBFA 2E6YA 1DE6A 4O50A 4AWEA 4JNZA 4IP4A 3CGTA 3R7MA 2QZRA 1FFQA 3OGRA 4H8HA 1MFUA 2WJFA 1R7OA 4N9DA 1IWBA 3TJLA 4F0LA 3ITXA 3KOZA 5CJ5A 4W88A 2VC9A 2RGLA 4KWVA 1XPYA 5BWAA 4DWDA 4ADSA 3U0HA 3PBUA 2YR1A 4H9UA 2P3ZA 3DESA 5I0DA 4ZSTA 2HPMA 3D3AA 1LF1A 4DJDC 1SFLA 1QI4A 3GYCA 1QRQA 3F4VA 3I3BA 1XLGA 3TEVA 4MUPA 1XLCA 2NWSA 5CJNA 4QJ4B 4GYPA 5DF0A 4H6QA 5LIKX 3WNOA 3LCHA 3IV8A 2X1SA 1OBAA 3SUWA 1DVJA 3BJTA 2OODA 4N42A 1W3KA 4GXWA 1UP2A 3TH6A 4HTYA 4UQ9A 1EEPA 2FLIA 2G97A 1EXPA 1C3FA 1ZHAA 3W27A 1YW1A 4R7OA 1AZ1A 3KZSA 1XWYA 2D2JA 1Z89A 2CETA 3VIPA 4CEXC 3G8EA 4CD5A 4ZB5A 3OHIA 4JX4A 4UFKA 5FA5A 3ARWA 3WFAA 3GSMA 1JFXA 1XIBA 3L66A 1ZB5A 3BCFA 2Q09A 5G4HC 4PBEA 3HTWA 4Z1BA 4I7VA 4ZQMA 3ARVA 1CLXA 3F2BA 1N8WA 3L7RA 4LCQA 4JOMA 2DZPA 4E3VA 4IG2A 1PEZA 3CH9A 5D30A 1CXFA 3LRLA 1SO4A 4UQDA 4FXFA 1RP9A 1B3ZA 5GVJA 3FEMA 4V33A 1EWDA 1XW8A 3TZNA 4JTCA 3E3HA 4IG2B 4GYJA 3KE0A 1WKEA 3AXKA 2DV0A 2LLEA 1WKDA 2GGHA 4BY3A 4HNCA 4G5DA 2QEZA 1ZJHA 3KCJA 4HZ8A 3WK2A 2Z29A 3R94A 2PEVA 2W62A 4K1WA 2QT3A 3EDFA 5I03A 4H6RA 1E3ZA 5A6BA 1O7AA 1E4IA 5M03A 2D0HA 3PJUA 1XKYA 3VNLA 2XM1A 1B4KA 1QW7A 1PX3A 2PI6A 3KP1A 3ZJ8A 3SCPA 3NQCA 3ALGA 4EAYA 1GVSA 2IPJA 2V69A 2X2YA 2NZLA 1W32A 3KOFA 4TR9A 1E43A 4MKVA 3BLDA 3H4GA 1VJSA 2X1IA 4UCFA 1JG9A 4K68A 3W7MA 4HJFA 4S3KA 2X05A 3LNPA 2G95A 4MB1A 3QPYA 1TJ0A 1DJNA 1WUEA 3E6EA 1P6CA 3ITVA 1MUMA 1VEOA 2J8TA 3FGCA 3VM5A 3D3FA 3TAOA 2CKSA 1O94A 4H7ZA 2HROA 1YPXA 1KLZA 3IIVA 2HNHA 3VVGA 3VMOA 5D32A 3L0NA 5AC8A 2BZNA 4IT1A 1B9ZA 1QCWA 3E0VA 5AHEA 1QBBA 2XINA 4L4MA 1A5OC 4HOZA 3INPA 1U33A 3P81A 1GTHA 2PPGA 1EP3A 3FGCB 4LTSA 1RCOB 4Q8UA 4QJ1A 3SCQA 3ES7A 4PMDA 4EX4A 4IFRA 4BF9A 3IS4A 3CJPA 2WZEA 1ALDA 1M65A 1TTPA 4AY1A 5CPTA 3M6YA 3BZJA 1KFKA 1GGOA 1EJ7L 1X8CA 3GXFA 3OZPA 3FHAA 1GQNA 1TZ9A 3THDA 1V3MA 4AMAA 3JU2A 4JYDA 2EKCA 1QHOA 3TC6A 1ZCOA 1EIXA 4IQLA 4S1FA 4KWOA 4MWAE 4AD0A 4AWUA 3M7WA 3C6CA 4DBWA 2Q02A 1BLIA 1PXGA 2ZRXA 2ZQ0A 4BI5A 2HTMA 1LWHA 4MAVA 2XGZA 4UFIA 1GQIA 3VDHA 4WF7A 3UY8A 4LRTA 1VJIA 4ZB2A 3TX9A 3WH6A 4ZQOA 2XTKA 3KVJA 2BX7A 1VENA 4IUOA 3OU8A 1XRSA 2OWCA 3AJ7A 3NQEA 3G1VA 1GQLA 1L8NA 4FXSA 4WJ8A 5IHRA 2XUCA 4K8EA 3SZ8A 3DUGA 1OFQA 1V0MA 3W7KA 6A3HA 1JRBA 2WCAA 2BVWA 1BSIA 3NG3A 2VGIA 4S3BA 4ZZ9A 1QDSA 1G69A 3F2DA 4A8IA 4EPDC 3AISA 3VD5A 3BAWA 4LY4A 4PUWA 4QSHA 4POCA 3UESA 2PMQA 3KBSA 3A9BA 3MBDA 3PPHA 2P8CA 2REQA 3WSUA 4BEQA 3ELFA 3GIPA 1W1PA 1HP4A 4LYPA 3VE9A 5IHSA 1JCLA 1UKOA 2FKPA 1F3XA 3URNA 3I7SA 3LXAA 2DJXA 4RDYA 3RM4A 2PB1A 4Z0SA 4G9PA 4UTHA 4XK2A 4E4UA 4IMGA 3BC9A 3BW4A 4PMXA 2REQB 3RPTA 5FJJA 3CQIA 3RLVA 3MWAA 3K13A 3VIMA 2KAUC 1QOPA 1RK6A 4EVZA 4AZBA 3TQPA 2VEKA 3AWNA 4O11A 2BS9A 3N73A 4QDPA 4S2BA 1BWKA 3C3UA 1S1RA 5HPCA 3S5ZA 5BXSA 2PF8A 1JF5A 2ZDRA 4MWAC 3MZ2A 3WEZA 4XBKA 1TQXA 3WQDA 2ZOXA 2E1WA 1DJGA 3NCOA 1V08A 3RYSA 3PNZA 4UMCA 2DW7A 3WMCA 2BOFX 3BH4A 1H5VA 1TR1A 3CQJA 2BXVA 3ERPA 2B7OA 2B0MA 1HO1A 1IV8A 2J27A 1D3CA 3NL6A 2RDUA 3E2SA 3M0YA 1QHPA 1PIIA 3WQ8A 1W1B1 1H1YA 3RCYA 2YBVA 2QULA 3KEHA 5D04C 4I5UA 3STPA 3VIIA 3CNYA 4OOUA 3KWSA 3H53A 2PDJA 7TAAA 1JYWA 2BDQA 4QGCA 4IMFA 2RDWA 4W8LA 4H6KA 4WX2A 1YE6A 1ZCCA 4ERGA 1K70A 3II1A 4CLMA 1LBFA 3RX2A 1WDPA 2F8QA 4TX9A 1SZGA 1HL8A 3DKJA 1BHGA 2DPEA 1KRCC 3MS8A 4AQLA 1P4CA 4ZCWA 4JTHA 1Y5XA 4JFWA 4PUEA 2HBXA 1ENUA 1I1WA 1FKWA 1XLJA 5A1AA 2DSKA 3E49A 2CLKA 3G3DA 3OQEA 1K8ZA 3S6TA 4P8WA 1VF8A 2R1PA 4IFKA 4JYEA 4KIRA 2PTDA 4I6VA 3IVTA 1K3UA 1A5MC 1JYNA 1Y8BA 2FMNA 4DJFA 2I9EA 3CHFA 3L5AA 4UTTA 5DRCA 4LANA 1FHLA 4JTKA 4G56A 2OX4A 1FFRA 3B8TA 1OEPA 1R2TA 1RPXA 1ZBKA 4WLCA 3IRSA 2XFRA 4IFKB 1J12A 4H83A 4LXFA 3GVWA 1JGMA 3TJ4A 4DHGA 2PWGA 1VPXA 4QAIA 2V38A 1U1UA 3QVQA 2OR2A 1TMLA 4RLIA 5CXPA 2FZ8A 1VPQA 2Z1VA 3G77A 3U5UA 1E0VA 3H22A 2H90A 3EEGA 3N6HA 1OF6A 4MZ1A 4S39A 1CGTA 2CZEA 1Y0EA 4WHBA 3EXSA 3QPEA 5E9AA 4AF0A 1ITUA 1HKJA 3MKKA 3QR1A 5EBUA 1SZNA 4EIVA 1OK6A 4NI8A 1WQ5A 3ZWSA 4E2DA 1TZZA 3VFCA 2DZVA 3VGGA 1THFD 3QMSA 4XZBA 3WQ5A 3ZJKA 3O6CA 1IZCA 3KCOA 5AY7A 4HNNA 4Q33A 4PMJA 1XGZA 4AF0B 2VX6A 4PMQA 3T9PA 4FS9A 4LV4A 4DVOA 2OG9A 1SR9A 1XBZA 1M04A 3V0UA 1E0WA 1GPWA 1S5TA 1FKXA 1H7XA 5A6BD 2FVLA 4LVFA 5HA7A 3H7VA 3QEZA 4B5SA 3C56A 1AW2A 4F0MA 3GH7A 4JEQA 4ZQNA 1P6WA 1A0DA 4MJ4A 1SPQA 2QF8A 4GGHA 4I7WA 3SSZA 3NM3A 4DO4A 3SUUA 3MT1A 1PYMA 4LUYA 1DWHM 1JAKA 2FHBA 1WXYA 1ZFJA 4XVEA 1I1XA 4HN4A 4UQBA 3MSYA 1MQQA 1K8CA 4M0XA 2O0TA 2R1KA 4N0RA 3R8HA 1TMHA 3W7DA 5I24A 4G6CA 1BD0A 1CB2A 3IJ9A 2BY1A 1TWZA 4NJHA 5LNRA 2PDBA 4AZ5A 1F5ZA 3UD6A 1EC7A 1T96A 4LH8A 1B3YA 1M01A 1A5LC 3LB0A 3EGJA 1EC8A 3APYA 3KFTA 1ONEA 3LN3A 3LHVA 4DUWA 1AODA 4GMEA 2Z2UA 2ACQA 3KTSA 1E56A 4CQ8A 3VA8A 1MW3A 5XIMA 3NL5A 4MF4A 3W87A 2F9RA 5CPOA 3GR7A 4GJJA 1VD6A 4R27A 5C9ZA 3HV8A 4U5IA 1R47A 2NVCA 2WC3A 3QM3A 3NJ3A 1KRBC 3MANA 3E2QA 3OYXA 3NIYA 3OOQA 3TTSA 4XWUA 5ABHA 1G67A 4GUFA 3AS0A 4IPJA 4PB3A 4AH7A 2R1LA 1OX6A 4PMUA 3VDGA 4QQUA 4GYKA 1R2RA 1MUWA 4OGZA 3WNMA 1YXCA 3WD1A 3AQUA 2R1NA 1TX0A 1DHPA 3B40A 2VD8A 1IEXA 4OBRA 1PX4A 5D8ZA 4HMNA 3VILA 4B4FA 5AZ0A 4RPQA 4PCPA 4CGTA 5DRIA 5A6AA 3SGUA 3BLOA 1PO9A 2PRHA 1ODZA 4LVAA 2V0TA 1FCBA 2OEMA 1DORA 2W63A 3VOHA 4CVUA 3RJXA 3EX4A 1FX6A 1Q6EA 2GJRA 2QVNA 1QI5A 3QY6A 1NDWA 1RQHA 4R85A 1HJQA 1FRBA 5CGTA 5J5DA 1AZ2A 4JTAA 2HBVA 3QYSA 1WKFA 3EKGA 1W9BM 3UPBA 4FX8A 4H9TA 5AKQA 4H9YA 4LC8A 1RBAA 3OYZA 3VXGA 3R8RA 4D6HA 1K77A 4XB3A 3LPGA 3CUIA 5CG0A 4LS2A 2E5CA 3H2FA 1HT6A 2A7PA 4IGNA 2DVUA 3BOXA 1FCUA 5D2XA 1Q6FA 1LZOA 1BAGA 3M43A 2PD9A 2ZRWA 3RU8X 4NNBA 3W7JA 2GWNA 2DSWA 3W23A 4DBUA 2IUZA 4XAGA 1KA9F 1XBXA 3O2LA 4M6UA 2J74A 1OYAA 4O0QA 4QG9A 2ZXAA 3LDVA 4AD5A 2F84A 3NQ7A 5HPOA 1UIOA 2BB0A 4X3ZA 1PDYA 1U1JA 2WKLA 4HU4A 1X7IA 3CV7A 4FP1A 3L65A 3PSWA 4Q4QA 2Z7KA 3EWCA 1TUFA 4AYGA 4QAWA 4PUUA 3UG5A 1RJQA 3WNLA 5A2CA 1PS9A 4KEMA 1V7AA 3LV6A 4ACYA 1FWBC 4NXKA 2HS6A 1R5YA 1XIIA 3R0UA 4WRHA 2XN0A 4FX6M 1PTGA 1R0MA 1P1MA 3GU2A 3DDMA 4C91A 4DJEA 2NQHA 1L8PA 3MHUA 4I9MA 2IKJA 3HG4A 3NQAA 4NG3A 4NRSA 1WDWA 1DQXA 4DX3A 3BAJA 3MUCA 4L56A 7TIMA 1IR1A 4O10A 1W1VA 4KCVA 3DKLA 1I45A 3GR8A 4KGJA 3I7RA 4FLQA 1YMYA 5JBEA 2C16A 5A8QA 2YKKA 3LCFA 1L2QA 1ELSA 3PBYA 3O0FA 5AYBA 3VCNA 3IIOA 3ZLHA 3CMFA 2E5DA 2D0GA 3FN9A 3VX1A 3LCIA 1VZWA 3TU9A 1ZBWA 4UQCA 3QFWA 1RD6A 1S38A 3ZFHA 3MBFA 4MKSA 1W54A 4DJFD 1J0YA 1J0JA 3VOCA 3WYZA 1UPPA 3GE7A 4KF1A 1QUMA 3DN5A 3WG6A 5T8GA 2I5QA 4JAWA 4GLEA 1M9HA 4Q8QA 2Y6ZA 3H24A 4ECLA 5A95A 4Y9MA 1OZMA 1UPMB 3PZNA 3LHYA 3DYMA 3LTPA 3U2EA 4Y9OA 4F4RA 1JRCA 2ISVA 3ECQA 3N2OA 1S5VA 3PZ9A 2OQLA 1ZPTA 3TW7A 4EPBC 1IT7A 4WCJA 2ALDA 1R46A 3UCDA 4BF5A 3UFYA 3CAWA 2YBTA 1XLAA 4ZODA 1J0IA 3SGGA 1A0EA 2VHLA 3B06A 1VCGA 3DAQA 2J7HA 1ICSA 1OC6A 4FZIA 4P8UA 5DEZA 2EKGA 3IJQA 1KQYA 1PWMA 4GQRA 2WLZA 3IRDA 4RE2A 4LBSA 2PDPA 4HPGA 5AHMA 1Z7AA 2GQ3A 2C1IA 2Z1SA 1C7TA 3FYPA 3M64A 1RQEA 4K38A 3W01A 1OFEA 4M7SA 3IGXA 3ZJ7A 5D2YA 1TPEA 5HWNA 4XV0A 1WOBA 2NSXA 1UC4A 2C91A 3LZ3A 3WF3A 2GJPA 1QK2A 4D8AA 2CW6A 2OO6A 3G24A 1BWVA 3P5YA 2PTYA 2VUYA 3LXBA 3WD2A 1UG6A 4D1IA 5DMLA 4KMQA 1R8LA 2PDIA 4AC1X 1US3A 3FJ6A 2RFGA 4CUCA 3S1XA 2V3GA 3QN3A 4JX5A 3UXLA 1KFLA 2F7FA 1KXTA 3VKCA 3QHMA 3UZ5A 4TO8A 4CQCA 1NY1A 3WEMA 3PR2A 1XIFA 3WQGA 3GTFA 1X6NA 3FOKA 2I9UA 3NL3A 1VFFA 4ZO8A 1XG3A 5EGRA 2WWDA 5CEWA 3CL6A 1HJWA 3U2ZA 4ERAA 5HMFA 1HJSA 4W93A 2EF9A 3JRKA 1CXHA 1VLIA 3LYEA 1DIEA 4X61A 5FJOA 3MMDA 3ZT7A 3LBMA 1AFSA 4PCFA 1EPVA 2I7GA 2WW5A 1N55A 5C9XA 4EPEC 3QKEA 5C70A 4H9ZA 3TVAA 3MO4A 3CZGA 1JNDA 2QPXA 5LIWX 3A5FA 1S39A 3RXZA 6ALDA 3O1NA 3KCLA 5CLTA 3W7PA 2GVJA 4Q4SA 3C2OA 3I68A 2WWCA 4XISA 3LCWA 1HJVA 3QZEA 1CECA 1PV8A 2QPSA 1NWSA 1UD8A 3N2MA 4LU0A 4OFCA 2HZGA 2O92A 2BOGX 2Z2BA 3XIMA 3B0YA 1NQ6A 1IE7C 1UH3A 4GJIA 4JFVA 3ZM8A 4PYSA 4NZ1A 4N7QA 3RMJA 1AW1A 1J0ZA 1KGUA 2OCZA 3N25A 3OIXA 2V3EA 3SRHA 4HK6A 3AXIA 5LNUA 3HB9A 9RUBA 1HKVA 4S3CA 1UD4A 4YTSA 5F2GA 3SECA 2NUXA 2VFHA 3LGEA 4ZOCA 5FSDC 1VFHA 2W6RA 2CERA 4AMCA 2ZC1A 3WJYA 5IRPA 1TV5A 1KGWA 3KW3A 1A4MA 1Y5WA 3N34A 3TN4A 2YSWA 3T1GA 4GUGA 2V5JA 4L6DA 3T0BA 4XSMA 4MJMA 4MOZA 4ML4A 4QE1A 4KRUA 5SWUA 4DY1A 3STFA 2G37A 2GGGA 3AC0A 1W5QA 3MKVA 2VEIA 3EA1A 5CBJA 1SU5A 3W7NA 4A2RA 1CZ1A 1OFAA 4A3UA 1NDVA 3L5MA 1OWQA 7ENLA 2ZZ6A 1IEVA 1MUCA 1IWAA 5A8MA 3MVIA 1X6LA 3C2YA 2NVDA 2QIIA 1K1DA 4KH2A 1BKSA 3OO2A 4XBSA 1EX1A 3GM8A 3EX3A 1GHSA 1SO6A 4IUGA 4WSJA 1RR2A 2FH6A 2BHYA 2DH3A 3LPPA 2MUCA 4IICA 3LCLA 3EX2A 2BVTA 4RNJA 1VAHA 2NXHA 4I8DA 4GUJA 2NW0A 3SCSA 5BRBA 2UV8G 1P0KA 2UY5A 3NQ8A 4HSHA 4RZBA 1XX1A 5I3HA 2PF0A 2WMGA 3THQA 3MHFA 3NEHA 3DFNA 3G3MA 4K3ZA 1K7FA 5IBXA 1TWSA 3KX6A 3W1NA 3QV9A 3TC3A 5FEZA 3U57A 1HN1A 5JBDA 1XFCA 3FA4A 3TA6A 2PAJA 1GOKA 3T42A 4S3JA 3GDLA 1Z69A 3H2MA 3DYOA 3LRKA 4K2SA 1TPWA 1I75A 3OBAA 4WGXA 3TTOA 1NF0A 4TMCA 2WZTA 4DJED 4P5UA 2Y63A 5H91A 3PTKA 3V75A 4HZ7A 5CC6A 4GX8A 3TWAA 1DKWA 2YCIX 2I57A 3HURA 5CSYA 3VGFA 1K03A 3CXOA 3TYCA 1GW9A 2CBIA 2PP3A 4YHGA 4OE7A 3AWOA 4GO8A 4BHYA 2R24A 3WBXA 2WZMA 4EOUA 4EWJA 3MDWA 3WK0A 1H7RA 3GQYA 4JPGA 2AAAA 3C61A 4HNLA 3EB3A 2WKJA 2PODA 1LT8A 1IT0A 2FQIA 2VGGA 1YTDA 5D8WA 3HO8A 2VDHA 3P6LA 2QDHA 1B9BA 4K7VA 3M5XA 2VTFA 4O52A 9CGTA 4HK5A 3NYDA 2P8BA 4HIBA 1Q6LA 3VIJA 2AQOA 1P0DA 2W3ZA 3ZS4A 3Q4DA 1GZGA 4E38A 3E38A 3FVDA 3G6LA 1NOWA 4DZAA 4QROA 3LMZA 3WJSA 3NGJA 2ZX7A 4DAIA 4MDOA 3S9YA 1M7JA 1JCXA 4B9YA 1XYBA 1V6XA 3WBAA 1SSGA 1A3WA 3FA5A 5HINA 3DHDA 1WXZA 4MNMA 3CZJA 4IPNB 3KS5A 3P84A 3I6TA 2ASHA 4UUIA 5CBIA 4LUJA 1CGWA 2IKGA 3TTQA 3P14A 1LLZA 1FP9A 3MQTA 2OJPA 2QJMA 4Z0JA 1Z41A 2X7WA 3GXIA 2QUNA 3K4AA 1QNOA 3WL1A 2WSYA 3LHZA 2QGHA 5I2UA 4F66A 2MANA 4O8AA 2A3HA 2FTWA 4J3SA 2VT0A 4URIA 2PDGA 3ATYA 3R79A 3WLLA 2XM2A 3CM4A 2VDGA 5ABGA 1EBHA 3OBKA 2XZ9A 2W66A 2EPLX 4XBJA 2GOKA 1RHCA 1W1ZA 1EXBA 3JVAA 3GXDA 5KZMA 3MU7A 2Y61A 4Q8TA 2J9XA 4ERIA 3DI1A 2D3LA 4D6GA 4Q4MA 4D9PA 3BAXA 3CB8A 1W37A 2VYOA 3UNTA 2A4AA 4AD2A 3L4XA 1A47A 3EWWA 3FY1A 3KHDA 3QOMA 3MSGA 2WYSA 4H9VA 1L9WA 2HVMA 4GD0A 4UFLA 3ZLGA 3GXNA 4GCXA 1KTCA 5BW6A 4RZ5A 5CZ0A 5EU9A 4HJWA 1BYAA 2W61A 4DPQA 1JYXA 4FR6A 4JIIX 4IIDA 2IXUA 3APGA 5CC7A 2WCGA 4V27A 4MVAA 1FWAC 2BY3A 4Q7IA 1M7PA 6TIMA 1U1HA 1UR1A 4YL2A 5EMYA 1FWHC 4KETA 1OZQA 1ITCA 3VIHA 1G4TA 3FIGA 3XISA 3IJDA 3M47A 1H7OA 3OVPA 4O4WA 1R9YA 4YLWA 3USZA 4ZE4A 4GYFA 3MDUA 5D05A 4AEFA 1CXKA 3E2VA 1CPUA 2VRQA 4QEEA 3CZKA 1W5PA 3DFHA 2C8NA 3B8WA 2UY3A 2O9TA 3BW3A 3ARQA 3HGSA 4E6MA 3LTYA 3EKLA 1HG3A 4JYFA 3RO6A 1LLWA 5GNXA 1YKWA 3GVGA 3F4WA 3CT7A 3R43A 3BGJA 3PAJA 4IJRA 1PTAA 1TPH1 3AS3A 5A8NA 4LOCA 4MY9A 1J10A 2JBMA 3P0WA 5AHFA 2JIEA 2ZZ1A 1QWKA 5JU6A 2Y2WA 3WDRA 1XYCA 4DPPA 3COTA 3HG3A 3TQVA 3VD4A 2VRKA 3C86A 3CPUA 1PKNA 2NQLA 1W3IA 3W1LA 2E9BA 1YPIA 2D73A 2J7GA 3HQPA 4G7EA 3TYBA 3U7VA 4F0KA 1TWWA 4GUHA 2HVNA 1PB0A 4D6FA 3QR0A 4U2ZA 1W3HA 3KL3A 4S3DA 3NFUA 2EJAA 1QNVA 2R6OA 2HS8A 5DMNA 2CBVA 3PZIA 4HNVA 5HK4A 3UBPC 1ZGDA 2E6DA 5HUPA 2POTA 1V0LA 1R87A 1UKTA 4G7EB 4G2DA 4RW5A 4GYPC 3EA2A 1OGGA 4KBXA 4DB7A 1LRQA 1X97A 1A3HA 3CHCA 3NVTA 1EJWC 3URBA 2PDXA 4YS1A 2DIEA 2BODX 5I3GA 3NO1A 3EDEA 3R6IA 1W2VA 2P88A 4Q4PA 4UR7A 1RSCA 2ZZ4A 4Q4OA 4CQAA 4BJHA 4YTRA 5J5RA 4XZ9A 1RH9A 3GY1A 3O16A 1RA5A 2ZA2A 3TJXA 1HGYA 1HKWA 3WBYA 3EOSA 4GVIA 4C6JA 2H8XA 4X0VA 2J62A 5CZJA 4K36A 4YN5A 3ALFA 3WH8A 2NQZA 3NURA 3AIUA 2QCMA 5AVHA 1PJ9A 1BF6A 1W91A 3CL8A 1RD5A 1YNPA 2H3DA 3C52A 4HN8A 4MSSA 2GYIA 4DXVA 1LCOA 1T8QA 2JF7A 1LL7A 3GDMA 5CGMA 2BVDA 4DAFA 3CEUA 3RCMA 4HPXA 3IGSA 1T40A 1T41A 1GG1A 1LL4A 3BURA 1QW9A 4CU7A 2PLCA 5FJTA 2QW5A 3GNXA 4JY8A 2OGYA 1SW7A 2ZUSA 3MW7A 4PB4A 4AG0A 3TP4A 1AQFA 1FWDC 4F40A 1UKPA 4UMBA 1CWYA 1WB0A 4NF7A 2DU2A 3CZEA 3OLGA 1E70M 1UC5A 1PVNA 1JDCA 4QLLA 1POKA 3SN0A