3PBGA

6-phospho-beta-galactosidase form-c
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
468
structure length
468
Chain Sequence
b'MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITENGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 190
structure length 468
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pbgA00
1TCMA 3BAXA 3VGFA 1BHGA 2IUZA 3WF0A 4DM2A 3WD2A 1VFUA 3AHTA 4D72A 4C7DA 4HPHA 1J0IA 5A6LA 1UZ4A 4S3KA 5FKYA 3TA9A 2JE8A 4EK7A 5TD4A 1MXDA 4W88A 1CDGA 4IISA 3UETA 3WMSA 4RE3A 1CGVA 2RGLA 2D22A 1QNOA 5JIPA 4ZFMA 2BFGA 1BYCA 1V6XA 3MMWA 4ATLA 4H04A 5ABFA 1EO7A 3SCNA 4U2ZA 4YHEA 4PMUA 4BZYA 2E8YA 3L4TA 3VMNA 4JFVA 4LXFA 1E55A 1BPLB 3EDJA 4M80A 1ZU8A 3CZEA 4AZIA 4D6GA 4P7QA 1WDRA 1C8XA 1OGGA 3U7BA 1XGZA 5A2AA 1EHAA 1KQZA 2J7DA 4AZCA 5FOOA 2PWDA 2ZUUA 3A4WA 3W28A 8A3HA 2VRJA 3L4YA 3CUGA 2V3GA 3WBEA 1UR1A 1NWUA 3N17A 1C8YA 2FHFA 3A4AA 1DHKA 1CLXA 1W1VA 3UG3A 1XRVA 1MQPA 1VBUA 2QPSA 3GZAA 3O9NA 3KL3A 2PWFA 2BHYA 3AJ7A 3WFZA 5C70A 1K6AA 1MVYA 3PBGA 4IUGA 2VCBA 5C71A 4MB5A 4HMDA 4CVUA 1KXQA 3AISA 5D4YA 2WVTA 3POHA 4B15A 2PBOA 3ARYA 5CG0A 3ZT7A 3RIKA 1WZKA 1UQZA 4D6EA 4YPJA 3SCWA 2IXVA 2V3FA 3GNRA 4BQ3A 2J7HA 4PTWA 4W85A 3VGGA 2XVKA 1R7AA 1V3LA 1QI5A 4CVWA 1FOBA 4P7NA 2X05A 1HKIA 2QV4A 1W3KA 3VIOA 3WD1A 1EQPA 4XB3A 5BXTA 4PN2A 1CPUA 2J8FA 4CD4A 2EXOA 4M82A 1HJVA 5JBEA 2CESA 1OT1A 3EDFA 4EANA 1QI0A 1FH9A 1EHNA 2PF0A 4CCDA 4PEEA 4OIFA 2J8GA 1JD9A 2WMKA 2EPLX 1JZ2A 5I77A 1VJZA 1V3IA 2ZWYA 3AYRA 3VIHA 1H09A 4AZ6A 3SCTA 5DO8A 4CCCA 2YDQA 1VEPA 2VQUA 3WQVA 5LA2A 3PZOA 2BS9A 1XD0A 2ZOXA 3LPFA 5CSYA 3OB8A 2QMKA 1BG4A 2WCGA 1WB0A 3GTNA 1JZ4A 4JFSA 2CHNA 3DYPA 3SURA 2WMGA 1GONA 1WPCA 4D6DA 1L0PA 2CCRA 1UZ1A 2DSZA 1B2YA 2G3IA 2VZUA 2XM1A 1XCXA 5CSUA 4FF5A 4YN5A 2FGLA 4JHZA 4H7VA 2CKRA 1HNYA 5D9NA 4XUYA 1EDQA 4Z2HA 3KE0A 1GVYA 1KBKA 1BVZA 1X1NA 2XVPA 5JBDA 1XH0A 2F61A 2VL4A 4UFHA 3VGHA 2YJQA 1E56A 1E71M 2GK1A 4MB4A 1HJWA 2J4GA 3WEZA 1ZB5A 5M5DA 4CKQA 3CHDA 3K46A 4J3TA 1E73M 3WNKA 4HOZA 4W5UA 1HL8A 5E0CA 5CLTA 3KWXA 2WHKA 3W25A 3T0BA 1JYXA 4GZJA 2YLAA 4W7WA 4HU0A 2ZIDA 1B3YA 1K9FA 4QAWA 1E72M 4JHOA 1K9DA 1B3ZA 2DEPA 1VBRA 3VILA 2J7CA 1PEZA 2QMJA 5FL0A 4BF7A 2JEPA 3WDPP 1ISWA 2WWDA 4GPNA 3SUSA 1F4AA 1QNPA 3O6AA 1DWHM 2XSBA 1KWGA 2BHZA 1IV8A 4AD5A 4PMDA 4R27A 4JFWA 3OBAA 4AEEA 2WCAA 3OLGA 2D0GA 1J18A 1GOWA 1PPIA 4EE9A 1E43A 4QLJA 1GHSA 3MS8A 3OLDA 4W5ZA 4QFUA 1WAWA 1C90A 3VIFA 4M56A 3PZQA 2DGAA 1XYFA 1E9LA 4OJYA 3BLPX 5IDIA 1W9PA 1O7AA 1BYDA 3IAQA 2D3NA 4CD7A 1HF6A 3OZOA 3EDKA 1OIMA 4R5EA 2ZUWA 3L4VA 2MANA 4AD2A 2FDMA 1W2VA 4W8LA 1ISXA 3AZSA 2WB5A 1EXPA 2YOCA 4JL1A 3SCOA 1B9ZA 3GXMA 3K4DA 4DUVA 4MTVA 3HU7A 3WMBA 3BAKA 3RM4A 1ZBWA 2X8RA 1OGSA 1AVAA 5E70A 2VI0A 2Y2WA 1TA3A 3EDEA 3MO4A 1QHZA 4AIEA 2Z1SA 3VM7A 1V6WA 4UZSA 3JUGA 4J27A 2VCCA 4A3HA 3SCUA 4PMYA 1GOQA 3PN8A 4TVDA 1HP5A 3VNZA 3K8KA 4CCEA 4W84A 4B9ZA 3IK2A 1WDPA 1QI3A 2EQDA 3EMCA 2WSPA 3WELA 3GNPA 3DHUA 4E8DA 2X0YA 3GXIA 2E0PA 1HKKA 4U5KA 4PCSA 1WZMA 3VIIA 3CZJA 4H8VA 4IM4A 1NOFA 1D3CA 3W37A 1ITCA 1CTNA 1GZJA 1I1WA 2WBGA 4JCLA 5A1AA 1BGGA 1NWSA 1OB0A 2BV9A 2JIWA 3ARQA 2JIEA 1VJSA 1E4LA 3VPLA 1EA9C 1DWJM 1BLIA 2OYMA 3DHPA 1BG9A 3NDZA 1XC6A 4OBRA 1TR1A 1J11A 1HIZA 5ABFB 4DWSD 3AOFA 1KB3A 4AZ5A 1W9XA 4UOJA 2XSAA 4L4PA 2WLZA 1UD2A 1XSIA 3WNOA 3CZGA 1BYAA 4P7LA 9CGTA 1GOKA 2UY4A 5M3WA 1BGAA 3O2LA 1JZ7A 4MADA 3WDJA 4AZCB 1WCGA 1VEMA 3OG2A 1V6VA 3II1A 2VUYA 1EDGA 1LG1A 2D3LA 3AMCA 3F5LA 3VINA 1XSJA 1SMDA 3FAXA 2GVYA 2XTKA 1AMYA 2V3EA 2VVNA 5ABEA 3SUUA 4DWSA 3L2MA 3ZJ7A 1H4PA 2DT2A 4DWSC 1CENA 5D9PA 1LJYA 2ZXDA 3CO4A 1E15A 3MUY1 3ARVA 4EAMA 3AIRA 1V0KA 2VO5A 4B9YA 3AIBA 3N12A 3UERA 1HX0A 4HOWA 1W9UA 4KGLA 4GO9A 3ECQA 2GUYA 1JFXA 3K4AA 2C7FA 4TXEA 2WYSA 1JF6A 1VFMA 5DT5A 3G6LA 3WH7A 4E8CA 4F79A 3PTMA 3E1F1 3MSGA 3ZO9A 5CQ1A 3W4RA 4KRUA 3NCOA 2CEQA 1J12A 4GI9A 1OCQA 3ARXA 3B9AA 4OOZA 1Q6CA 4W89A 5HBFA 2BY2A 4UR9A 4W8BA 1WZLA 3GBDA 1B3XA 4F8XA 1E6QM 3RO8A 4MNLA 3W6MA 2G3MA 4D71A 3LPOA 5I3DA 2ZUNA 1NP2A 5D8ZA 3F5KA 1GNXA 4L4OA 4FLOA 3ALFA 1E70M 1GOMA 3ARTA 3WFLA 1PIFA 3NUKA 2W4XA 2CBJA 4J28A 3MUZ1 2J75A 2WZHA 3FXYA 4M29A 1LL7A 1LG2A 1KCKA 4CGTA 1ZBVA 3CZ8A 4JCMA 5LYRA 4HPGA 4CD6A 3BAJA 4UOZA 3SCRA 3U5UA 2JFEX 3VGBA 4U31A 1J01A 3G6MA 3N11A 1GOIA 1CXHA 1PZ2A 1JYWA 2W66A 3CMJA 5FD0A 2QLYA 2XWEA 4Z2LA 2J78A 5EMYA 3MSDA 4S3JA 3L4UA 3FNDA 3VD3A 4WF7A 3GBEA 4ACZA 3AZRA 4MPKA 1KFWA 3S2CA 5A8MA 2DIEA 3CGTA 3QOKA 3B8SA 2J25A 2XGIA 1LL6A 5E6YA 5BRQA 2GK1B 4RL3A 5FIPA 1UA7A 4CU7A 3VDBA 3A47A 3A6OA 1CIUA 4KRTA 3GH5A 2IXUA 1WO2A 1BSIA 3RJYA 2ZUVA 3W24A 1JXKA 2VZOA 3AIWA 3MMDA 3CZKA 1W1TA 3M7SA 2DSKA 2Y8VA 3GYCA 2W62A 1NQ6A 2CHOA 1BTCA 1G5AA 4URIA 1CXFA 4LQ1A 1C3FA 1SMAA 1H0IA 1WZAA 3WKZA 3CHFA 3WNMA 1PBGA 1UD3A 3AS2A 2VR5A 1E0WA 3L4ZA 4U2YA 2EPOA 1RD6A 4X0NA 3WQ4A 3ZM8A 1W3LA 4TUFA 2OYKA 4AIOA 1EOKA 4CU6A 4F66A 1UUQA 2XJ7A 2J7EA 1V6YA 3TOPA 3WN6A 1XCWA 2OWWA 4TVCA 4MNJA 2CETA 1JF5A 1ZS2A 1J0HA 2J47A 2X09A 1XH1A 3PZGA 3WD0A 5E6ZA 1C91A 4H8HA 1JL8A 4NI3A 2GJRA 2V5DA 2VOTA 3ZT5A 2E8ZA 4QLLA 3U57A 2HISA 1NM9A 3PZIA 1W91A 1J0ZA 3AXIA 1CXEA 4CN1A 3IJ8A 1Q6EA 5I0DA 2G4FA 3OA5A 4AISA 4LGXA 4CU8A 1HJUA 2XWDA 2VRKA 2OWCA 1O6IA 2G8ZA 3BLKA 3T2PA 3ARPA 1A3HA 1Q6DA 2X2YA 2V3DA 3ARRA 3HN3A 1TA3B 2DPEA 2YDRA 2ZWZA 2EPKX 2FH8A 4KH2A 3MUAA 3UCQA 3W38A 1HXJA 4WK9A 4AEFA 2J7BA 2C8NA 2V38A 4HA1A 1LWJA 1UWTA 4F9JA 2BY0A 4KGJA 3WUBA 3AXXA 2DQXA 1UD6A 3LPGA 1SYTA 3WY1A 2UY5A 1E4IA 4A3YA 4AD3A 2DSVA 1NP0A 2J77A 2WVVA 4UQDA 1UWIA 1FFRA 1X6NA 4ZXLA 1JYVA 1G0CA 3AIUA 1UWRA 1RP9A 4M81A 3GXFA 2DH3A 3L4XA 2E3ZA 2WMFA 2YLLA 2XFFA 5A69A 3HJEA 2BVTA 2E9MA 4HU8A 2FHBA 2WZIA 3AHZA 2D1ZA 5ABGA 2E40A 2XGBA 1E6PA 1WKYA 2Y24A 1FH7A 1V03A 2VVSA 2WWCA 1JG9A 4JIEA 1FP8A 2RGMA 1VRXA 2X1IA 4WSKA 2QF8A 1OSEA 2DSUA 1JZ5A 1YHTA 2YBUA 3LPPA 4MAVA 2JF6A 2ZXQA 1GPFA 2W5FA 5FCZA 3WD3A 1IZKA 1OD0A 1M7XA 4JFUA 4K68A 5BRPA 3WNLA 4GO8A 3QR3A 2ZX5A 3N04A 2WNWA 4D6HA 1LF1A 2XYLA 1HL9A 4OKDA 4LYRA 4EKJA 3CUHA 1PX4A 2CIPA 2WCSA 4PTMA 1SR0A 4Q7NA 4PCTA 1CZ1A 1UG6A 4HMCA 3I3DA 3SUWA 1AQMA 2ESCA 1PZ3A 2XVGA 3D3AA 3ZR6A 1OGBA 4GI6A 3FHQA 4CUCA 1B1YA 1UHVA 3VTRA 4DWSB 2B31A 1DP0A 2WMIA 4PMQA 1K9EA 4P7OA 3ZR5A 2TAAA 1J0KA 4W7UA 2WVUA 1EH9A 5AYIA 3BGAA 1CGWA 1GHRA 4BQ5A 4IPLA 1MFVA 2WBKA 2GJPA 1Q6FA 4AW7A 3VD7A 3CHCA 3WNNA 5A8QA 2VT0A 1B0IA 2JEQA 3SCPA 1Z32X 2E9BA 2FH6A 1UA3A 2O92A 4V28A 1R8LA 1H41A 4J3VA 3VKKA 2YL6A 1NARA 1CGTA 4P8VA 1E0XA 3GM8A 1HVQA 1WDQA 5IXEA 1PAMA 4C7GA 4AIUA 1L8NA 1P6WA 3F4VA 1QI4A 4MDPA 3OLEA 4HP5A 5HNNA 3T2OA 4HOXA 1B30A 1UR4A 2A3HA 3AZTA 3BXWA 1C8QA 4J3XA 4HTYA 3QHMA 2A3AA 5GNXA 3ALGA 2GDUA 4PSRA 2AMGA 3T0DA 3GH4A 4A4AA 4D6FA 5A95A 1EQCA 4J3SA 6TAAA 4UFLA 3WUFA 6A3HA 1VAHA 1TVPA 3B9DA 2ZX6A 1PX8A 4PRWA 1UKTA 1V0LA 2UY3A 5BWFA 4GINA 4CN6A 3A3HA 2WANA 4M1RA 1UKOA 4WKFA 3QGVA 2QPUA 2CBVA 4GXPA 5A6MA 1D7FA 3AIVA 3K1DA 4TTGA 3RDKA 4AZBA 4NRRA 3BSHA 4V2XA 3RJXA 3ZSTA 4D1JA 3TTSA 3EMZA 4CD8A 2CNCA 1Q6GA 1EIBA 3ARWA 4PMVA 4GQRA 1B90A 3SEPA 5M03A 2VX4A 1LWHA 3AS3A 2DSWA 4AZGA 1E5NA 1ODUA 3BAYA 3NSMA 2ZE0A 1TE1A 3IAPA 3WBAA 3PZ9A 1UH3A 1E1FA 1XD1A 5JUVA 4HZ7A 2D2OA 1CWYA 2F8QA 3VIJA 1SFSA 2PI6A 3SCVA 3VO0A 5A2BA 3WQ8A 1GQKA 5GNZA 5I79A 3AI0A 4GQQA 1M04A 1TZ7A 3BH4A 4ACZB 3WSUA 5A8NA 1QHPA 4FLRA 1MQRA 5I24A 2YDSA 1LQ0A 3OGVA 2BVDA 5GNYA 3WENA 1HJXA 4B16A 4FMVA 4Z2GA 3ARUA 1UR0A 3VVGA 1KCLA 3WF1A 4AYSA 1UQYA 1KGUA 3AHVA 4OUEA 3N15A 3W6LA 2ZUTA 1US2A 1GVIA 3ARSA 3BAWA 3OGRA 1H49A 2PWGA 2O9TA 4PMZA 2VZSA 3AROA 5CGTA 1PX3A 5EB8A 2HVMA 5AYBA 1UH4A 4UNIA 2E4TA 2VQTA 3KZSA 2WC3A 4HA3A 4CN4A 2VURA 3ZJ6A 3VD9A 3CHEA 1NH6A 1UD5A 4MJ4A 1W2PA 4HZ6A 1UYQA 1FHLA 1M53A 2WVSA 4J7RA 3ZJKA 4OBSA 3GXDA 4E2OA 4KWUA 1GQLA 3KL5A 1EOMA 4NRSA 1H2JA 2CBUA 2VZVA 3MANA 5I6SA 1FHDA 3AMKA 5DF0A 3W53A 1XHGA 1BYBA 2OSWA 5DMYA 2WK2A 1CGYA 2Y4SA 4PUEA 4V27A 3KEHA 1JZ3A 5A6AA 5CLWA 1J9YA 1E6NA 1V02E 3AS0A 3DECA 1M03A 1V6UA 1RPKA 2BNJA 3SUTA 4NZCA 4LYPA 4KMQA 3I3BA 3T2QA 3WNPA 1NOWA 3POCA 1HVXA 5CXPA 1U30A 1JDAA 1R87A 4MDOA 1KGWA 2YIHA 3ZJ8A 1H0GA 1OINA 1BQCA 1OBAA 1CNVA 1C7TA 4ZE4A 3TTYA 2DT3A 2WHLA 4WKAA 3TP4A 3UG5A 1ITXA 3VM5A 2YA2A 5JBFA 4FK9A 3W0KA 1H11A 2ZX8A 4W8AA 2YL9A 1UR8A 1VB9A 4ACYA 1CGXA 5KZ6A 3RM9A 1KXHA 1WNOA 4X9YA 2ZXAA 1W9VA 1I75A 2Z1KA 3QHNA 3WDHA 1BVNP 3WH6A 3T0AA 1KWKA 2E9LA 2CITA 2W92A 2PWEA 2Q8XA 1QNSA 3PZMA 5E0FA 3WDRA 4DUXA 1E4MM 4HMEA 4PTVA 2XFRA 3A4XA 3AFBA 4UQEA 4C7FA 4D6JA 2EJ1A 2Y5EA 1PIGA 2WXDM 2VZTA 2YKKA 1MWOA 2J7FA 2PC8A 2ZX7A 3VGDA 3UG4A 4ZXOA 1UWUA 5M17A 3DYMA 1G1YA 2XHYA 1EO5A 1M01A 4AD4A 2EO7A 3L4WA 3VNYA 2EPNA 1GOOA 3WQ6A 3EDDA 1JDDA 2WVVB 1MW2A 1MW1A 4U5IA 4MB1A 3WH9A 1OWQA 4BS0A 1E6RA 2YA1A 1JGIA 3D5HA 1AQHA 4TX8A 2CPUA 1KR0A 3DC0A 4AXNA 2WPGA 4AMCA 5CPTA 3MMUA 1V0MA 1YQ2A 3WF4A 2J62A 4M24A 5A2CA 3VIKA 5I2UA 1QVBA 1RH9A 1UKSA 2ZUMA 1NWRA 3VIMA 4UOQA 3RMEA 5IFTA 3OGSA 2WM0A 2CXGA 1BFNA 5D9OA 3K8MA 1C92A 4WLCA 5JIWA 3N9KA 3AHXA 3WMCA 1D2KA 1HKMA 1W1PA 4N0RA 5AC5A 1N82A 1EGZA 4JKKA 1E1EA 5D8WA 3AHYA 5HPOA 1UD4A 1UR2A 3AXHA 3CTTA 2YL8A 2X0HA 2JALA 3VDHA 3BMWA 1W9BM 3TTOA 4JZ5A 2WSKA 1DEDA 1JDCA 3SCQA 4F9DA 1KQYA 3IJ9A 1QW9A 4E4PA 4UQAA 3QOMA 1VIWA 5DEZA 3VU2A 4UCFA 2NSXA 3THDA 4CD5A 2A3EA 2WMJA 4FLQA 2OSXA 4BQ2A 1CEOA 1LLOA 2WMIB 2WW5A 1E40A 1NWTA 1DWIM 5EFDA 5CGMA 2CBIA 3VUPA 4TOQA 3PTKA 2D0HA 4D6CA 4GIAA 1ZL1A 4UQ9A 1GQIA 5BXSA 4XZBA 1CXLA 3TONA 3BSGA 3PZNA 3RILA 3WF2A 8CGTA 4J3UA 3UR7A 4UFIA 3VIGA 2WHJA 1JYNA 3I3EA 3J7HA 5I78A 3FHAA 4GKLA 2GSJA 4TVUA 2EPMX 1US3A 3LMYA 3W29A 3AIQA 1R7OA 1FP9A 4UFKA 1TG7A 6CGTA 2GFTA 1G9HA 1C93A 2VMFA 1TMQA 3CH9A 1QW8A 5A6KA 1Q4NX 4PMXA 4PUDA 2BXYA 1FH8A 2O9PA 4W93A 2JF7A 1U2YA 3MV01 2DH2A 2CKSA 2D23A 2VX7A 2A3CA 2WKLA 1V3KA 1TFVA 4DUWA 4ATWA 1UOKA 2BY1A 1WP6A 2W63A 4Z2JA 1E5JA 1HP4A 2XIIA 2GJXA 3WL1A 1Y7VA 3AMDA 5ABHA 4WSJA 4HA4A 3BAIA 5IFPA 1B3WA 3PZTA 5BXPA 3PZVA 1XH2A 2ZICA 1V0NA 2VX5A 4ML4A 3CUJA 1S46A 3AYSA 4PMRA 1ZBCA 2WAGA 3CBWA 3EYPA 2VC9A 1BAGA 1UR9A 3FN9A 3WEOA 1JAEA 1CGUA 5KEZA 4RE2A 1G94A 5LA1A 3GNOA 3B9EA 3BMVA 7A3HA 1DTUA 4UZUA 4U3CA 3UEQA 2O9RA 2XM2A 1VENA 3WF3A 3M46A 1TUXA 5A8OA 4WKHA 1FFQA 3UR8A 1B31A 5EBAA 5LA0A 1UWSA 3L2LA 1JAKA 1H5VA 3FY1A 5A6BD 1GJWA 4MAZA 2G3JA 5F7UA 3WQWA 2XUCA 4AY1A 5GPRA 3OZPA 4GI8A 1E3ZA 1RP8A 5A6SA 2WMHA 1GCYA 1G01A 3MKKA 3N13A 1VF8A 3K8LA 4OZOA 2CERA 3VMOA 5HXMA 4DM1A 1XV8A 4JKLA 1MFUA 5DFAA 3WH8A 2ZXBA 4D6IA 1E4NA 3SUVA 1QOXA 3SIMA 3WQ5A 1CXKA 2XPKA 4OOUA 2NT1A 3ZIZA 5E9AA 4TX6A 5A6BA 1JI1A 4AD1A 4MB3A 4UQCA 3VDAA 1J10A 5CPSA 2WKGA 3CPUA 1WE5A 1E6SM 2J79A 4LYQA 3WUGA 2VX6A 1XYZA 4JFTA 1E6ZA 1I1XA 3CLWA 2QHAA 4NF7A 5CZKA 1CBGA 5GQBA 2WHMA 3SCSA 4Q22A 4QCFA 1MQQA 3BC9A 4H2CA 1HJSA 1W3JA 4Z2KA 2CYGA 3WDIA 1ZBKA 2AAAA 2FGZA 4UTFA 2OLHA 3W81A 1HN1A 1QPKA 2A3BA 3CZLA 2NT0A 1V3MA 2BVYA 1MYRA 2YA0A 4Z2IA 3W27A 4BQ4A 4BA0A 3OLIA 1ESWA 3WEMA 5AY7A 5ECUA 1TVNA 1QI2A 3NIYA 2OWXA 1QHOA 1IZJA 2VCAA 3VD5A 1LL4A 4RE4A 5I23A 2XFYA 5BYWA 2VRQA 2WLYA 3ARZA 2G41A 3CUFA 4QLKA 4H41A 4XX6A 4M8UA 2W67A 3PZUA 1ZJAA 4P8UA 1W3HA 2DDXA 3N1AA 4AWEA 5A94A 1HJQA 1W1YA 2PWHA 3IJ7A 3UESA 2PBGA 2DIJA 2EEXA 2ZX9A 1VFOA 3HMCA 4HZ8A 3EBVA 4LX4A 1K9TA 2J7GA 2UY2A 1MW3A 4XV0A 3VX0A 2VNCA 4N42A 5A3HA 4B3LA 1OIFA 3VGEA 4BCEA 2VJXA 2WZEA 2XVLA 3AICA 1OT2A 1PJ9A 3U5YA 2W61A 3NSNA 4P8XA 2AOSA 4YHGA 1UD8A 7CGTA 3CMGA 4PMNA 3FAWA 3RCNA 3FW6A 1UKQA 1KGXA 4W87A 5D9MA 4PSPA 4MNKA 3VMPA 5BXRA 1AQ0A 4B3KA 3TTQA 1VEOA 3NSXA 4ZENA 4MJ2A 1GUVA 5A8PA 2BHUA 4P8WA 3WIJA 1CECA 1JNDA 1KXTA 1ODZA 4AC1X 2WC4A 1J0JA 4W7VA 1UH2A 3AIEA 2OSYA 4X0VA 1OM0A 1ECEA 4WIWA 2BY3A 2D20A 2XIBA 4TTUA 5C8BB 4LPCA 2VR4A 3T09A 3F5JA 1DWGM 4GZIA 2J74A 3ZSSA 3NJ3A 1ZJBA 3W82A 3PTQA 1JFHA 3KL0A 4GZEA 1J0YA 1QBAA 2EBNA 4Y7EA 2WC7A 3W26A 1V3JA 1JIBA 1GW1A 1VFFA 3U7VA 1IT0A 1H1NA 3AMLA 4PYSA 3NDYA 3WH5A 1HKJA 1E0VA 4H8UA 3NYDA 2YBTA 4JKMA 1QBBA 5EFFA 4XZWA 5HDRA 1UKPA 4JL2A 4J3WA 3AQUA 4AZ7A 1KXVA 1CLVA 4ZEPA 2YL5A 5IHRA 3ZMRA 3BCFA 1JZ6A 2XVNA 3EMQA 1UWQA 5BROA 7TAAA 3M07A 1GORA 4W86A 5HOSA 3MU7A 4ATDA 5A6JA 3WDQA 3WUEA 3N18A 3PHAA 1W9DM 3ZOAA 2ZUSA 1FA2A 3WD4A 3AMGA 1U33A 4P7RA 5CPQA 5HPCA 3ZQ9A 4JAWA 2OYLA 4QDMA 1GJUA 2Y8KA 5DT7A 2FHCA 5AC4A 3CUIA 1W32A 1EDTA 1H3GA 3VX1A 3ZT6A 4AD0A 3RPMA 4PBGA 1QNRA 1CXIA 1DWFM 4PMOA 3THCA 4QCEA 2D0FA 1QNQA 2BXZA 1B3VA 1R85A 4ZE5A 3GDBA 4PTXA 1X6LA 2D24A 4MNMA 1V02A 1MW0A 1WDSA 2DT1A 3IANA 2XG9A 2VTFA 1ISZA 4UFMA 2DT0A 5E09A 5CJ5A 1DWAM 4QP0A 1OD8A 2G3NA 3QHOA 3M6DA 2W91A 4WJXA 2PB1A 5BCAA 1CYGA 1JNEA 2GJXB 1XSKA 3S6TA 3AS1A 3OIHA 2V5CA 3CIVA 3WL0A 4U33A 1JXJA 5FL1A 1JI2A 2GDVA 1C7SA 1HT6A 1ISVA 1ISYA 1F4HA 1JZ8A 3MUIA 3VIPA 4UQBA 3BCDA 1V08A 3GH7A 3VOCA 4IPNB 3VD4A 4D1IA 4UFJA 1KBBA 2UWFA 3RM8A 3VDCA 2NW0A 2O9OA 4U3AA 5IHSA 4FLSA 1NOUA 1R86A 1JD7A 4AZHA 1MXGA 1A47A 3T08A 5I5RA 1KR1A 4NSBA 3APGA 3DYOA 2C0HA 1BF2A 1V3HA 3MV11 1E3XA 1E6XM 1GQJA 2F2HA
chains in the Genus database with same CATH superfamily
1L6GA 2C16A 4LBSA 1Q2SA 3TE9A 1YNQA 3MI3A 4ZO9A 4ZO8A 1OX4A 1IEXA 3WD2A 2NX9A 3AHTA 3I6RA 3S1UA 4C7DA 1BXNA 4HPHA 3UPMA 4S3KA 3TA9A 3BOXA 2JE8A 3RO6A 1J5SA 3OYXA 3MY9A 3RX2A 4IISA 4JX5A 3UETA 4IJRA 3T05A 4ZFMA 4IOTA 1BYCA 4GYJA 1V6XA 2QUUA 1U83A 5ABFA 3E2RA 3GR8A 3BGGA 4LXFA 1OJXA 1BPLB 3W2UA 3WZ0E 4Q4QA 2GOKA 3CZEA 4AZIA 4D6GA 1TTPA 1WDRA 2R9RA 5HULA 2VELA 1KQZA 4EXAA 1D3GA 4XVDA 4Y96A 4GD0A 2RHGA 2NV2A 1EC8A 1T8QA 2V3GA 1KNWA 4K37A 1NWUA 1VHNA 3M16A 3N17A 1LOSA 1RVGA 1C8YA 3A4AA 3KFTA 3EOOA 1W5OA 1VCVA 3UWWA 4ONVA 4ASTA 4KEUA 2F6XA 3MB9A 5H1WA 1VBUA 3GZAA 2GVEA 5LIYX 1R9XA 4L6HA 2PWFA 1A5LC 3WFZA 5C70A 1IEIA 3W1UA 4CVUA 4GNJA 1NEYA 3ABRA 5EMKA 3AISA 5AZ0A 3UWQA 4NIRA 2KAUC 3GFYA 1OZMA 1QATA 3TJIA 2WJDA 4ZVJA 1DJQA 1YBQA 3K1GA 1QNVA 1GQNA 4W85A 3ZLHA 1S2WA 2CWXA 2V81A 4XTDA 3VGGA 2XVKA 1YTEA 1R7AA 1EX5A 5I07A 1OK6A 3SGZA 3M5ZA 1I2PA 3PBVA 2QV4A 4Z0SA 1W3KA 4XK2A 4TV5A 3H53A 2FZDA 5IRPA 4PN2A 2J8FA 2EXOA 3QFEA 3GFZA 5JBEA 4UTMA 3M6YA 3IACA 3S3GA 4E3TA 1U5JA 2ZA2A 2ZCGA 2E67A 4G1KA 3ICJA 2ZWYA 3PNUA 4L9ZA 1H09A 3TQKA 3VIHA 3ZLFA 4AZ6A 2IQDA 3SCTA 1UASA 3WQVA 1FUYA 3PZOA 4AX6A 7PTDA 5EU9A 2BS9A 3W86A 2ZOXA 2FLIA 3OB8A 2QMKA 3PR2A 1WB0A 2RDUA 4JFSA 4N2YA 3DYPA 2W3ZA 3QPYA 2XSXA 2WMGA 1NFPA 2REQB 2PLJA 4NYUA 3WLOA 4I6VA 1F8IA 1SPQA 3T4CA 3MW7A 2H9AB 4RXFA 1XCXA 4FF5A 4HN8A 4JNMA 2FGLA 4JHZA 1FWEC 1HNYA 4XUYA 1EDQA 4Z2HA 3IWPA 1GVYA 2IKIA 4S3CA 3VNIA 2F61A 1YNPA 4XZHA 3QQ0A 2YJQA 1DQUA 3HPZA 1GVEA 3U2ZA 3V4BA 3FXGA 1DVJA 3W88A 2HVOA 4OE7A 4ZOAA 1QPRA 2J4GA 5LXEA 4YTTA 4CKQA 1W3IA 5E0CA 4TO8A 5CLTA 3EWZA 2QCEA 4GY1A 3LBMA 1JYXA 4XZLX 3NQBA 5TIMA 3CK5A 1K9FA 1TMHA 4TMBA 4JHOA 1K9DA 3BLOA 3HGJA 5DMMA 3TMQA 5FL0A 3G1SA 1DXIA 2X42A 3JZEA 4BEQA 3LNPA 1ISWA 2WWDA 4GPNA 3SUSA 1F4AA 1D9EA 1QCWA 3EKLA 3O6AA 2XSBA 1DXEA 4LUSA 4DXVA 3OBAA 4AEEA 4O10A 3S9YA 1YDNA 2D0GA 3OLGA 5DBTA 4K6AA 6ENLA 2LLEA 3C8FA 4EE9A 3TEVA 3GTIA 1O5KA 1B9BA 2Z2UA 3TYBA 1V79A 1DKWA 1UP0A 2PWUA 1P5BA 3UVAA 3BLEA 2X0SA 3LYEA 2DGAA 3P5ZA 4M1BA 5EL1A 3F03K 2DJXA 1G7UA 3IAQA 3O05A 5FJRA 3EDKA 4AQLA 3S6DA 4NNCA 4AD2A 4HPXA 5I7GA 4MG4A 2WB5A 4C6PA 3CV7A 1SVDA 1EXPA 3UD6A 1KFJA 1QK0A 4IZGA 3ZVIA 3HU7A 5DANA 3WMBA 1EFZA 1GG1A 1TA3A 2GVGA 4AIEA 2CHRA 4U28A 3QV6A 5FA5A 4AMAA 1KCXA 3BL3A 3JUGA 1HL2A 4O1CA 3UY8A 1AZ1A 1REQA 2I5QA 1OYCA 3BOLA 3EA1A 1WUFA 4PMYA 1W0MA 4TVDA 1QMLA 3N19B 3IK2A 1GYLA 1VR6A 1UC5A 3FA5A 3OQEA 4H9TA 4E8DA 3FKKA 2X0YA 4U5KA 1WZMA 1YE6A 3P61A 4KIRA 1CTNA 1I1WA 4GH1A 2Y61A 2PTXA 3N2CA 3W7NA 2PE4A 1NWSA 2BV9A 3ELFA 3HFTA 2NWSA 4IMGA 3ARQA 1VJSA 3VPLA 1PWLA 5CZJA 1UUOA 2G0WA 4DO7A 3NDZA 4UTWC 3DX5A 4KWVA 2UBPC 3L0KA 2R1PA 3KBMA 4B5TA 1W6TA 4DWSD 3LQGA 2P0IA 3AOFA 2IKHA 2G37A 2OX4A 4REQB 4L4PA 2XN1A 1UD2A 1X1OA 2CLHA 3WNOA 1BYAA 2DJLA 3QTGA 3O2LA 2P53A 1FCUA 5LNVA 1HO4A 1V6VA 1H50A 3PS7A 3AMCA 4W4QA 4GISA 5AYYA 3FAXA 3G3DA 3ITCA 2HXUA 4DWSA 1H4PA 2DT2A 3N25A 3W7EA 5LHFA 1ZENA 3KLKA 1CENA 3R12A 1HG3A 1XDMA 5CBIA 1LJYA 1KBLA 1C9WA 1E15A 1X7FA 3VFLA 1SW3A 1D7KA 3N3MA 3T8QA 2FJKA 3E02A 1H7WA 3C2RA 2GUYA 3N2MA 3VA8A 2WYSA 5KSWA 1RY8A 1O68A 1JF6A 1VFMA 4LYKA 3E1F1 5A8GA 3ZO9A 1W56A 4MLRA 1YPFA 1ZALA 3NCOA 2KX9A 4JTHA 1XRTA 3WQCA 1OCQA 4H7CA 3E74A 2XINA 4FR6A 1XDLA 2PU0A 1YTDA 3CPGA 1NP2A 3EKGA 4Q4OA 2V2CA 1PYFA 3CQ0A 1PIFA 5BMXA 2J9XA 4JEQA 2QIIA 1KFKA 2CBJA 4JIQA 2J75A 3UBPC 2WZHA 1LL7A 4OT7A 3LXAA 3L23A 4JCMA 3QM3A 1O5RA 4V1YA 5HATA 3BAJA 4LBUA 3B8IA 3SCRA 1QXLA 3TSDA 2AKMA 3P80A 4POCA 5ENLA 4XAZA 4RZBA 2W66A 3ONCA 4JPGA 1HTIA 4L5ZA 5FD0A 3PK7A 1AFSA 2QLYA 3FJ4A 4XIMA 1AJZA 5EMYA 3P8IA 4O16A 1P0NA 3L4UA 3FNDA 3CYVA 1IEVA 3GBEA 3AZRA 4N6EA 3HPSA 1TSIA 2FMOA 4B92A 4E6MA 3GHTA 2V0TA 2GK1B 3M47A 4FOUA 1PWMA 3IV8A 5FIPA 2GWGA 1KRBC 1CI1A 2ISWA 2YCLA 2DZXA 3GH5A 2IXUA 1HZYA 4ZSTA 2ZUVA 3LCHA 3T44A 3M0KA 3W24A 4NUWA 4I5UA 1TMLA 2DSKA 2YW4A 3ZVHB 4ZGYA 2Z00A 4FX7A 1M7OA 4QE4A 1YX1A 2DW6A 2WV8A 4JYEA 1C3FA 2XN0A 1H0IA 3V3WA 3OP2A 3WKZA 4IQLA 4HSOA 1PBGA 2E6YA 3AS2A 2VR5A 3L4ZA 3U4AA 1T8XA 4U2YA 1G4EA 4NJIA 3DC8A 3OOQA 3IJIA 3WQ4A 3ZM8A 1W3LA 4CU6A 2ZRUA 3VK5A 2FB3A 4MJMA 1AUSL 3TOPA 3WN6A 3TW6A 3M4HA 5JU6A 3FOKA 4MNJA 1LRTA 1J0HA 2X09A 1XH1A 4NJJA 4H8HA 1H61A 1S5WA 2ISVA 3R1ZA 1NF0A 3STGA 1VJIA 3TQ0A 3AXIA 1CXEA 1XLDA 2NXGA 1ZPTA 3OA5A 1HJUA 1XLEA 2VRKA 3F4NA 2G8ZA 3ARPA 1A3HA 4H9VA 4QG6A 1A5BA 3GLCA 2ZZ6A 5HWJA 2RDWA 2ZWZA 1TQJA 3RLHA 2Z7KA 4AEFA 3G8EA 3TXZA 2C8NA 4V1XA 2V38A 1LWJA 4F0KA 3UXIA 1LT7A 2VC6A 1Q63A 4F9JA 1R3WA 2Q02A 5C7VA 2ALDA 4QS6A 2CW6A 4KGJA 3QVQA 1Q13A 1UD6A 3I4KA 3LPGA 1I60A 3C61A 2UY5A 1XLGA 1J5TA 3QEZA 4A3YA 4AD3A 1NP0A 2J77A 3T07A 3RX4A 4FEZA 1UWIA 1UP3A 1DQXA 3EPMA 4Y8EA 4M81A 1UWRA 4WXZA 2E3ZA 2H8ZA 1PXGA 5A69A 3BICA 3HJEA 2BVTA 4QG8A 1PHQA 2WNZA 2FTYA 1Q6LA 3H2CA 2G5WA 1E6PA 1DJYA 2IPGA 4L4MA 4CQDA 3QY7A 4Q8QA 2WWCA 2V2DA 1EZWA 3C0JA 1FP8A 2ZZ3A 4WSKA 2P1FA 2DUXA 2QR6A 1OSEA 3B05A 5AKQA 3PC0A 2DSUA 3LPPA 3N2BA 1UC4A 2QPXA 4L1GA 5FCZA 1MUWA 1AL8A 3CHVA 3VCRA 3M0JA 1F05A 3PJUA 5C2XA 1RCXB 3OYZA 1PX4A 2CIPA 2Z27A 1U1UA 1VHCA 1UG6A 4HMCA 3P60A 1H63A 2ESCA 4Z1YA 2XVGA 2F7FA 4K1GA 3N3TA 4Q7IA 4HMNA 2NUWA 4M51A 3VTRA 2PDWA 4MVAA 4XAPA 3L67A 4P7OA 1EGMA 2VD9A 3ZR5A 3MDWA 4GI4A 3GXTA 1EH9A 2INZA 4PB3A 4DO6A 4UTTA 2WBKA 4AW7A 2I5IA 2NWRA 3CWHA 5A8QA 2PD9A 2E6AA 1B0IA 3C52A 5C5YA 3SCPA 1KFEA 2FH6A 1KKOA 1L6FA 2CZEA 4DJEC 1H41A 5D33A 3I6EA 5BZAA 3PF3A 1CGTA 1E0XA 3GM8A 1KV5A 1VZWA 5FAJA 4PODA 1IT7A 1SZNA 2ATMA 3WLIA 2PDBA 2Y1HA 4R7OA 1UZHA 3P81A 1B30A 3AZTA 3BXWA 3PWAA 4J3XA 2VGFA 1X38A 1TPWA 3GX9A 2AMGA 4L4LA 4A4AA 1W31A 3BLIA 1F3XA 3RHGA 4UFLA 5FF2A 2OCZA 4ADSA 1VAHA 4MY1A 3HGRA 3DFYA 1UKTA 2VYOA 1K7FA 1XIGA 1OG0A 1TB3A 4CN6A 1GTHA 4M1RA 1LQ2A 3GWQA 4TQTA 3NQ8A 4V2XA 3N4FA 3FYOA 3ZSTA 1DYSA 3TTSA 1KRAC 4R53A 1M1BA 2PTDA 4INFA 3LCIA 3W2NA 5M03A 3QY6A 3AS3A 4AZGA 2TYSA 3LU2A 3BAYA 3NSMA 3IAPA 5FESA 1JCXA 1PL9A 3PP7A 3QSRA 1XD1A 3LERA 3FV9A 1CWYA 2F8QA 2X41A 3SCVA 2Q3OA 3WQ8A 1MSSA 4Y2WA 3SECA 4GQQA 3P0XA 5H91A 4JTRA 3V75A 3WSUA 3DKJA 3WLKX 4FLRA 1MQRA 1LQ0A 1GEQA 2W6RA 4L56A 2UV8G 5GNYA 3UXDA 1HJXA 4Z2GA 3WF1A 2XU2A 5AC7A 3WYZA 1OFQA 3AHVA 4D8AA 3IIZA 1GVIA 3ARSA 4EWJA 1H49A 4PMZA 3WLMA 1R3QA 3O06A 2VZSA 4Q8UA 1NF7A 3H70A 1PX3A 2QJNA 4Y90A 2R94A 1E0TA 2VQTA 2WC3A 3H7VA 3VD9A 1UD5A 1FHLA 1M53A 5LKYA 4TMCA 4B3ZA 1CB2A 2DZPA 4OBSA 3B0PA 2Z2BA 1EOMA 4O57A 4WJ8A 4Q4MA 5DF0A 3W53A 4Q4RA 5HA7A 3QMSA 1S2TA 1BYBA 4ZR8A 1XPGA 1CGYA 4DVOA 1GK8A 3TCEA 2PDCA 3GR7A 5A6AA 5CLWA 4NXSA 3AS0A 1AD4A 4NAEB 1FWRA 3O16A 3SUTA 4LYPA 4O8RA 1PTDA 1P7TA 4MWAC 3T2QA 5CXPA 1F07A 3CV6A 2V9DA 1S5MA 2Q01A 1R87A 3TAOA 3EWDA 5T26A 3KHJA 3MKCA 3WX7A 3SFWA 1OBAA 1CNVA 1C7TA 1KM1A 1XLCA 2NSOA 4A3QA 2DT3A 2WHLA 3W2KA 4JYDA 3TP4A 4ROQA 3VM5A 1T7LA 5JBFA 3W76A 1EP2A 5AN7A 1YDYA 1H11A 2ZX8A 3VKDA 3H7UA 1KXHA 2HBVA 3HG4A 3M5YA 2Z1KA 1BVNP 3F2BA 2OKOA 3NQFA 3MPGA 3NZRA 2W92A 4XD3A 1QNSA 4DUXA 4D6JA 3S5ZA 3IJDA 4RPPA 2EJ1A 1PIGA 1EIXA 2VZTA 3M0IA 2YCKX 1MWOA 2J7FA 4ZXOA 3TKFA 1G1YA 3DYMA 2XHYA 3GDKA 2EPNA 4DQWA 1BRLB 3EDDA 3E0FA 1TRDA 3Q4DA 4H6QA 4BS0A 1EP1A 2Z29A 5G2WA 1AQHA 3LUTA 4TX8A 4AXNA 2WPGA 4GUIA 8RUCA 3E5BA 5D2YA 4XKYA 2QGHA 3DXIA 3RMEA 1F5ZA 1XLMA 1XP3A 4TR9A 3VFCA 2PDFA 4YTSA 3S5YA 5JIWA 1J4EA 3WMCA 1D2KA 3VZXA 1EGZA 4CQAA 2EKCA 4OU1A 3UZ5A 3KOWA 1UD4A 1UR2A 3AXHA 3M43A 2YL8A 1VBHA 4XSLA 5C0QA 1W9BM 3TTOA 1JDCA 3H23A 3K30A 1FBAA 1QW9A 1SZEA 3VU2A 3FFSA 4UR8A 2WKJA 4FLQA 2OSXA 4BQ2A 1CEOA 5L6UA 1LLOA 3WBYA 4QJ4B 3W7LA 5CGMA 2CBIA 3VUPA 3BOFA 4JTDA 4D6CA 1OVDA 4GYKA 2H6RA 2EF9A 3M0MA 3G1HA 3NG3A 4XZBA 1PKYA 3LGGA 4O54A 1Q6QA 1J8VA 3UR7A 1TE6A 2HROA 2QAPA 3FHAA 1R3RA 3TW7A 3OBKA 4C5ZA 3PBMA 3RG6A 1FP9A 1PSCA 1TG7A 5AZ1A 5CZTA 3ZYZA 1YXYA 4F40A 3KX6A 4E2DA 1XG3A 3CH9A 1M6JA 4R85A 4C6LA 4B4HA 1U2YA 1XBVA 2HDJA 2VX7A 5K4ZA 5AOUA 4YCPA 5EMMA 1V3KA 4DUWA 4S2CA 2W63A 5KINA 2Y62A 5BU6A 3CASA 1Z42A 5ABHA 3VOHA 5IFPA 1QWKA 3CWOX 1XH2A 2ZICA 2OZ8A 2MNRA 3WQOA 5FEPA 1N8WA 4EXBA 1RALA 4PMRA 2WAGA 3CBWA 1ONEA 3PPCA 2QCFA 4AUBA 1JAEA 1CGUA 3REQA 1S39A 5KEZA 2XISA 3A5VA 3LI1A 1G94A 2DZSA 3BMVA 4FNUA 5J8LA 4A3UA 1DTUA 3UEQA 3W7QA 3C86A 3QLDA 1XQLA 4CQCA 4JTQA 3ANYA 2OEMA 5LA0A 3MYPA 2CFFA 1THFD 1JAKA 3CT2A 4KCVA 2QCMA 4MAZA 2OXNA 2UZ9A 5F7UA 4ZL1A 1JUKA 3RLVA 4N9DA 2ZA3A 1SZFA 1E3ZA 2WMHA 3S83A 2CU0A 3K8LA 4OZOA 5CZSA 4GUJA 2FJUB 3W1XA 2FTWA 1XV8A 4MZ8A 3H12A 2PDHA 4H9ZA 4D6IA 4UUIA 3G5EA 3SUVA 2C1GA 3SIMA 5L9FA 1IR1A 2XPKA 4GC3A 4OOUA 4H01A 2NT1A 3W7IA 2BB0A 4TX6A 1N8IA 4MB3A 4UQCA 3BJTA 2Y89A 4FX6M 3G3MA 2VFFA 1XYZA 5J5RA 1G4PA 1I1XA 4FNRA 2GOUA 1ZLPA 1L2QA 2E1WA 4Q22A 1ZQ5A 2BSLA 4FR1A 3PUOA 3PPFA 3GNNA 4O0KA 2QCDB 3PY2A 1RZMA 4GOAA 3K4WA 1KO0A 3W22A 1P1MA 3FYPA 2IS7A 3CZLA 1VPXA 2BGQA 4GNKB 2A7RA 5CAHA 2X1SA 4QNWA 4AH7A 4E8GA 1F8MA 4JY8A 3MI2A 5ECUA 2PD5A 2OWXA 1IYXA 2H8XA 2Q8ZA 4QIUA 4MHBA 3E0IA 4O12A 4O28A 4GKTA 1LL4A 2VEMA 4TV6A 5BYWA 2V8ZA 3NQ2A 4IMAA 3JVAA 4QDPA 4QLKA 1EJUC 4M8UA 3QV8A 1Y65A 1FWJC 1Q85A 1ZJAA 4F0MA 4P8UA 5A94A 1HJQA 2P88A 3F4DA 3L21A 2J8TA 1W54A 2B7NA 4JQ4A 1JUEA 3IJ7A 3UESA 2IKGA 1SZRA 1VFOA 2PZNA 4LX4A 4MYAA 1K9TA 2GGJA 4ZO7A 4JDYA 3LTPA 1ZGDA 4LVGA 2ZDRA 3MSYA 3AICA 2FKPA 5CGQA 4XKMA 3NEVA 2W61A 3NSNA 4P8XA 3C3UA 3VC5A 2AOSA 1UD8A 4H6RA 3RCNA 4IIBA 5D9MA 2HTMA 1VEOA 3NSXA 3CLMA 2C6QA 3W1RA 3WIJA 1IQ8A 1UUMA 1JNDA 1XBYA 1ODZA 5FJPA 4H9MA 2AQWA 4MF4A 5HUPA 4B5NA 3VCCA 1TV7A 2A3LA 3DFOA 4PB4A 3B3DA 1OM0A 5DCBA 4WY0B 4WIWA 2BY3A 2XIBA 4TTUA 3T6CA 4LPCA 3N2TA 2VR4A 1QRQA 1DWGM 3WLQA 1KM3A 2VEGA 1YDOA 3STPA 1Z89A 1ZJBA 5LGXA 3G1RA 4BKNA 3NXLA 3WK0A 2FPVA 1J0YA 4IFKA 1QBAA 3W26A 3S46A 2NX1A 3WH5A 3WLPA 4NZ3A 4Q8MA 2ZYFA 4LUTA 4EF8A 1EGVA 4H8UA 1L9WA 4XAYA 1A80A 1IXQA 2MUCA 5C55A 3AQUA 4AZ7A 4IIEA 3R0UA 1RV8A 3W6YA 1JZ6A 3EMQA 3A9BA 7TAAA 4Z1DA 2Q3RA 2C1IA 3WDQA 2OQLA 5D2TA 1P0BA 4GH3A 3BLDA 2ONEA 3PHAA 5EKYA 1HQTA 1IWBA 5JVLA 2OLSA 3M0VA 2Y63A 3EPOA 4JQ2A 1FA2A 3WD4A 2Y88A 2P0OA 2DW7A 3GVRA 4P7RA 2JGQA 5HPCA 1EB3A 3ZQ9A 2ZVIA 4QDMA 3W1MA 2Y8KA 3WCZA 5AC4A 1W32A 1Z69A 1H3GA 1TREA 3A3WA 3B9NA 1XIMA 1W8SA 5EA9A 3RPMA 3GTFA 1KM5A 1QNRA 1CXIA 2XZ9A 4NT0A 1DWFM 3NQMA 2Z1VA 4IGHA 3H2FA 4R3UA 3EXRA 3SO7A 4QQUA 3W1NA 1OZQA 4P5UA 1JCJA 3DIPA 1MW0A 2BZNA 2IKJA 1WDSA 4U10A 2DT0A 1RCOB 5CJ5A 1QU4A 1Q7MA 1AMKA 4KESA 4ZTYA 3LBOA 2G3NA 1ZUAX 2DQWA 3M6DA 4WJXA 4GA8A 5BCAA 1CYGA 3RCMA 1XSKA 2Y70A 5I06A 5D2VA 1JXJA 1GYNA 2PDQA 1TKKA 1JI2A 4NZ4A 3GK0A 3VIPA 4UQBA 3GIYA 1S2CA 1K7EA 1OCBA 4B2DD 4GIEA 3VOCA 4IPNB 1Q7ZA 4LEFA 3WLSA 4DJDC 1K4HA 2WQDA 4H3DA 2D2GA 5DY2A 4RE0A 5DCEA 3BW3A 4XIAA 1QASA 4NZ1A 1MXGA 1A47A 3LOTA 5REQB 3BV4A 3APGA 3HBLA 1AD1A 1BF2A 1E3XA 5FJOA 4QDWA 1UOZA 4OWGA 2PP0A 2X1UA 3P74A 3QV9A 1W1ZA 5MKGA 4Y9OA 1NIUA 3VGFA 2PDXA 2Z1WA 2QCNA 2FYMA 2RFGA 4B2DA 4KFNA 4DM2A 4H4IA 1J0IA 2VGGA 3M5XA 1T96A 2C71A 1PE1A 4NAFB 4S3BA 3WMSA 1CGVA 5AVNA 3N14A 3MDUA 1QNOA 5JIPA 2RDXA 2BFGA 3P67A 4MFEA 4A05A 3VNKA 1VPYA 2BOFX 1E9ZB 4Z08A 4YS1A 3VMNA 2W27A 4M80A 1ZU8A 4ZTXA 3NZ1A 2GYIA 4P7QA 1C8XA 1OGGA 4H19A 1YRRA 1XGZA 5A2AA 1EHAA 2PFHA 4RCXA 4AZCA 3CYJA 2ZUUA 2OEJA 3SJNA 3GG1A 2FPTA 5H8PA 8A3HA 3LCXA 4N7QA 3L4YA 4LWWA 3CUGA 3WBEA 4DX3A 1UR1A 4YYCA 3NPUA 1FY6A 1W5MA 3QC0A 1YPIA 3B0YA 2NZLA 3Q65A 1EKOA 1BD0A 5E1QA 3BCJA 3VKBA 3UG3A 3O6CA 4H9UA 1RA5A 1MRQA 2OQYA 2PCEA 3KL3A 8XIAA 5AB3A 3LLXA 1TPC1 2BHYA 3STFA 5KITA 4LUYA 1TWSA 3DHDA 2VR2A 4IUGA 4IGSA 5C71A 4FX8A 4OV9A 2A4AA 2VC7A 3S9IA 1X97A 4RZ5A 4YTUA 1LBLA 1SO4A 1UQZA 1SO5A 3APYA 4YPJA 3HGSA 2IXVA 2VEPA 3GU9A 4WXYA 3CEPA 3LY0A 4PTWA 3KVLA 2A6NA 3C4UA 4HBKA 2HPMA 4CVWA 1FOBA 2C3ZA 3THUA 2X05A 1FWFC 1O4UA 2V30A 3W00A 4XB3A 4DBEA 3B0UX 1KM2A 3GFXA 3AWNA 2INFA 4L1WA 1E51A 3NQCA 3E49A 2CESA 1OT1A 3B40A 3USZA 1ITUA 2ZTJA 3UA3A 5FJUA 5DO8A 4L9YA 4HQVA 3SI9A 3TUUA 1XD0A 4X63A 4LB3A 4C6QA 4HK7A 1XKJA 4M7SA 5CSYA 4WDWA 1BG4A 1B5TA 1EEPA 4JTCA 4QGCA 2HCVA 3NL5A 4BK9A 1WXJA 3S1WA 2AAMA 2G3IA 4Q8PA 3C6CA 3MMTA 4AY8A 3CUXA 3PUDA 3S5OA 3MYOA 3KE0A 4K8HA 1Z44A 1BVZA 4PUKA 2X40A 4WY0F 3LCWA 2OTDA 4O0ZA 1UPMB 2ZRYA 2DU2A 4MB4A 4XTIA 4MPQA 3WO8A 1E73M 3WNKA 4HOZA 3KWXA 3W25A 3K13A 2HRWA 3UJEA 3RU8X 2CZ5A 2GUBA 3EOLA 2NUYA 4GZJA 4W7WA 4HU0A 2ZIDA 1E72M 4IH3A 4R7JA 3GO2A 3VILA 3TIMA 3TAKA 2J7CA 2QJHA 1CW2A 4WZHA 3WDPP 6TIMA 1TPDA 1A0DA 4Q8OA 4LF1A 4HT3A 4GUHA 3KOYA 1S1RA 3ABOA 4IPJA 1KWGA 4AD5A 3MUCA 4PMDA 4R27A 4ZA0A 2PP1A 1E1CB 3BMXA 4A8RA 1OCJA 1G6CA 1GOWA 1SSGA 1E43A 5C54A 2ZDSA 1AA1B 2CZFA 3W2JA 1W17A 4DAFA 3OLDA 4W5ZA 4LS0A 4GGHA 3FDGA 4RNIA 3VIFA 4NASA 3RNDA 3CAKA 1E9LA 4UTIA 4OJYA 1O7AA 4XZ9A 4NKCA 2D3NA 1QTWA 3ZS4A 2JQXA 4CD7A 4G7EB 1HF6A 3TMLA 1OIMA 4LFYA 3PB2A 4LW7A 3EWXA 3RAOA 3GZ3A 2MANA 1W2VA 4W8LA 3SR7A 1XLFA 3LBCA 4DLMA 2V63A 3KOFA 1EF3A 1B9ZA 3GXMA 1OFAA 4PTNA 3DOPA 2X8RA 4ZMGA 2CLIA 3HOJA 2HS8A 5E70A 2VI0A 2Y2WA 3MO4A 4WQ6A 4UTHA 2DZUA 3S1VA 4QTGA 1C29A 1F7BA 2ZC1A 4UZSA 4X2RA 2VCCA 1ME8A 4A3HA 3SCUA 1XIIA 4M6PA 1ADOA 1GOQA 3VNZA 3K8KA 3W07A 5LIXX 3LGDA 1QI3A 2EQDA 2ACQA 3WELA 3GNPA 1RK6A 1JPDX 5LHEA 1M7JA 1XICA 3CQIA 1VD6A 3H2NA 4CNNA 1O1ZA 1OX4B 1Q4WA 1GZJA 3T42A 4I9TA 4IMDA 4IMCA 4JTTA 4HPNA 4XSMA 1WKEA 3ATYA 1QJWA 4UBPC 1OC7A 4XZIA 4EF9A 3B4YA 4LCRA 3IJQA 1EA9C 3GB6A 3M9YA 4F48A 1YEYA 4I9AA 1ME9A 3UZJA 1XC6A 4OBRA 3QLLA 3QSTA 5ABFB 2Y85A 4X60A 3TN3A 5CCZA 4AZ5A 2XH7A 4UOJA 4BWLA 4M0XA 2WLZA 3W7RA 1XSIA 2YX0A 4IFOA 4DI9A 3CZGA 4C6IA 4HD5A 9CGTA 5M3WA 1BGAA 4YTQA 1WCGA 5AYXA 3UXLA 4M7TA 3NL2A 3UYCA 3O6DA 4F4RA 3KW3A 3CO8A 2D3LA 1OYBA 2QEZA 1XSJA 5XIMA 1SMDA 2JKAA 2QT3A 3FEMA 1JR1A 5ABEA 3TWBA 5ECVA 4FA3A 4G2DA 5T9BG 1FQ0A 3RMJA 4J2MA 4HNVA 2P3EA 1PUDA 3GW3A 1B3OA 3LXBA 1A3XA 2POZA 1TJ0A 1PDYA 3MUY1 4EAMA 3AIRA 4N9CA 2VO5A 3N12A 1R38A 4J1OA 3UERA 2E28A 3EXTA 4H9XA 3ECQA 4R7WA 1JFXA 3K4AA 2AL2B 1ICSA 4E8CA 1BVWA 4F79A 3PTMA 4CEUC 1YBQB 3MSGA 1LOQA 5CQ1A 4N4QA 3W4RA 4KRUA 4GG9A 3BJSA 2DIKA 1JVNA 1UP2A 1P6BA 4OOZA 2BY2A 3GG0A 3MBDA 4NZ5A 4W8BA 4UR9A 5DQPA 3GBDA 1E6QM 1TZ9A 5ABTA 5FJTA 3RO8A 1RQEA 1W5PA 3AC0A 1VKFA 5B7YA 4OVXA 1NFGA 4DJDA 1GOMA 1P0EA 5FF0A 3GHUA 2VDGA 3ARTA 3E0LA 1R3YA 2INEA 3LB0A 3WFLA 3OA3A 1WBJA 3MKVA 3PSWA 1Y5WA 4TU1A 3FXYA 4D9PA 4M29A 2ASHA 4GX9A 5AHIA 4QRNA 3RUBL 3U5UA 1MNZA 1X8FA 2NXIA 1FKWA 3W70A 4WHBA 1NQKA 1GOIA 1T40A 1PZ2A 3ISIX 3IARA 2QUVA 3CMJA 5CC5A 1HKWA 3MSDA 3W7DA 4IX0A 4XZMX 4F0SA 3R25A 3H8AA 1ZHAA 4UIOA 4O18A 2QIWA 4ZQCA 4Q32A 3T4WA 4WF7A 4ACZA 1KFWA 4IUOA 2BX7A 5AHEA 2DZAA 2DIEA 3QOKA 3B8SA 3WLJA 4NNAA 3HQOA 2G97A 1BWVA 1KFBA 1UA7A 4GUGA 3O7UA 1SQ7A 3P93A 4GLEA 1CIUA 3EX1A 8XIMA 1TPFA 2DZVA 3MHGA 3N9SA 4QITA 1VQTA 1PCWA 3JW7A 2A2IA 3HJZA 1JXKA 1W1A1 4YVVA 3OBEA 3AIWA 3MMDA 4PFHA 3CZKA 4X9SA 4I7WA 2Y8VA 2PC4A 2W62A 3B8TA 1IWPA 2CHOA 1BTCA 4L1XA 1K02A 1CXFA 5CPMA 3S4TA 1WZAA 3UJRA 4LUSB 1P0DA 3RR1A 5BW6A 1UD3A 3TYUA 4X0NA 1EOKA 4F66A 4X22A 4I7VA 1XG4A 3TSBA 4L9XA 3CTLA 3W72A 3R8GA 4ZB0A 4V33A 4RZ6A 1ZCOA 1XCWA 1R5YA 2CETA 1ZS2A 1UIOA 4LAUA 3GC4A 2J47A 3PZGA 5AECA 5E6ZA 3CJPA 4NI3A 4FP1A 2V5DA 3B04A 4ICCX 2E8ZA 4IF2A 3U57A 3MZ2A 4NJKA 4OV4A 3PJTA 3I68A 3GW0A 4AHOA 4LC8A 3H2MA 1J0ZA 2WZTA 1TIMA 3HQPA 3O3RA 3G24A 2DP3A 3IJ8A 2F38A 2OWCA 1EYWA 2OZ3A 3BLKA 2GQ3A 3T2PA 1RSCA 5DBUA 4A29A 1Q6DA 1TA3B 2DPEA 2ODOA 1D8WA 2EPKX 1EJXC 2HSAA 2DORA 2XIJA 1KCZA 1TJ1A 1GKPA 1V7AA 3KVMA 4L80A 4HA1A 1REQB 5BOFA 3NWRA 3BW2A 3WUBA 1KRCC 4HNLA 4LRTA 3DI0A 4ZQPA 2XIQA 1DJWA 1XUUA 1Q65A 2ZRWA 3UY7A 3C0LA 1F3WA 1VGAA 4GC4A 1FFRA 4NX5A 2RDTA 3QF0A 5K3VA 5EGRA 4ZXLA 1JYVA 1K6WA 3GXFA 1QAPA 3L4XA 2XFFA 1AG1O 4DRSA 4JQAA 3B97A 2E40A 1QOPA 2I14A 1I6NA 2Y24A 3N34A 2VVSA 6XIAA 4S3AA 2OEKA 4H9YA 6REQA 4GZ7A 2RGMA 1VRXA 9XIAA 2BGNE 5DN1A 4KEVA 1KTCA 4MAVA 2V5LA 2ZXQA 1ONXA 2W5FA 1VIZA 3ABQA 3MVIA 1MI3A 5C9UA 4UTJA 4Q4PA 5KETA 3EX4A 2P3ZA 4K68A 1YPXA 3QR3A 1LF1A 2XYLA 2V69A 4LYRA 1ADSA 4R9XA 1DIEA 3CUHA 4EKJA 2WCSA 3IIXA 4PTMA 3DFTA 2EAWA 1WQ5A 1PZ3A 3KXQA 1B1YA 2PURA 1UHVA 4DWSB 1FXPA 2WMIA 3LDVA 4HYRA 1K9EA 3SFKA 5K9DA 1R2RA 5IM51 3LV5A 1KBJA 1MEIA 3BGAA 1GHRA 2C91A 1MFVA 3UYIA 1Q6FA 3VD7A 3CHCA 2E9BA 4BJHA 1UA3A 4KQNA 4V28A 4FIRA 4PC8A 1F61A 1YLVA 4J3VA 3VKKA 3A12A 4HJFA 1P6CA 1XS2A 1WDQA 4I3GA 1PAMA 5D05A 2PDIA 4AIUA 1P6WA 2ALRA 4ERAA 4PUUA 3OLEA 4JN8A 5HNNA 3G77A 4HOXA 1SFTA 3SRFA 1ECQA 3AU6A 1RK5A 3QHMA 5GNXA 3ALGA 2GDUA 2QGYA 4DF2A 3GC5A 4UMCA 3LM7A 3NVTA 4D6FA 5A95A 6TAAA 3DZ1A 2YXXA 3O8AA 6A3HA 4GIRA 1PX8A 3N4EA 3TYEA 1E9YB 1P0KA 4HJWA 3W75A 2WANA 1UKOA 4WKFA 2QPUA 2CBVA 5A6MA 1D7FA 5C9RA 1A5SA 3RDKA 3DEQA 5M2FX 4AZBA 2OQHA 5G4WA 4PUNA 1TCDA 5I3KA 3HPAA 3RCYA 3EMZA 4CD8A 2CNCA 2R8WA 4F2BA 4GQRA 1Q5MA 1E5NA 3E2VA 3CC1A 2DUZA 2ZE0A 3TOYA 1XIBA 3TQPA 2V6AA 3RITA 3PZ9A 4CEXC 4O1FA 5JUVA 4HZ7A 3M64A 2G95A 4PUMA 2PI6A 3C56A 4XBKA 2J88A 4C1NA 2R24A 3AI0A 3PPGA 5K7JA 4S38A 3NO1A 3N4AA 1XCFA 5I24A 5F1VA 1VC4A 2BVDA 1YYAA 3HB9A 3EZ4A 1UMYA 4FMVA 1V7YA 1UR0A 1U5VA 3ZWTA 3W6LA 3EX6A 1US2A 3V18A 4AHQA 2YB4A 1ZNNA 2YCLB 3BAWA 5H2ZA 4IHCA 2I1OA 3FGCA 3AROA 3LLFA 5AYBA 1UH4A 4DB7A 4GK8A 3NURA 4CN4A 2B7QA 3DERA 3DFNA 4WX2A 3CHEA 1ZZMA 1BWLA 1W2PA 4K2SA 2YPIA 3SZ8A 2WVSA 5FAGA 3ZJKA 2ZRVA 1QWGA 3KL5A 5CSSA 4KIEA 4NRSA 3WQFA 2VZVA 2CBUA 3MANA 1FHDA 3P3BA 2PDNA 2PDUA 3QRHA 3CV2A 2Y4SA 2C13A 4V27A 3KEHA 1JZ3A 2VFGA 3G1FA 2PLKA 1J9YA 1V02E 1PS9A 1V6UA 1RPKA 4LV4A 1BTMA 3I3BA 4GVGA 4HK6A 5CZ0A 3GUGA 3KBNA 4MDOA 3OHIA 1ZCCA 1YTKA 1KM6A 2YIHA 3R5EA 2JKPA 5LIUX 3STCA 1TWZA 3TTYA 3VE7A 1TYGA 4N02A 3UG5A 1ITXA 3KBVA 2YA2A 3SQLA 1C9DA 1QFEA 4C6OA 1H7OA 2YR1A 1VB9A 1CGXA 3MBFA 4XWUA 1ITQA 1W9VA 4IP4A 1LORA 3KTSA 3ABZA 3UU0A 3WH6A 3T0AA 3R10A 2E9LA 2CITA 4DZHA 5E0FA 1GZGA 2VDIA 1E4MM 4PTVA 4NQ1A 2YZRA 4QSHA 5RUBA 1PIIA 4XAFA 2BMBA 3PTDA 2Z0IA 5TBOA 4E2BA 1DXFA 2ZX7A 3EWUA 4LAMA 4GRSA 3P84A 4B91A 3TYDA 3F2CA 5F2MA 4C60A 2HPIA 1F9CA 1EUAA 1GOOA 1H51A 4K3ZA 1MW1A 1U1JA 3Q37A 3WH9A 2PZ0A 2YA1A 2PGRA 3LG3A 3OQ8A 3D5HA 4UNLA 2CPUA 3QMTA 3MMUA 1GVRA 1RD5A 2YZ5A 2ZBTA 1R6WA 2J62A 2O4MA 1ONWA 1QO5A 2YFNA 5G2HA 3TROA 1IEQA 3VIKA 1WDWA 1RH9A 4DNMA 4K36A 2ZUMA 1NWRA 5IOBA 5J5DA 3ABXA 3WJYA 3E9AA 2B81A 4S2BA 4FALA 4IPIA 2WM0A 2CXGA 2ZFAA 3K8MA 5HQLA 1A4LA 3AHXA 3OU8A 1TWIA 4E5TA 4IP5A 1HKMA 1TX0A 1W1PA 5AC5A 2Y8UA 1N82A 4ICNA 3HA1A 1E1EA 5D8WA 4O4VA 4IJBA 3CTTA 2X0HA 1LP6A 2WSKA 1DEDA 4F9DA 3DG3A 4MKVA 4E4PA 1YADA 5E93A 3DDMA 2H3BA 4DNHA 2A3EA 3E2SA 1TPB1 1ZSXA 5A5WA 2WW5A 2Q8LA 5EFDA 2CLMA 1ZL1A 4GIAA 4UQ9A 1GQIA 1OY0A 1L6WA 3RILA 3EWBX 2OPJA 3F4WA 3DKLA 1JPMA 3I3EA 4I7UA 1WV2A 1NU5A 4FPSA 3W7KA 3W29A 1R7OA 4DJFC 1VRDA 1EZ2A 6CGTA 1UIPA 1G9HA 1C93A 2VMFA 1S1PA 1TMQA 4WGHA 5A6KA 1Q4NX 4PUDA 1CX9A 2BXYA 4PGLA 4W93A 2ZRXA 3OG3A 3VNDA 3OODA 3RR4A 4OQVA 2DH2A 2D23A 3T7VA 1TFVA 2Y5SA 2BY1A 4Z2JA 1E5JA 1HP4A 4KRZA 2DVUA 1Y7VA 3AMDA 3LXCA 4WSJA 5AYZA 3QJAA 1KM4A 1B3WA 3PZTA 5AHMA 5BXPA 5F2GA 4NJHA 2QDDA 1MXSA 2VX5A 4ML4A 3AYSA 1XQKA 4V15A 3EYPA 3UGVA 3P7YA 3KUMA 3WEOA 3BSMA 3KM8A 4G56A 4RE2A 3CQJA 3KVKA 3LMZA 2NLIA 2D2JA 3GNOA 1SR9A 4FNSA 7A3HA 4UZUA 2XM2A 3M46A 4DZIA 1R0MA 1D8CA 3MHUA 2R91A 4S3FA 4IGNA 4WKHA 1Y8BA 2NX3A 4XD5A 5EBAA 5H8MA 2A7PA 1UWSA 4AWTA 2Y5JA 5BU9A 5A6BD 1FWGC 5HNUA 3U2OA 3UVIA 2P8BA 4US5D 1M68A 3OZPA 4DYJA 1PDZA 5FACA 3TYZA 3PJXA 2GDQA 4KBXA 4KEMA 3TWAA 1VF8A 4S3EA 1I2NA 3EOEA 1IXPA 4HSHA 5HXMA 3VKCA 4DM1A 3AWOA 4JKLA 4YVPA 1MEWA 3ES8A 3WH8A 4ZBCA 1JULA 3COTA 4O14A 2QDGA 3UPBA 3A13A 4H00A 2HXTA 2PLCA 1RHCA 2BASA 5A6BA 4AD1A 3H55A 4B5WA 2VWTA 4LVFA 1WE5A 4US5A 4JOMA 3LGEA 3OW1A 1LRNA 1HFBA 4JTSA 2XIMA 4JFTA 5CZKA 4AB4A 3VC6A 2PLMA 3SCSA 1UBSA 4H2CA 4HNCA 3HQ1A 3W02A 4JEJA 2E68A 4UTFA 4IQEA 3LD5A 1UPPA 2NT0A 1V3MA 5K9CA 3LRLA 2DZBA 2WZMA 2D69A 1MYRA 3U3HA 1TO3A 2YA0A 3SJ3A 4AVOA 3LCLA 2Z25A 4BA0A 1P7TB 1QI2A 3G1YA 1IZJA 4KWOA 2VCAA 1DJXA 1XW8A 4RE4A 4LY8A 5I23A 1OABA 4YJ5A 2FPYA 2XFYA 3CS2A 3ZLGA 2G41A 2YXGA 3IS4A 5BOEA 3W7CA 3TW9A 2W67A 1KKRA 5FI8A 4FOJA 3KRSA 1W3HA 4QEHA 2EG8A 2DDXA 1MDRA 3PUEA 2PWHA 4BFAA 3VYLA 4LVDA 2DIJA 4QJ5B 2ZX9A 4JIIX 5D38A 4QAIA 3KAOA 1XR2A 1MW3A 2GGGA 3BVJA 4AF0A 3VX0A 5BNKA 3BWWA 1WAUA 4WSHA 4A35A 4B3LA 5A3HA 1TELA 1RY0A 4GBDA 3M0HA 7CGTA 3CMGA 3FAWA 3B0VC 4Y8FA 1UKQA 1KGXA 1ZY9A 4W87A 4AC7C 3VMPA 5BXRA 4B3KA 3WJSA 2C79A 4PL1A 4P8WA 3M0YA 2QCHA 3RRAA 1HKVA 3RU6A 1FWDC 2WC4A 4BR1A 1J0JA 5HJXA 1RA0A 1W3TA 3NM3A 5HR7A 3AIEA 3IV3A 4GFIA 4I8YA 1UJQA 3S1GA 1FHUA 5C8BB 3AYTA 1A5CA 3BDKA 4XKYB 2OZTA 4LAZA 1DJHA 4US6A 1OX5A 5M1TA 3F5JA 3M0LA 4ZOCA 3ZSSA 3NJ3A 2C0AA 3W82A 3F4CA 1GJPA 4IFRA 2EBNA 4LH8A 2WC7A 4WDTA 1XIHA 4IIFA 3U8GA 3ZXWA 1DL3A 3NPVA 3S2LA 1AL7A 3NOEA 3M41A 4NILA 3H4WA 4XZNX 1A0EA 3W1AA 2QS8A 3QBUA 1CLKA 4GJIA 1QBBA 4KW2A 4N9BA 2OO0A 1RCQA 3KRUA 2YL5A 5IHRA 2IMRA 3ZMRA 2QCCA 3BCFA 1ZAIA 2GGEA 4W86A 4NP7A 3QKZA 2PU1A 3WUEA 2X1TA 1EPXA 4DBWA 4RDYA 4BI7A 1VFLA 3QQWA 4FZIA 2J6XA 2ZUSA 4YWSA 1I0DA 3AALA 1EC9A 3G18A 3D47A 2OYLA 1AZ2A 3NTYA 4PBGA 1XFCA 3THCA 3I4EA 3YPIA 3L12A 3BG5A 2BXZA 3OO2A 4EP8C 3S9ZA 3LCFA 1B3VA 4NNBA 4M5PA 3GDBA 2D24A 1V02A 3SN4A 4RX0A 4QBXA 1T0OA 3NNTA 4DXXA 1JEZA 5AHLA 3KS6A 4JGDA 4UFMA 4IQDA 5CJMA 4QP0A 2PB1A 1JNEA 4MSSA 5EMUA 3OIHA 3EWWA 4EPKA 3EGJA 3WL0A 4QEEA 3VOFA 3SAZA 3UJSA 1C7SA 1J93A 1HT6A 3A21A 2E5CA 4JY9A 2ZZ4A 3BCDA 1V08A 3TC6A 3WLNA 3GH7A 1G69A 3M5VA 3REQB 1EYEA 4HKPA 3TC3A 1KBBA 3RM8A 3VDCA 4RV8A 1FCBA 2O9OA 5FSEC 2WJEA 4FLSA 1OX6A 1QK2A 3PBUA 1LUCA 4AZHA 1TJRA 4Z1BA 5I5RA 3GUWA 4NSBA 3MV11 1V3HA 4HCLA 5EBUA 5C6MA 2F2HA 5F4XA 1RBOB 3G0UA 4ZODA 4HSNA 5CAKA 3H2OA 2VDHA 3DESA 1GVQA 4JQ1A 1BHGA 2IUZA 3WF0A 1K70A 2XFWA 1DJIA 4RV3A 2Z24A 5A6LA 1UZ4A 4TIMA 5FKYA 4S1FA 4HIBA 5TD4A 1MXDA 4W88A 1CDGA 4PCNA 1EF2A 1VFSA 5I3GA 2D22A 1FCQA 4GMEA 2VGIA 3EOUA 3QW4B 1K7XA 3FSTA 1XF0A 3MMWA 1UR3M 4K7VA 3NQEA 4H04A 1EO7A 4U2ZA 2VEKA 1K8YA 2YCJA 4YHEA 2G50A 4PMUA 4BZYA 3L4TA 4PUWA 4OGZA 1E55A 3A22A 3EDJA 3LI0A 4LCQA 1NAL1 3U7BA 4DBUA 5FOOA 4XD4A 3A4WA 2HQAA 4HHHA 4MM1A 3IVUA 1KM0A 2DVXA 1OQFA 1W8GA 3TVAA 2G96A 4A8LA 1CLXA 3DU0A 4EAYA 3C3NA 2EJAA 4H8NA 1MQPA 4ORMA 2XH2A 5DY3A 2QPSA 2EG6A 4DJFA 1LDCA 3W71A 4O1DA 2OT1A 1K6AA 2D2HA 1MVYA 5AHFA 5DELA 2PGWA 3W85A 3WK1A 1V77A 1XIJA 4HMDA 4ADUA 3KCOA 5D4YA 5EMLA 4B15A 3POHA 3DFSA 2PBOA 1VLIA 4GBUA 3BPWA 5CG0A 1FCVA 3ZT7A 3RIKA 3H6OA 1JUBA 4D6EA 3SCWA 3SRHA 1Z9AA 1NDVA 3GNRA 2Y7DA 3P82A 2OB3A 4ILSA 4GY0A 2Z26A 1R30A 3UZXA 1GT8A 1V3LA 1O60A 1VYSX 3V1HA 5LIWX 1GKRA 1WYIA 3VIOA 3WD1A 5BXTA 1A5AA 1JQVA 4O13A 4S3DA 5DXYA 4RPQA 5HANA 3A24A 5TF0A 4G9PA 1JQXA 3BK0A 3EDFA 5CPLA 2WSQA 5GJPA 8TIMA 4EANA 1QI0A 3CNYA 3NL3A 1EHNA 2PF0A 4LVBA 1R3VA 4CCDA 3L68A 2WMKA 3CL6A 1JZ2A 5I77A 3G0XA 1VJZA 3AYRA 4HZMA 1SM9A 4K38A 1VEPA 2VQUA 1SO3A 5LA2A 4YWIA 2DY3A 3LPFA 2G3FA 1SZGA 1YMYA 2WCGA 4G6CA 3NO3A 5HNTA 5DRCA 5XIAA 1GONA 1H1YA 4DF1A 5B80A 1XGDA 3I10A 4ZCWA 2CCRA 1XLHA 5F1UA 2DSZA 3VAVA 5CBBA 2BOEX 2XM1A 5D2XA 4YN5A 4ZQMA 5U7SA 4LS1A 3F2DA 3R58A 1PO9A 3GVVA 1X1NA 4RW3A 2XVPA 4UMAA 3BGJA 1XH0A 2XH0A 1OF8A 4IFKB 3RRXA 5HWMA 3VGHA 4J2PA 1E71M 3MUXA 1HJWA 4TX9A 1IIGA 3K46A 1JGMA 4J3TA 2NQZA 4W5UA 1HL8A 4LUTB 1UB3A 3UQNA 2WHKA 2PAJA 3W1PA 2E6FA 3T0BA 2YLAA 4E4UA 1IGSA 1B3YA 4JIPA 2I57A 3B9OA 1B3ZA 3NR0A 2DEPA 2DVTA 2OO6A 1VBRA 1XRSA 3ONBA 3R8RA 5G1MA 2ICSA 4C6JA 4LJ3A 3KCJA 1S38A 1AW1A 1OCNA 1LQAA 1B57A 1PYMA 1PB0A 4E38A 1QNPA 3EB3A 1DWHM 3BE7A 4JTEA 3U9IA 2BHZA 1KLZA 1IV8A 3V0UA 2Z1BA 4NY2A 3M1ZA 4JFWA 4CNSA 1US0A 2J66A 2WCAA 3H24A 5J04A 1J18A 3LHZA 4MUPA 3EAUA 3IUIA 3LHTA 3MS8A 4QFUA 2NUXA 3SB0A 5TQLA 4M56A 2X1RA 3P6LA 1XYFA 1EUNA 3BLPX 3GYEA 5IDIA 4AEOA 1W9PA 4EVZA 4MJZA 1BYDA 1GVFA 1HW6A 3OZOA 4R5EA 4RXGA 2QVHA 3L4VA 4YVXA 2OFJA 3V16A 4PMJA 3JS3A 1A5UA 3USBA 2YOCA 3SCOA 4QSFA 1EJWC 4LB4A 3K4DA 3HM7A 4DUVA 3R0DA 3QZEA 4A8NA 3BAKA 1UMLA 3R0KA 4J40A 3H21A 5D30A 3NQ6A 4Q8TA 1PZ0A 1QHZA 4C6BA 2Z1SA 3VM7A 3R13A 3O6YX 1V6WA 4QG9A 4J27A 3B06A 3O1NA 3LS9A 2FVMA 5D32A 4CCEA 2O7SA 3PN8A 1HP5A 4W84A 5T8GA 1Q6OA 4DY1A 1WDPA 3R11A 4X2PA 3QQ1A 4QE5A 3EMCA 4LV9A 4QR6A 2WSPA 5MKGB 3DHUA 2XGZA 1EX1A 2E0PA 3SY1A 2O55A 4PCSA 1HGYA 3VIIA 1H1ZA 3CZJA 4FXRA 3W37A 3TU9A 5A1AA 4JCLA 5I02A 1AJ0A 3CMFA 3EB2A 3T8LA 1BKHA 1ZAJA 1OB0A 2GQ8A 2JIWA 4PL2A 3THQA 4UTWA 3K5XA 3BO9A 3DHPA 5I09A 4FNTA 1U1HA 1TR1A 1J11A 4DO4A 3S6OA 1KB3A 2F2KA 4JX6A 1W9XA 4HCHA 3W1QA 4PZVA 2EKGA 4NXKA 3C0SA 3LEPA 4P7LA 1GOKA 3OZMA 2QULA 1OC5A 4LS2A 4AZCB 2WPBA 3II1A 2VUYA 1EDGA 1O5XA 3PM6A 4Q4KA 4RLIA 4Z42C 2W9MA 4XG1A 3VINA 4P61A 4NHVA 4K7YA 2GVYA 1XKYA 2XTKA 1AMYA 2V3EA 4MWAE 2VVNA 4RW5A 3N9RA 4BHYA 4JTLA 1FKXA 2O7QA 4DWSC 4CNTA 1JPKA 5D9PA 3SY5A 3IIVA 2ZXDA 3EA3A 3CO4A 5F4WA 3DH7A 1FWNA 1EBGA 3GR4A 3GQYA 3AIBA 4B9YA 4LT9A 4OTKA 1W9UA 3UWYA 4GVIA 1L6SA 4AVNA 5DT5A 3G6LA 1MO0A 5EMJA 3UWUA 1SU5A 4MY9A 1I2QA 3CUZA 3N29A 3GE7A 1K4GA 2CEQA 1K8CA 4GI9A 4NZFA 5HMEA 3ARXA 4HYWA 1Q6CA 5HBFA 3NAVA 1WZLA 1B3XA 4F8XA 4E4FA 1Y0EA 2CLOA 4MNLA 3W6MA 2C19A 2R1KA 3KTCA 4D71A 5I3DA 3ANUA 2PRHA 4O11A 1TWDA 2ZUNA 1GNXA 4L4OA 3TLQA 4FLOA 3ALFA 1E70M 4FAMA 2Y0FA 4D8ZA 1BSLA 5E5CA 3N6QA 2VFEA 4LOCA 4MOZA 1JCLA 1IWAA 3TC7A 1BEUA 1G4SA 3MUZ1 5B7ZA 1KCKA 4ECLA 3BLFA 3UNDA 3CZ8A 4JHMA 3UT0A 4HPGA 4CD6A 4UOZA 4I9MA 2V67A 2QQ6A 1SW0A 2JFEX 3E5PA 3V7PA 5I3JA 4U31A 3EXSA 1A3WA 1CXHA 1JYWA 1RUSA 1VYRA 1OK4A 3DBPA 4KCWA 3GXNA 4L6OA 4PFMA 1J2BA 2XWEA 4Z2LA 2XDFA 2PGFA 2ABAA 3IRSA 4ORIA 3VD3A 3OTRA 3L66A 3AU2A 5E9XA 4MPKA 1VH7A 3S2CA 1DV7A 1XM3A 5A8MA 3CGTA 2E77A 3GAKA 2XGIA 4UR7A 1LL6A 3DN5A 5E6YA 4IIGA 3UFYA 1SJCA 4AAJA 4WVXA 4CU7A 3UZYA 3GU1A 2Q71A 2CZVA 3KOZA 5G1YA 3WFAA 1BSIA 3RJYA 3IGUA 3B0XA 3IJLA 3Q94A 3M7SA 3GHSA 5CPOA 1Z6KA 2O4QA 4C6NA 1DJGA 4BF9A 1QPNA 3P5YA 1EJVC 1HO1A 3WJXA 2AQVA 1C8VA 4LQ1A 3W7JA 2F6KA 3H7RA 1UZDA 3CIXA 3ITYA 1M9HA 1ALDA 1OF6A 3S2JA 1RD6A 4KS0A 3GVQA 4AVFA 4TUFA 2OYKA 2R6OA 4C6KA 4M6QA 4C5YA 3IUHA 3NXFA 1V6YA 1PV8A 3UNTA 2OWWA 2H3DA 4TVCA 2I7GA 4IT1A 4JTKA 1NDYA 2NQ5A 2EHHA 4UNKA 2AL2A 3OJGA 4F3HA 3VOGA 1JL8A 4PTDA 2GJRA 2VOTA 2GJNA 1S5TA 2FMNA 3PZIA 5DX7A 1W91A 4IPPA 2QAFA 2Z28A 1Q6EA 5F2IA 5I0DA 2G4FA 4AISA 3N6JA 2XWDA 2I16A 4H7ZA 2PF8A 3W83A 2HNHA 2V3DA 1P4CA 3ARRA 3HN3A 3TK7A 4DELA 4UTLA 2FH8A 4PCFA 4KH2A 4Q6JA 3UCQA 3U2CA 3W38A 1HXJA 2CWNA 4WDXA 2J7BA 4PH6A 2WOQA 3L5MA 4J5NA 1UWTA 5K4XA 1H7RA 2BY0A 3AXXA 5D09A 1OHLA 3TR2A 1GW9A 3K2GA 3RN6A 3EEGA 2ADAA 5JMUA 4XO6A 2HS6A 2WVVA 1DPMA 5CEWA 4UQDA 3U0HA 2YDAA 1PKMA 3VZYA 1A4MA 3HFYA 3SN0A 5EYWA 1G0CA 2X16A 9XIMA 2DH3A 2HMCA 2WMFA 2YLLA 5CKSA 3OPSA 4K1WA 4QJ1A 3OVPA 4HU8A 1O5QA 3QMRA 2FHBA 4WDUA 3MZNA 5ABGA 3U48A 3S5NA 3C8NA 1WKYA 3EX2A 3CAWA 1FH7A 3NQAA 1V03A 4GVFA 3I65A 1I9CB 3E0VA 2X1IA 2QF8A 5KZEA 1SUXA 1JZ5A 1V93A 3SADA 1TV3A 4IIHA 3WD3A 2PRLA 1IZKA 3UGRA 3HIJA 1M7XA 1YXDA 4PEKA 5BRPA 3WNLA 4GO8A 2ZX5A 4D6HA 1F6KA 4GJJA 4DJED 3E0WA 5LNSA 3JU2A 4JS3A 1SR0A 4Q7NA 3QW3A 3B8DA 1CZ1A 4J9JA 1H7PA 3SUWA 1AQMA 3SSZA 1OGBA 3ITTA 4GI6A 5HINA 4CNUA 4CUCA 2R14A 1NY1A 1S2AA 4QX4A 1CCWB 4JIRA 1DP0A 3MWCA 1KLYA 4JYFA 3VXGA 5MF5A 1EP3A 2J9YA 3DUGA 5DXXA 3BQ5A 4S23A 4HHPA 4HHMA 4AU0A 4IPLA 3R79A 1YW1A 1OC6A 3PJWA 2X7VA 2VUNA 4DJEA 2HWGA 4UTTC 5GJMA 4O15A 1Z32X 3JRKA 1GGOA 4PBEA 1RBAA 2YL6A 1HVQA 5FEZA 5IXEA 3FX4A 2JKEA 3F4VA 3GVWA 1QI4A 2ACRA 3T2OA 3W7PA 1UR4A 2A3HA 1C8QA 3LZ3A 3V5CA 2ON3A 2A3AA 3KS5A 4PSRA 3QV7A 4BY3A 2I9EA 3MP3A 2RJGA 1EQCA 4ZB5A 4J3SA 1M3UA 1ZTVA 3HO8A 2PDLA 1E0UA 4K8EA 3B9DA 2ZX6A 4IG2A 2UY3A 3LLDA 1K8ZA 3APTA 3A3HA 3WJWA 3QGVA 4D8LA 4GNVA 2V2HA 3K1DA 1F3EA 4WD0A 4S3GA 3BSHA 3VNLA 3RJXA 3URNA 4U4MA 3ARWA 1B90A 2VX4A 3NEHA 1SO6A 1ODUA 1LLWA 2JGYA 3UW6A 2PDMA 1XYBA 2WJZA 1W1B1 2D2OA 4ICMA 4JN6A 4CQ8A 2PWVA 2XN2A 3VO0A 5A2BA 9RUBA 1KBIA 1IEWA 5GNZA 2J13A 5I79A 3VNJA 2XIOA 1M04A 1TZ7A 3BH4A 4ACZB 5A8NA 1QHPA 3DFHA 5MHBA 1RR2A