3PBGA

6-phospho-beta-galactosidase form-c
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
468
structure length
468
Chain Sequence
MTKTLPKDFIFGGATAAYQAEGATHTDGKGPVAWDKYLEDNYWYTAEPASDFYHKYPVDLELAEEYGVNGIRISIAWSRIFPTGYGEVNEKGVEFYHKLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFIDYAAFCFEEFPEVNYWTTFNEIGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLYKDKGYKGEIGVVHALPTKYPYDPENPADVRAAELEDIIHNKFILDATYLGHYSDKTMEGVNHILAENGGELDLRDEDFQALDAAKDLNDFLGINYYMSDWMQAFDGETEIIHNGKGEKGSSKYQIKGVGRRVAPDYVPRTDWDWIIYPEGLYDQIMRVKNDYPNYKKIYITENGLGYKDEFVDNTVYDDGRIDYVKQHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAHWYKKLAETQVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-PHOSPHO-BETA-D-GALACTOSIDASE
publication title Crystal structures and mechanism of 6-phospho-beta-galactosidase from Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 190
structure length 468
sequence length 468
chains with identical sequence B
ec nomenclature ec 3.2.1.85: 6-phospho-beta-galactosidase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pbgA00
3MMWA 4GZIA 1EIBA 3VGEA 1W9XA 3VNZA 4AZ5A 3WFZA 3CZ8A 5GNXA 2X0YA 3GNPA 1MQQA 2D24A 3KZSA 4PUEA 3ARTA 3AS0A 3AIEA 1SYTA 2VURA 3W82A 2J78A 3WD2A 2PF0A 5FOOA 3VGGA 1NWSA 4UZUA 3WMCA 1NWRA 2XVGA 4LXFA 3RILA 2A3BA 3VM7A 2EBNA 1E15A 3ZT6A 4UR9A 3CUFA 4B16A 2WANA 3OLIA 5HBFA 3PHAA 3WMBA 1BF2A 4UOJA 1FFRA 4FLSA 1E71M 1UA3A 3N04A 3W26A 1XD1A 3VIOA 2G3JA 1KXHA 1H0IA 1J18A 3QOKA 3ZQ9A 1GJWA 2HVMA 1MFVA 2XVPA 3WQ8A 2EPOA 2ZX9A 3OB8A 3D3AA 1FH7A 2CBJA 4HZ7A 3J7HA 4NRSA 4M82A 1TZ7A 2DGAA 1J0YA 1HVXA 3VGBA 3W28A 3MUAA 5BXPA 4AEFA 5GNZA 5A6MA 1MW1A 5IFPA 1W2PA 1QNSA 4TTGA 4D71A 4CUCA 3UCQA 2E3ZA 3WL0A 1LWHA 4H41A 3CHCA 2CKSA 1AQMA 3UR7A 1D7FA 3WNMA 1V3JA 3ZJ8A 1UYQA 4EAMA 2QLYA 1GOMA 3OGVA 1EOMA 4MNJA 1BG9A 5AC4A 5E9AA 4ZENA 3IK2A 1CGWA 1B3WA 4CD4A 4UQ9A 3CO4A 1E0XA 2X0HA 3I3BA 1V08A 2WWDA 1V3IA 1GPFA 3UR8A 1HN1A 1X6LA 4W8LA 3CBWA 5CXPA 1VB9A 2ZUMA 4PUDA 1FH8A 5I78A 4F9JA 3VGDA 1C91A 1WCGA 3GXMA 4GO9A 2W62A 1HIZA 1C8YA 3EBVA 2FGLA 4M29A 1I75A 4AD1A 1UZ1A 4BQ5A 1H3GA 4L4PA 2V3EA 1OGSA 1B3XA 1FHLA 2CBVA 4HZ8A 4J3WA 3AZRA 2YIHA 3UERA 2FHFA 5HNNA 3POCA 5ABEA 4JCMA 4OIFA 3PN8A 3W53A 3II1A 2WMHA 3K46A 2O9TA 2WNWA 1E70M 1CEOA 2BHUA 2J74A 1US2A 3VU2A 1WZLA 2DT0A 2EPNA 2XSBA 1MVYA 1GORA 1UR0A 1UWTA 5IHSA 2J25A 1E6XM 1GQJA 2BXZA 1VEPA 5I6SA 4AEEA 4DUXA 1BLIA 2X09A 3FW6A 3RM9A 2JALA 1JDCA 2ZX7A 3CZEA 3VDCA 1XYZA 1U30A 3OLGA 1JYWA 3M7SA 1JZ8A 1I1WA 1OT2A 1CLXA 5I5RA 3BAJA 3RO8A 2E0PA 2VZTA 1HKJA 3EMZA 3L4ZA 1UD6A 3AROA 2PI6A 5C70A 1JG9A 1GOKA 4PMYA 3K8KA 4AD5A 4FLRA 2VVSA 3ZR6A 4M1RA 1HJSA 1VJSA 1Q4NX 4MPKA 3WNKA 3WH9A 3W4RA 1CECA 2AAAA 4WKAA 4XV0A 1MQPA 3WL1A 1E6SM 5HPCA 4L4OA 3ARYA 1NH6A 2C7FA 2XWDA 2EPKX 1UR1A 1H4PA 4NRRA 4MDOA 2WHKA 1VIWA 1PIGA 1EA9C 3POHA 2DSVA 1E72M 4HP5A 2PWFA 3ZM8A 1K9EA 2WVSA 4MNLA 1OWQA 1B31A 4GI8A 1UKOA 3AYRA 2EPMX 1MYRA 3PZ9A 2ZUTA 4JKKA 4Z2HA 1TMQA 2WMJA 5A6JA 2WAGA 4CGTA 3CUIA 1BYDA 1GVIA 1L8NA 1JZ7A 1IV8A 5DO8A 1Q6EA 4CCCA 4LGXA 3NSNA 3MSDA 2YDSA 3VDAA 2YDQA 2IUZA 4P7LA 3WNPA 4PRWA 1E3ZA 2IXUA 1AQHA 3GXFA 1UA7A 1BGAA 3M6DA 3NYDA 4HMCA 3BAKA 1WDPA 2D3LA 1EHNA 1UWQA 5D9NA 2XVLA 2BHZA 3VD4A 3GH7A 5CSYA 3VD7A 2XGBA 1LQ0A 4M56A 1GW1A 2DSUA 4UFJA 3VNYA 4DWSC 1XH0A 4U31A 3WUGA 5CLWA 1QI3A 1VJZA 4HMEA 1CGXA 4BF7A 2A3EA 3PZOA 4S3KA 2JE8A 1C3FA 4PMNA 2WXDM 2WMIA 5ABHA 2YBTA 1EDGA 4BQ2A 3EDEA 1K6AA 2PBGA 1LF1A 4J27A 2VQTA 2JFEX 2D23A 4LYRA 5A2AA 4GQQA 2VI0A 1JZ5A 1MFUA 3BAYA 1DWHM 4OOUA 5EFFA 3ZIZA 3T2QA 4AIEA 1JIBA 3QHOA 2ZWZA 1DP0A 3U57A 5D8ZA 3AFBA 3F4VA 3QOMA 3F5KA 2MANA 3WFLA 4XUYA 2YLAA 1OGBA 3L4TA 4FLOA 3CMJA 3S2CA 1OM0A 5CLTA 3RM4A 1SR0A 4AYSA 1UQYA 1JYNA 1F4HA 5DF0A 3WH7A 1M53A 1WDSA 3BGAA 2E9BA 4V2XA 3PZMA 4DM1A 2J75A 5A8MA 4A4AA 1PX3A 2CITA 1GOQA 2OSXA 1BQCA 1ZB5A 1E6QM 3AS3A 1QNRA 1R85A 3UG5A 1DHKA 4B9YA 1ITXA 4UFLA 3NDYA 4W5UA 3OGSA 3LPOA 1U33A 4R5EA 1E73M 4W89A 4KRUA 1C8QA 1VFFA 2D0FA 3SCSA 2BVDA 2BFGA 1GVYA 1BPLB 2TAAA 1CLVA 1PEZA 4WKFA 3WH6A 3MV11 4MJ2A 1H41A 1RP8A 4UQBA 4QAWA 5M03A 1LL6A 2J4GA 3VM5A 3W37A 2G8ZA 1KR0A 3DYPA 1BSIA 5IDIA 1J9YA 4EE9A 5IHRA 2FGZA 3W29A 4IUGA 4KGLA 4D6IA 5JIWA 3AS2A 4ATLA 4KGJA 2QV4A 4U33A 3SCTA 4KWUA 3MS8A 3UETA 4OJYA 2NT0A 5E09A 3ALGA 1U2YA 1TFVA 4OUEA 4JCLA 3AJ7A 3SCNA 2ZXAA 4W87A 3VIFA 4JHZA 4CU7A 3AIQA 2DSWA 4PTXA 4D6GA 5A6AA 1W2VA 3W25A 2XWEA 1HL8A 2JF6A 3KL0A 2O9PA 4MB3A 1KGWA 1UKPA 3IAQA 1W3JA 5I23A 3VPLA 3MUZ1 1E1FA 5A8PA 4D6FA 3IAPA 1B90A 5IXEA 4KRTA 3ARVA 4GZJA 1UR8A 1XV8A 4QLJA 2CBUA 1HKIA 1JI1A 1QHOA 5I24A 1ZBVA 2DSZA 3PZIA 5F7UA 4GI6A 2HISA 4A3HA 2J77A 1E40A 3CH9A 2UY4A 1HJVA 4W8BA 1CENA 4MDPA 3BCFA 4ZXOA 3CLWA 1FP8A 1GOIA 4P7QA 3SUVA 1X6NA 2WMIB 2QPSA 2ZX6A 2DT2A 1W3KA 3CUGA 4ACYA 2WZEA 3BAIA 5C71A 1NWUA 3BAWA 4QCEA 4NI3A 1KQYA 2QHAA 3TTQA 1H11A 1BTCA 1XCWA 3AXHA 5A69A 2V3GA 1AMYA 4ACZA 3L4XA 1CYGA 1Q6CA 3NSXA 3AIBA 2W92A 3ZJ7A 4FF5A 3LMYA 4UCFA 1DWIM 1QI2A 4OOZA 1ODUA 5JBDA 2VCBA 3KE0A 4JZ5A 4CN6A 3DHUA 3BAXA 5EBAA 2Y4SA 3N9KA 4UOQA 1BAGA 1O6IA 1XGZA 4HU8A 3ALFA 4N0RA 4RL3A 1CBGA 1KGUA 4CN4A 1QI0A 4D6HA 3WN6A 3BH4A 4U2ZA 1XHGA 2WKLA 3MKKA 4PMRA 4EK7A 2WHJA 2YA2A 4H8VA 5CG0A 1R87A 3N13A 4GPNA 2WK2A 2VTFA 1UKQA 2DDXA 3PTKA 1K9TA 3VGHA 3ZMRA 1P6WA 1OT1A 1HJUA 4RE3A 5HDRA 2ZUNA 1ZBKA 5EFDA 1YHTA 1VFOA 1V6UA 1W9VA 2VX5A 4W84A 3WDIA 4IPLA 2ZX5A 1W9DM 3AS1A 5A95A 3FAXA 3T2PA 3WEOA 1W1YA 1CWYA 2J62A 2ZIDA 2XIIA 1E4MM 2E9MA 2GJXA 2DEPA 2WC7A 1XC6A 3TOPA 3AIRA 4AMCA 2WM0A 2A3CA 4ATDA 1VEOA 2FDMA 1US3A 1TUXA 3CZKA 1ZBWA 5TD4A 1XSKA 2Z1KA 4W88A 1ISXA 2XIBA 3WSUA 1IT0A 3QR3A 2XGIA 3W6MA 4PCSA 3SCRA 4Z2GA 5BCAA 1JZ6A 4NZCA 1JD7A 2E9LA 4X0NA 3TP4A 1FOBA 4P7RA 3WUBA 2ZE0A 4H8HA 3MV01 3BSGA 1NM9A 2D0HA 2ZUSA 3K4DA 4Z2JA 3M46A 4X9YA 3HU7A 4GINA 4UZSA 4Z2KA 2WMFA 3SUUA 1HVQA 4TUFA 2XPKA 3AZSA 1VFMA 1E0WA 2V3FA 1R8LA 2YBUA 1DWJM 2CHOA 5ECUA 3WDPP 2GSJA 2FHCA 1DWAM 3VO0A 1EOKA 2QMKA 4ATWA 7A3HA 4TTUA 4AD4A 3RPMA 2VCAA 4BCEA 3VOCA 1E4IA 1CTNA 1NOFA 4ACZB 2VX6A 4JKMA 3SURA 1C90A 1NQ6A 3SIMA 3AHXA 5FD0A 2G41A 2J7DA 3OZPA 5LA0A 3WF2A 3K8MA 3B9EA 3AYSA 5JIPA 1HX0A 3MSGA 2XJ7A 3DHPA 3GXIA 1QVBA 3KWXA 3AHYA 2GDVA 3L2MA 4ZEPA 1BHGA 1HXJA 5DFAA 3LPPA 4KMQA 3RJYA 3NCOA 2BS9A 1UQZA 1CXIA 1BFNA 1ZJBA 1WPCA 4BQ3A 4CD8A 1GUVA 3A3HA 4TVDA 4W5ZA 4HA4A 2YJQA 2CPUA 3K8LA 3WELA 5BWFA 4MB5A 1LWJA 4CU6A 1HJWA 4W7WA 3PTMA 4PTMA 1XH1A 3A4XA 2DPEA 5DT5A 3L4VA 1B3ZA 3AISA 4JHOA 2DT3A 3BLKA 5FL0A 3OA5A 1FFQA 3O9NA 4BQ4A 3PZTA 4LYQA 2F61A 3AMDA 1BVNP 1JDAA 1UKSA 1C7SA 3FXYA 3NDZA 5JUVA 1OIFA 1FA2A 1MW0A 3ZR5A 4HPHA 1M04A 4MNMA 9CGTA 3WD1A 3D5HA 4U3CA 2VMFA 1QNPA 2W5FA 1H09A 5BXSA 2O92A 6A3HA 3THDA 4P7NA 1ZJAA 1RH9A 1VRXA 4OKDA 1GHRA 3PZVA 1I1XA 3VDHA 1XSJA 1LJYA 3GBDA 2XFFA 3LPFA 1G94A 1L0PA 2GJXB 2CEQA 3RDKA 1OCQA 4TXEA 3ARSA 4P8XA 4AW7A 1MWOA 2FHBA 1HL9A 4D6DA 3SCPA 4MAVA 2YA1A 3WEZA 1UOKA 1JAEA 4PMZA 3VDBA 1JFXA 3CHFA 5BROA 1V3MA 3BC9A 3KL3A 1HP4A 1W9UA 4JFTA 3ZT7A 4HOWA 4CN1A 5E0FA 5A8OA 4NF7A 4MADA 4EKJA 1PX8A 3WNOA 2J7GA 1H5VA 2YL8A 4BZYA 1MXDA 1JF5A 4HA1A 2CCRA 1FP9A 2EJ1A 3TTOA 5I3DA 1ISWA 1WKYA 1SMDA 2D3NA 3DYMA 1B3VA 4W86A 1UG6A 1JXKA 1V02E 3VMPA 3WKZA 2JEPA 1IZKA 3FAWA 2CNCA 1E0VA 2JF7A 1DEDA 4YPJA 4AZIA 4X0VA 4PBGA 1J11A 5M3WA 3W6LA 3CUJA 1LG2A 1EQPA 1H2JA 1FH9A 3E1F1 2VVNA 3LPGA 1QNQA 2UWFA 3MO4A 1UD5A 2GK1A 4N42A 1CNVA 2VR4A 3G6MA 2W66A 5A3HA 2WMKA 2Y5EA 5I79A 1UH3A 3F5JA 4CD5A 5A6LA 1V3LA 2BVTA 4J3XA 1B3YA 1PPIA 2JIEA 3NIYA 3WMSA 3VUPA 3APGA 2VJXA 2XSAA 2YOCA 1J0HA 5M17A 3GTNA 2WHLA 3VD5A 4GQRA 2EPLX 2OWWA 2D20A 4AZCA 1C7TA 3AIWA 2D1ZA 4B3LA 2C8NA 1UR4A 1B1YA 1PX4A 1EHAA 2WBGA 3NUKA 3WDJA 5A1AA 1HNYA 3OG2A 4TX8A 2QPUA 5CGMA 3WQ6A 1WE5A 4AD3A 2VQUA 5E70A 1VFUA 3EDFA 2J7BA 8CGTA 3AIUA 2VC9A 3ARUA 4XZWA 3VIKA 2VRQA 3VX0A 1PZ3A 1A47A 4AISA 3ZSTA 3AMKA 1UHVA 1QI4A 3IANA 4MNKA 4D1JA 4FLQA 2NSXA 2G4FA 4F8XA 4PMDA 1M03A 4HTYA 1X1NA 5C8BB 1B30A 1EO5A 4DUWA 4CU8A 1HJQA 4WSKA 4UFMA 1J12A 3OGRA 1J01A 1OBAA 4YN5A 1D2KA 2WSKA 1VAHA 4LQ1A 4HOZA 5AYBA 2J7EA 3THCA 3VIIA 5CPSA 5FIPA 4AZHA 2ZXQA 3GXDA 2J7HA 2WWCA 1PBGA 1G9HA 3GYCA 1V6VA 1E3XA 4AXNA 4JL1A 2Y8VA 4BA0A 3ARWA 3O6AA 2BNJA 1UWSA 4K68A 4MB4A 1CGYA 2G3IA 1OD0A 2BV9A 4C7GA 3B9AA 1EQCA 5CQ1A 2RGLA 3AHVA 4AZ7A 3ZSSA 4JFWA 4MTVA 1GJUA 1ITCA 3WIJA 3K4AA 1BYBA 2F2HA 2Z1SA 1KGXA 1PAMA 3OZOA 4PSRA 2XHYA 2YDRA 5BXRA 2YL5A 4D72A 5CSUA 4J3VA 1W1VA 4W7VA 3RJXA 3W81A 4P8UA 2Q8XA 4E4PA 2O9OA 3PTQA 1J10A 1XYFA 3WQ5A 3RMEA 5A6SA 2VOTA 1K9DA 1UUQA 1ODZA 3U5YA 2XYLA 1ZS2A 4AY1A 1TVNA 1JF6A 1QW9A 1MW2A 3UESA 4UTFA 1CGVA 3CHDA 3GNRA 1UD8A 2VZOA 4P7OA 1BYAA 4W8AA 2EEXA 3SCVA 2GK1B 5I0DA 1CPUA 1BVZA 1E4NA 3EMQA 1JYXA 1V3KA 4OBSA 1JGIA 4AZBA 2GDUA 4TOQA 2F8QA 3TONA 2XTKA 5A2CA 4TVCA 3F5LA 4PMXA 5BRQA 3VD3A 1MQRA 1TG7A 1CXEA 2OSYA 2WZIA 3RM8A 3ARPA 1V6XA 3T0AA 3CZGA 1GQKA 1PIFA 3WD4A 3ZT5A 1JNDA 4IISA 4LPCA 2GJRA 1JAKA 3CUHA 3SCOA 4J3SA 3UG3A 2CHNA 1JL8A 1Z32X 3AXXA 4UQDA 4WJXA 3KL5A 1SFSA 2YL9A 2GFTA 3U7BA 1H49A 4TX6A 3VMNA 3AMGA 4AZCB 5M5DA 2QMJA 3VIHA 4W7UA 2V3DA 4D1IA 3PZNA 2D2OA 3VMOA 2WKGA 2XM2A 2VNCA 1Y7VA 3G6LA 2ZXBA 3NJ3A 3CHEA 1UZ4A 1XH2A 5FL1A 2Y2WA 8A3HA 3WD3A 4QP0A 3VIPA 3N1AA 2X8RA 1PJ9A 1ISZA 3OLDA 4FK9A 2OYKA 1NOUA 1XD0A 2WCGA 4GZEA 4XZBA 2E4TA 2OSWA 4C7DA 1KWKA 4CCDA 4UNIA 2GVYA 2YLLA 1V0NA 5HOSA 3WNNA 4M81A 1WNOA 4J28A 3WD0A 4ZXLA 2WVUA 4PCTA 2WHMA 5ABFA 3DC0A 1TR1A 4PMUA 1GQLA 4HMDA 1UR9A 4RE2A 3AHTA 3ARZA 4V28A 1DWFM 1V3HA 4GXPA 2VO5A 4UFKA 2GJPA 4E2OA 3PBGA 5D4YA 4IM4A 5GQBA 3A47A 1JD9A 2J79A 3ARRA 2IXVA 3SUWA 4LX4A 5D8WA 4W93A 2E8YA 4A3YA 1VEMA 3MUY1 1KXVA 4MAZA 1GONA 2WLZA 1Q6GA 2OYLA 2J7FA 1WZAA 3GH5A 1UWUA 3WF3A 4H2CA 4OBRA 4Y7EA 1QW8A 2FH8A 3GDBA 1BGGA 1KFWA 2PWDA 2DIEA 3BSHA 3VIMA 3WUFA 4D6EA 1C8XA 1TE1A 3IJ7A 1B2YA 7CGTA 1E6ZA 4HU0A 1H0GA 3S6TA 1ECEA 3WUEA 2OWXA 3AHZA 5BRPA 1CZ1A 4AIOA 4NSBA 4M80A 1OINA 3T09A 1MW3A 3IJ9A 5CJ5A 4CVUA 5DMYA 2WMGA 2CETA 3VINA 5A94A 3N11A 1E9LA 3UEQA 3AZTA 3BMWA 3U7VA 4HA3A 3WEMA 3VX1A 4D6CA 2OLHA 2WW5A 2A3AA 4EANA 2J8FA 3AMCA 1JXJA 3ZO9A 5BYWA 3WY1A 5LA1A 4PMQA 2J47A 1ZBCA 4B3KA 2VZVA 5ABGA 2J7CA 4S3JA 1V6WA 1GCYA 5CPTA 3A4AA 5EB8A 3QHNA 1EO7A 2BY1A 5BXTA 1OIMA 4WIWA 1OGGA 2ZICA 4B9ZA 2EO7A 4C7FA 4JFVA 1QNOA 3AI0A 1E4LA 1WZMA 1WDQA 4E8CA 1M01A 1G5AA 1SMAA 3WNLA 2ZX8A 4DWSA 2OWCA 1VBUA 1UD3A 3EDDA 1EDTA 4PTVA 4HOXA 1E43A 2WLYA 4GIAA 4PMOA 1QOXA 2BHYA 4RE4A 5A8QA 1UH2A 2CBIA 4M8UA 1EXPA 1K9FA 3MANA 3AMLA 3GZAA 4KH2A 3T2OA 3RIKA 3CZLA 3MMDA 1H1NA 5FCZA 3JUGA 4AWEA 1W9PA 3BXWA 4QDMA 5GPRA 4F66A 4J7RA 1ZL1A 1JFHA 5AYIA 1KBBA 2BY0A 4W85A 4DM2A 3W38A 1J0IA 3NSMA 4UQCA 1GOOA 1LL7A 3CIVA 4Z2LA 2Y8KA 2PWHA 2ZUWA 1Q6FA 1UD4A 2VL4A 4UOZA 2CESA 1HT6A 5D9MA 1UH4A 4AIUA 1W9BM 4H8UA 1NP0A 2DIJA 3BMVA 2E40A 5ABFB 3HMCA 1QPKA 4UQAA 1B0IA 2XFRA 2XVNA 3VIGA 1E1EA 3AXIA 5JBEA 3FHQA 3L2LA 2V38A 3WENA 5AC5A 3VTRA 1OD8A 3KEHA 2UY3A 2C0HA 4YHGA 4JIEA 3WQWA 3M07A 3ARXA 3K1DA 2W91A 2UY2A 1AQ0A 2G3NA 2XM1A 5D9OA 2YKKA 1G01A 1EDQA 4B15A 5D9PA 2VZSA 2WZHA 1A3HA 2CXGA 2DT1A 5DT7A 3T08A 4U2YA 1E55A 1E6NA 1QBBA 3L4YA 3BLPX 5GNYA 3CPUA 4PTWA 1V0MA 2XFYA 4UFHA 2B31A 3MU7A 3HJEA 1B9ZA 4AD2A 1KCKA 4WKHA 3TTYA 1HKMA 1ISYA 3ZJKA 3WQ4A 3U5UA 1TA3A 3WBEA 2XVKA 2PC8A 4MJ4A 1CGTA 2QF8A 3QHMA 3WF4A 3B8SA 3SCWA 4Z2IA 2ZWYA 4BS0A 3EDKA 2CERA 1UKTA 4AZ6A 4PN2A 5E0CA 1CXFA 2ZXDA 4HPGA 5CZKA 1CDGA 2WPGA 3N15A 1OSEA 2XUCA 1E5NA 1HJXA 2AMGA 5A6BD 1VBRA 2WC4A 1V0KA 2W63A 4P8WA 3UG4A 4Q22A 4PMVA 2V5DA 3EYPA 1WDRA 1RPKA 5A6KA 1W1PA 1WZKA 4JAWA 1D3CA 1JNEA 4ZE5A 1V0LA 1CGUA 5E6YA 1Q6DA 4F9DA 5LYRA 2D0GA 4D6JA 4DWSB 2WCAA 2XG9A 1EH9A 4UQEA 4AC1X 4HZ6A 5KZ6A 1QI5A 1RP9A 2W61A 4U5IA 3N17A 2YL6A 4QLLA 3HN3A 2A3HA 1GHSA 1J0JA 2UY5A 2DSKA 3GBEA 1QBAA 1FHDA 1RD6A 4GKLA 6TAAA 1W3HA 3AICA 1ESWA 1WP6A 5JBFA 2D22A 4R27A 4H04A 2O9RA 1KXTA 3EMCA 1DTUA 4IPNB 2ESCA 4DUVA 1V02A 1OB0A 5E6ZA 3L4UA 1N82A 2JIWA 3FNDA 1TCMA 1E56A 5A2BA 4QLKA 1HP5A 1G0CA 2RGMA 3IJ8A 1UWIA 3BCDA 3GM8A 4CVWA 2EXOA 1CXHA 2BY2A 2V5CA 2CYGA 1S46A 2J8GA 2VZUA 4CD6A 3ARQA 4WK9A 4CD7A 3PZUA 4J3TA 2CKRA 3VKKA 5DEZA 4PEEA 3WF0A 3WDRA 3OLEA 4WF7A 4MB1A 2WVTA 2W4XA 4AZGA 1NARA 1WO2A 2EQDA 2WVVA 2PBOA 3FY1A 1LG1A 2X1IA 4CKQA 1ISVA 1O7AA 3WF1A 1JDDA 3TA9A 1GQIA 1XSIA 3CGTA 2VX7A 3FN9A 2OYMA 1WAWA 5EMYA 3VVGA 3B9DA 1AVAA 2G3MA 3PZGA 2GUYA 1W1TA 2DH3A 3VIJA 2VRJA 5LA2A 6CGTA 1XRVA 5I77A 4M24A 3WDQA 3PZQA 1NP2A 1BG4A 1BYCA 1W91A 3N12A 3DYOA 1PZ2A 1G1YA 3L4WA 4E8DA 4AD0A 1TA3B 2VUYA 3SUTA 1JI2A 2AOSA 2ZUVA 1GNXA 3RCNA 1KBKA 4XB3A 3WBAA 1QHZA 1KXQA 4JKLA 7TAAA 5IFTA 1MXGA 1CXLA 4U3AA 4TVUA 4DWSD 3N18A 2X05A 3VILA 4QCFA 4WLCA 5A8NA 1C93A 1R7AA 1TVPA 3WDHA 2WCSA 2VX4A 2BVYA 4F79A 4H7VA 3ZOAA 1KB3A 3AIVA 2FH6A 1NOWA 2DH2A 5KEZA 2YA0A 3ECQA 3TTSA 3QGVA 2WSPA 3O2LA 3SCQA 5CGTA 5CPQA 2BY3A 5FKYA 1HKKA 1V6YA 4P8VA 3W0KA 1R7OA 2W67A 3I3DA 1GOWA 3T0BA 1KR1A 1KQZA 1GZJA 1JZ3A 1LLOA 3AOFA 1CXKA 2ZOXA 4JFSA 5I2UA 1W3LA 1VENA 1JZ4A 3MUIA 1YQ2A 3WH5A 1E6RA 1UR2A 1E6PA 1WB0A 3SCUA 3WQVA 3CZJA 3MMUA 3ZJ6A 3I3EA 3SUSA 1HF6A 4U5KA 2PWGA 3A6OA 1J0KA 4LYPA 2VR5A 2DQXA 4OZOA 2CIPA 1DWGM 4QFUA 1VF8A 3VGFA 3OIHA 4CCEA 4UFIA 5HXMA 1V03A 3CTTA 1JYVA 1F4AA 3W24A 1E5JA 3DECA 2ZUUA 5A6BA 1XCXA 3SEPA 4JL2A 2E8ZA 4Q7NA 4GI9A 1JZ2A 5HPOA 3AQUA 4V27A 1C92A 4ZFMA 2VCCA 1KWGA 5AY7A 2Y24A 4URIA 2X2YA 3EDJA 3W27A 4ML4A 1KCLA 2NW0A 1NWTA 2NT1A 1LL4A 3OBAA 1EGZA 2PB1A 3VD9A 4ZE4A 4WSJA 2WYSA 1UWRA 4FMVA 1IZJA 2WVVB 2VRKA 3T0DA 2WC3A 1W32A 4YHEA 2WBKA 3FHAA 1J0ZA 1CIUA 4J3UA 2BXYA 1R86A 2WB5A 3GNOA 4PSPA 3WH8A 1QHPA 1ZU8A 2PWEA 1M7XA 3GH4A 4XX6A 4GO8A 4JFUA 2JEQA 3CMGA 1UD2A 3A4WA 4PYSA 2VT0A
chains in the Genus database with same CATH superfamily
3MMWA 2ZBTA 1F2JA 3HG2A 3RO6A 3LI0A 4JYEA 3KVKA 3VGEA 2PDHA 1VFHA 3UXLA 2PDMA 3W2JA 2D24A 2B4GA 3PJXA 4IICA 4MSSA 3AIEA 1G69A 3OZMA 1X7FA 4O0ZA 1NWSA 4JX5A 3SN4A 1SQ7A 1SW7A 3WLNA 1SJAA 5D33A 3VM7A 3ZT6A 3OLIA 1WA3A 4AC7C 3AO0A 1XW8A 3B8TA 4O28A 4UOJA 1XD1A 3GIQA 1YXYA 3ZQ9A 4DPQA 4PEKA 1RPXA 2XVPA 3WQ8A 1SSGA 1FH7A 1XDMA 2V0TA 1XKJA 4G5DA 4M82A 1TZ7A 5A8GA 1HVXA 3H2OA 5B80A 4NYUA 5FJPA 3DFPA 3ABQA 3P60A 4GUIA 3MUAA 4AEFA 4LUTB 5GNZA 4XZNX 5A6MA 4PTNA 1EJTC 5HUPA 3W7CA 1W2PA 1QNSA 4DY1A 2V5LA 3M5XA 4CUCA 1QFEA 3DI1A 3H8AA 3UCQA 1H7RA 3CHCA 4ZB2A 3H2NA 1UYQA 4DUOA 1GOMA 4A8IA 1KRBC 6ENLA 3R12A 4DO4A 1XLFA 4JTUA 2VP8A 4OQVA 3G5EA 4UQ9A 1I6NA 1XIFA 4XD6A 4LCQA 4TIMA 1V79A 1GPFA 4PUUA 1HN1A 3KCLA 4ZOBA 5G4HC 3CBWA 4WVXA 5CXPA 2VOMA 1XIBA 1TJRA 4AUBA 3GXMA 3SECA 2W62A 2A7NA 4RDVA 1V8EA 2FGLA 4M29A 2CLLA 4AD1A 5F2IA 1UZ1A 1J2WA 4BQ5A 2NUXA 3SW6A 4N02A 3P93A 3PBUA 1DXFA 3G3DA 1RK5A 1AK5A 3Q37A 3SM0A 3IUHA 5FSEC 5ABEA 4OIFA 4L9YA 3PN8A 2E1DA 3B8WA 3BQ5A 1ZCCA 3OVQA 1TREA 2PDBA 3H6OA 2BHUA 2J74A 4NXKA 4F3HA 1WZLA 2DT0A 4K37A 1XPGA 3E3HA 3RG6A 4MKSA 4CNNA 2VUNA 2H9AB 2B81A 1H1YA 3DFOA 1UR0A 1UWTA 3KS6A 5IHSA 5HMDA 2BOFX 2WOQA 4GOAA 4NZ3A 1FWIC 5I6SA 3V5OA 1DQWA 4A05A 3RM9A 4NJHA 1JDCA 3QR1A 3VDCA 1YXCA 4Z1YA 1XYZA 3OLGA 1NY1A 2YB4A 1VH7A 5DMLA 1JZ8A 1WKFA 1UASA 5I5RA 1MUWA 3RO8A 2E0PA 2VZTA 1EFZA 1HKJA 3L4ZA 4V1YA 1UD6A 2PDPA 4OWGA 1JG9A 1V51A 1GOKA 1VZWA 4AWSA 2P3ZA 4PMYA 1TVLA 3LCLA 3LENA 2HNHA 3WH9A 4AG0A 1EJSC 3WK1A 1MZHA 1CECA 2AAAA 2OKTA 2ZKMX 5CZSA 4XV0A 1MQPA 1UP0A 2VFIA 3JVAA 1NH6A 2C7FA 2WJEA 5LNSA 1UR1A 5CZJA 1H4PA 4AFYA 1A0EA 4RR4A 4E3VA 1PIGA 1KV5A 3N25A 4HP5A 1K9EA 3MSRA 4S38A 4JN6A 2ANUA 1REQA 1XFCA 1ICSA 3C4UA 3MA8A 3VZXA 3PZ9A 4JKKA 4Z2HA 4Q8TA 1OYCA 5A6JA 4K38A 4CGTA 4ERAA 4F2UA 2C15A 1WKDA 3MKVA 4UTJA 1IV8A 3W84A 3H21A 1QWKA 1KD0A 3VDAA 5DANA 4DJFA 3WNPA 3P6LA 1DJYA 4I9JA 1KKRA 1TZZA 2CU0A 1BGAA 4IX2A 5CAKA 4HMCA 1O1ZA 1YBQA 4RZ4A 4V1XA 5D9NA 2HZGA 3K4WA 2HPMA 4KWVA 1O60A 5FJUA 1KBIA 3VUSA 4G1NA 3WFAA 4LVGA 5CLWA 1QI3A 3LX9A 2A3EA 3LGEA 3PZOA 3S8HA 4S3KA 1C3FA 4PMNA 2YBTA 4AEOA 4MM1A 2Z0IA 1HW6A 2JFEX 5L6UA 3W88A 3VNJA 1JZ5A 4GYKA 2MNRA 3BAYA 4PUKA 1DWHM 5EFFA 3T2QA 2ZWZA 4FALA 5D8ZA 3P5YA 2GQ8A 1JCTA 3D0CA 4EF9A 2A6LA 3HF3A 2YLAA 4H4IA 1TYGA 3CMJA 1E51A 3S2CA 3RM4A 4AYSA 1XR2A 4UBPC 1ZJIA 3OW1A 2E9BA 4O4VA 5A5WA 2HJPA 1WBJA 5XIMA 2CITA 1BQCA 5CBJA 5LSMA 1R85A 1VLIA 2G37A 1DHKA 2XN0A 4UFLA 2F6KA 3NDYA 4W5UA 4XG1A 4C1NB 1U33A 5C7HA 4ICNA 4XTIA 1QCWA 4BI5A 5ECVA 1GVYA 3W1TA 4WKFA 1IIGA 1XLJA 3H26A 5FACA 2YCLB 4H6KA 4MJ2A 4UTHA 1RP8A 1WV2A 4LVBA 1LL6A 2J4GA 2G8ZA 4F48A 3RHGA 1A5KC 2OX4A 1BSIA 3S3GA 2FB2A 1J9YA 3B9NA 4EE9A 5IHRA 2FGZA 3NYZA 4KGLA 4RPPA 2C16A 1ZFJA 4ATLA 4KGJA 4U33A 3HGSA 2Q3RA 4RKAA 4R88A 2L5HA 3SCTA 3UETA 4OJYA 3MWAA 3M0ZA 1U2YA 3ALGA 1TFVA 4JBRA 4M19A 1KFCA 4RDZA 4CU7A 3I7QA 1RA0A 3VFLA 3LCWA 1W2VA 2BZNA 1HL8A 2O9PA 4JYDA 1KGWA 2NZLA 5FJRA 3BZGA 2X1UA 4WDTA 4D6FA 4Y9PA 1B90A 5HJLA 5IXEA 2BG5A 4KRTA 2FFCA 3ARVA 2FVLA 4EWND 5LIUX 3FX4A 3GU9A 4LUTA 5I24A 1KKOA 2V5KA 1ZBVA 2DSZA 3APTA 4GI6A 2HISA 3LCIA 3FDGA 1DIEA 4A3HA 3UPBA 4N7QA 3CH9A 2B7OA 1CENA 3C0LA 3AUOA 4LF1A 2O7QA 3GR7A 3CLWA 4O15A 3IJQA 4FPSA 1S5MA 3SUVA 1X6NA 1OABA 2ZX6A 1W3KA 3C56A 3T8LA 3RK8A 3H4XA 5K9CA 1BRLA 4JDBA 4QCEA 1XLHA 3VFCA 2QR6A 4JR5A 1UZDA 1XCWA 3MVIA 1AMYA 2V5JA 1CYGA 1Q6CA 3NSXA 2EF9A 3AIBA 3AYVA 1OX6A 2NV9A 3ZJ7A 1DWIM 1QI2A 1XX1A 5D2TA 4OOZA 5B7ZA 4DAIA 4CN6A 3BAXA 4GRSA 3UJSA 1BAGA 4HU8A 3G22A 4QS5A 1S1PA 1WXZA 4N0RA 3EOSA 4HSOA 1QI0A 3RPTA 3C2VA 4PODA 4Z1BA 4U2ZA 3DX5A 2VEPA 3GHSA 4WGHA 3NWRA 1HQTA 4C6MA 4EK7A 3QFWA 2YA2A 4UTWA 3N13A 5LNVA 2WK2A 2Q8LA 4LS1A 2WV8A 4PR4A 3PULA 2VEMA 1JJKA 1HGWA 2FMNA 3VGHA 1NDZA 1P6WA 1OT1A 4RE3A 5HDRA 2Y1HA 3H4WA 4E4UA 4WCJA 3M41A 1W9VA 3IVSA 2VX5A 3ZXWA 2P53A 4DYJA 4EAYA 2HDJA 3KM8A 3TN3A 3WEOA 1UMYA 5C9WA 2J62A 3CV7A 4O12A 3WLQA 1ONEA 2ZIDA 1AH4A 3PUEA 2GJXA 2DEPA 3CMFA 1Y5XA 4HHMA 3AIRA 2PRHA 1TJ1A 1GQNA 1YPIA 2IKIA 3AALA 4L5ZA 2J9YA 4W88A 2OOGA 1KV8A 2W6RA 3WCZA 2ALDA 5BU9A 4PCSA 5K3VA 2POTA 4EF8A 4Z2GA 3WK3A 1XI3A 4X0NA 4OTKA 4P7RA 2J24A 4DI9A 2RJHA 2D0HA 3RITA 3GFZA 4CEUC 2Q8ZA 3HU7A 2QDHA 4GC4A 2FQIA 2A2IA 3ABXA 3H2MA 1HVQA 3O6CA 3AZSA 2IS7A 3M64A 1BXNA 1E0WA 2YBUA 1DWJM 1HG3A 1JUEA 1O12A 2FHCA 3CS2A 1DWAM 4NAFB 2ADAA 5K2ZA 3MI6A 3LSCA 4NKCA 3N4EA 4E5TA 4TTUA 2HS8A 4W9TA 1RJQA 3H12A 4F0MA 2CZDA 1E4IA 1NOFA 4JKMA 5MHBA 1FWTA 1KFEA 4RX0A 2G41A 1EP1A 1OADA 3IUDA 1FWCC 3W7PA 3GC4A 3K8MA 3AYSA 1Q7QA 4C6DA 3MSGA 5BW6A 4GZ7A 1H7NA 2OO6A 3KWXA 3AHYA 4C6CA 2GDVA 4F40A 3L2MA 3HO8A 5DFAA 4GKTA 1RCQA 3RJYA 2BS9A 1K4GA 1BFNA 4NZ4A 5JH1A 1LUCB 3K8LA 4FNPA 4IMEA 3WELA 5BWFA 2ABBA 4W7WA 2ABAA 2O4QA 4C6FA 3A4XA 4FNUA 1GEQA 3R6IA 3F2CA 1W56A 2VDHA 4NZFA 5FL0A 4XUGA 4TU1A 1VPQA 3FJ4A 5I00A 1OIFA 4HPHA 9CGTA 2VMFA 1QNPA 2W5FA 3P14A 1RH9A 5G2IA 2QCHA 8TIMA 4GH1A 4DO6A 4N9CA 3R8RA 1QRQA 2I17A 3FDKA 1I1XA 2ZRWA 3C52A 1RCXB 2XFFA 3LPFA 3PUOA 1L0PA 3RDKA 2KX9A 3QZAA 1IWPA 2R9RA 4TXEA 1RXOB 3ARSA 4AW7A 3GFYA 4MVAA 2FHBA 3PBVA 4US5D 2A0NA 4FOKA 2RDTA 2R6OA 1ZP3A 2FZ8A 1JAEA 3MP4A 1JFXA 4O13A 4LFYA 3STGA 3BC9A 4IG2B 3KL3A 1W9UA 3IGSA 4CN1A 4F2TA 3OYZA 1PX8A 1TWDA 2EG7A 4GG9A 1H5VA 2WJZA 4IXXA 4HA1A 2CCRA 4R7WA 3H54A 5FJJA 5AN7A 5CG7A 5C5YA 3W7OA 5H1WA 3KHJA 2EJ1A 5LNRA 3H7RA 3QMSA 5GJPA 5M2FX 1W3NA 3DYMA 4W86A 3QPYA 3ABOA 4M7TA 5E5CA 2JEPA 3E49A 1JPMA 2FGBA 1DEDA 5C9ZA 2VD8A 4PL2A 1EJUC 3LGGA 2NSOA 1M65A 1H2JA 2R8WA 5HNTA 3E1F1 3GVVA 2UWFA 3MO4A 1UD5A 5J5RA 2VR4A 3G6MA 4XBJA 4LV4A 2I16A 4B3ZA 1MMFA 2WMKA 2D73A 3KCJA 3H7UA 4B91A 1B3OA 3B0PA 4J3XA 1R2TA 3BPWA 2JIEA 3EEGA 4I8DA 2VFEA 4LCRA 3GTNA 1YW1A 4NP7A 4MOZA 3TW6A 2OWWA 4YLWA 4AZCA 1C7TA 4XTDA 3A23A 3AIWA 2P0OA 3KOYA 4I5RA 1ENUA 3LLDA 4Q7IA 4KQNA 3CYJA 3NUKA 3WDJA 1YNPA 1AJ2A 1QK2A 4TX8A 4ZO7A 4O52A 2Y85A 4UTIA 1K77A 1CX9A 5E70A 1VFUA 2VC9A 2ZRXA 3WJXA 1VGAA 2E1WA 4O1AA 1OC5A 3AMKA 1QI4A 1EJVC 3IANA 4UTTC 1L6GA 2NSXA 1K6WA 4GNVA 3QKZA 3F1QA 1OJXA 5I3GA 1B30A 1EO5A 4LANA 1HJQA 4Q8WA 1J12A 3BVJA 3NL2A 3SRHA 4HOZA 4EXBA 1A5CA 1S39A 2DW6A 3LHZA 4Z0SA 3NZQA 1LRTA 4AQLA 2PWVA 3GYCA 1V6VA 1FVPA 2Y62A 2P3EA 2ZFAA 4JL1A 5J5DA 3CL6A 3ARWA 3VKAA 4DYEA 4GX9A 3KRZA 4MB4A 4GJJA 3VCRA 1LRNA 1NDYA 2BV9A 2Z2UA 2PFHA 4XVDA 1EQCA 5AHEA 2YFNA 2NVCA 1XJBA 2OMAA 3ZSSA 1EWEA 3CASA 2GVJA 4HPNA 2GOKA 3IS4A 1IF2A 1PAMA 1PYMA 3GZ3A 3OZOA 3QW3A 3B05A 4PSRA 3G1SA 2YL5A 4L6HA 4J3VA 3W81A 1J10A 2NXIA 3OIXA 4GBDA 5A6SA 2PCQA 1KM5A 1K9DA 4MLRA 3M47A 2I7GA 5G1TA 3TROA 1JF6A 1QW9A 3TN6A 1J8VA 1JCNA 3TYUA 3UESA 3WQEA 3TWBA 2VZOA 1XLLA 3ANUA 1BYAA 4IUOA 5EMJA 2EEXA 3SCVA 2GK1B 1TWWA 1BVZA 3PNUA 3W2UA 1F8IA 3EMQA 1V3KA 1IZCA 4NJJA 2GDUA 4R85A 5EYWA 2F8QA 2XTKA 3S5SA 3F5LA 4PMXA 3VD3A 1MQRA 2G97A 1EXBA 3MI3A 3CB8A 2W79A 1GQKA 1PIFA 4LPCA 3CUHA 5FF0A 4ZOEA 2CHNA 2YCEA 4PMJA 1Z32X 3AXXA 3VOHA 2GFTA 1XINA 5H6HA 4MWAB 5RUBA 4WRHA 2GL5A 2V3DA 2KZHA 2P8BA 1Y5WA 3I7RA 3E02A 2ZXBA 1OG0A 1IEIA 3H4GA 4L1GA 1X39A 1UZ4A 1S5TA 1LT8A 2ZDSA 2Y2WA 8A3HA 3WD3A 3N1AA 2X8RA 3V0TA 3G77A 2Z7KA 2OYKA 3UWUA 4GZEA 3AYTA 1R38A 3LK6A 4CLMA 2BTMA 1IT8A 1KWKA 3LERA 4LSBA 4NYYA 4H19A 4ZBCA 1DKWA 1A3WA 4GXMA 3Q65A 4QITA 3MDWA 4ZXLA 3TDFA 3XINA 3W7KA 4PCTA 4O0QA 2PRMA 1TR1A 3DC0A 1GQLA 1UR9A 1CB2A 3WQOA 3H22A 1TWZA 1VPYA 3AHTA 3Q4DA 2VO5A 2GJPA 2GUBA 2VEFA 3PBGA 1PWLA 2J79A 3HPXA 1IXOA 4W93A 2C14A 2DY3A 3MUY1 2X16A 2FPTA 1PKMA 4MAZA 2J7FA 2DQWA 1EX5A 1UWUA 4JQ2A 4QDWA 4H2CA 4LY4A 4OBRA 4Y7EA 3GDBA 5J04A 3CB3A 2PWDA 4HK6A 3GRIA 4CQCA 3WUFA 5CPNA 3S6TA 5AYXA 3AHZA 3G2GA 4GYJA 3GFXA 1YE6A 4L61A 5DMYA 4C6QA 5BMXA 2E77A 3LYEA 3QW4B 2CLEA 1E9LA 1IT7A 1EJRC 3AZTA 4J40A 3W71A 3UYCA 3C3NA 3VX1A 1TPH1 3ZO9A 3WY1A 3LUTA 5LHEA 4B3KA 3PSVA 1F05A 3RYSA 1EGMA 3IIVA 1XICA 1EEXA 3S5NA 2I1OA 4WIWA 1OGGA 1VYPX 2ZICA 2EO7A 1QNOA 4H9VA 1L8PA 1G5AA 1SMAA 3EAUA 3WLMA 4BF5A 2BLEA 1PHQA 3I4KA 2OWCA 3ICJA 1GVOA 5G4EA 4JPGA 4PTVA 4NXSA 1E43A 4H6QA 3HJZA 3HPAA 4BEUA 4EACA 4HD5A 1QTWA 4M8UA 1EXPA 1K9FA 3LEPA 3MANA 3VNIA 1G4PA 1H1NA 3LG3A 3QV6A 3JUGA 3CYVA 1NSJA 4S39A 3I6RA 4LS0A 4GMEA 5HR7A 3G8RA 4MY9A 3N19B 1PDYA 4BFAA 4J7RA 4K7VA 2QCMA 4Q4RA 2GWGA 4NUWA 2KAUC 2ZA1A 3TLQA 5C9RA 3R0DA 2WM1A 2FLIA 3W1NA 5DRIA 3HURA 4UQCA 2IPGA 4IIFA 4Z2LA 2PWHA 4HCHA 3E9AA 4J5NA 2OQHA 1N2VA 4UOZA 2FVKA 1HT6A 5D9MA 5KETA 4P2VA 1UBPC 1W9BM 1TV4A 3NR0A 4H8UA 1OFOA 5CJMA 4GY0A 2E40A 4UQAA 1KFBA 3S42A 3KLLA 1BWLA 2V2CA 4GQBA 4IIDA 3TNBA 1I2RA 1FQ0A 2B0MA 1ZENA 3M07A 4GY7A 5F4XA 4G2DA 4QBXA 5D9OA 1DOSA 4WOZA 4B15A 4GIYA 3NZPA 2GGIA 4YIWA 3IGUA 1SFJA 2CXGA 3LB0A 1XDJA 4U2YA 1F8MA 2VR2A 1Z89A 3LRKA 3FGCB 4UFHA 2B31A 4HJFA 1KCKA 2F84A 3A3WA 1ISYA 3ZJKA 4O1CA 3QEZA 1TA3A 4HKPA 4FNTA 1BVWA 2XVKA 2PC8A 1CGTA 1UP3A 3QHMA 3B8SA 2ZWYA 1TV7A 1XG4A 3F4WA 3N9RA 2QCDA 1K02A 1JCXA 1CXFA 3TSBA 2ZXDA 4MHBA 1S1RA 3N15A 1E5NA 4K8GA 4Q22A 4TX9A 1WDRA 3BJTA 1Q6DA 3BW3A 4F9DA 1GOXA 1GVQA 5IM51 3IUIA 4NU7A 4D8ZA 4GCXA 5TNVA 2HROA 3NA8A 3HB9A 3T07A 3SQLA 3TV8A 3PPFA 4PFHA 5KZ6A 3CJPA 5FEWA 4DYKA 1FCQA 1EB3A 2FTPA 3ZR4A 1QO5A 2BVWA 2EKCA 3C2OA 3N17A 4E8GA 4GVGA 3HN3A 3W7NA 1J0JA 3RX2A 3GBEA 5LNUA 4B2DD 1SO6A 3M0VA 4UIOA 3ID7A 1R3TA 3AICA 3ME3A 2CLMA 1KXTA 4HNCA 1PCWA 1BWVA 3W7DA 4DUVA 4X61A 3FIGA 2GJNA 2JIWA 3TH6A 3B8DA 4AXKA 4IL2A 5A2BA 3EWCA 1HP5A 1SSDA 4KIRA 3IJ8A 5BZAA 2EXOA 3BWWA 1CXHA 2BY2A 4UMBA 2FZNA 3E2SA 1DBTA 2VZUA 4CD6A 2QIWA 3NG3A 3TYDA 3LMZA 3PZUA 4FNRA 5REQB 3IGXA 1XIIA 3MVTA 3V0SA 4XWUA 4WF7A 2BX7A 4NI8A 3C61A 4MB1A 1XUUA 2W4XA 2WVVA 2I14A 4E6MA 2PBOA 3FY1A 2FKPA 4HNOA 2X1IA 4DBDA 1ISVA 3UJRA 2ZVIA 1W37A 1SJDA 1JDDA 1ZY9A 2GSEA 2OEKA 3ELFA 3HPZA 1XSIA 3WF1A 3CGTA 3W02A 2OYMA 3GUWA 3VVGA 3CIXA 1YE4A 3KVJA 3OBKA 3STCA 2GUYA 3LM3A 1W1TA 3KBNA 3VIJA 2VRJA 4X2RA 4A3RA 4M24A 1V7AA 2H3BA 2FPVA 3O6DA 1BYCA 2EG8A 1DIKA 1NEYA 3EWWA 1Q45A 5D38A 1CB7B 3ENLA 3HV8A 3ABSA 5C2CA 3RCNA 1KBKA 3BOXA 4O1EA 2GJLA 3QSRA 4GGHA 3P0WA 4R53A 2VC5A 1KXQA 4JKLA 4IP7A 4O54A 2PLJA 4GACA 7TAAA 2RDXA 4DWSD 5AHIA 1G67A 1C93A 1R7AA 2PSNA 2BVYA 3GX9A 2G3FA 3ZOAA 4F79A 1POJA 2PCEA 2YA0A 3TTSA 3O2LA 1OYBA 5CPQA 1HKKA 1I2NA 1A5BA 3A13A 1R7OA 3NURA 4LCSA 3R79A 4Q4SA 4XKYA 4GUJA 1CXKA 1U5HA 4GFSA 2ZOXA 4JFSA 4GHRA 4NJGA 4YL2A 4QIUA 3MUIA 3QGKC 1QPQA 3C3UA 3EKGA 1L9WA 2QULA 1E6PA 4H7ZA 3WQVA 3CZJA 2CWNA 2Z26A 3NQ8A 3O8AA 3A6OA 1TJ2A 3OEXA 4IFKB 1Q85A 2PTWA 3VOJA 1PKLA 1B4EA 3TC7A 1SW3A 4UFIA 4PC8A 2XIOA 1X8FA 3BUVA 4YVPA 1RY0A 3DECA 1EWDA 3PVFA 2ONEA 2NQZA 1XCXA 4IPJA 4XO6A 3GG8A 2E8ZA 1JZ2A 1DJGA 3AQUA 5HPOA 2ASHA 3E2QA 2F38A 3DCPA 4URIA 3NQ2A 3ANVA 1KW1A 1KCLA 1AW5A 3P74A 1OCBA 3WJSA 3OBAA 1GG0A 4XIAA 3PAJA 2PTDA 3FJ6A 3BLEA 3T0DA 5DCBA 1O5RA 2WC3A 4LNCA 3TYEA 1T40A 1W32A 3LGDA 2WBKA 3AXMA 3WLLA 3FHAA 5DY2A 3T8QA 4PSPA 1L6SA 1QHPA 4I9TA 4GO8A 2YX0A 3CQIA 5LIXX 1DV7A 3QPZA 3CZ8A 2QCEA 5GNXA 4H3DA 2IKHA 1IGWA 3TYAA 3KZSA 1EL3A 1XBVA 3ARTA 3LHWA 3P61A 2BGQA 1LDCA 2VURA 5CCZA 2J78A 3WD2A 1V6TA 3WMCA 4GUFA 1W3IA 4A35A 2XVGA 1FCBA 1E15A 2PF8A 2F6XA 1GVRA 4DJEC 4DB7A 1M7PA 1BF2A 1FFRA 1UA3A 3W26A 3GTHA 1KXHA 2RFGA 1VCFA 1J18A 4XD5A 4QQ3A 3GDKA 4J3ZA 4M3PA 1F07A 3UWVA 2PEVA 3OB8A 4DBEA 3EB3A 3OBEA 4ZSTA 3MCMA 3TJLA 2PDLA 1J0YA 4A22A 4LAKA 3TUUA 3B4YA 3N3MA 1FHVA 4GNKB 3LM7A 4QSFA 1MW1A 4AWUA 4TTGA 5HMSA 1DVJA 1BKSA 4A8RA 8XIAA 3M0HA 3WL0A 1XISA 4JN7A 1LWHA 1E0UA 1V3JA 4BKNA 4EAMA 3PB2A 1BG9A 1MDLA 4X22A 4I90A 1CGWA 5FSDC 3CO4A 1XCFA 1E0XA 2ZVRA 3I3BA 3P62A 4IFRA 4GXWA 1UP2A 3OU8A 5BNKA 1OZQA 4PUDA 4EIVA 5I78A 3K30A 4F9JA 1H50A 3LDVA 3NQDA 4YNGA 2ZRVA 2F7FA 1XIJA 4IMAA 3GDMA 2Z29A 1I75A 1Q7ZA 7REQB 1H3GA 1KFKA 4L4PA 4LAZA 1YDYA 2PDIA 3IIXA 1P0KA 1B3XA 1FHLA 4JY9A 4I7WA 2YIHA 3UERA 3UZYA 3N3TA 4MFDA 2HBVA 3POCA 4TR9A 4IIHA 3II1A 4FIQA 1VRDA 4DNMA 3W1XA 2NWSA 1E70M 3G3MA 5AHNA 1G4TA 1RA5A 2R14A 1XL9A 3TCEA 1MVYA 4EPBC 2BGNE 4ES4A 3E0VA 4PB3A 2J25A 2BB0A 2BXZA 4GE8A 4Q6XA 5AC8A 1VEPA 3VNDA 2FIQA 3MTWA 2IMRA 2J88A 1MNSA 3DGRA 1U1UA 2ZX7A 3CZEA 5KITA 1U30A 3IACA 2WSRA 1XBYA 1AQFA 4DPPA 1OT2A 1CLXA 6REQA 4DXXA 2H3DA 3GC2A 3AROA 2PI6A 4CQBA 3W1AA 3THAA 1A5MC 1RLDA 3K8KA 4AD5A 1QT1A 4HHLA 1T41A 5DY3A 5I03A 4M1RA 4LB4A 3FJNA 1VJSA 3BDKA 3DH7A 4MPKA 2WKJA 4UR7A 1Y5VA 2EAWA 1TE6A 4ZO6A 2DZAA 1V5XA 1SZNA 4Z1AA 3WL1A 3FK4A 4MUPA 1NELA 5T8GA 3TTEA 2GGGA 2IKGA 4MDOA 5EL1A 2WHKA 1EA9C 1PHWA 3POHA 2DSVA 4D9PA 2PWFA 4Z0JA 1OWQA 4EOUA 4GI8A 3GR8A 4UTMA 2EPMX 2Q71A 2PPGA 1MYRA 2WMJA 3ZVHA 4DZHA 3GTFA 4ADUA 1Z69A 1YTDA 1JZ7A 3WZ0E 5DO8A 4CCCA 4LGXA 3NSNA 3EX6A 3MSDA 2YDSA 3E38A 4P7LA 1X1OA 3W7JA 2IXUA 1AQHA 1XRTA 3KVMA 4PB5A 3TNOA 1DJXA 2D3LA 1IQ8A 1UWQA 3UF9A 3VCNA 1POKA 4L9XA 4ICMA 1AZ1A 3TMLA 3UBPC 3VD7A 1LQ0A 3L12A 3TXZA 4M56A 4UFJA 1SO3A 2XH0A 3V36A 4DWSC 1XH0A 2CZVA 4U31A 1JCMP 1VJZA 4HMEA 4BF7A 3EX2A 4XZ9A 2QCNA 4U10A 5ABHA 5TQLA 4ZODA 1RR2A 1NF7A 5AFDA 2QUVA 4UTKA 2PBGA 3V1HA 4XBSA 1Q63A 1F73A 2Y8UA 3GD6A 4QISA 1M5WA 3ZIZA 4GLEA 4AIEA 1JIBA 1DP0A 3U57A 3AFBA 1TX2A 4PCNA 3I65A 4FLOA 3ABZA 1NJJA 5CLTA 2ZYFA 1SR0A 1UQYA 1JYNA 1F4HA 2B7PA 4FNSA 3R7MA 4V2XA 1AUSL 3DBNA 3PZMA 3NO5A 3VKDA 1TPUA 1GOQA 1ZB5A 1WBHA 4CNTA 4B9YA 2GVLA 5GJNA 3TW7A 1KLZA 1W1B1 1R9YA 2QJHA 1E73M 4W89A 5HNRA 2VGIA 2D0FA 1EZ2A 1AW2A 2BVDA 4XZLX 1BPLB 4QX4A 3IK4A 1PEZA 2FJUB 3TC6A 2W9MA 4B5VA 4BJHA 1BTMA 1FUYA 5M03A 1KFLA 5G4WA 1LBLA 5D03A 4DQWA 3NZ1A 1IIHA 3VI2A 1A5AA 2Y5JA 2XIJA 1UROA 2J13A 2QKFA 3LLFA 4K36A 1MEHA 4AF0A 1OFAA 5EU9A 2NT0A 3QQ1A 4CQ8A 1ZNNA 4G9PA 4MG4A 3SCNA 2ZXAA 1PVNA 2D2GA 2OGJA 3KL0A 1E9ZB 1TV5A 1R47A 4JTLA 1W3JA 3VPLA 5A8PA 4QE5A 3UYIA 1C29A 1J5TA 3BGGA 1H7OA 3U6WA 4GZJA 1XV8A 2DZBA 2HE8A 3QF0A 1L6FA 4XAGA 3KBMA 2PTYA 3PZIA 4N6EA 2YFOA 1E40A 3GVRA 3BMXA 3CEUA 3LV5A 2UY4A 1HJVA 4US5A 4W8BA 3QFEA 4H1ZA 3NQFA 1YTEA 2O0TA 4IP5A 2I5QA 2WMIB 2QPSA 2DT2A 3CUGA 3P84A 1NWUA 2A6NA 4NI3A 4LBUA 1T5AA 1BTCA 4C91A 1U1JA 1JPHA 4FXRA 1YKWA 7XIMA 1UBSA 3KTXA 4JTIA 4FF5A 1XYLA 4UCFA 4R7OA 4K8EA 3CK5A 5AOUA 3JZUA 3NZRA 3DHUA 4XIMA 1WYIA 1Y8BA 4NJKA 1XGZA 1W54A 3UVAA 3ZFHA 1KGUA 2DUZA 1Q2SA 4RPQA 2R91A 1OK4A 1TPVA 1XHGA 5C7VA 4BI6A 4JEJA 3SRKA 5FA5A 1N55A 3GDTA 4H8VA 2HTMA 3PJWA 1ZAHA 4RDWA 2ZRUA 3PTKA 4NAEB 4XZIA 3L2IA 5FAJA 4LUSA 3NO3A 3RCMA 3MSYA 2ZUNA 3MY9A 5EFDA 4RNJA 1V6UA 4DVOA 1SR9A 4NVTA 2VWTA 3MCNA 3URNA 4DBUA 1K4HA 2Y7FA 2G50A 2AKMA 1W1YA 1CWYA 3REQB 3UCCA 1JEZA 5ABTA 1NVMA 4WY0F 3TX9A 1XBXA 1GK8A 5D04C 4O14A 2X42A 4HHPA 3D46A 1VEOA 3NL3A 2FDMA 3U3HA 1TUXA 5TD4A 3W1RA 1XSKA 2Z1KA 4FOJA 3W70A 2NUWA 2XIBA 4XAPA 2XGIA 3THUA 4EPDC 1JZ6A 1HKVA 4F0LA 3TP4A 1FXPA 1Q4WA 2HBXA 3BSGA 4ENLA 2ZUSA 1TPC1 3P7YA 4X9YA 4HA0A 4Z2KA 1KM2A 1OX4B 3NEHA 3ORWA 1R2SA 2QAPA 4BF9A 2XPKA 2YB1A 4LBRA 2V3FA 1BF6A 1ZZMA 1RY8A 3GKAA 5ECUA 2H8ZA 1OCJA 3VO0A 2OJPA 2LLEA 3KCOA 4MPQA 2QMKA 2NLIA 8XIMA 1KRAC 1UR3M 2Z1XA 3UNTA 2R94A 4MLJA 2VCAA 1VYSX 1CTNA 2RJGA 4ACZB 1TV3A 3GS6A 3SURA 4RW5A 1FWSA 3AU2A 3BURA 1GWJA 3G18A 4NILA 1RQHA 3SAZA 3WF2A 1FWFC 4YJ5A 3HIJA 4KCVA 3B8UA 3UVIA 4IFOA 3C0SA 3DFHA 3K5XA 2XJ7A 3GXIA 4YS1A 4QQUA 4ZEPA 1F9CA 1LBMA 2PWUA 1WPCA 4BQ3A 4IMGA 4EP8C 5C9XA 4HA4A 2YJQA 2CPUA 3SN0A 3LQLA 1WDDA 2GVEA 4AIBA 4MB5A 1LWJA 2IQTA 1M1BA 1HJWA 4PGLA 3RRAA 1MZRA 1XH1A 5DT5A 1OYAA 3KRUA 3L4VA 3AISA 5D2WA 3BLKA 2V8ZA 5G1MA 3IPWA 4IGSA 4LV9A 2F61A 1BXCA 1BVNP 1S3TC 3N2CA 1LQ2A 1UKSA 3FXYA 3JRKA 3NDZA 1FDJA 1MW0A 4ZTYA 3QV8A 5CAHA 3WD1A 4U3CA 1ZJHA 4LJ3A 2X7WA 2W27A 3L23A 4ZQMA 5BXSA 1MUMA 2DUXA 3THDA 1ZJAA 2NV2A 1DJWA 1VRXA 4OKDA 1GHRA 1SZGA 3PZVA 1UJPA 4IXHA 2Y7GA 1XWYA 3L7RA 5CSSA 1FHUA 3VDHA 1XSJA 3EPOA 1LJYA 3S9YA 5KZEA 2CEQA 4JHMA 3MI2A 5C9UA 3QVQA 2E6AA 4P8XA 2Z6JA 3NXLA 4KPLA 1OF8A 1MWOA 2A79A 1HL9A 1W1IE 3PSWA 1LT7A 4Y9AA 2SFPA 2QJGA 2PA6A 2PZNA 4PMZA 3ZWTA 3U48A 5KZMA 4BEQA 1VJIA 3UWEA 1S3HA 4G6CA 3PB0A 4TMBA 5BROA 2I5IA 4O16A 1HP4A 4WJEA 4O8AA 3T0CA 2V2HA 5A8OA 2OPJA 3C2FA 1M7JA 1S2VA 4H9UA 4IIBA 3RX4A 3TTOA 4JNZA 5I3DA 1ISWA 3TCSA 1SMDA 1G4EA 3LOTA 2X1TA 3V16A 1UG6A 3GC5A 1JXKA 4WXZA 3VMPA 4HPJA 1GW9A 3S1GA 1IZKA 3FAWA 5F2GA 5BOEA 4XVEA 4CQ9A 4X0VA 4NT0A 1R3SA 5M3WA 2J9ZA 2DZUA 3EX1A 3W6LA 1R3WA 1LG2A 3E2VA 1K03A 5LKYA 3LPGA 1QNQA 1CNVA 2ACUA 2W66A 2E68A 1G6CA 3QC3A 1LORA 2PLMA 2F2KA 1SZFA 2Y5EA 3VKJA 4PUMA 5F1VA 5I79A 3F5JA 3O6YX 4S3BA 4K39A 4CD5A 1V3LA 2X0SA 2VHLA 4MUZA 3W7QA 1QOPA 1PPIA 4GBUA 3WMSA 2HVNA 3VUPA 1LYXA 4DWDA 3P3BA 4HYWA 4FZIA 3GW0A 1NAL1 2D20A 4IPIA 2C8NA 1UUOA 2DUAA 1FWJC 4JTKA 1B1YA 1PX4A 1EHAA 3QY8A 4PE8A 3CEPA 4KFNA 3IRSA 2WNNA 5C54A 5CGMA 4AD3A 2VQUA 3KRSA 5CBIA 2J7BA 3AIUA 4Z1DA 5LGZA 4Q4KA 3CWHA 2V68A 4CNSA 5CC5A 4D1JA 3BQ6A 5CSRA 2G4FA 1TR9A 4HTYA 5E9XA 2RHGA 1S2TA 4CU8A 4WY0B 4UFMA 3OGRA 1D2KA 1PTDA 2WSKA 4ZQOA 2PTZA 4LQ1A 1HTIA 2O56A 3GIPA 2J7EA 5AYBA 3CHVA 3UR5A 4AH7A 3GXDA 1DYSA 1GVFA 1XP3A 4DJEA 1UWSA 1RBOB 4K68A 1KTNA 3L0NA 1E1CA 3GLCA 4S3EA 3B9AA 3UZ5A 4B5WA 3H24A 5EMLA 3C2EA 1GZGA 2RGLA 4MYXA 2PLCA 3DG7A 3QY6A 1ITCA 4HCDA 1EJ7L 3UFYA 4QJ1A 3OG3A 2Z1SA 1KGXA 4QSHA 3KS5A 2DJLA 2AL2A 2XHYA 2E7FA 3H2CA 1W1VA 4JTTA 3RJXA 1DIDA 2IW0A 5DRCA 3PTQA 4H01A 1XYFA 1VC4A 2ZA3A 3WQ5A 1KRCC 3W2NA 2HQAA 4KEZA 1ZS2A 4IZGA 4AY1A 4G7EB 1MW2A 1DE5A 2JKPA 3VZYA 1AH3A 3MPGA 3CHDA 4ZZ9A 3R2GA 3G1FA 2DORA 1HL2A 1OVDA 3M0IA 4Q8VA 4RCXA 2P88A 1O94A 2C1GA 4ZB0A 2VD9A 3FEQA 4C6EA 4DAFA 2E6FA 1Q6OA 3UA4A 3QPEA 1N8FA 1XC4A 3P81A 5A2CA 3UA3A 4S3CA 4TVCA 5D32A 1GTEA 1CXEA 5B7YA 5CH9A 2CLFA 3ZT5A 3WD4A 1JNDA 1WX0A 2FB3A 3EX3A 5FAGA 3LZ5A 3SY5A 4UQDA 4WJXA 1RSCA 2YL9A 1PKYA 1Z7AA 3URBA 4G7FA 1ONRA 3CAWA 4CEXC 4D1IA 3VMOA 4DZ5A 2XM2A 1P1XA 1FCUA 1Y65A 1VLWA 3L67A 3M5VA 2DW7A 3LTPA 5FL1A 3PUDA 1DJZA 1W5NA 4QP0A 3VIPA 5EMKA 5AKQA 3EOLA 3OOQA 4FK9A 4KT2A 1XD0A 2WCGA 2YBVA 5HMFA 1YTKA 1XQKA 2WNZA 1P43A 2OSWA 1TTPA 4UXDA 4C7DA 3ITLA 1TO3A 2GVYA 2POZA 2VC7A 2NVDA 1PUDA 2YLLA 1HKWA 5F4SA 1WNOA 2OQYA 2OEJA 4JDYA 4JX6A 3WLHA 4KEUA 2WVUA 5GVJA 4CCZA 3FJLA 1ZGDA 2WHMA 5ABFA 1I4NA 4HMDA 1V3HA 3TQKA 1VP5A 2XN1A 4L64A 3KP1A 1SJCA 3F2BA 3LXBA 4XD3A 4E2OA 3Q58A 3GU1A 1PS9A 3TVAA 4LX4A 1ZRQA 2E8YA 3RRXA 5BOFA 1KXVA 1EC9A 4IIEA 2GYIA 1Q6GA 3QH2A 1CT5A 1SO5A 3RR1A 4ZQRA 2QPXA 3WF3A 4KCTA 4RNIA 1QW8A 1BGGA 1KFWA 3LQGA 2ZRZA 4LY8A 1K8CA 4QG6A 3VIMA 1TQXA 1BXBA 1TE1A 2A3LA 2Z28A 3WUEA 4REQA 2OWXA 4HU4A 4GQGA 1CZ1A 4NSBA 3TE9A 1N8WA 1OINA 2PDUA 1MW3A 3IJ9A 5DBUA 2CETA 4A29A 3N11A 3TR2A 3RR4A 4ML9A 2Z27A 3TLLA 3BG3A 6PTDA 3U7VA 5H8PA 2PE4A 1MI3A 2A3AA 2C3ZA 1E0TA 1GVEA 2OCZA 3LD5A 5BYWA 5EPDA 5LA1A 3VOIA 3B0VC 2JGQA 2OLAA 1ZBCA 2VZVA 3ZLFA 4DNHA 5EB8A 3QHNA 1H51A 5CPOA 5BXTA 1OIMA 4LOCA 4C7FA 1RJPA 1E4LA 1WZMA 2I9EA 4DX3A 5AZ0A 4KW2A 4PZVA 3RX3A 3WNLA 2ZX8A 4DLMA 4DWSA 3EDDA 4ZVJA 4HOXA 3NGJA 3ZLGA 4RV3A 1PTGA 1NIUA 3CZLA 5I3HA 2GLKA 2QEZA 3N2TA 3TA6A 2YYTA 3LHUA 3K1GA 4FXFA 5CPLA 5H91A 1PV8A 1NQKA 1XYMA 1JFHA 5DCDA 5AYIA 4DM2A 4X60A 4DIAA 1J0IA 4FXJA 3DENA 4I5UA 3CIVA 4XZMX 4Z17A 1ONWA 2Y8KA 1Q6FA 2DFAA 2VL4A 3FYYA 2CESA 4MY8A 4HN8A 1UH4A 1G7UA 2DIJA 3BMVA 3ONCA 1TKKA 1QPKA 2XFRA 3S0CA 4F4RA 1E1EA 3N9SA 4BWLC 2CHRA 1BWKA 3FHQA 1IGSA 3EWXA 4XISA 1TELA 3COTA 5LXEA 3VTRA 3MUXA 3P8IA 2REQB 4A21A 4C6BA 5U4NA 1QXLA 4JQAA 3VXGA 1I0BA 3ARXA 3K1DA 2QNEA 3U9IA 1TQJA 3VZZA 2YKKA 5T26A 4L1XA 4WDWA 1ITUA 1KCXA 2PGRA 2WZHA 1A3HA 1U5JA 1Z41A 4GJ1A 3T08A 1QBBA 3Q94A 4NL1A 3RNDA 4H9ZA 4XQ6A 3BLPX 3C86A 2QV5A 4PTWA 1V0MA 3BW4A 3H7VA 4DRSA 1HFBA 3MU7A 3NPUA 1B9ZA 4L1WA 4WKHA 3UXKA 5DXXA 3WQ4A 3CAQA 1S2UA 7ENLA 4HT3A 3WF4A 2GDQA 1DQXA 3KFTA 3WQDA 2X2GA 3EDKA 2CERA 2A21A 1UKTA 4AZ6A 2CW6A 1X97A 3DHFA 4HPGA 5CZKA 1CDGA 5LIWX 3ZLHA 1EKOA 1FRBA 2AMGA 2QQ6A 1SJBA 2W63A 1TMHA 3QR0A 2YSWA 3SFWA 4H2HA 3CO8A 2V5DA 4PMVA 1WZKA 2CLOA 1D3CA 1FWAC 4JAWA 2GUUA 1CGUA 5LYRA 2Z6IA 1SO4A 4GI4A 2X1SA 4ZSUA 2WCAA 1N7KA 1EH9A 3N6QA 4HZ6A 1MO0A 3GR4A 1KTBA 1RP9A 2VDIA 3QTGA 1P7TA 4CNOA 3F4DA 1GHSA 3BJSA 2DSKA 4XAZA 1QBAA 4GKLA 5IBXC 1W3HA 1K8ZA 2A85A 1WP6A 2YCKX 4IF2A 1JDEA 2O9RA 1DTUA 2P0IA 3SQSA 1EP3A 1AL8A 1FDZA 1TCMA 1IWBA 2R1MA 4J35A 2J6VA 1SPQA 4M6VA 4QLKA 5D30A 2RGMA 3GM8A 4CVWA 5JXQA 1S46A 4N9DA 4WK9A 4J3TA 1BD0A 3VKKA 1T8XA 2CFFA 4AZGA 3G1YA 3ITVA 3EA3A 4CKQA 3KOZA 1WAWA 4L6DA 3B9DA 3BLOA 5DN1A 1YNYA 5IRPA 1X38A 1T99A 5LA2A 6CGTA 5I77A 3WDQA 1D7KA 1BG4A 2DZTA 5HINA 1W91A 1PZ2A 4US6A 1G1YA 4OV4A 5TIMA 1ME7A 3B03A 4WJ8A 4E8DA 4AD0A 3O0FA 1GJPA 2PZ0A 1CI1A 3U0HA 1UC4A 1IWAA 2AOSA 3LHTA 5DQPA 3LTSA 1VPXA 4JICA 3UY7A 1QDSA 1KM6A 4XB3A 1L2QA 1YYAA 3PPGA 1QHZA 3AXKA 1W5PA 2OZ3A 3UNDA 1XGDA 1MEIA 4U3AA 1RUSA 3M6YA 5DMNA 5CC6A 5H8MA 1PL9A 1Q7MA 3PS7A 4WSHA 2Z2BA 1TVPA 5G2HA 4C1LA 3AIVA 3S5YA 1F3EA 5KEZA 3WBWA 3ECQA 3QGVA 2WSPA 4JS3A 5FKYA 3FFSA 4P8VA 1X1ZA 4DJFC 3I3DA 3T0BA 1KQZA 1GZJA 3SR7A 3AOFA 1MEWA 1J6PA 5I2UA 1W3LA 2OT0A 2QYGA 1UR2A 4KKXA 3FOKA 3GXNA 5FEXA 5C55A 3MMUA 3SUSA 1HF6A 4U5KA 3MT1A 1THFD 4EXAA 1J0KA 4LYPA 2NQ9A 2VR5A 4DZAA 5HXMA 4HQVA 3S46A 1ZALA 2NQLA 4QE1A 4A6GA 3W24A 4WDUA 3IRDA 5A6BA 3SEPA 4JL2A 4Q7NA 3BLDA 1EIXA 4OGZA 2HPIA 4A2RA 4YMZA 4QAIA 2PGFA 1KWGA 4ZTXA 5AY7A 1I0DA 2Y24A 2QCCA 4ML4A 3HG3A 2NW0A 1A80A 1A5NC 1NWTA 1H1ZA 1LL4A 4MWAC 2PB1A 3VD9A 4ZE4A 4JTCA 3N34A 2WYSA 3UCDA 1UWRA 4HGXA 4QROA 2BDQA 2V2DA 1YPFA 1J0ZA 3B06A 2BXYA 4JXCA 2WB5A 2Z1BA 3GNOA 3A4JA 1OC7A 1M7XA 2H9AA 2VELA 4XX6A 4JFUA 4IGMA 2JEQA 1X1NA 2C18A 3LCHA 2VM8A 4HSNA 1UMLA 4GZIA 2UZ9A 1W9XA 1IHIA 3AWOA 3VNZA 4AZ5A 3WFZA 3V5CA 7ODCA 1DXIA 2X0YA 3R0KA 3ZYZA 3AU6A 4FNQA 4PUEA 2HK1A 1W1ZA 4HYVA 1O1HA 1SYTA 1DE6A 2V81A 1JUBA 2PF0A 3NL5A 1EA0A 1PTAA 4AVFA 3OYXA 4UZUA 5D02A 3VOFA 1NWRA 3RILA 2A3BA 3NNTA 2EBNA 3L9CA 4UR9A 4ORMA 4PRTA 4B16A 3LA4A 3MHFA 3M0JA 3Q67A 6XIMA 2XZ9A 3QOKA 1YADA 4R9XA 1GJWA 2IKJA 2HVMA 1H60A 1MFVA 3QV7A 2OQLA 1M41A 6ALDA 4I6KA 2NQ5A 3EOOA 3GQYA 5KMYA 2ISSA 3VGBA 5AECA 3B8VA 3TWAA 3RPDA 4HNUA 3W28A 4ZMGA 1VCGA 2EKGA 3JW7A 1ECQA 5BXPA 4N2YA 2OZ8A 3BICA 1YEYA 3IJIA 1TIMA 5IFPA 3SSZA 3G1HA 4NASA 3GTIA 2Z24A 3MHGA 2XISA 3L5AA 4H41A 2CKSA 2PURA 3UR7A 4XKMA 4FO4A 1QAPA 4MNJA 4YXGA 5EKYA 4DJDC 5AC4A 3M44A 4ZENA 4AX7A 3IK2A 4CD4A 2QAFA 3W1LA 4UMAA 3S2MA 3ABRA 3O3RA 3CQ0A 3UR8A 3TKFA 4W8LA 2ZADA 1JPDX 4HNTA 4HCLA 1VB9A 1ADSA 3CV1A 2B7NA 3VGDA 1C91A 3S5ZA 3M1ZA 1HIZA 1C8YA 1XRSA 3L0GA 1X98A 1XKYA 3KBSA 1O5QA 3R4IA 4JNYA 2V3EA 1OGSA 2CBVA 1KM0A 3W23A 3AZRA 5FI8A 2FHFA 5HNNA 4JCMA 1E9IA 3W53A 2WMHA 4R33A 3K46A 3HQ1A 1PCKA 4FHAA 1X7IA 2WNWA 3QZEA 1CEOA 4K8HA 5AHMA 2EPNA 1GGOA 3OHIA 2PDWA 5MKGB 1GYNA 1GORA 1L6YA 4NJIA 2BOEX 1ICPA 4AEEA 2X09A 3FW6A 3GVQA 3N2OA 4NQ1A 3N29A 4OT7A 3L65A 1XYBA 3EPNA 3UGRA 3EKLA 3HA1A 3OZYA 3T6CA 2WNQA 5AB3A 3UXAA 3GKFA 1I1WA 4NNCA 2QDDA 4YWSA 3BAJA 3W00A 3EMZA 4C1NA 4LW7A 1O5KA 1Q65A 5BMWA 3O07A 3TC3A 1HUVA 5C70A 4DLFA 3G0SA 1I2PA 5KTLA 1OFBA 4FLRA 2VVSA 2YCLA 3ZR6A 1UPMB 1NU5A 3B3DA 1Q4NX 3MW7A 4ONVA 3S9ZA 3BCJA 3TYBA 3W4RA 4MZ1A 4BHYA 1H7WA 3APYA 1PB0A 3MP3A 1UC5A 3RAOA 1E6SM 3OVGA 5HPCA 4L4OA 3ARYA 3U8GA 2XWDA 1JRBA 2CZ5A 4NRRA 2ZTKA 3DKJA 3T4WA 3ZM8A 2WVSA 3NVDA 1UIOA 4RLIA 7TIMA 1B31A 1UKOA 3EB2A 1GTHA 3BJFA 3H2AA 1FKWA 2AKZA 4KWSA 1TMQA 2WAGA 1MRQA 1BYDA 2Q3OA 4GC3A 1L8NA 4QTGA 3DERA 1JPIA 4XK2A 3MBFA 3TQPA 3NVTA 2WZMA 1N8IA 1C9DA 3DUGA 2IUZA 3EWDA 1SW0A 4PRWA 3S2JA 3BLFA 4ROQA 1QU4A 5GJMA 1QNVA 1UA7A 3NYDA 1ADDA 4PA8A 3UPMA 3BAKA 4O17A 3SADA 4ZQCA 2FTYA 1A49A 1EHNA 1XIEA 5F4WA 5HQEA 5CSYA 3NQCA 3T78A 2ZC8A 1GW1A 4W4QA 3VNYA 3GIYA 2ZTJA 2ACQA 5JVLA 1F76A 2DZWA 2OX1A 4PUNA 1AW1A 3LCFA 1XXXA 2JE8A 5AHLA 3B0XA 5FJIA 3EDEA 1W17A 4PL1A 1LF1A 4J27A 4V33A 4GD0A 3KUMA 3P0XA 4LYRA 5A2AA 4GQQA 1K7EA 3THQA 4JIRA 1MFUA 1UUMA 3G8EA 3QHOA 3FVMA 3F4VA 3GWQA 3G1VA 3WFLA 4UCGA 1OGBA 2EGZA 3L4TA 1D8WA 3WO8A 1OM0A 1QPRA 1YDVA 4YTUA 5DF0A 3WH7A 1LLZA 3BGAA 2GOUA 2FZBA 5LGXA 3PBMA 4MJMA 5A8MA 3BTNA 1PX3A 3AUJA 3SO7A 1E6QM 1QWGA 1S2WA 3UG5A 4IMFA 1ITXA 4V15A 3OGSA 3LPOA 4R5EA 1RLCL 2I57A 1VFFA 4LVAA 1OK6A 3GHUA 1IE7C 1H5YA 1W5MA 1H7PA 4GUGA 3WH6A 4F0SA 1YLVA 1H41A 4QAWA 4LH8A 3LCXA 3DYPA 1Q5MA 1PXGA 3TJIA 4RZBA 4E2VA 5IDIA 2FFIA 1TJ0A 4H8NA 2J9XA 5C2GA 4IUGA 4D6IA 1B9BA 1TMLA 3KTCA 3AS2A 4FR6A 3MYOA 2J8TA 2DVXA 1IYXA 3RLHA 2IPFA 3EXRA 4KWUA 4JIQA 3NPWA 3CV6A 3FV9A 5E09A 3CM4A 2PGWA 1REQB 1K3UA 4JCLA 3AJ7A 2VKZG 4W87A 4L4MA 3K2GA 3VIFA 4JHZA 3R8HA 1Z6KA 2DSWA 1HGYA 5D05A 3QKEA 2UBPC 4PTXA 4D6GA 5A6AA 1A50A 3W25A 3NFUA 2I9UA 3M5YA 1GEHA 4DBWA 4MB3A 2BGSA 3MKCA 3IAQA 5CKSA 3IAPA 2IPWA 1WOAA 4QLJA 1IEWA 1HKIA 1YBQB 1JI1A 2DJXA 1QHOA 1EBGA 4YYCA 4LAMA 5F7UA 1AL7A 3LBOA 2J77A 3WQPA 4RV8A 5CZTA 1Z3NA 3V3WA 4MDPA 5HQLA 1UB3A 4TO8A 5DXYA 4FAMA 3BCFA 4ZXOA 3FS2A 1KM4A 1FP8A 1GOIA 3NAVA 1TSIA 4GA8A 4NAFA 1A4LA 5C71A 1XLIA 3R13A 3BAWA 3S2LA 5I06A 1KQYA 2QHAA 5HULA 1NFBA 3G1XA 1ZUAX 1H11A 4WZHA 5A69A 4QE4A 1S5VA 3WLJA 4ALDA 2E5CA 4IGHA 1DL3A 4I6VA 3HV9A 2R1NA 3LMYA 2V9DA 3P5ZA 1XLBA 3F4CA 2E6DA 3RU6A 3GYEA 5JBDA 2VCBA 3KE0A 3STFA 1TPFA 2YGYA 1R3YA 5I3JA 5E93A 2Y4SA 3N9KA 2PDJA 1O6IA 4RUBA 3ALFA 1XLDA 1XGEA 4ROPA 1CBGA 2X7VA 4CN4A 4R34A 1LUCA 4ZR8A 4ZOAA 1FDYA 1R30A 1D3GA 1TB3A 2CWXA 1FX6A 2WKLA 4MFEA 1YRRA 2XIQA 2P50A 4JIPA 4L6OA 4PMRA 4BWLA 2WHJA 3C6CA 3I6TA 1KFJA 1R87A 2YW4A 1XYCA 2VTFA 1UKQA 3L66A 3ZMRA 2YPIA 1HJUA 1Z9AA 1YHTA 3NL6A 4O1FA 1XLGA 1QASA 1DXEA 4W84A 5DLCA 4HNVA 2ZCGA 3L5LA 4IPLA 2ZX5A 1W9DM 1DORA 3AS1A 1X6UA 2MUCA 3T2PA 1AD1A 4B5XA 3T81A 4ORIA 1ZQ5A 3SJNA 2XIIA 4Z1CA 5DCEA 3GXPA 4YTSA 4AMCA 2A3CA 4JNMA 4AY8A 4JIIX 1TPEA 1US3A 4QEHA 3BOLA 1ZBWA 2Y7EA 4DBSA 4FF7A 2QUUA 3SFKA 5LHFA 4ZOCA 3W83A 1FWGC 3WLTA 3TSDA 2QXWA 1IT0A 3W6MA 5BCAA 4GUHA 4LUYA 1FOBA 2NLYA 3WUBA 4H8HA 3MV01 4Q8PA 1NM9A 4PH6A 3CPRA 1HO1A 4IG2A 4Z2JA 3M46A 1OF6A 3O15A 2Y5SA 4GINA 1H61A 3V0UA 2Y63A 1EPVA 4IJRA 3SUUA 3UJFA 3NM1A 3TZNA 4Q7BA 6TIMA 1VFMA 3G0XA 1R8LA 3HPSA 2CHOA 3WDPP 2GSJA 1GKQA 4QG9A 3AJXA 1B4KA 1EOKA 2YR1A 3LCGA 3BZJA 1BRLB 3FXGA 4ATWA 4S2BA 4AD4A 3RPMA 1OG6A 4BCEA 3VOCA 2Z7GA 1PZ0A 3P67A 3NM3A 1OY0A 5G1YA 2VX6A 4A3QA 1W1A1 1NQ6A 1R6WA 4YCOA 3OZPA 5LA0A 3V1PA 4LF2A 5IBXA 2PD9A 5EA9A 2E5DA 1HX0A 3W76A 3QC0A 4K6AA 3LS9A 2O7SA 1HXJA 3NCOA 3EPMA 2QS8A 1VD6A 4GJIA 2YYUA 4CD8A 1GUVA 4TVDA 1S2AA 1R3QA 3H2EA 3M43A 3O05A 3SGUA 3PTMA 1XPYA 3EXTA 5BWAA 4O57A 2BOGX 3R94A 1DJQA 2Z25A 2P10A 2QUMA 4D2JA 4DJED 1D8CA 3M5ZA 2DT3A 2TMDA 7PTDA 1F6KA 2GGJA 3OA5A 3O9NA 5G5IA 4NY2A 4LYQA 3QSTA 4LUJA 1JDAA 3KW3A 1C7SA 2QCGA 5JUVA 1FA2A 3W07A 5T9BG 1M04A 4LTSA 3VNLA 3FA5A 2O92A 3GW3A 2WPBA 3BSMA 1J79A 2CXEA 3MDUA 1GZ1A 3S1WA 5HNUA 3GBDA 1YXDA 1C8VA 1L6WA 2YXGA 1G94A 2GJXB 1RQEA 1RBLA 2QJJA 1W8SA 1OCQA 1FXQA 4H7CA 1O68A 3GNDA 4QJ4B 4D6DA 3QLLA 4WOQA 2PDCA 4MAVA 3DXIA 5FJOA 4RZ6A 4GIRA 1AMKA 3GDRA 3SN1A 1V3MA 3KVLA 4QR6A 4H00A 1WXYA 5H2ZA 3ZT7A 4HOWA 5E0FA 4MADA 4OE7A 4U28A 3DFYA 4PULA 4EWJA 2YL8A 1SM9A 1MXDA 3I7SA 1FP9A 4GWEA 1F61A 3B4UA 2A7RA 3NPXA 3OVRA 2D3NA 1ZCOA 4S3FA 4JD4A 5K7JA 1WDWA 3D47A 3IGHX 3WMLA 1E0VA 1KM1A 1NF0A 2JF7A 4AZIA 4PBGA 1SZRA 3CUJA 1EQPA 2Z2AA 3GG7A 2EJAA 2XGZA 4C6JA 2GK1A 2BWGA 4N42A 2ODOA 2XH7A 2OFJA 5A3HA 2AMXA 2PD5A 5A6LA 2JBMA 3PNZA 3S5OA 2INZA 2BVTA 4ZGYA 3FKRA 4C6OA 5E0KA 1GKPA 3SGZA 3NIYA 3TMQA 2XSAA 3S47A 1J0HA 3W87A 5KINA 5M17A 3CLMA 2VEKA 5HANA 2WHLA 3VD5A 4F0KA 4NIRA 1ITQA 3HGJA 4MWAA 4PFMA 4WHBA 2GZXA 2D1ZA 1XLMA 4DF2A 2VENA 2ISVA 2XFWA 1OC6A 3W22A 1MRAA 1HNYA 3OG2A 3GNNA 2QPUA 3WQ6A 1WE5A 3GVWA 1MDRA 1QR7A 5LXXA 3ARUA 2PDGA 2C19A 4Q8NA 2VRQA 3VX0A 3DFTA 3ZSTA 1XIHA 2PRLA 3I10A 4O8RA 4F8XA 1M03A 1XG3A 4GYFA 3BL3A 4QGCA 2TSYA 3BE7A 1OBAA 2PC4A 2VFDA 2YDAA 3THCA 2R24A 4CQAA 3HTWA 1A0CA 5CPSA 2ZXQA 5I09A 1J2BA 1PBGA 2HXTA 4JEQA 3W2MA 3FCPA 3CNYA 1E3XA 2P8CA 3QJAA 2VFHA 2OT1A 1B54A 4HB7A 2BNJA 4L80A 3UP8A 1CGYA 1OD0A 4GVFA 3PTDA 2JK2A 5CQ1A 3AHVA 4AZ7A 1TV2A 2XDFA