3PBGA

6-phospho-beta-galactosidase form-c
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
468
structure length
468
Chain Sequence
MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITENGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
total genus 190
structure length 468
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pbgA00
1BG4A 4W93A 2J7EA 1XYFA 1UR1A 2A3AA 4TTGA 4M56A 1JZ7A 5IXEA 4UFJA 3BAYA 2J75A 3N9KA 1M01A 4Z2JA 1OGSA 1QNQA 3EYPA 3K8KA 5A6LA 1CTNA 3A4XA 4PTVA 4CN6A 2DIEA 4PUDA 2XSBA 1MW2A 4PTWA 2E8YA 4AMCA 3RO8A 1IZKA 4A3YA 5DO8A 4MAVA 3UR8A 4PTXA 2PBOA 1BYBA 1GOMA 1ECEA 2DT2A 3VIIA 4N0RA 4UQAA 1E56A 2OSWA 1V3MA 4D6HA 3KWXA 5FCZA 1EDQA 4BF7A 2QV4A 3AYSA 2GSJA 1K9TA 1MFVA 4D71A 1UH2A 5A6AA 4GZIA 3M07A 3IAQA 4CD4A 1EQPA 2PBGA 3VD5A 1UHVA 3OZOA 3L4VA 4XZBA 1UD5A 3SCRA 1VEPA 1H3GA 3MUZ1 1SMAA 3W37A 5IHRA 4UNIA 1E4MM 1BVNP 4AEFA 5CXPA 4CCDA 4ACYA 1PX8A 1H4PA 3QGVA 2V5CA 2Y4SA 3ARUA 3ZIZA 4B9ZA 3KL0A 3VM5A 3N13A 1G9HA 2XM1A 5EBAA 1OD0A 5D4YA 4PMUA 2DSKA 2OWXA 2CKRA 4IISA 3VX1A 1PIFA 3AIUA 4DUWA 1KGUA 2XJ7A 2CPUA 4GXPA 3FAXA 3WEOA 1X6NA 1WZAA 4B3LA 4J28A 3ZT7A 4W88A 1UA7A 2ZXDA 4PBGA 3AMKA 2EXOA 5HOSA 3T0DA 4XUYA 1OINA 4M1RA 1OB0A 5IHSA 4QFUA 3SCOA 2FH6A 2DPEA 2OYKA 4IPNB 3WD3A 4JIEA 2Z1KA 4JFWA 5BRPA 1R7AA 3D3AA 4AWEA 1LF1A 4KH2A 4GZJA 2DSUA 2DH3A 3AROA 3WF2A 1JDDA 3EDDA 1VRXA 3WDHA 3VGBA 1MQRA 1DHKA 3NSNA 1ZBKA 4OOZA 4UQEA 2EJ1A 2WZIA 2BY0A 5EFDA 1BGGA 3TOPA 2F8QA 4UQDA 4WKAA 1MVYA 4H8UA 5E9AA 2TAAA 1W2VA 2OLHA 4C7FA 4BS0A 5ABGA 1JI1A 5DFAA 3SCTA 2VZTA 3OLDA 4GPNA 5DF0A 3RM9A 5BROA 1HJWA 2VCCA 1VEOA 2XIBA 4MB5A 1EXPA 1J0JA 1QNOA 2CCRA 3LPPA 3FN9A 3K1DA 2JEQA 1YQ2A 4OBSA 2YIHA 3CHDA 1W3KA 2FGZA 4U33A 3UEQA 3WL0A 1WDQA 2DQXA 2G8ZA 4ZE4A 1J0HA 3VD7A 1J01A 3AS2A 5A95A 1E6NA 4QLLA 1XCXA 1E6SM 1TFVA 2BS9A 4JKLA 3WELA 5GNZA 3WD0A 1WKYA 5CJ5A 1HVXA 3QR3A 1H5VA 1K9FA 4CD6A 1W3HA 3W26A 3MV11 4W86A 5A2AA 4UTFA 5F7UA 5I0DA 1R86A 2E8ZA 4GO8A 1FP8A 1XYZA 1KXHA 4P7OA 1XRVA 3GZAA 2YA1A 4EE9A 2X09A 1KQYA 3CMGA 4D1JA 2YA0A 1BSIA 3WH5A 3RJXA 1HKIA 1G1YA 4D6CA 4HOWA 3SUTA 1ZB5A 1J0KA 1CXKA 1UWTA 1TZ7A 4EK7A 2XWEA 3WD2A 1V02E 3OG2A 2V5DA 5E6YA 1UD3A 5M17A 3VDAA 1C8XA 2YLLA 1BGAA 3JUGA 4GI9A 1C91A 2X0YA 2EPLX 3KZSA 3VDHA 2XSAA 1TA3A 4HMCA 1GORA 4EANA 2W62A 5EMYA 1UWSA 2XTKA 7CGTA 4FLQA 1GOWA 4ZE5A 4J3VA 2UWFA 3BSGA 2WCAA 3T08A 1UKTA 1QI3A 4KRTA 4DUVA 5CSYA 1XH0A 1GNXA 1VEMA 2J8FA 3W6MA 3F5JA 3N17A 4ML4A 2VZOA 3VGDA 2E9MA 1VJZA 4ZXLA 4MNKA 1V03A 4BQ2A 4TOQA 2WNWA 3WIJA 1EHNA 3EBVA 4MNLA 3GBDA 1J18A 1RPKA 2D24A 2VL4A 4JCLA 3WDIA 3NIYA 2YDQA 3WNOA 3ZJ6A 5E70A 4OBRA 1UWUA 1CXEA 1D3CA 2YDSA 2EO7A 2D20A 4M81A 4Z2KA 3OLIA 4AY1A 1D2KA 4JKMA 2WHLA 4JZ5A 2ZUMA 1Q4NX 3WNLA 1E70M 1UWQA 1H41A 1CGYA 4TVDA 4NRSA 3MO4A 5I6SA 4M24A 1UZ4A 1ISYA 1GOKA 1W9BM 1CGUA 1C93A 1UQZA 2FHBA 1HKKA 4WSKA 4MB1A 4FLOA 5A8OA 2ZXAA 1W32A 4KWUA 4HMEA 4UQ9A 2MANA 5AC5A 1QI5A 3MS8A 2PB1A 5JIPA 1FOBA 1N82A 5BXRA 1GOQA 2WBGA 4NF7A 4DM1A 2UY4A 2VX6A 3UCQA 2WMIA 3CZGA 4MJ2A 2BVTA 2W91A 4E8CA 1EA9C 5CSUA 1NWRA 3BAIA 4Y7EA 1H0IA 5FL0A 5E0CA 1CNVA 1V0NA 1GW1A 3AYRA 2GJPA 4BA0A 3NSXA 2QPSA 3SEPA 2JF6A 5AY7A 4A3HA 4W8AA 3U5UA 1OT1A 4S3KA 2BVYA 4U5IA 4EAMA 3OGVA 1E1EA 1BHGA 5I78A 2D3NA 2NT0A 2VQUA 3FXYA 4KGLA 1EDGA 3L4TA 4NRRA 2EPMX 3CHFA 2YBTA 1JFHA 2WKLA 5DMYA 1OSEA 1U33A 4TTUA 1XH1A 1EH9A 1CXFA 3MUY1 3AMCA 4AZHA 1M03A 4NI3A 2VT0A 2YA2A 1GPFA 4UFIA 2DSZA 3J7HA 4MDPA 1W1PA 5BXTA 2OSXA 1KBKA 1UR2A 5HNNA 3WBAA 4FLRA 2WXDM 3MSDA 2VZUA 2O9RA 1QOXA 3WDRA 3THDA 1AQHA 3NDYA 1JGIA 3MMUA 2OWCA 1FA2A 5KEZA 5C8BB 1V3JA 3WUFA 2CHOA 1A3HA 2CERA 2JALA 3WQWA 1E9LA 1ZU8A 3VILA 1EGZA 2JIEA 1QPKA 1V02A 4GI8A 2WVVA 2BXYA 3I3EA 1X1NA 2CESA 2CHNA 1UD8A 1HJQA 3VMOA 1JAEA 2XFFA 3WNMA 3AZSA 3KEHA 2WMJA 4V28A 3ARVA 3WNNA 4CU7A 1CWYA 1L0PA 4YHGA 4PMNA 4Q22A 2ZXQA 3MMWA 1KQZA 3PZUA 1JZ4A 5KZ6A 3KL3A 3CBWA 4AZ5A 2Y24A 1V3KA 1CIUA 2DSVA 4P7NA 3ZO9A 4X0VA 1JYWA 4F9JA 4U3AA 3ARWA 4AD1A 3APGA 1WDRA 3OGSA 2GUYA 2EPNA 1H2JA 4NSBA 3WNKA 3ZMRA 4HZ6A 3BCDA 3W82A 3WQ6A 3TTSA 4ZFMA 2J74A 1C92A 2ZXBA 1C7TA 3PTKA 1KXTA 2VO5A 2PC8A 1H49A 4U31A 5A6BA 7TAAA 5A8QA 3MU7A 3NJ3A 1GOIA 3PBGA 3SCNA 3GXIA 3ALGA 1C8QA 2NT1A 1HXJA 3PZNA 2BV9A 3A6OA 5I23A 2WWCA 1KR0A 2XM2A 2AOSA 2AMGA 1BAGA 2WSPA 2J7FA 3N15A 5M03A 4OZOA 1QBAA 3IAPA 2VOTA 4WJXA 2A3BA 3VD9A 3CHEA 3AHZA 3GM8A 3IJ8A 1UQYA 3VIMA 1HNYA 2ZX8A 2J7CA 3N04A 1M04A 1UKOA 1MW1A 2VMFA 1LL7A 4GO9A 1ITXA 4Z2IA 3QOMA 4J27A 1E71M 1JZ8A 4ATLA 1XHGA 4UZUA 3PTMA 1TVNA 1HJUA 4LGXA 3O2LA 1X6LA 3CMJA 3AXXA 4AD4A 2IXUA 4BZYA 2WLZA 1JYNA 4IUGA 4E8DA 1GCYA 1FP9A 4CCEA 3WF1A 3DYPA 4YN5A 3WKZA 4OJYA 2CITA 4HOXA 4J3WA 3WY1A 4D6GA 1WPCA 2WZEA 2XFRA 1E55A 1J0YA 1B3VA 3B8SA 3ARSA 1KXVA 1WAWA 1HP5A 3WQ8A 2WM0A 3VIHA 3G6LA 3OZPA 4WSJA 2WVTA 1DP0A 4CVUA 3WH9A 3CZKA 5D9NA 3VGEA 5CG0A 2WHKA 3AXHA 1WO2A 4RE2A 1RH9A 3WUGA 3CLWA 3VDCA 1SR0A 2ZX9A 4AZBA 1C7SA 2C0HA 1O7AA 2YJQA 1CBGA 4QAWA 5CPQA 3HJEA 1J12A 1ODZA 2ZIDA 1TCMA 5BXSA 3WD4A 1TE1A 3BAWA 2X2YA 3W29A 1LG2A 4F8XA 4OOUA 1CXIA 4WKFA 2YL5A 2WMGA 1UWRA 4ATWA 1XSKA 4JFVA 4W89A 4ATDA 1FH8A 2J7HA 2WAGA 4UQBA 3WF0A 3VKKA 1GJWA 1VB9A 4JAWA 1LL6A 1HX0A 1BF2A 1NOUA 3ZSTA 4XZWA 4Z2HA 4PEEA 3ZSSA 3QHOA 1WE5A 1BG9A 3VGHA 3WEMA 4E4PA 1DWHM 5ABFB 4GKLA 1W2PA 3F5KA 2W92A 1E6ZA 2GDUA 1E6QM 4AZ6A 4CN1A 4B15A 2XG9A 5GPRA 4PSPA 1MQQA 1CDGA 1V6YA 4TVUA 1E72M 1CGXA 4CCCA 1VFUA 3ZT5A 2PWHA 5CLTA 4HOZA 1PZ3A 1VFOA 2VR4A 3QOKA 2EBNA 3SCUA 3HN3A 5AYIA 3VX0A 3PZQA 1AQMA 5FKYA 2G4FA 4MNJA 4V27A 1V6XA 2FDMA 1WNOA 1NQ6A 4QLKA 4ZEPA 5A6SA 4HU8A 4W5UA 1M53A 1LQ0A 3FNDA 4HA1A 5LA0A 1SMDA 4PYSA 1XD0A 3ARQA 3AHYA 4RE4A 2GFTA 2DEPA 2NSXA 5AYBA 1IZJA 2ZUUA 4JCMA 1FFRA 1HL8A 4Z2GA 2XGIA 2OYMA 3AIEA 5CPTA 4UOZA 3GXFA 4ZXOA 3TA9A 2ZOXA 1ZJAA 1JD9A 1UYQA 3RILA 1B3XA 1JXKA 3SCWA 1C8YA 3BAJA 3KE0A 5CGMA 3OLGA 2Y8VA 4L4OA 3VUPA 2BNJA 5D8WA 2J7GA 3FW6A 1PX4A 3O6AA 2WBKA 1MYRA 4W7WA 5EFFA 2W66A 3HMCA 2BHUA 1V3HA 4AIEA 2BFGA 3EDJA 1GHSA 4PRWA 2GJXB 4GQRA 2CETA 2OWWA 1K6AA 2YL6A 2J47A 2J77A 1B0IA 2J7BA 1G5AA 4D6DA 4A4AA 4GINA 4LYRA 3AOFA 3AISA 5ABHA 1OIMA 5BRQA 4C7DA 1ZL1A 3WL1A 4C7GA 3W53A 3OIHA 1OM0A 3SUWA 3F4VA 2BY3A 2HISA 3W38A 2XVGA 3UG4A 1GJUA 2WK2A 1HJXA 1GUVA 1ISZA 3ARPA 3WUBA 1EOKA 1ESWA 1JXJA 1TMQA 2OSYA 2E3ZA 1IT0A 1MWOA 2J78A 4W5ZA 1I75A 4PMVA 3WDPP 2FHCA 1V6WA 1UKQA 3GTNA 2X8RA 1DWIM 1AMYA 1UUQA 4U5KA 4DWSD 5E09A 4UOJA 1E40A 1QHZA 1LWHA 2RGLA 5CGTA 5A6BD 3S2CA 3EDEA 2AAAA 3DHPA 4B3KA 1CPUA 2VZSA 2ZX7A 2O9OA 3AICA 1E0VA 3D5HA 5HPCA 4GZEA 1KCLA 1ZBCA 4URIA 4F9DA 4AC1X 4OKDA 3SUVA 1WDSA 4CVWA 4EKJA 1NP2A 3ARTA 5I24A 1VIWA 3WEZA 2D2OA 2E4TA 3MV01 3ARXA 1J9YA 4AEEA 2EEXA 4AW7A 4UFKA 1EOMA 3I3BA 1DWAM 4W85A 2CNCA 6CGTA 1R87A 1KB3A 1CGVA 1XSJA 5GNYA 4PMXA 3AZRA 1B9ZA 1QVBA 4J3TA 4IPLA 5JBDA 3BC9A 2DT1A 2GJXA 3NCOA 1OCQA 1PIGA 3DYOA 1RP8A 1W9UA 2XVKA 3SUSA 4KGJA 4Q7NA 3WDJA 3AIBA 4V2XA 5CZKA 4UCFA 3NSMA 3ECQA 3N18A 3IJ9A 1G94A 2FHFA 1R7OA 3CO4A 3WQVA 1EQCA 1FFQA 5E6ZA 2VNCA 3A3HA 1E73M 1B3YA 1HIZA 2WCGA 4JFUA 1CLVA 2QPUA 1B90A 3K46A 2ZWYA 4J3UA 4AZCB 1JZ3A 2FH8A 2QMJA 4J3SA 3VIKA 2PWEA 1UG6A 2WWDA 2VRQA 4P7QA 1R85A 4P8UA 3AJ7A 3CUHA 3M7SA 4XV0A 4WKHA 1E4NA 2VX7A 3NYDA 5A6JA 1M7XA 1BLIA 2D0HA 4M8UA 1MXGA 4AZIA 1TVPA 3VU2A 1CEOA 5IFTA 4OUEA 1KWGA 3ZR6A 3SCPA 5DT5A 1XC6A 1V0MA 1MQPA 2CIPA 3OBAA 1A47A 4XX6A 1HL9A 1JZ5A 1UOKA 3TTQA 3T2OA 5I77A 3ZJKA 4BQ3A 4D6FA 2XGBA 2PWFA 1BFNA 3AIRA 2UY5A 3WFLA 4HPGA 1GZJA 3AIVA 2J4GA 1PAMA 1DWGM 5D9OA 1UD6A 4ZENA 4H7VA 3WMSA 1DWFM 2EPOA 1MW3A 1E4IA 2G41A 2CKSA 4P8VA 1GQKA 4B16A 3PN8A 3CH9A 1Q6DA 3WF4A 4W87A 2ZWZA 4D6JA 1KWKA 1FHLA 3B9DA 4DM2A 3ZJ7A 3RM8A 3AMDA 3PHAA 1UKSA 1E5JA 2DT0A 2CXGA 1R8LA 4DWSC 1ISVA 1MFUA 4PMYA 5D9PA 1HN1A 3PZGA 2VCAA 3K8MA 5TD4A 3WH8A 2E0PA 2HVMA 1HT6A 4AD0A 3UERA 4UFHA 3ZM8A 1Q6GA 4XB3A 1HP4A 4U2YA 1UH4A 2WMKA 2QLYA 2J25A 3RPMA 4MJ4A 5EB8A 5D9MA 5A3HA 2JIWA 1EHAA 1GONA 3AS1A 4FF5A 5LA2A 1J11A 4LQ1A 4ACZA 3WH7A 4W8LA 1VF8A 1OBAA 3L4WA 5A69A 2O9TA 1CLXA 3UETA 4RE3A 3N12A 3WDQA 2Q8XA 4H8VA 4S3JA 3SURA 3W25A 3MUIA 2CYGA 3N11A 4M80A 1K9DA 1WZKA 3RMEA 2J62A 3L2MA 4W7VA 2D0GA 2NW0A 1PZ2A 2DGAA 4Z2LA 4UFLA 2J8GA 4CD7A 5M5DA 4D72A 3G6MA 3U7VA 2VTFA 3OA5A 3PZ9A 3MANA 1JG9A 1VFFA 3PZMA 3VMNA 3AHTA 1J10A 1JZ6A 1V0LA 1HJVA 1JAKA 3CUIA 4QCFA 2YLAA 1BQCA 4MTVA 2VC9A 2CBJA 4FK9A 1US2A 2XVLA 3VIGA 3M46A 1I1WA 3CHCA 5IDIA 1VJSA 2CBUA 3VD4A 2WVUA 1NWSA 1V0KA 2IUZA 3VM7A 2WVSA 4BQ4A 1QNPA 1EO7A 1VBUA 1VBRA 1WZLA 2GK1A 1E6RA 1TR1A 5HBFA 1HVQA 2CBVA 9CGTA 2ZUVA 4F66A 4WF7A 8CGTA 2IXVA 3WUEA 3RJYA 4PMRA 3GBEA 1U2YA 3UG5A 1MXDA 3LPFA 2CEQA 1V3LA 3WN6A 4WK9A 1IV8A 1BTCA 3GNPA 4JHOA 1W9XA 2GVYA 4WIWA 1QI2A 1CGTA 1SYTA 1W9PA 3EMZA 1NH6A 2C7FA 1W91A 1WP6A 1JF5A 2BY2A 1QI0A 4HU0A 4CU6A 4ACZB 3BH4A 2WCSA 1XH2A 5M3WA 4H2CA 4LXFA 1NWTA 1JI2A 1OT2A 1DTUA 1Q6FA 3S6TA 1VAHA 1FH7A 2ZX5A 2WHJA 1QBBA 3O9NA 3CTTA 3VIOA 3TTYA 3IJ7A 2DH2A 3POHA 1F4HA 1B3WA 1J0ZA 2B31A 2UY2A 1Q6CA 3NUKA 4PSRA 3T2QA 1ZBWA 4PCSA 1H1NA 3KL5A 3VGFA 2JEPA 3CZEA 1WCGA 2YL9A 4QLJA 2F61A 3A4WA 4AZCA 2ZX6A 4HPHA 1UWIA 1CYGA 4QP0A 4YHEA 2EQDA 2W5FA 3CUJA 5ABEA 1LJYA 3PZTA 4PUEA 6TAAA 1J0IA 2VRKA 1I1XA 3GH7A 2XIIA 4JFSA 1G0CA 3BLKA 2ZUWA 4HZ7A 4CKQA 3VD3A 1ZJBA 2WC3A 1TA3B 4F79A 1W1YA 2V3EA 1PEZA 4MADA 3E1F1 2XUCA 4J7RA 3CUFA 3GNRA 1NARA 4TUFA 3GXMA 3AFBA 3ZT6A 1GQJA 1JYVA 2WVVB 1HKMA 1W1TA 1TUXA 1UZ1A 2JF7A 2XWDA 3AZTA 3GH5A 3BGAA 4X9YA 3SCQA 4FMVA 3AI0A 3VINA 3K4AA 1E6XM 2VR5A 4LPCA 3QHMA 3FHAA 1XD1A 3QHNA 4UR9A 4DUXA 4QDMA 1UA3A 3L4YA 2A3HA 3W81A 1NP0A 3AQUA 4PMOA 3BAXA 4UOQA 3VNYA 4JL1A 4E2OA 4LYQA 3VDBA 1XSIA 2V3GA 4HMDA 2VVSA 5CLWA 1H0GA 3GXDA 2Y5EA 4HA3A 4DWSB 2O9PA 2D22A 1GVYA 5ECUA 4UFMA 1QNRA 2W67A 1UD2A 1B30A 3ALFA 3W27A 2VZVA 4JHZA 5FL1A 1WDPA 1E0WA 4P7LA 2VI0A 3VVGA 1KFWA 2WZHA 4RL3A 4W84A 2X0HA 2EPKX 3W6LA 3WFZA 2XFYA 4KRUA 2F2HA 3F5LA 1L8NA 3L2LA 2WSKA 4BCEA 4LX4A 5A94A 4B9YA 4N42A 2XYLA 4R27A 1W9DM 1KGWA 4AXNA 1OGBA 3FAWA 3LPOA 3AIQA 3GH4A 4CN4A 5ABFA 2G3JA 2E9LA 1XGZA 2VQTA 5CPSA 3WQ4A 1HF6A 4YPJA 1PPIA 1E3ZA 4L4PA 1KGXA 4D6EA 4MB3A 1S46A 5JIWA 3ZQ9A 3PTQA 1Z32X 1UH3A 4P8XA 4W8BA 3HU7A 4OIFA 3AS0A 4CD5A 4FLSA 1B1YA 3UG3A 2YOCA 3I3DA 1HJSA 1ZBVA 2A3EA 3OLEA 1LWJA 5BWFA 5A1AA 1BYDA 1CZ1A 1E4LA 5I79A 2GDVA 2ZUNA 4W7UA 1QW8A 4D1IA 2G3NA 5A2BA 5GQBA 3CZJA 2UY3A 4GQQA 1PX3A 2W61A 4X0NA 1E3XA 4PTMA 2VCBA 3CIVA 1EO5A 2XHYA 3CZLA 2W63A 3PZOA 5HPOA 3POCA 4U3CA 1H09A 1Q6EA 3VIJA 1ISWA 1E1FA 4AISA 1ISXA 3VPLA 1G01A 4MNMA 5I5RA 1F4AA 2WPGA 5A6KA 1KXQA 3N1AA 3UR7A 2VJXA 3AXIA 3T0BA 5BYWA 1CENA 2PF0A 4MB4A 1B3ZA 4P8WA 1OD8A 4MPKA 3WNPA 1QHPA 3MMDA 3ZJ8A 3BMVA 4PCTA 3U5YA 3FY1A 3W4RA 3L4ZA 2CBIA 5CQ1A 3M6DA 3LPGA 1W3LA 2VVNA 1OWQA 3WMBA 3WSUA 1XCWA 4H04A 4M82A 3U57A 3VTRA 2WANA 5E0FA 4UQCA 2A3CA 2G3IA 8A3HA 3RDKA 1RP9A 2VX5A 3PZIA 1MW0A 4GIAA 4DWSA 1JF6A 2JFEX 3CUGA 4MDOA 3UESA 2ZUSA 1KBBA 3CZ8A 3DECA 1KCKA 2BXZA 3EDKA 1HKJA 3NDZA 3VMPA 1JDAA 4KMQA 2WLYA 1BYCA 3VIFA 3ARRA 1SFSA 3B9AA 1C90A 2V38A 2Z1SA 4PMZA 1JIBA 3A4AA 1VFMA 5JBEA 3IK2A 1WB0A 5A6MA 5A8MA 3T09A 2DIJA 1E5NA 4CU8A 2X05A 1UKPA 2BY1A 3RCNA 3VIPA 1W9VA 1E0XA 3BAKA 5I3DA 1W1VA 3BSHA 2YL8A 4AZGA 3EMQA 4AD3A 2RGMA 2WW5A 1U30A 4H41A 2XVPA 3W0KA 4P7RA 3WMCA 2ESCA 2ZE0A 3PZVA 1JNDA 2QMKA 3WENA 1E43A 5JBFA 4CUCA 1BPLB 2W4XA 2D23A 5I2UA 1UR0A 3AS3A 2D0FA 3A47A 1CXLA 1QW9A 4AD5A 2O92A 1BVZA 1NOWA 2OYLA 3T0AA 4CD8A 1JNEA 1FH9A 2GK1B 3CGTA 3MKKA 2YBUA 1PBGA 1PJ9A 3RM4A 1JYXA 3B9EA 5AC4A 5A8PA 4HA4A 1XV8A 3L4XA 3THCA 1D7FA 4TVCA 2WYSA 2BVDA 5FIPA 1US3A 3EDFA 1QHOA 3CPUA 3W28A 6A3HA 3SCSA 4UZSA 4JFTA 4HTYA 1JFXA 1KR1A 3WH6A 3K8LA 5LYRA 4TX8A 4M29A 4AYSA 2PWGA 1V3IA 2DSWA 4AD2A 3II1A 3IANA 4K68A 3WD1A 2WHMA 1UD4A 3AIWA 1O6IA 5HDRA 3BCFA 2C8NA 1LG1A 3ARYA 1CXHA 2VUYA 2BHZA 4H8HA 4MAZA 2ZUTA 1GQIA 3AHVA 3OB8A 1Y7VA 2GJRA 4R5EA 4D6IA 2XPKA 1NWUA 4AIUA 1RD6A 5JUVA 1JZ2A 1DEDA 3GDBA 1TG7A 2XVNA 2Y8KA 1OIFA 1AVAA 1NOFA 4AIOA 1K9EA 2WKGA 5FOOA 1V6VA 1NM9A 4JL2A 2PI6A 3BLPX 2JE8A 1DWJM 2YDRA 1CECA 4TX6A 3AHXA 5DEZA 1V6UA 4AZ7A 4JKKA 3WBEA 2Y2WA 1YHTA 1ODUA 2WB5A 1V08A 3L4UA 3VNZA 2DDXA 4IM4A 3FHQA 1ZS2A 2BHYA 1B31A 5D8ZA 2X1IA 4CGTA 5GNXA 3SUUA 2G3MA 3DYMA 2D3LA 1VENA 1C3FA 1ITCA 3SCVA 1QNSA 2D1ZA 3GYCA 5HXMA 1B2YA 5C70A 2V3DA 1GQLA 4PMQA 4GI6A 5A2CA 1AQ0A 2WC4A 1UR8A 2YKKA 1OGGA 2DT3A 3BXWA 1W3JA 2WMFA 3DC0A 2FGLA 1JL8A 3ARZA 3EMCA 1LL4A 4WLCA 1JDCA 3BMWA 1H11A 5C71A 1GOOA 2PWDA 2ZICA 5BXPA 7A3HA 2J7DA 3LMYA 3ZR5A 4PN2A 1E15A 1JD7A 1EIBA 4LYPA 1CGWA 2QHAA 3VO0A 3TTOA 4HZ8A 1EDTA 5DT7A 4BQ5A 3WF3A 2QF8A 2WC7A 3K4DA 2E9BA 1GVIA 3GNOA 5A8NA 1LLOA 3W24A 1E6PA 1UR9A 2J79A 2VRJA 2VX4A 3VOCA 4QCEA 4PMDA 3TONA 3ZOAA 3AMLA 3T2PA 3OGRA 4HP5A 1GHRA 3U7BA 4U2ZA 1P6WA 3DHUA 4J3XA 1FHDA 3AMGA 4NZCA 5LA1A 3MSGA 2WMIB 1WZMA 3RIKA 4TXEA 5IFPA 3TP4A 1QI4A 3MUAA 3VGGA 2V3FA 3SIMA 5BCAA 2E40A 1BYAA 1UR4A 5FD0A 3WQ5A 2WMHA 2VURA
chains in the Genus database with same CATH superfamily
1BG4A 1XICA 3G24A 3E38A 5A8GA 5F4XA 4TTGA 2V67A 3DFOA 2B7PA 5IXEA 4UFJA 3N9KA 2J75A 5HULA 2FKPA 3S46A 5MF5A 4ZL1A 2P10A 2VEMA 5A6LA 2QCHA 4PRRA 3ATZA 2ZRYA 4PUDA 4HJWA 4PTWA 4AMCA 1P43A 3QC0A 3P5ZA 2QULA 4O0ZA 1SFTA 3BJTA 1W8SA 2R1KA 3N25A 3UR8A 2PBOA 1BYBA 1NAL1 3HZ3A 3VIIA 2OSWA 4UQAA 1OG0A 4AHPA 3OYZA 3SGUA 1AA1B 4GMEA 4BF7A 3C2EA 1TREA 4F2TA 1AH3A 4M0XA 3TYDA 3RX4A 1Q6QA 1MFVA 5A6AA 1QDSA 4F48A 4IPJA 4FAMA 4YTUA 4DNMA 2DY3A 4UNIA 5IRPA 5CXPA 4ERAA 4YYFA 4UCGA 5TIMA 1TWIA 5FJJA 1LRTA 1JCXA 1IEVA 4LV4A 1UB3A 3ARUA 2BOFX 1TPWA 2I14A 1PIFA 3KCJA 2NLYA 3U9IA 4J1OA 4ECLA 4QRNA 1X6NA 3VOIA 1WZAA 3DG3A 3SBFA 4Q7BA 3TC6A 3ZT7A 4EPBC 4W88A 2ZXDA 3AMKA 2EXOA 3ZVIA 5HOSA 3MQTA 3S1XA 2Q02A 5AHFA 3PR2A 1VD6A 3SCOA 2DPEA 2YR1A 1XPYA 3U48A 2OCZA 3WD3A 4B92A 1LF1A 1SW7A 4REQA 2GGGA 4RK8A 1JDDA 1VRXA 3EX1A 2C91A 3GVGA 3EA3A 2WZIA 3LCGA 4RNFA 2QJIA 1YKWA 4LVBA 4KWOA 5CSRA 2OLHA 4C7FA 2TODA 5ABGA 4AVOA 5DFAA 3SCTA 3CQIA 6XIAA 1O5XA 2QGHA 1HG3A 2VCCA 4MB5A 1QNOA 1SO5A 4H1ZA 2CCRA 3PY2A 3LPPA 1A3WA 3DBPA 2CLMA 2JEQA 4DYEA 2HZGA 5HMSA 3GZ3A 4OBSA 1W3KA 2R6OA 3D47A 3CLMA 3EOSA 4NJIA 1IGWA 4K38A 3WG6A 3EOUA 4ZE4A 1NY1A 2G4JA 3QV7A 3TFXA 1J01A 3AS2A 3B8UA 1KRAC 4QLLA 1XCXA 1E6SM 1TTQA 1TFVA 3WELA 2QCDB 5GNZA 1NDVA 3UY8A 4ADUA 3HOJA 1WKYA 4YTRA 3QR3A 4I8YA 4O54A 1XLAA 2QW5A 4H9TA 1EPXA 4W86A 4QDPA 4E38A 3W70A 5A2AA 1U1JA 1J4EA 4OUIA 3IJLA 4GO8A 4Q8NA 4C91A 1M65A 5MKGB 2VEIA 1XRVA 2ZYFA 2GJLA 3R8HA 4D1JA 3ITGA 1BSIA 4XBSA 3UQNA 1PS9A 4D2JA 3N73A 4KCWA 4HOWA 3SUTA 1X96A 1EF2A 1UWTA 2PFHA 4EK7A 3C0QA 2OZ0A 5I3JA 1GVOA 1LOQA 5DX7A 4ZQMA 3E96A 2V5DA 2ZZ7A 4NX5A 2ZVRA 1C8XA 1V79A 1SW3A 2Z4GA 2X0YA 4S3DA 1TA3A 5IDZA 2TYSA 2DUAA 1TTJA 7CGTA 2DW7A 2PDUA 4J3VA 1UKTA 4PODA 3HV8A 3LCXA 3DFNA 4DUVA 5CSYA 1XIJA 2ZBTA 1GNXA 2RDXA 3P67A 4PA8A 3W6MA 4JTQA 3R1ZA 2VZOA 1VJZA 4MNKA 3O15A 2WNWA 2YW4A 1EHNA 3VKCA 3ZR4A 3GBDA 1KV5A 2CLOA 3WNOA 2DV0A 4RDZA 4Z2KA 4M81A 3MP3A 3QSTA 1YADA 4JZ5A 2WNQA 3WNLA 1E70M 1THFD 2ACRA 5K9CA 4B4FA 1KA9F 2IQDA 3WJWA 1UZ4A 3W1NA 1KM3A 4WSKA 3I4EA 3EPMA 1QI5A 1W1ZA 1ME8A 4E6MA 2PB1A 3NQMA 5JIPA 2E6AA 3W7DA 5G2IA 1F2JA 3BZJA 3S83A 2WBGA 2PC4A 3CQKA 4HT3A 4C6EA 2BB0A 3LRKA 3L5LA 4YXGA 1WUFA 4N4QA 2GJPA 3FYYA 1ML1A 5G2HA 1KRCC 1F8IA 5C54A 1KD0A 4L61A 3WLSA 1OT1A 4S3KA 3G0XA 2J24A 4FZIA 4XSMA 2D3NA 1UROA 3W2LA 5E1QA 4TMBA 1GZ1A 4GQGA 1OSEA 2CZFA 1CXFA 4LWWA 4IIGA 1ZTVA 3LSCA 2OGYA 2R9RA 3UW6A 1FUYA 4FXSA 1K4HA 4MDPA 3KHDA 3TIMA 1KTBA 5BXTA 3EGJA 2OSXA 1KBKA 1P0EA 3UXKA 2G50A 4LJ3A 2A5HA 2WXDM 2J6XA 3MSDA 1DORA 2VZUA 2CFFA 1AQHA 5DXXA 1PYFA 2OWCA 1FA2A 2VEKA 3WLKX 1R2SA 1V3JA 4PUJA 2CERA 2JALA 2PLJA 2X41A 2ZDSA 2G95A 1V02A 4GI8A 1VCGA 2WVVA 2BXYA 4Q4PA 1HFBA 4ZB5A 3I6EA 1W5MA 1QT1A 3HBLA 1OJXA 1QPRA 4V28A 4CU7A 3WNNA 3TJIA 1ZQ5A 3NPXA 3PUDA 1KFJA 2QKFA 1KQZA 3QW4B 5LKYA 5HJYA 2J6VA 2BWGA 4LF2A 4RUBA 3GNNA 2GOKA 1CIUA 2FIQA 3ZO9A 5EBUA 1ADDA 4U3AA 4AD1A 4B4HA 4H6EA 3OGSA 2GUYA 3WNKA 5TQLA 3RLUA 3TROA 3W82A 3WQ6A 4NAFB 3TTSA 1VHNA 3H70A 3BO9A 2J74A 4ZGYA 3R0DA 3M0LA 1SO4A 4IOTA 3OVPA 1UZDA 2XIQA 4ROPA 1RBAA 1OCNA 3AUJA 1EBHA 3ALGA 4S2CA 4QJ3B 3KRBA 3PZNA 1GKPA 3UWZA 5FJRA 3IPWA 1M3UA 2AOSA 3QJAA 1BAGA 4JIIX 4G1KA 2J7FA 3TK7A 1EJVC 1VYRA 3PG9A 1EWDA 3CHVA 2VOTA 2NZLA 3AHZA 3IJ8A 3TCSA 3VIMA 3KX6A 2J7CA 3OBKA 1M04A 4CEUC 1UKOA 2EHHA 4GO9A 6PTDA 3G2GA 1DIEA 1E71M 1JZ8A 3UPMA 4L4LA 1PO9A 2A21A 2YX0A 4UZUA 1TJ2A 4FB7A 2VFEA 3OHIA 1XPGA 1TVNA 1XG4A 4LGXA 3O2LA 3CMJA 4LVFA 2IXUA 1RBOB 3EOLA 3WF1A 1G7VA 2ISWA 3DYPA 4OJYA 2PDJA 1XFBA 3TN3A 3WY1A 1E55A 4US6A 4TR9A 4IGMA 1DE6A 3TZNA 4ERIA 2A3LA 4RZ4A 3V36A 3VIHA 2YGYA 1XCFA 1R46A 1XBXA 4WSJA 2AKMA 3WH9A 4R85A 3B8TA 3GTXA 4DBEA 2G96A 5CG0A 2PTWA 1EJUC 4YWSA 2WHKA 1L8PA 3AXHA 3RR1A 1WO2A 4ORMA 4G7EA 4BK9A 1O7AA 2YJQA 5LXEA 3VA8A 4DF0A 3HJEA 1J12A 2ZIDA 4GCAA 2PU1A 1T96A 3WD4A 2PGRA 3BAWA 1LG2A 4QE1A 4B5SA 2PURA 3W7NA 4HNNA 3W7GA 1F8MA 4IXHA 2INEA 4GKTA 2QJJA 3MCOA 4ATWA 4JFVA 1P7TA 4ATDA 2J7HA 3SECA 1PDZA 4YTQA 4DLFA 3WK0A 1E9IA 3PJWA 4CEXC 3TKFA 2TMDA 1VB9A 4FNQA 3VYLA 4Z2HA 1DJGA 2HE8A 4O53A 3WEMA 1V7AA 4C6NA 1M7PA 5LGZA 2W92A 2GDUA 3KWSA 4CN1A 2CZDA 5GPRA 1FDYA 1DV7A 3L0NA 1MQQA 3LCIA 4M6VA 4QG6A 2CLKA 2EKCA 4XSLA 1W6TA 4JX5A 9XIMA 3KBMA 2JBMA 1VFUA 3ZT5A 3JRKA 4DPPA 3TW9A 3M0HA 4FA3A 5AYIA 1AQMA 1NTHA 1H7PA 9XIAA 4V27A 1YXCA 1NQ6A 5A6SA 2CWNA 3QSRA 5EMMA 1M53A 2IKJA 3BLOA 4M6PA 4HNLA 4PYSA 3FJ4A 3S8HA 3ARQA 4RE4A 2BTMA 2NSXA 2ZUUA 3R43A 1FFRA 3FXGA 2DJXA 3AIEA 3N9RA 1DTNA 1Y65A 1LTDA 1ZCOA 3NQBA 3TJLA 5FF4A 3TA9A 1B3XA 4HSNA 3SCWA 3AYTA 2GDQA 3BAJA 3LNMA 3A13A 3VUPA 1PX4A 2QDHA 4Y9NA 1UR3M 1MYRA 3ANYA 5B80A 5EFFA 2W66A 1VCVA 4AIEA 2BFGA 3G1RA 3EDJA 1G69A 4PRWA 2OX4A 4GQRA 2CETA 2E5DA 1UUOA 5C2CA 4MY9A 4JHMA 2YL6A 2FVKA 1LYXA 1SU5A 3ELFA 2FFCA 4D6DA 4GH3A 1LWIA 3G1VA 4YCOA 1ZAHA 1OIMA 1OQFA 2OQYA 3NGFA 3OIHA 4N7QA 3PB2A 1FX6A 3GX9A 2XVGA 4BJHA 1HJXA 2QPXA 3QN3A 4DBUA 4PTNA 4N4PA 3ARPA 2C16A 1A5LC 3WUBA 3MI3A 2QUNA 1EEPA 2QCGA 4DBDA 2W6RA 2J78A 4PMVA 1DHPA 3ABQA 2FHCA 4HVXA 3M5YA 4U5KA 1XM3A 3O0FA 2W9MA 4IGNA 5E09A 4F0SA 4UOJA 1LWHA 1QK0A 1I2NA 2NUWA 3KCOA 3KCLA 1CPUA 2VZSA 1EZWA 1NF7A 2ZX7A 3XIMA 3D5HA 4GZEA 1KCLA 3W7CA 4F9DA 4CVWA 2QCFA 3RUBL 1HO4A 3K2GA 3KOFA 5KETA 2D2OA 2OU4A 4RW3A 1UC5A 4JTCA 4PMJA 2EKGA 1DWAM 3L65A 1XIDA 6CGTA 2OLSA 1KB3A 5GNYA 2QGYA 1AMKA 4IHCA 3AZRA 3A5FA 1ICQA 3V5OA 1KFLA 2DT1A 1XYLA 2GJXA 1XYAA 1PIGA 3MCNA 2XVKA 3C3UA 2DZSA 3SUSA 4Q7NA 1M5WA 3V0SA 3MJYA 2ZRWA 3NSMA 4S1FA 4KWVA 2QCCA 5HQEA 2ACQA 1R7OA 3CO4A 3HM7A 1VFLA 3NA8A 3H2EA 1HGYA 2ZWYA 4J3UA 2PU0A 4BF5A 3VKJA 3VIKA 3AC0A 3L21A 5I02A 2R14A 2PTYA 3GD6A 2ODOA 5K2ZA 1UG6A 4Z0JA 1KM4A 2I17A 3E02A 3CAVA 3AJ7A 4XG1A 4XV0A 3NYDA 3W1MA 1M7XA 5BOOA 1MDLA 4GNJA 5IFTA 1KWGA 3U6WA 3ZR6A 3SCPA 5DT5A 3LV5A 3P3BA 1V0MA 3E0IA 1JZ5A 4RPPA 1PCKA 3TTQA 3SGZA 4REQB 5I77A 3ZJKA 4MM1A 4JY9A 1KBLA 2GQ3A 1A5AA 1PTAA 2NSOA 2YXOA 3CTLA 4FR6A 1K02A 4HPGA 3MPGA 3WLJA 5LNWA 4Y2WA 2J4GA 4A8RA 3AUOA 1UWAA 3H7VA 3DENA 1P6BA 4HCHA 1PAMA 5D9OA 4FP1A 3O05A 3TYEA 2CXEA 3WK1A 3WMSA 2EPOA 5U4NA 4UB9A 1E4IA 2VD9A 2Y0FA 3WJXA 1Y5VA 2RDUA 1FCBA 3L2IA 4A8NA 1VYSX 3WF4A 1Q6DA 3UF9A 2ZWZA 1KWKA 1M68A 3PBMA 2VGFA 3T44A 5EMLA 4NY2A 1KM2A 3OTRA 5HNUA 2Y1HA 4LNCA 3WX7A 4QSHA 4L4MA 4DWDA 1IZCA 1YDVA 1HT6A 1A4LA 3UERA 4UFHA 1Q6GA 3NYZA 3P62A 2E5BA 1UH4A 2WMKA 2GQ9A 3QR1A 4O1EA 2J25A 2OZTA 3H2MA 4RW5A 3GG0A 4MJ4A 3T40A 8RUCA 2AL2B 4KS0A 5A3HA 4JICA 4JIRA 4L6HA 1J11A 3WH7A 1DJXA 3CL8A 3H4XA 2OJPA 2OPJA 5D38A 4DXVA 2VP8A 4ZO8A 4R3UA 3UETA 1OVDA 3N12A 2PP0A 1MUWA 3N11A 4DYJA 1NEYA 4W7VA 1QO2A 4QG9A 2DGAA 2X1SA 4R9OA 5EPDA 2J8GA 2NLIA 4D72A 3COTA 1Q8JA 5DMLA 4B91A 3EOOA 5CAHA 3KFTA 4A2SA 1JG9A 3UGRA 3H2FA 3V0UA 1PHQA 2ZRZA 1HJVA 4ZOCA 3GW0A 1IGSA 3GLCA 4CNPA 4QCFA 2CBJA 4FI4A 3KBJA 4LUTA 1V7YA 1RK5A 1XWYA 3W1PA 3CHCA 1WAUA 3GTHA 3GU1A 2E6YA 2WVUA 4LEQA 1V0KA 4HPXA 3DG6A 4PZVA 2WVSA 1P1MA 1QNPA 3BANA 4X22A 3T4WA 1L6GA 1N55A 2GK1A 1JPIA 3PM6A 1HVQA 1S5WA 3WUEA 3U2ZA 1IV8A 3F1QA 3GNPA 3BICA 4JHOA 1GVQA 4XAFA 1R0MA 3PBVA 1OK6A 4JGDA 5SWUA 2FPYA 4HNVA 4LALA 4UNKA 2FLIA 1LOLA 2A4AA 3N2OA 3W7MA 2EJAA 3I4KA 3M0MA 1M7JA 1OT2A 1DTUA 1R5YA 3S6TA 3MT1A 2J9XA 3O9NA 3JS3A 1PUDA 3CTTA 3TTYA 3IJ7A 2DH2A 1A5NC 3S1GA 1R38A 1F76A 2WQDA 2B31A 5K3VA 1XW8A 1OX6A 4PSRA 3S2MA 2YB4A 1H1NA 1OZMA 4IIFA 1XIEA 2YFNA 3FV9A 1UWIA 2IQTA 3PP7A 1VKFA 1VFTA 4WOZA 2WM1A 3BZGA 3LNPA 1EJRC 3CUJA 1T8XA 4DO6A 1XYMA 4PUEA 1X8FA 3VNMA 4JFSA 4G1NA 1ZJBA 2WC3A 3VKBA 5LIWX 1TA3B 4TIMA 1PEZA 1RD5A 4J7RA 2XUCA 3C0JA 3P80A 1ZUAX 3W23A 1YW1A 3AFBA 4WVXA 2AQWA 3OJGA 4EPEC 2WVVB 1HKMA 2Q8ZA 3R7MA 2JF7A 3AZTA 1C9WA 2AL1A 3DERA 3BGAA 3R4IA 4FMVA 3B06A 3ONBA 1X1ZA 2PDBA 5F1UA 1YPXA 4LCSA 3BLEA 3EA2A 3H2NA 3VE7A 2GPTA 3CV6A 1XD1A 3UZYA 3QHNA 3MYPA 1TJ1A 4DUXA 1UA3A 3M44A 2VR2A 3WK2A 2RHGA 3W81A 3L67A 4A22A 2XINA 4IPPA 2E6FA 4GVFA 3VNYA 4JL1A 1T5AA 3EB4A 3T81A 4HA3A 4CNNA 1SO6A 1TR9A 3B04A 2PDLA 1GVYA 2PDQA 4GA8A 1KM6A 1RQEA 2ICSA 2W67A 4KCVA 4Q8TA 3TWAA 4HSOA 4GIRA 1KFWA 2EPKX 3EEGA 2XFYA 1EYWA 2F2HA 4U28A 3LLFA 3NPVA 1BWVA 4BCEA 3VCCA 2XYLA 4R27A 1W9DM 1A5KC 3UJRA 4CN4A 2G3JA 3R94A 3UWUA 3CPRA 1FXQA 2H6RA 3WQ4A 3NO1A 3A22A 1UUMA 1KGXA 3N6HA 1Z41A 3H55A 4MB3A 4TQTA 1BWLA 1Z32X 4RZ5A 5ECVA 1TV4A 4FLSA 1X8CA 3I3DA 3QZAA 2A3EA 3K1GA 1BYDA 1F7BA 2ZUNA 4F0RA 2LLEA 2HWGA 4B5VA 2I57A 1KO0A 2UY3A 3CU2A 5FJTA 3CZJA 4GQQA 4NU7A 3EPNA 3CIVA 2DZXA 1EO5A 3CZLA 3FYOA 3LZ3A 3OZMA 2QCDA 1F5ZA 1XRSA 3E0VA 2PD9A 3VPLA 1G01A 4Q6JA 2YFOA 1A3XA 5G1TA 1KXQA 3QPEA 1FKWA 1M1BA 1KBJA 4XIAA 4AWSA 3JW7A 3WMLA 4P8WA 1OD8A 1W3NA 4BEQA 1QHPA 4E3VA 2V5LA 4JNZA 1IIHA 1XIIA 3ZJ8A 5AC6A 5D2XA 1ZHAA 2C1IA 3W2KA 4IUOA 4PL2A 4ZQNA 1JPDX 1GKQA 2NQLA 3N2MA 1OWQA 3WSUA 1SZFA 1GJPA 3JVAA 3CYJA 4YIWA 5E0FA 4UQCA 2F6UA 2G3IA 5A5WA 3RDKA 1RP9A 4BWLC 3SY5A 1JF6A 2BVWA 2OZ3A 1KBBA 5CBBA 3CZ8A 2QEZA 1REQA 1VC4A 4LANA 5AHLA 4NUWA 3LHUA 3CASA 1YE4A 2OFJA 3PAJA 3DI1A 2XZ7A 3B9AA 1X6UA 4GQBA 3VK5A 3A4AA 1VFMA 5JBEA 3IK2A 1WB0A 4O8RA 1VGAA 4GCXA 5FEPA 1XBYA 4K7YA 4EWJA 3V1PA 1TWDA 1W1VA 3BSHA 2HK1A 1QFEA 2Z7KA 4P7RA 5HQMA 3WMCA 2ESCA 1SZGA 1KKOA 1YE6A 2OO6A 4JTIA 3SI9A 5JBFA 3NQFA 2V69A 2D0FA 3A47A 1CXLA 1NOWA 3T0AA 4IQEA 4DAFA 3NL6A 3MC5A 3RM4A 5AC4A 5A8PA 3BUVA 3EZ4A 3L4XA 3O16A 4GQ0A 4TVCA 2VUNA 5C9WA 1LBMA 5AHNA 5FIPA 4R34A 4QROA 2VC6A 3KVMA 4LFYA 3OOQA 4FNTA 1K1DA 1KR1A 1OADA 3IGSA 3NTYA 5HNTA 1MUMA 1BD0A 3ZXWA 1RALA 1T40A 3WD1A 1DVJA 4X63A 2QAFA 2WHMA 2W27A 2JGQA 2RKXA 3LG3A 3BCFA 3FOKA 4JTHA 1LG1A 4FOJA 3ARYA 1CXHA 2VUYA 4H8HA 2ZUTA 2UV8G 5DCBA 3NQCA 4E2BA 1Y7VA 3AYVA 3FSUA 3GDBA 1NJJA 4JEJA 3BG5A 4UIOA 1N8IA 3TW7A 1K9EA 4LUSA 4JL2A 3H53A 1FWNA 4AZ7A 1V6UA 3WBEA 3A23A 4C1KA 1CW2A 1TSIA 3TC3A 3ZYZA 4KERA 5CPNA 4YVPA 5HATA 3FHQA 3TXZA 1W5NA 2BHYA 2V82A 2J8TA 4JN8A 3DDMA 4HB7A 1Y0EA 3UP8A 4WXYA 3SCVA 1W31A 3KS5A 2Z6JA 4H6KA 4UMCA 2QJGA 5HXMA 4RR4A 2OXNA 3ZVHA 3KBVA 1ADSA 4PMQA 4GUIA 1LLWA 3NPUA 3VNIA 1X38A 2DZAA 7TIMA 2WC4A 2YKKA 3BXWA 4Q4QA 2PDKA 2HVNA 1OCBA 3EMCA 5EKYA 5HK4A 4K8GA 3WLHA 5BXPA 4IJCA 3RGTA 3E5PA 2J7DA 4ADTA 2NWSA 2J88A 2VD8A 3GNOA 5CZSA 1LLOA 3W24A 4HKPA 2JGYA 1UR9A 3MP4A 2Y7EA 3ZOAA 3AMLA 1EGMA 3IGXA 4WD0A 4ZB2A 4HP5A 3CIXA 4DB7A 5LIKX 1LOSA 1BKHA 3DHUA 5LA1A 3LX9A 3MSGA 1JUEA 4Y96A 5KZDA 5IFPA 4TV6A 3MSRA 2V3FA 3VGGA 3KP1A 3QLLA 1UMYA 3H7RA 4BEUA 1Q7MA 1AH4A 4W93A 4ZO7A 4IG2B 4ONVA 5IBXC 3W87A 2Q71A 3BAYA 3THUA 2D73A 1RY8A 1UMLA 4Z2JA 4ZMGA 1OGSA 4RNJA 1CTNA 3R2GA 2DIEA 2PDGA 4XTIA 2JKAA 1JJKA 4IMDA 4HNUA 2XSBA 1MW2A 5H1WA 4WJ8A 4DJED 4MAVA 2KZHA 2DT2A 2NX3A 4N0RA 3LCLA 3KWXA 3UJFA 1EDQA 1ZRQA 3YPIA 3ITLA 2QV4A 3AYSA 3RITA 3PBWA 1K9TA 4A8IA 3DBNA 3M07A 1OFEA 1DBTA 3S47A 2PBGA 3VD5A 1UHVA 3OZOA 4WUIA 4O19A 4XZBA 4LAMA 4GK8A 5LIYX 1VEPA 4PUUA 4GFSA 4H83A 5IHRA 1E4MM 3WBWA 1XLBA 2C14A 4ACYA 5H8MA 1PX8A 1H4PA 4IH3A 5C9XA 1P0DA 2Y4SA 4B9ZA 3MDWA 1EL3A 3KL0A 1ITQA 1J79A 3N13A 1G9HA 1PYMA 1CT5A 3K4WA 4LAUA 1MZHA 2GWNA 1UJQA 2XJ7A 2DZVA 4R33A 3KOYA 4LF1A 5CC7A 4PBGA 3ZFHA 3T0DA 1UOZA 4XUYA 4RX0A 4M1RA 5IHSA 3WLQA 4IPNB 2Y61A 3QYSA 1OG6A 3L12A 3BOXA 4KESA 5FACA 4UTWA 1AODA 4GJ1A 4JIEA 3OBEA 1R7AA 2YYTA 4NAEA 1EXBA 2DSUA 3BPWA 1NELA 3AROA 2BDQA 3WF2A 4D8AA 4IL2A 3CV2A 1XL9A 3DCPA 3VGBA 3CIWA 4GJJA 4OOZA 3TCEA 4UQEA 4FO4A 5EFDA 1BGGA 2WZMA 2I1OA 3GFXA 2HBXA 2OR2A 2NQZA 2PDIA 1I6NA 4UQDA 4IFKA 4WKAA 4FALA 4NJJA 1MVYA 2YPIA 4LRTA 4I7VA 5AYXA 5DF0A 3SSZA 3WQPA 5E0KA 2XIBA 1VEOA 2E1WA 3HV9A 1EXPA 4IIDA 5DELA 1WOBA 3K1DA 1TJRA 1CX9A 3APTA 5TAOA 5GVJA 5AN7A 3T4CA 5FJPA 3ORWA 3FGCB 1KFBA 4IJBA 1DKWA 3F4CA 4EOUA 3CHDA 3K30A 3UCDA 2DQXA 1MRQA 1NQKA 2BLEA 5A95A 1B9BA 2V30A 5XIMA 1VFSA 2FDSA 2PLMA 2PTDA 1HVXA 3S2LA 1RJQA 3W72A 3DZ1A 1H5VA 1K9FA 1EFZA 5AHIA 1EUAA 3IUIA 1XI3A 4UTFA 2E8ZA 3E2VA 5MKGA 4HZMA 3UXDA 3LGEA 1FP8A 3VNLA 5IOBA 3TR2A 1KXHA 2VFHA 2QIWA 1X7IA 3IV8A 2OEMA 4EE9A 5C5YA 1JCMP 1NDYA 4OWGA 2YA0A 1OFAA 3MWCA 3OO2A 2HQAA 1G1YA 4D6CA 3N3MA 3D6NA 2X7VA 2EAWA 2IKIA 5LNRA 2HCVA 3OG2A 4GY0A 4L64A 1FWAC 1LDCA 1YBQB 3SM0A 2XN2A 2YLLA 3JUGA 2ZKMX 4LUIA 3NG3A 1AK5A 1IXOA 5EMYA 2XTKA 3OODA 4IG2A 4XKYA 2XH7A 3L0KA 1OC7A 2UWFA 1DXIA 2Y63A 4O0KA 3T08A 3UY7A 4KRTA 3GKAA 4G7FA 4AF0A 2CHRA 4QNEA 1VEMA 4S3EA 3I65A 4UTWC 4FOKA 4AH7A 3F5JA 1QK2A 3ABOA 4ML4A 4DJFD 3W2NA 3VGDA 1CB7B 3IRDA 2V68A 3ANUA 1V03A 4YNGA 3L0GA 4O10A 2P3EA 1N8WA 3WIJA 3L5MA 3EBVA 5MHBA 1L2UA 1J18A 4LT9A 4JCLA 2VL4A 4AY7A 3NIYA 2YDQA 3ZJ6A 3KTCA 5E70A 1LRQA 1D3CA 4GC4A 2Y6ZA 2PDFA 2YDSA 2D20A 3OLIA 2R82A 4AY1A 1HGWA 2ZUMA 3KRUA 5DANA 1UWQA 2HS8A 4XQ6A 4TVDA 4NRSA 3MO4A 4K37A 1S2CA 3PSWA 1H7XA 2YBVA 4ZZ9A 4BI7A 2QUTA 1HKKA 4DO5A 1S1PA 1W32A 4HMEA 2MANA 2ZADA 1TQJA 1L6FA 3HGRA 3OW1A 1FBAA 1W17A 3UCQA 2PDCA 2WMIA 3HQNA 4MJ2A 3RU8X 3LS9A 1NWRA 3BAIA 5F2MA 1H0IA 2PUZA 2Y5SA 1TTPA 2QDDA 1VLIA 3SEPA 2PDNA 4HK5A 4U5IA 4EAMA 1E1EA 5FEXA 1BHGA 2VC7A 2OTDA 3GR4A 1O1ZA 3P0XA 1IR2A 2NT0A 3FXYA 3TQKA 1GW9A 3CHFA 4A8LA 3UWEA 1NF0A 2V2CA 1EH9A 3QXBA 4LUYA 3N29A 4LU0A 1UIPA 1W3TA 3W75A 1M03A 3H23A 3PUGA 2NXHA 2DSZA 4IICA 1WBHA 3J7HA 5FI8A 3MKCA 1YNPA 5IM51 3LQLA 4MY1A 2B7QA 4JYDA 3DFQA 3U0HA 3WBAA 3PB0A 3CEPA 4FLRA 1QOQA 3C0LA 4IFKB 5I03A 2ZQ0A 2O9RA 3WDRA 5LHFA 3THDA 1QPQA 3NDYA 3TQPA 3MMUA 2Y8UA 5KEZA 4FS9A 4Q4RA 1YPFA 4MKSA 3PC0A 3NOYA 1A3HA 1FWTA 4YS1A 3VILA 1QPKA 1JGMA 3QY8A 2PD5A 3B8VA 3WQCA 3I3EA 3FDGA 2ANUA 1X1NA 2PDWA 2CESA 3PBYA 1ONXA 3N4AA 4IL0A 1HJQA 3VMOA 4DNHA 1Q7QA 4ZOAA 3E49A 3AZSA 2FGBA 3UJEA 3TA6A 4PB3A 2BOEX 1CWYA 1L0PA 4PMNA 3MMWA 5JQ9A 3ZVHB 2P3ZA 1JZ4A 5KZ6A 4QJ4B 3CBWA 2Y24A 4MFDA 4QBXA 2DSVA 1OYCA 2OT1A 3E0LA 3EX4A 6ENLA 4NSBA 2A2IA 4NYUA 4HZ6A 1AQFA 4WY0F 1IYXA 1GVRA 1Z9AA 1C92A 4IQLA 1YEYA 4FPSA 3PTKA 2RDWA 3OQ8A 1N7KA 4U31A 4N6EA 5A8QA 3MU7A 2C1HA 3TC7A 1MRAA 4CCZA 3B0PA 3WLLA 5EGRA 2BV9A 3DI0A 2J66A 4S38A 4XBJA 3MB9A 3T07A 2AMGA 1QCWA 3GS6A 1QBAA 2PLCA 3IRSA 1P6CA 8XIAA 1TUFA 3VD9A 3CHEA 3GM8A 5CC6A 4Q4OA 4QHRA 4Y8FA 4J27A 2OB3A 1Y5XA 4ZCWA 3NQ6A 2BZNA 2IS7A 3SRFA 3QKZA 5CZJA 1ICSA 1I0BA 3AU6A 3ANVA 1PE1A 1KC7A 2WLZA 1XLJA 1JYNA 1GCYA 1FP9A 4CCEA 4YN5A 1K3UA 4HBKA 2Z25A 2CITA 3SY8A 1TX2A 2J9YA 3NXFA 3OIXA 1IE7C 3FJ6A 3NZPA 1WPCA 2XFRA 1C9DA 3GC5A 5D30A 2NV2A 4DZAA 5K9DA 4MF4A 5CH9A 2FQIA 1HP5A 2Z1XA 3ZLGA 3D3FA 3ITVA 1GQNA 1XLHA 2WM0A 1VLWA 3CQHA 3OZPA 2WVTA 1S38A 4Y9AA 5D9NA 3IS4A 3UVIA 1TRDA 2QDGA 4J5NA 4OBTA 4PGLA 4GVGA 1GKRA 3GHRA 1MEWA 3CLWA 3UR5A 1C7SA 4QAWA 2PA6A 4GUJA 1ODZA 1TCMA 1L6SA 4G5DA 2XFWA 4MFEA 3W29A 4F8XA 4OOUA 3B8IA 1UP3A 4WKFA 4JD4A 2YL5A 2ZRUA 3T6CA 1ITUA 1PB0A 3QQ0A 4UQBA 4EPDC 3DHDA 4GYJA 3CT7A 4B2DD 1Q8AA 1XLLA 3PPHA 4J35A 2I16A 3ZSTA 3OA3A 4PCPA 4S3GA 2ADAA 3VI2A 3VGHA 3WQFA 3R6IA 1W2PA 3F5KA 1H62A 1US0A 3GUWA 1F61A 3KZPA 5LIUX 5JMUA 4F0MA 4UC5A 2YSWA 3VC5A 4R7OA 2XG9A 4Q4SA 1R2TA 3RRXA 3SB0A 5F2GA 4YWIA 1ICPA 3FLUA 4CCCA 3TUUA 1AJZA 4GGBA 4P2VA 1VFOA 1YNYA 2Q6ZA 3QOKA 3T9PA 3VX0A 3PZQA 1JDFA 3PJXA 2G4FA 4UTIA 2HEJA 3PF3A 3N9SA 5K7JA 1WNOA 4QLKA 4ZEPA 2B4GA 2CLIA 4QTGA 4XVEA 3RYSA 3LK6A 2DZTA 3FNDA 2X40A 4HA1A 3TQVA 3AHYA 1TWWA 1IZJA 1SW0A 4UXDA 1WKDA 4Z2GA 1K4GA 4WGXA 5CPTA 4FIQA 2PAJA 4NG3A 3UXIA 4C6CA 4ZODA 4IQJA 2VHLA 1UYQA 3C2VA 4H4IA 3QGAC 4IP5A 2G37A 4K1WA 3WLMA 1JXKA 2VEGA 1RV8A 3RR4A 8XIMA 4C5YA 4L4OA 5D32A 5D8WA 1JQXA 5JVLA 2WJDA 4YMZA 5D05A 3TLQA 4QDWA 2WBKA 1QTWA 3AXMA 4W7WA 2V6AA 4S3FA 2BHUA 4POCA 1VP5A 5HWJA 1GHSA 3S2NA 5HMDA 4LVAA 2Y88A 4I90A 2OWWA 3P0WA 4JTFA 1B0IA 3KM8A 3LLDA 1X98A 1LT8A 3AOFA 1XKJA 3AISA 3CWNA 4JQ2A 5BRQA 1ZL1A 4NASA 4C7GA 1RCQA 3DFYA 1QPOA 4AEOA 2POTA 1OM0A 3I6TA 3CO8A 1IQ8A 2QVHA 2XU2A 3F4VA 3M0YA 3N4FA 3K13A 3UVAA 4Q32A 4ZQPA 3SJNA 5AZ1A 4K2SA 2Y7FA 1EOKA 3W84A 1JXJA 2E3ZA 3W7OA 1G4PA 4FNPA 2W79A 4NZ4A 4W5ZA 3LCWA 3GTNA 1V6WA 4M19A 1ZNNA 4F2UA 1DWIM 2ZE3A 3FVMA 4QISA 1FWEC 5D33A 1E9YB 1QHZA 4KIEA 1H51A 2RGLA 5A6BD 1UW9A 3S2CA 1GZGA 2AAAA 3DHPA 1RCXB 4O17A 1KRBC 1FWSA 2OQLA 4QEEA 1E0VA 3GO2A 4YVVA 3W74A 3WZ0E 4I5RA 3GW3A 1NP2A 4EKJA 1O60A 3ARTA 5I24A 3MCMA 1TQXA 1VPYA 2E4TA 4GJIA 3MV01 1TV3A 3ARXA 1A5SA 4AEEA 2EEXA 4AW7A 3OHMB 3I3BA 2CNCA 3H54A 4XWUA 5EY5A 1R87A 1IXNA 2Z28A 1B9ZA 1VFHA 4J3TA 5JBDA 3BC9A 3M47A 3LI0A 3IUHA 5BOFA 4WRHA 3M0VA 4O11A 4KCTA 1W9UA 4AHQA 3BWWA 3AIBA 2Q8LA 4Q8UA 2YCLB 2VFIA 2DW6A 1G94A 5DMMA 3WQVA 4UTTA 3C61A 1EQCA 1FFQA 6REQB 5E6ZA 2VNCA 3G18A 1HIZA 2WCGA 4HPJA 3BQ6A 1RQBA 2V2DA 1B4KA 3O1NA 3V16A 1B90A 4AZCB 3OP2A 5CSSA 2GUUA 3M5XA 3ZZ1A 4Y9PA 3RNDA 3LA4A 3QFEA 4E5TA 4P8UA 5C6MA 3CUHA 3R11A 3GU2A 5JH2A 3EX6A 4WKHA 1E4NA 4HN8A 4CLMA 4Y9OA 4GACA 5LXXA 3VU2A 1CEOA 3RLHA 2FZMA 2Z1BA 2PRLA 1XC6A 1MQPA 3MI6A 2CIPA 1A47A 4O16A 1UOKA 3NQGA 1L9WA 3LBMA 4BQ3A 1XG3A 4GGHA 1TKKA 3W7JA 1BFNA 3AIRA 7PTDA 1YMYA 4MIMA 2IPJA 1GZJA 2PE4A 5FF3A 3U2EA 1UD6A 3EX2A 1DWFM 2F2KA 1MW3A 3FKRA 3W7KA 2CKSA 3QPZA 1PCWA 4NJHA 2E25A 4O18A 4B16A 4JR5A 2OVLA 3PN8A 1XBVA 3U4FA 1S3HA 3CJPA 3CH9A 3RPTA 4W87A 1I8JA 4DM2A 3ZJ7A 2PDMA 2OEKA 4QE5A 3PHAA 4AIBA 3CK5A 3B8DA 5GJPA 3UD6A 1JCLA 1R8LA 4DWSC 4J9JA 1MFUA 4O1BA 1HN1A 3PZGA 3K8MA 1NFPA 1EB3A 2XH2A 3CL6A 3S0CA 1TYGA 4MUZA 2E09A 4L80A 1NFBA 4J2MA 4INFA 4XB3A 1OFQA 3N34A 4NAEB 3TN6A 2DUZA 3RPMA 5D9MA 2GSHA 4FF5A 1GONA 1U22A 4LQ1A 4ACZA 1VF8A 1OBAA 2F38A 4A3UA 4MWAC 3LLXA 5D03A 3DN5A 2O9TA 4K7VA 4MWAA 3NQEA 2PGFA 1J8VA 4DHGA 3TNBA 3W3OA 3TYBA 5PTDA 3W25A 3UFYA 1K9DA 2J62A 3IIZA 2NVDA 1PZ2A 3FS2A 2OOGA 1W54A 4CD7A 3G6MA 2ZC1A 2GYIA 3VE9A 3PZ9A 3OA5A 3MANA 5DY3A 3R25A 4HK7A 3AHTA 3ZLFA 1J10A 3Q94A 4CQCA 1V0LA 5KITA 3IJQA 5K9XA 1DJHA 3S3GA 2YLAA 2PZNA 4IWWA 1US2A 3MVTA 4H9YA 4B5XA 5AC7A 3BTNA 1PIIA 3M46A 5IDIA 9RUBA 4QS5A 4H9MA 5EMKA 4AC7C 2HPMA 1VJSA 4LVDA 2F9RA 4ZFCA 2IUZA 3GAYA 3VM7A 2XH0A 3TYZA 2YCKX 4A35A 1WZLA 1M6JA 5HBFA 2YW3A 4WHBA 1S5TA 3TW6A 2ZUVA 5D02A 4F66A 4WF7A 3EWBX 3RJYA 4KKXA 4PMRA 3UG5A 1ONRA 3U8GA 1ZAIA 3MI2A 1V3LA 2VC5A 4WK9A 1BTCA 4GABA 4PUWA 3M5ZA 4YYCA 2C7FA 1W91A 1JF5A 3H4GA 4XTDA 3V3WA 4HU0A 4ACZB 2WCSA 4I3GA 1NWTA 1Z6KA 4FEZA 2YZ5A 3MA8A 4FXJA 3EOEA 4LC6A 3R5EA 1SFLA 3POHA 4G56A 3WLOA 4ZQRA 2FJUB 2QYGA 3NUKA 3T2QA 1ZBWA 1ZPTA 1QPNA 3KL5A 3LBCA 1ZFJA 4XZIA 4HPHA 3HO8A 3LHWA 2BOGX 1H1YA 2AL2A 1VBJA 4QP0A 4YHEA 5ABEA 1QR7A 3BLDA 3PZTA 5HMFA 2VRKA 1ZJHA 2R8WA 3EKZA 2ZUWA 2YCIX 3DC8A 4PBFA 3GNXA 2V3EA 4R9XA 3I68A 4KBXA 5D2YA 4MADA 4C5ZA 4M3PA 3E1F1 2CU0A 3ZT6A 1GQJA 4JS3A 1JYVA 4MJZA 1TUXA 2XWDA 2E6DA 4LBRA 1EC8A 4H3DA 3SQSA 4LAKA 1O5KA 4QSFA 3E12A 1Z3NA 2GUBA 4HPNA 5HUPA 2VR5A 2ZA1A 4LPCA 4X2PA 3FHAA 3KHJA 3KOZA 4RV3A 2PGEA 3ABSA 4DJFC 4W9TA 3UZJA 4ZQCA 1RZMA 3T0CA 2C0AA 2X0SA 2A3HA 5CG7A 1NP0A 4ROQA 4PC8A 5C2GA 3D46A 3EAUA 1RVGA 4H6QA 2R1MA 4E2OA 1GPWA 1TMLA 3CWOX 2WV8A 4DXKA 2O9PA 3EX3A 2QJHA 1A5OC 1XIBA 3UG8A 1SZEA 1A0DA 1WBJA 3MHGA 5DMNA 3ALFA 1D8WA 4GYPC 1WDPA 3LBOA 5M2FX 1GVEA 2VI0A 3RMJA 5DCDA 5C7HA 1T6MA 3STPA 2WZHA 1XLKA 1O68A 4NHVA 4W84A 3W6LA 3G1AA 3A12A 4IF2A 3F5LA 3JR2A 5HUOA 2JKPA 1HW6A 3EB2A 1ZP4A 4XD4A 2WSKA 4NYYA 4HIBA 3PS7A 5CC3A 1TO3A 1Z48A 3DESA 4L9YA 3FAWA 4KWWA 1P4CA 1XLMA 4JDYA 2EF9A 2H9AB 3BGGA 1SUXA 3B05A 3VKAA 4IIHA 4AMAA 3HPAA 4H01A 3EB3A 4LEFA 3ZQ9A 4E4UA 1UH3A 3HU7A 1H61A 3GE7A 3WLTA 3NL5A 3ID7A 1ZBVA 2MUCA 1LWJA 3S6DA 5I79A 4GD0A 3UJ2A 1OF8A 1K8XA 2G3NA 3CB8A 2YZRA 3Q4DA 3WCZA 2I7GA 4AG0A 1PX3A 4X0NA 1E3XA 4J3ZA 3SJ3A 4H6RA 3H4WA 5HPOA 3POCA 1H09A 2F84A 1ISWA 1Y5WA 1K77A 2ZA2A 2ACUA 5I5RA 4U4MA 3C2YA 2WZTA 3CC1A 2WPGA 1DIOA 4NX0A 1D8CA 2B81A 3BW4A 2JKEA 1CENA 3U3HA 1B3ZA 4MPKA 4WR3A 1ALDA 3BMVA 4PCTA 3W1RA 1XGEA 5CAKA 4X60A 5T91A 2TRSA 4M7SA 1L6WA 1W3LA 3TJXA 4GC3A 3R8RA 2D69A 4H04A 2NV1A 3R8GA 3U57A 4NVTA 4GG9A 2DVTA 2A3CA 8A3HA 5FA5A 3VDGA 4LYKA 3BGJA 2G0WA 4GIAA 2JFEX 4MDOA 1XIMA 2EG6A 4GWEA 1F6KA 2EGZA 3R12A 3MTWA 2DJLA 4DXXA 4FF7A 1G67A 4ZO6A 1HKJA 3NDZA 3S5NA 3VMPA 1JDAA 3H2AA 5ENLA 2WLYA 2ZZ2A 3VIFA 2HS6A 4M7TA 3IIOA 2Z1SA 1JIBA 3F2BA 3RX2A 5A8MA 1SZNA 4CU8A 3S5YA 4MKNA 3VIPA 2FB3A 4C60A 4GYKA 5I3DA 3JZEA 4EF9A 1XS2A 2WQPA 2QUVA 3EMQA 2WPBA 2RGMA 4H41A 1B57A 3H7UA 3W0KA 3INPA 1CI1A 2ZE0A 1GEHA 4KFOA 1JNDA 4S39A 4NJKA 3ABZA 2QJMA 1SQ7A 4NQ1A 2W4XA 2D23A 1UCWA 1UR0A 3NO5A 1OF6A 3AS3A 1EJWC 1QW9A 1BVZA 3GXTA 1FWFC 3CGTA 2GK1B 3G3MA 4NZFA 4UTMA 4GY1A 1PBGA 1TIWA 1Z69A 1XLFA 4GHRA 1XV8A 3UU0A 2PDHA 2FVMA 1IEWA 1D7FA 3HTWA 3RF9A 3HB9A 1D3HA 4XAZA 1H50A 3QMRA 1QHOA 3SCSA 4UZSA 4HYWA 1GTEA 1CLKA 1SJDA 4RXFA 4F40A 4ZSUA 3TSMA 3WH6A 3K8LA 5LYRA 4IGHA 3LM7A 3N2XA 2DSWA 3FYPA 4AD2A 3IANA 3THAA 1TPB1 3VXGA 2INFA 3AIWA 1O6IA 5EMUA 2C8NA 4ZBCA 2Z2BA 4EF8A 1JUKA 3AHVA 3NL2A 4YTSA 3BSMA 1NU5A 3BLLA 4R5EA 4D6IA 1S5MA 4DJDA 1SZRA 4U10A 3W83A 2B7NA 2QAPA 1TG7A 1UP2A 1XR2A 3RAOA 3F03K 4ALDA 3EWWA 2REQA 2FB2A 4DELA 5HA7A 4TX6A 5DEZA 2JE8A 1DWJM 2YDRA 3GHUA 2Y2WA 2WB5A 2I9EA 4G2DA 3NEVA 3PUEA 1A80A 1ZS2A 1MEIA 1B31A 3HQ1A 1XC4A 5GNXA 5FSDC 4AUBA 1EC7A 2ALRA 1YYAA 1A0EA 2QQ6A 4JIQA 1VENA 3FGCA 1QNSA 2D1ZA 3GYCA 3LUTA 1RQHA 3TN4A 3TMQA 1SFJA 2PWUA 2IKGA 5D09A 3VAVA 1GQLA 4EAYA 3XISA 4JBRA 4M1BA 4OQVA 4GI6A 5A2CA 1AQ0A 1BEUA 2PODA 2WMFA 3LHTA 3ARZA 4WLCA 1JDCA 1T8QA 3O7UA 4JTUA 1G4SA 3BURA 5HJLA 3ICJA 2PWDA 2ZICA 1RR2A 1V51A 1EIXA 3LMYA 4LBSA 1SO3A 2GGEA 1E15A 1JD7A 1F74A 4GX8A 3N4EA 2E9BA 3RCYA 1E6PA 5G1MA 1G4EA 4UWMA 4QG8A 4QCEA 5LGXA 1AD1A 2V81A 2CW6A 2IPFA 4GUFA 3T2PA 5HR7A 1F73A 1P6WA 4J3XA 4HNTA 3AMGA 3GKFA 1F6PA 1VCFA 2WMIB 3QV8A 1FHUA 1JPMA 4KIRA 2Z27A 3MUAA 5LSMA 3QH2A 4H00A 1Q13A 2ZRVA 3KTSA 2VURA 2NVCA 2BP1A 2J7EA 3S4TA 1TB3A 1XYFA 1H60A 1OC6A 5A6TC 2R94A 1UR1A 2A3AA 2OOFA 3DG7A 1M01A 2GWGA 1K03A 3BLFA 4PUKA 3REQB 3PTDA 4S3AA 3LGGA 1QNQA 3K8KA 4FHAA 1XLGA 5CBJA 3LTPA 4AQLA 3W7IA 1EF3A 3LYEA 1J2BA 4US5A 1K8ZA 5BRBA 1RA5A 2FZ9A 3RLGA 4A3YA 2BBFA 4G6CA 5K4XA 4A05A 5KTLA 4G8TA 3TEVA 4PTXA 1GOMA 4BKNA 1E56A 1V3MA 4D6HA 4V15A 4C6DA 4N2YA 3GR7A 4Q8OA 5DY2A 2GVJA 2VDIA 1UPMB 1X1OA 5DLCA 1TCDA 2QCMA 3UWWA 3FSTA 4D71A 2XN1A 4IX2A 3KXQA 4CD4A 1EQPA 3BMXA 4QE4A 3SCRA 3WLPA 3GFYA 1L2QA 3P14A 4HTBA 1NVMA 3QMSA 3HIJA 4CCDA 5U7SA 1XIHA 4K6AA 4XZLX 1UPPA 3M0XA 2V5CA 3O07A 4KFNA 3ZIZA 1U1HA 5CJMA 5G1YA 2FZBA 3VM5A 2XM1A 4PMUA 2DSKA 4CNTA 4Y8EA 3QQWA 2BXVA 1SJBA 2CKRA 4IISA 3VX1A 1KGUA 2CPUA 4GZ7A 3M9YA 5AOUA 1XQLA 3NR0A 3N2BA 3WEOA 4FNSA 3EWZA 4J28A 1UA7A 3DFSA 4ICNA 4J4KA 3R58A 1OINA 1OB0A 2OX1A 4C1LA 1YXDA 3H8AA 2FH6A 3I7SA 4KETA 1ELSA 4DJDC 1RPXA 4LVGA 4X2RA 2Z1KA 5KINA 5BRPA 4A29A 4AWEA 4FX6M 4GZJA 1YLVA 3NQ7A 1Z8AA 3WDHA 5LNSA 1DHKA 1XDJA 3NSNA 4PBEA 1ZBKA 3SFKA 5H91A 3BV4A 4RPQA 4BFAA 2F8QA 1TRIA 1OABA 3FJNA 4NZ1A 4NNCA 3SGGA 4DF1A 2TAAA 2WNNA 4BS0A 2OG9A 1POJA 1JI1A 3OLDA 3W76A 4GPNA 3RM9A 4J40A 4K8EA 1J0JA 7REQB 2VFFA 3W7QA 1Q6OA 1QMLA 1UIOA 1XUZA 5BW6A 5HANA 2YIHA 1J2WA 6ALDA 4U33A 1G4TA 2HTMA 4K3ZA 3TYCA 1U5JA 2G8ZA 3C8NA 3USZA 2X7WA 3DH7A 4MG4A 3CAKA 3EWDA 4ILSA 4JKLA 2ASHA 4H9UA 5CJ5A 4CQDA 4JTTA 4LB4A 4CD6A 2CLLA 2XIMA 3W26A 2JQXA 4Z1BA 3MV11 5I3FA 4NZ5A 4O50A 4OTKA 1VBHA 1YRRA 1BXBA 1N2VA 3BOFA 1XYZA 3T1GA 4P7OA 2C79A 3GZAA 2X09A 4C1NA 3LRLA 2HJPA 2VYOA 3RJXA 1LUCA 1HKIA 1B5TA 5J8LA 1F3EA 1QOPA 1J0KA 3AALA 3F7JA 1E1CB 3HG3A 2I9UA 1TZ7A 2DZPA 3NZRA 3WD2A 1V02E 1Q4WA 1J6PA 5M17A 1TPUA 3GTIA 1TWSA 1BGAA 1FDZA 1E9ZB 3W1AA 2EPLX 3VDHA 4JTEA 1GORA 4MWAB 4EANA 1UWSA 1EA0A 4L5ZA 3NQ2A 3PPGA 4FLQA 1GOWA 3DFPA 3W2UA 3A3XA 1QI3A 2VEFA 3QW3A 4QAIA 1Q6LA 1EJSC 2Y7GA 3L66A 3WLRA 2E5CA 1ZCCA 2E9MA 4ZXLA 5C55A 4BQ2A 1XINA 1C29A 2EPHA 4MNLA 4H7ZA 1LCOA 1RPKA 2D24A 4RZBA 1GYLA 1UWUA 1CXEA 1R3QA 2ABBA 3L5AA 4HHLA 1D2KA 4JKMA 2WHLA 2RUSA 4O0QA 1K7XA 2GGJA 1Q4NX 2CLPA 5I3IA 4UTJA 1CGYA 1JRCA 1LRNA 3MDUA 1RJPA 3C86A 5I6SA 4M24A 1KCZA 4Q8VA 2Y5JA 3A64A 1CGUA 3KAOA 1AL7A 3NGJA 2WSRA 4MB1A 3NWRA 4JQ3A 4FLOA 5A8OA 1WKEA 5F4SA 4DYKA 3C8FA 2G97A 4HHPA 1FOBA 5BXRA 2WSYA 1FRBA 1GOQA 5FSEC 2Y62A 4DM1A 4GH1A 2UY4A 1EJTC 3CZGA 1IT8A 3WBYA 2W91A 3B4UA 5CSUA 4Y7EA 2UBPC 5FL0A 2FYMA 2RH9A 4HD5A 4BA0A 2QPSA 2V5BA 3FVDA 2JF6A 1CB2A 5AY7A 4AX6A 4ZQOA 1WXZA 4A3HA 3QZ6A 1DJYA 4W8AA 3CMFA 3JU2A 3OGVA 4WJEA 4DJFA 4KGLA 4NRRA 2EPMX 2YBTA 2ZA3A 1JFHA 2FVLA 1KFCA 3GDLA 1U33A 2XIJA 3MUY1 3GHTA 4Y6GA 3DHFA 4NI3A 3FCPA 2YA2A 1GPFA 3G0SA 1YDYA 3P61A 3PAOA 4KWSA 2Q01A 1WV2A 1QWKA 4WOQA 1KLZA 5CPOA 1W1A1 4RZ6A 4DJEA 1QOXA 3IVTA 2AAMA 4GVHA 1Q2SA 1Z89A 4AXKA 2DP3A 3L7RA 3MZ2A 3SR7A 1JR1A 4O4WA 3PWGA 4Z08A 3WUFA 3WQWA 1IHIA 5T26A 1E9LA 4MWAD 1OYAA 5HJXA 1JDEA 4LV9A 4UTKA 1UD8A 1ZAJA 2X42A 1JAEA 2XFFA 4NP7A 4ZVJA 3ARVA 1XDLA 4Q22A 1IIGA 2ZVIA 4UR8A 3NQVA 2DVUA 3TVAA 3KL3A 3NQDA 4XZ9A 2L5HA 5C9UA 1DIKA 1V3KA 4K1GA 1JYWA 4F9JA 3EKGA 3UJSA 3ARWA 4S23A 3APGA 3MUXA 1BVWA 1WDRA 4I9TA 1H2JA 4PTDA 3ZMRA 1ECQA 3GUGA 1V6TA 3B3DA 4ZFMA 3BLIA 1P0BA 3KDNA 2ZXBA 3UNTA 1F3WA 4AY8A 1P5BA 1C7TA 1S1RA 4PCFA 1MNZA 1KXTA 2VO5A 3AXKA 3TTEA 5CKSA 3SCNA 3NJ3A 3GXIA 5AFDA 1VBGA 3CT2A 1MNSA 3NNTA 5I3KA 4JYFA 3A4JA 1JPKA 3MJMA 3N15A 4O4VA 4OZOA 3DOPA 1TPVA 3IAPA 4WJXA 4O1CA 4IMCA 1LQ2A 1UQYA 4JTDA 4FOUA 3O0KA 1HNYA 2PSNA 3VNJA 1MW1A 2VMFA 1ITXA 4Z2IA 3QOMA 3LTSA 3GVQA 4N9CA 3FKKA 1REQB 3Q37A 3LSBA 4I5UA 1MSSA 1TPC1 2OO0A 2V0TA 3T0TA 3SDOA 1RK6A 4G9PA 4AX7A 1T0OA 3FEMA 4E0CA 4BZYA 4IUGA 4E8DA 3LI1A 3WKZA 4C6JA 5T9CE 5JH1A 3W7PA 1R3VA 4D6GA 2WZEA 3IVSA 1B3VA 3B8SA 4B5TA 3GVWA 3LRMA 3VNKA 2GOUA 3WQ8A 3T8QA 1B4EA 1TZZA 3G6LA 3NAVA 1DP0A 1FCVA 4CVUA 3DKJA 4AHOA 1VRDA 4HU3A 3VGEA 4L9ZA 1EEXA 4Z1AA 5FAJA 3RU6A 3GFZA 1LBFA 4Z17A 1RH9A 2ALDA 1SR0A 2ZX9A 4AZBA 3MP5A 2C0HA 3NOEA 1CBGA 5CPQA 4F2BA 1TE1A 2R1NA 4ZA0A 3QQ1A 1P1XA 1C8VA 2WMGA 1GG0A 5XINA 1XSKA 4W89A 3MHUA 4QX4A 1FH8A 3PFMA 3UGVA 2ISDA 4OVXA 4RJEA 3TXVA 2ZC8A 2ZZ4A 3WF0A 1GJWA 3TZFA 3G1FA 3PK7A 3SAZA 4A2RA 4JAWA 1LL6A 1X7FA 1HX0A 2WKJA 1BF2A 1W5QA 2VEPA 4PEEA 3ZSSA 3QHOA 4EXAA 1WE5A 4E4PA 1DWHM 4HYRA 4GKLA 1EWEA 4GUHA 3AJXA 5I07A 1HKVA 1E6ZA 1BQGA 1ZSXA 1DPMA 2FPTA 4PSPA 1G6CA 2DZBA 1XUUA 1CDGA 3SRKA 1R3TA 1I2OA 1E72M 1CGXA 2NQ9A 4JOMA 1FXPA 3SO7A 2PWHA 5CLTA 2XDFA 2VR4A 3SCUA 1GTHA 2NQHA 3G3DA 4MOZA 1OX5A 4MLRA 5FKYA 3A3WA 4MNJA 3W86A 1VZWA 1I4NA 1VQTA 4W5UA 4XD3A 1J93A 1KFKA 3TV8A 3VOGA 1FKXA 5LA0A 1BRLB 2H3DA 1P0NA 1XD0A 3QY6A 4JDBA 3NZQA 1WDDA 3BK0A 3ZLHA 1PZ0A 1FWBC 2XGIA 3QC3A 2OYMA 3E6EA 4MGGA 4GUGA 4GISA 4GXMA 4ZXOA 2ZOXA 1ZJAA 1JD9A 2CC0A 2XN0A 3BG3A 1F05A 3RILA 1LUCB 3U2CA 2E1DA 1C8YA 2O4MA 5J04A 3G1SA 2Y8VA 3GRIA 3M0JA 2J7GA 1EGVA 1F3TA 3M0ZA 1JVNA 3TX9A 3HMCA 1V3HA 1QRQA 3ITYA 1XDMA 5JU6A 3P93A 4CQAA 3LDVA 4XUGA 4I5XA 1GK8A 1RCOB 1D9EA 2GJXB 3MSYA 3TFCA 4C6IA 3M6YA 3ES8A 2VOMA 1H7RA 1Q65A 1XKYA 2J7BA 2QNEA 1FWGC 1S39A 3W1LA 4A4AA 4QITA 5HWMA 4LYRA 3CV7A 4C7DA 3WL1A 3FA3A 3W53A 3FIGA 3GIQA 3E9AA 1AH0A 1RLDA 3W38A 3UG4A 2WK2A 2FZDA 3ENLA 4HK6A 3PSVA 3O3RA 1AZ2A 3UWQA 2A6LA 1ZALA 3WDPP 3VC6A 4L6OA 2A7NA 4B3ZA 1UKQA 2X8RA 3TH6A 3M16A 4DY1A 1K7FA 1JQVA 2JK2A 1FWCC 4CQ8A 5H6HA 1OEPA 3TR9A 3U4AA 4X61A 3AICA 1ZBCA 3W1TA 4URIA 2GGHA 4AC1X 3PG8A 4OKDA 1JCYA 3SUVA 3DXIA 4Q8WA 4I9MA 4UMAA 4Z0SA 3STCA 1DJZA 1PV8A 2F6KA 3WEZA 1JPHA 3CAQA 1DXFA 5IBXA 3I7RA 4JY8A 3V5FA 3CH0A 1EOMA 4O12A 4W85A 1TV2A 1WQ5A 5K4ZA 1CGVA 1XSJA 4PUMA 3W71A 4IPLA 1QATA 3PNZA 3KTXA 4FIRA 4LCRA 2F7FA 4B90A 5M1TA 1HQTA 1OFRA 4O57A 2HPIA 1RP8A 4KGJA 3WDJA 3VUSA 4V2XA 3QV9A 4UCFA 3W1XA 3ECQA 3BW2A 4XKMA 4JTSA 2A1YA 1GOXA 1I2PA 3A3HA 1B3OA 5LIXX 4JFUA 1CLVA 2QPUA 3K46A 1JZ3A 4K8HA 1ZP3A 4GNKB 2QMJA 4J3SA 2BGSA 4LUSB 5CC5A 3EKLA 3NQAA 5D2WA 2VRQA 4OFCA 4K36A 3HQOA 4P7QA 4K39A 1GG1A 3LXCA 1ZJIA 1YPIA 2VX7A 4D9PA 5DCEA 1BLIA 2D0HA 4M8UA 2C6QA 4HYVA 1TVPA 3OPSA 4OUEA 3WQDA 4WX2A 3WYZA 1O1HA 3LHZA 1R3RA 1HL9A 3HG4A 1R9YA 1G7UA 4FR1A 3H2OA 2XGBA 3B0UX 3TOYA 5J5RA 2Z29A 4DN1A 1PSCA 4Q3MA 2O7SA 2Z26A 1ONEA 3OQEA 2DIKA 5B7YA 3C3NA 3DFHA 3NM1A 4ZENA