3PBLA

Structure of the human dopamine d3 receptor in complex with eticlopride
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
432
structure length
432
Chain Sequence
YALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
pubmed doi rcsb
molecule keywords D(3) dopamine receptor, Lysozyme chimera
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 163
structure length 432
sequence length 432
chains with identical sequence B
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 3pblA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3pblA01
3PXOA 3DN0A 4BWBA 118LA 1S54A 5AX0A 2YCWA 4OO9A 3CODA 1D2YA 3HAPA 1X0I1 1CU6A 144LA 214LA 232LA 2JAFA 3VHZA 1CVKA 1L75A 1KW7A 1QUHA 5DHGA 4LDEA 1CU5A 2VT4A 1L54A 3SB6A 1L68A 244LA 1L20A 3C8RA 4BEZA 3NY9A 190LA 148LE 138LA 1LYFA 3L2XA 2X72A 5DYSA 4IARA 2QB0B 2L6XA 1G1WA 3COCA 1KNIA 3DN2A 3OE9A 4I7MA 5I14A 5J7AA 2R4RA 4ARLA 2RBQA 4W51A 3JR6A 3A7KA 4G7SB 4IAQA 125LA 1D3NA 1L28A 1P3NA 4I7RA 1LYEA 225LA 4GPOA 1LI6A 2Q9EA 3HUKA 4MD1A 4MQTA 5AHZA 192LA 249LA 3C7ZA 2Y00A 2KSYA 1L65A 1T8AA 1L98A 3CDTA 177LA 2KSAA 3AM6A 1L79A 3CAPA 234LA 4L35A 3OE8A 1L62A 2Z73A 1QTCA 1BM1A 1QTZA 200LA 1L48A 205LA 252LA 1DYCA 3ABWA 3HASA 1LW9A 2B72A 1UCQA 1L21A 4OV0A 1QTBA 4K5YA 2Y04A 3HH3A 2OE7X 113LA 1JTMA 1C6EA 1P8IA 3NSBA 2RBOA 4MQSA 2I35A 1JV7A 1L34A 1L71A 4ZPUA 1F4ZA 166LA 129LA 1OV7A 2JAGA 3HDEA 1L99A 222LA 167LA 2B7XA 1LLHA 216LA 107LA 1LYGA 4AMIA 4W57A 3S3CB 3CDVA 1XJUA 1ZWNA 2HUKA 1P8HA 4W55A 220LA 182LA 1L08A 1C6FA 1L29A 4ARPA 1C6AA 1L77A 2RAYX 1HZXA 248LA 4A4MA 3UTVA 162LA 4W56A 1C61A 3SB7A 6LZMA 1C6DA 145LA 3F9LA 1L0JA 3HWLA 4PJZA 206LA 1C8RA 1L74A 2EI4A 1L26A 2I1XA 4WW3A 137LA 1TLAA 2RB0X 4I7SA 4XXJA 2Y02A 1QSBA 4LZMA 180LA 142LA 4QIDA 1L36A 253LA 4I7OA 4N4YB 4X31A 3PWHA 1GUEA 1CV0A 1QTDA 2CUUA 5KKHA 2B74A 3RUNA 1C68A 122LA 4EPIA 1QHJA 1XMEB 5H2KA 4EIYA 1L32A 4KNFA 1JTNA 1KG9A 3HU9A 3C81A 4AMJA 1EPYA 247LA 3HT7A 4EKRA 4Y9HA 2YCZA 3HANA 1PXSA 3QBGA 1L03A 2QARC 1KY0A 1L23A 1L84A 1C6IA 2RH1A 1LGWA 3UTYA 1CV6A 4IB4A 1CU0A 157LA 4I7QA 2NTUA 1L05A 1S51A 4KLYA 3EH3B 1P5CA 1B6IA 3QJQB 3VGAA 5H2LA 2NTHA 3QJRB 257LA 4ARJA 3S8FB 237LA 2AT9A 2ANXA 242LA 3HTGA 3SB8A 4EKQA 5G2DA 1CV1A 3GULA 1LGUA 1LN6A 2R4SA 2OE4X 5H2PA 1T8GA 1L09A 172LA 1C6NA 245LA 3FI5A 1C60A 4GYCA 1L38A 1UAZA 3HH4A 1C6JA 4FPDA 4GP5B 3HUAA 1QUOA 156LA 3MBVA 4I7NA 236LA 3ODUA 2WJLA 197LA 195LA 1S8LA 5TGZA 1G07A 3NYAA 183LA 4LDLA 3HH5A 5JJNA 1QUGA 5A45A 2O4WA 1L16A 5H2MA 1C62A 5G54A 108LA 3DN6A 256LA 1GZMA 1L94A 191LA 1L24A 1L17A 1L52A 1TN0A 3DQBA 1LI2A 1OVHA 188LA 4GBRA 1CV3A 5AZDA 3UTXA 1L10A 5ETZA 5B6WA 3VI0A 5EN0A 181LA 1U19A 1QT6A 1DYDA 1OVJA 2O79A 4DJHA 1L19A 1L97A 1P7SA 3PBLA 1L15A 4XTLA 3VVKA 1L83A 3X3CA 1PY6A 1LYHA 1SWZA 1OYUA 1QT4A 2OU0X 198LA 1IW9A 1L45A 4XTNA 5B6VA 3GUPA 3QJUB 143LA 184LA 240LA 1L59A 147LA 3OE6A 1C3WA 1L43A 3FA0A 4L6RA 1G0GA 2B6YA 171LA 1L14A 2BRDA 5B34A 4BV0A 5B6XA 3UZAA 173LA 4X1HA 3SBAA 5F8UA 1EHKB 1C66A 4UG2A 2YCXA 163LA 4EKPA 1L07A 1L67A 3QAPA 1L86A 2OE9X 3VW7A 4QI1A 3OAXA 260LA 1CV4A 4JQ6A 1KMEA 155LA 2WJKA 4G7QB 3SB9A 1KS3A 4HYXA 1L69A 3C83A 176LA 4TL3A 3GUMA 1Q5IA 4W52A 3P0GA 1C6KA 250LA 1CU2A 1PQDA 4EPFA 1M0LA 4N4WA 3GUNA 4FA7B 3EH4B 1P8UA 1T97A 5AX1A 3PQRA 4UHRA 4W54A 1LYIA 2RB1X 1FBBA 4W58A 3RZEA 1KGBA 196LA 1QM8A 3REYA 1L0MA 3D4SA 3HT6A 3HTFA 5G2AA 1L85A 5BR2A 4HWLA 1P64A 4YX7C 5AHYA 1C6TA 1C67A 2Y03A 4J4QA 1XJIA 1CX7A 1L87A 1P2LA 1C69A 229LA 5H2IA 1ZURA 4FBZA 4XTOA 1L37A 1LI3A 158LA 3S3DB 3C7YA 5JJJA 5B35A 1QS9A 4PXFA 5BR5A 228LA 4FAAB 1L40A 1G06A 1XJTA 1L41A 1L35A 149LA 1L64A 2KS9A 1F50A 1M0MA 178LA 3V2WA 3AYMA 1L51A 1CUPA 1D3JA 115LA 1L39A 2B70A 127LA 1L31A 1L95A 239LA 2PEDA 230LA 3DNAA 1L90A 1PQIA 1L25A 1OWYA 2LZMA 1L11A 3QBIA 1QT3A 119LA 3SBBC 261LA 2O7AA 1E0PA 262LA 4IAPA 3X3BA 1CV5A 1BRRA 1L0KA 3GUIA 146LA 139LA 2F32A 3NY8A 1OV5A 2KSBA 1L22A 1L93A 4EA3A 224LA 5H2NA 3HU8A 159LA 1AP9A 3HT8A 2RAZX 1QKOA 1CX6A 1XIOA 4G71B 3DMZA 5B0WA 4XT3A 5B2NA 3DN1A 3T45A 1LGXA 235LA 140LA 3RFMA 210LA 2NTWA 2F95A 5ITEA 1P6YA 1QTHA 186LA 251LA 3C8QA 3OE0A 123LA 3HH6A 102LA 3HAOA 1L61A 1L88A 1LWGA 2RBNA 4I7LA 1LWKA 3G3XA 1X0K1 2ZFEA 3SN6R 4G70B 1M0KA 3S3BB 3GUKA 2RB2X 2LNLA 1C65A 120LA 1JFPA 4ARQB 1L72A 2I20A 1DYAA 1L01A 3HUQA 5B6ZA 3VG9A 1C6HA 1L56A 1I6SA 1L81A 2B75A 3LZMA 5H2OA 1QT5A 1SSYA 238LA 2Q9DA 2QPDB 2F2QA 1F88A 1R84A 2QPEB 1L96A 4MD2A 103LA 1D3FA 1IW6A 1G0LA 3DN8A 1L63A 165LA 233LA 1KY1A 1G0JA 231LA 3V2YA 2HPYA 1OWZA 1L9HA 3GUOA 4S0WA 1L47A 3HTBA 1KW5A 1CWQA 1VJMA 1P2RA 111LA 2J4YA 3ZEVA 1L33A 241LA 4I7JA 5B6YA 1L92A 1G0KA 1IXFA 4X32A 2L78A 3NS0A 1QKPA 4AQNA 1T8FA 211LA 1CTWA 226LA 3DN4A 2A4TA 3UTWA 1C63A 160LA 150LA 3S8GB 3QJVB 3CDQA 1PQJA 164LA 2IGCA 4WAVA 4JKVA 1Q5JA 1E12A 4NC3A 3AYNA 227LA 2HUMA 2OU8A 4BUOA 169LA 1D2WA 5ITCA 1LYDA 4W59A 2LC9A 1QT8A 131LA 1NHBA 1G0MA 2B6WA 175LA 3G3WA 1JGJA 1X0SA 219LA 3ZPQA 3QDCA 3DMXA 4G7RB 4QRYA 4ARMB 1BRXA 3PDSA 2B73A 254LA 4PK0A 4GP4B 1L82A 4EKSA 4YXAC 187LA 4EXMA 1KG8A 3UG9A 3EMLA 3QBKA 1L12A 1S8JA 1C8SA 4G72B 1H68A 5G36A 212LA 5C1MA 189LA 2I21A 3C9LA 1L89A 2LCBA 1C6GA 1PQOA 4JR8A 1L49A 4ARQA 4PXKA 1C6CA 2OTZX 3BVDB 3HARA 1QT7A 161LA 5G28A 3QJSB 3QJTB 3SB5A 1MGYA 1L50A 1L42A 2RBPA 2G87A 1L30A 1QSQA 1G0QA 3DKEX 1L76A 1WTHA 3DMVA 3HTDA 1GU8A 1ZYTA 2M3GA 2ANVA 2RBRA 2YDOA 1BRDA 5JJEA 4GP8B 213LA 126LA 1OVKA 2B6TA 1S52A 1QUDA 1CU3A 1L55A 2OU9A 1L27A 1G1VA 1C64A 3C80A 1JQUA 3HAQA 130LA 1PQKA 246LA 1T6HA 128LA 110LA 1L02A 218LA 2Z6BA 1DZEA 4N6HA 109LA 1P36A 1CUQA 1L44A 1QS5A 5H2HA 3DN3A 1S53A 5A44A 1C6LA 168LA 1DYBA 1PQMA 2YDVA 4HYJA 4GBRB 4E97A 1L04A 1L57A 1G0PA 1L06A 209LA 3HDFA 3QAKA 3HT9A 1C6MA 1L13A 4W53A 1SX7A 1AT9A 1VGOA 1K28A 4I7PA 3DDLA 223LA 2F47A 3UONA 141LA 2B6XA 1L91A 1LYJA 5FJGA 1C6BA 5LZMA 199LA 5G2CA 3ZPRA 1D9WA 1DYGA 1L70A 112LA 2Y01A 2ZZLA 1L60A 5G53A 1L53A 1SWYA 2OEAX 4ARMA 1L00A 1L73A 3KJ6A 5A8EA 5LWEA 1L46A 4XT1A 3K2RA 1XEPA 151LA 2B6ZA 201LA 243LA 4DAJA 3C9MA 3C8SA 1C6QA 4GRVA 255LA 185LA 2NTGA 5H2JA 7LZMA 4I7KA 3C7WA 1TN5A 258LA 5DHHA 1DYFA 4BEYA 1L80A 215LA 2F93A 1L58A 2OTYX 170LA 1QTVA 1P37A 3QBLA 1LPYA 3GUJA 1C6PA 1P56A 3FADA 1FBKA 1DYEA 114LA 217LA 104LA 5AWZA 1SX2A 2YCYA 1R2NA 3CDRA 4MBSA 3EH5B 1SSWA 1PXRA 3L64A 174LA 4BVNA 259LA 2RBSA 1L66A 3UZCA 3WQJA 1L18A 4EJ4A 1P46A 3G3VA 4YXCA 4I7TA 152LA 1D3MA 2Z55A 1JV6A 3CDOA 221LA 3F8VA 1H2SA 2HULA 4DKLA 1O0AA 2ZIYA 3C82A 4LDOA
chains in the Genus database with same CATH superfamily
4R0FA 118LA 1S54A 1CKDA 3B6LA 1X0I1 1CU6A 214LA 4Z98A 5LAGA 1CU5A 1QQYA 2H9JA 1L68A 4NGKA 3J6KA 148LE 3L2XA 5DYSA 1LZYA 132LA 1WQPA 2F2NA 1DZBX 4W51A 1CKCA 4C5FA 1D3NA 1P3NA 4I7RA 4X32A 4GPOA 5AHZA 5M1YA 1HSXA 4J1BA 177LA 1L98A 1YKZX 3A3QA 4N0JA 3B0IA 1BGIA 5IHGA 1REXA 1L21A 4OV0A 1N4FA 4MQSA 2N5ZA 1B5ZA 1JV7A 4NHSA 1LSPA 1L99A 222LA 1WQQA 4DYGA 1LAAA 107LA 2DBTA 3LZ2A 4AMIA 2BQGA 3CDVA 2HUKA 1L29A 4G49A 4ARPA 6LYTA 1L77A 1G7JC 1C61A 1D9UA 5KXYA 1C6DA 2XJWA 3F9LA 1C46A 1L0JA 1GE4A 1VDTA 4PJZA 5C6IA 1L74A 2EI4A 1GB0A 3CT1A 180LA 1LSCA 5KXPA 3MGWA 4E3UA 1QTDA 2CUUA 3B0KA 1C68A 1AT6A 122LA 1XMEB 5H2KA 4EIYA 4RLMA 1OUCA 3G3BB 3W6BA 1LJGA 4ETAA 4Y9HA 2YCZA 2Z2FA 3QBGA 1KY0A 2EIZC 4WM3A 1JITA 1CV6A 2CDSA 4IB4A 157LA 1JTOL 1P5CA 5H2LA 257LA 4ARJA 1GFUA 3S8FB 4YEOA 3HTGA 1GB3A 1GFAA 1CV1A 1BWJA 3GULA 1LN6A 172LA 1C6NA 4BADA 5KXSA 4B49A 1YQVY 1JIYA 2C8PA 197LA 5A45A 3N9CA 4UWUA 4TSBA 1NQIA 1GPQC 1HEOA 4GCCA 5AZDA 1IC5Y 5ETZA 5B6WA 1FKVA 1REMA 3RT5X 1DYDA 1L97A 1CJ9A 1RJCB 3X3CA 1TEWA 3A6CY 1UIEA 2ZIJA 198LA 1IW9A 1L45A 4NSHA 3IJUA 5DM9A 1L59A 147LA 4XJFA 2ZWBA 3FA0A 4L6RA 3WXUA 171LA 3EO5A 4DT3A 173LA 3TMXA 1C66A 4UG2A 1L07A 4U3XB 1QTEA 3AW6A 1LKRA 1L86A 3VW7A 3QAPA 260LA 1KMEA 2FBDA 1DQJC 1L69A 3C83A 2LYOA 4BAPA 3LZTA 1GF9A 3P0GA 1M0LA 3TMUA 4D9ZA 4N4WA 1JKDA 4FA7B 1F6RA 3CQLA 1T97A 1AT5A 4OW1A 4W58A 3REYA 1QM8A 1GFEA 3D4SA 3HTFA 3LN2A 1L85A 4GN3A 5AHYA 2Y03A 4CJ2A 5LIOA 4OWHA 2ZQ3A 4LYCA 2EQLA 229LA 5H2IA 4XTOA 1LZNA 1GFGA 1SLYA 2DQGY 1IOCA 2YBIA 5B35A 1B7RA 4PXFA 228LA 4PJ2C 1L41A 1L64A 1PZYA 1M0MA 5LA8A 178LA 3AYMA 1LCNA 1IC7Y 2PC2A 3V2WA 1CUPA 1D3JA 1AM7A 1LJFA 239LA 230LA 1IP3A 1YILA 3EXDA 1QUSA 5I4XA 1QT3A 3SBBC 1B7OA 1E0PA 1REZA 3LYTA 3GUIA 1Z55A 2MEDA 3A34A 1L22A 1L93A 2D4KA 224LA 4EA3A 1BWIA 159LA 5C6LA 5LXWA 1BVXA 1B0DA 3CSRA 3DN1A 3T45A 3WUAA 235LA 4GCEA 210LA 2F95A 1OUDA 4H94A 4NSGA 2DQIY 1QTHA 1YANA 4G9SA 3FI7A 3C8QA 3OE0A 4TUNA 3E3DA 3HH6A 102LA 2DQHY 1L61A 2ZFEA 3G3XA 1X0K1 4PPOA 4G70B 3GUKA 2LNLA 3SP3A 4ET9A 1L72A 1XGTC 2I20A 1CKFA 3BKHA 1L56A 2B75A 1QT5A 2QPDB 2Q9DA 103LA 1D3FA 2ZNWY 3DN8A 1L63A 5E9RA 2ZYPA 1KY1A 231LA 1DPXA 2MEIA 4HJYA 3LYOA 3IWRA 3AZ6A 1GBSA 1LSYA 3D3DA 5DL9A 3WYHA 4ETEA 1T6VL 3DN4A 5HMJA 3UTWA 1JKCA 4NGLA 3QJVB 1F10A 1JPOA 3WVYA 2FYDA 2BQEA 227LA 1QUTA 4LFXA 1D2WA 3AGIA 5D5CA 4CHXA 4W59A 2ZNXY 3M18B 219LA 4YM8A 4G7RB 1IP5A 2B73A 1L82A 4EXMA 1KG8A 1GF6A 1LMAA 3QBKA 5G36A 1JTTL 212LA 3TMWA 2I21A 4C3WA 1NBZC 4WM6A 1UIAA 1C6GA 4ETDA 2YBMA 4NHIA 5B07A 4JR8A 4ARQA 2ZQ4A 4NGJA 161LA 3SB5A 3AB6A 2RBPA 2D91A 3DMVA 1L76A 1GU8A 2YBJA 1ZYTA 2ANVA 3A3RX 1OVKA 1B7PA 1QUDA 5FELA 4G4BA 1XFPL 4H8XA 1C64A 3P68A 2HEEA 218LA 4NHPA 1DZEA 1IR9A 1CUQA 168LA 1GDXA 2MEGA 1L57A 1HEPA 4XJHA 1G0PA 2DQAA 1SX7A 223LA 141LA 4RW2A 1L91A 1C6BA 2B5ZA 5G2CA 1D9WA 3WXTA 2Y01A 3P65A 1L00A 5F14A 1ZMYL 1XEPA 151LA 201LA 3C8SA 1BB6A 4KL7A 255LA 1GF3A 5H2JA 5KY1A 4TX7A 3C7WA 5HNCA 1O23A 4DD0A 1DYFA 4BEYA 1L80A 5FHWA 4B0DA 1F6SA 1C6PA 5HNLA 4ZEEA 1FBKA 1DYEA 3CDRA 3L64A 259LA 2RBSA 4HJVA 4DC4A 2D4JA 1D3MA 2Z55A 3CDOA 1LJKA 1WQMA 2BQHA 4OOOA 2ZIYA 4PGJB 5AX0A 1LZBA 3CODA 4HTQA 4NGYA 1D2YA 1VEDA 1CVKA 1L75A 2Z39A 3RNXA 4H9FA 244LA 3NY9A 190LA 1LYFA 1HC0A 4LYOA 2QB0B 3DN2A 1HEQA 1UBZA 3A6BY 5I14A 5II3A 5J7AA 2R4RA 2RBQA 4G7SB 3JR6A 3A7KA 1HMKA 3W6CA 1WQNA 1L28A 3HUKA 2Q9EA 4HTNA 1LZ5A 249LA 1T8AA 3CDTA 3AM6A 4L35A 1L79A 234LA 1YKXX 2Z73A 4UWNA 2LZTA 1QTZA 1YKYX 200LA 1DXJA 252LA 3HASA 1P8IA 4WLDA 4ZPUA 166LA 4QEQA 2ZYCA 4ETCA 2HTXA 1REYA 5LINA 1GB7A 1IP6A 1LSFA 1LZGA 1XJUA 5B06A 1C6FA 2W1LA 4BS7A 4HV2A 1MELL 1HZXA 4J0LA 4QY9A 3UTVA 1GEVA 145LA 1UC0A 5LYMA 206LA 2C8OA 153LA 2I1XA 1L26A 2A7DA 2RB0X 4H9CA 4X3BA 4LZMA 2BQDA 4H1PA 2X0AA 5DLAA 5HLLA 5KKHA 2B74A 1LOZA 1QHJA 1L32A 2GV0A 3C81A 3HT7A 247LA 3A95A 4N1CC 1G7IC 1YAMA 2BQJA 3EMSA 1LJNA 1CU0A 2DQEY 3EH3B 3QJQB 3T6UA 3QJRB 1I1ZA 1QSWA 4ZFPA 2ANXA 3SB8A 208LA 4EKQA 5G2DA 1IVMA 2R4SA 2OE4X 1T8GA 3FI5A 2G4QA 3TXKA 4FPDA 4GP5B 195LA 183LA 1LPIA 3HBDA 1OUAA 1W6ZA 3TXFA 1BWHA 1C62A 4DD3A 1IWUA 1TCYA 3A67Y 1TN0A 3DQBA 5LVGA 4GBRA 5KXKA 4LT0A 5EN0A 1U19A 1H6MA 1OVJA 4HPEA 3PBLA 5FDJA 4Z3MA 4BAFA 1L83A 4PRUA 1F0WA 2F4AA 5FCPA 1QT4A 3F6ZA 1GFVA 1GB6A 1C45A 3GUPA 3QJUB 4GCFA 2YBLA 3A90A 1GBOA 240LA 5KXWA 3OE6A 2BLXA 1C3WA 1G0GA 1QTKA 2F4GA 4WG1A 3UZAA 4X1HA 1EHKB 163LA 1IR8A 3OAXA 1B2KA 5F81A 1BB3A 1VAUA 1YL1X 1C6KA 250LA 4LT3A 3GUNA 4WM2A 1DKKA 3PQRA 5L9JA 3A8ZA 4W54A 1LYIA 4H90A 3RZEA 5APCA 4H9AA 4QDNA 1FBIX 4EMNA 3HT6A 5G2AA 3RZ4A 1FLUA 2LZ2A 1C6TA 3G3AB 1GF4A 3AGHA 1WTNA 4R6CA 1L37A 1OQMA 4IASA 3KAMA 3B0OA 1B9OA 4N5RA 1EQEA 149LA 4WMGA 2NWDX 2B70A 115LA 1L39A 2PEDA 1HEWA 1L31A 4DD2A 1IP1A 2H5ZA 1C43A 4ZIXA 1L25A 1OWYA 1ALCA 2LZMA 2Z19A 261LA 4IAPA 3X3BA 5J7CA 1BRRA 3AZ4A 1GE0A 4YF2A 139LA 1LMPA 2F32A 3TXDA 1V7SA 2BQAA 2HEFA 1VDQA 5H2NA 3HU8A 3HT8A 1VDSA 1CX6A 2YVBA 140LA 4MSTA 1HELA 1P6YA 186LA 4CGEA 3AGGG 3HAOA 4I7LA 1LWKA 3P4ZA 2HEBA 2F30A 2CWIA 3S3BB 1HFXA 1LSEA 1P2CC 4H9HA 120LA 1JFPA 1IY4A 1WVVA 1C6HA 5LVJA 5B1GA 1I6SA 3LZMA 3A94A 1OUFA 1SSYA 1F88A 154LA 2QPEB 233LA 3CB7A 4OWEA 2HPYA 3GUOA 1E8LA 1L47A 4RLNA 6LYZA 5LYZA 1KXWA 1GB2A 4A7DA 1L92A 5B6YA 4H92A 226LA 2A4TA 1C63A 160LA 1LHHA 1WVUA 3CDQA 4IATA 1HFZA 1FLQA 1GAYA 2IGCA 1LZ6A 2HUMA 4NHQA 2LC9A 131LA 1G0MA 2B6WA 175LA 4CFPA 3ZPQA 3QDCA 4QRYA 4ARMB 2G4PA 1LJ4A 4PK0A 254LA 4N8ZA 4YXAC 3M3UA 1MLCE 3UG9A 1C8SA 4G72B 2I26L 4ANRA 5C1MA 189LA 1LZCA 5I54A 5C6JA 3C9LA 4WM5A 4B1AA 2LCBA 1GF0A 1PQOA 1NDGC 1L49A 4KPMA 2IHLA 3BVDB 1B7NA 133LA 1DI5A 1G0QA 1WTHA 135LA 1BRDA 1NF5A 1S52A 1XGQC 1BB7A 4WO6A 1QDRA 3HAQA 1PQKA 2LHMA 1L02A 2Z6BA 4N6HA 1L44A 1QS5A 2Q0MX 5H2HA 2MEHA 5A44A 4WLTA 4ETBA 1LZ4A 1YIKA 4OWBA 5KXMA 3QAKA 1C6MA 1VGOA 1LMQA 2Z12A 4W53A 2BQMA 3UONA 3WUMA 3EBAB 3ULRA 5FJGA 1DI4A 1UA6Y 2DQJY 1L70A 3WULA 207LA 1C7PA 5G53A 1LSZA 2OEAX 3KJ6A 3VWOA 1L46A 4OOTA 3WVXA 243LA 1FN5A 7LZMA 5KXLA 4L41A 1RI8B 3B72A 2HEDA 1IR7A 4LT1A 4WG7A 4XN6A 1GE2A 2F93A 1L58A 1JTPL 4WLYA 3WPLA 4PHIA 5I53A 1G7LC 1IY3A 1LYOA 1GD6A 1P56A 3WU8A 114LA 217LA 4P2EA 1WTMA 5AWZA 1IP2A 174LA 1GFRA 1L66A 4YXCA 1P46A 4I7TA 152LA 4KXIA 1H2SA 2HULA 1O0AA 3C82A 3DN0A 1NBYC 4BWBA 4DQ7A 2YCWA 4OO9A 1HSWA 1OUJA 3HAPA 2ZIKA 3OK0A 144LA 3VHZA 4M4OA 1KW7A 5KXNA 4LDEA 1LSNA 1L54A 3SB6A 4BEZA 4IARA 2L6XA 3COCA 2DQFC 1KNIA 3OE9A 4ARLA 1UIBA 3A91A 5IDDA 125LA 1D6PA 1FLYA 225LA 4NHTA 4DD7A 192LA 1G7MC 2KSYA 3CAPA 4YEMA 1BHZA 4HP0A 3OE8A 1LZAA 1BM1A 1L48A 1DYCA 5KXRA 1B5WA 194LA 1LW9A 2B72A 1UCQA 1LHKA 1QTBA 4K5YA 1EQ4A 2OE7X 113LA 1JTMA 4FDYA 3NSBA 2I35A 1L71A 129LA 1DPWA 3HDEA 4DDCA 216LA 1LYGA 4W57A 3BKVA 4LYTA 1D0LA 1ZWNA 1GHLA 1P8HA 2BQLA 4W55A 1C6AA 2RAYX 5EBHA 1YAOA 2YDGA 4N9RA 248LA 4A4MA 1LHLA 4W56A 3SB7A 6LZMA 3HWLA 1JKAA 1LZ9A 1C8RA 1UICA 2HU3A 1OUBA 4WW3A 4XXJA 1TLAA 4I7SA 1GF8A 1QSBA 2Y02A 142LA 1L36A 2BQOA 3ATOA 3TXGA 4I7OA 4N4YB 4X31A 5KKIA 2BAAA 5DN5A 5APEA 4GCBA 1SQ2L 3WW5A 2BQFA 5AMYA 4EPIA 1WQOA 1EPYA 4EKRA 1ZVYB 1PXSA 2QARC 1L84A 3WW6A 1C6IA 3UTYA 4TTDA 3QNGA 4I7QA 2NTUA 1L05A 4KLYA 1LMTA 1B6IA 5I5QA 2XTHA 3AZ5A 1JKBA 2XQOA 242LA 4NSJA 3LHMA 2BQIA 1LGUA 4NWHA 1JEFA 1L09A 3RW8A 1BB5A 1NKHA 3IJVA 1LHIA 1L38A 4GYCA 5L3IA 3HH4A 3HUAA 1QUOA 156LA 3MBVA 2WJLA 1OUGA 1S8LA 3D9AC 5TGZA 1YAPA 1G07A 3NYAA 3P66A 4LDLA 3HH5A 2H9KA 2Z38A 2O4WA 1L16A 5H2MA 5G54A 3DN6A 191LA 3P64A 1YROA 188LA 1CV3A 5I4WA 3UTXA 1L10A 3TXIA 3VI0A 181LA 1DKJA 4DJHA 4XTLA 4NEBA 1PY6A 1JJ0A 1JWRA 1SWZA 1XEIA 2OU0X 4XTNA 5B6VA 184LA 1L43A 3ATNA 3WL2A 2B6YA 2BRDA 4BV0A 5B6XA 1IORA 1H87A 1UIHA 3SBAA 4HJZA 2YCXA 1L67A 2OE9X 4QI1A 5JENB 3QY4A 1CV4A 4JQ6A 1KIRC 1GFKA 155LA 2WJKA 3SB9A 1KS3A 4HYXA 4TL3A 176LA 1GE3A 4W52A 3HFMY 4II8A 1CU2A 1PQDA 4EPFA 5A3ZA 3AJNA 5AX1A 1GF5A 196LA 3TMVA 1IIZA 4NGZA 5BR2A 5T3FA 1IEEA 4WM4A 1B5VA 1C67A 4J4QA 1XJIA 1L87A 2D6BA 1C69A 4NGVA 3A93A 1GB8A 4WLXA 4FBZA 4LFPA 3WPKA 3S3DB 3C7YA 4NWEA 1QS9A 5BR5A 4I8SA 1G06A 1XJTA 4I0CA 1INUA 1JJ3A 3AZ7A 2KS9A 5D5FA 4GN4A 3FE0A 4N1EI 1L51A 3CSZA 1BB4A 1LZ8A 1L90A 3K3TA 1IOQA 4WL7A 1L11A 3QBIA 3T36A 262LA 1CV5A 2ZILA 3HBHA 1L0KA 5LYTA 1FKQA 1OV5A 2A7FA 3ZVQB 4NY5A 1LHJA 1RCMA 5B05A 2BQCA 1AP9A 3TXEA 1QKOA 1XIOA 1RFPA 3DMZA 5B0WA 1LMNA 1LGXA 2NTWA 4H93A 2YSSC 1OP9B 251LA 3CT0A 1LWGA 2RBNA 4XYYA 4HPIA 1LTMA 1W08A 1C65A 1UACY 4H8YA 3HUQA 1UUZC 1XGUC 1L81A 5H2OA 238LA 1C08C 2HECA 1R84A 1L96A 4XJDA 4MD2A 5KXOA 1G0LA 1G0JA 1CKGA 3V2YA 1OWZA 1L9HA 2AUBA 1CKHA 3HTBA 1KW5A 2BLYA 1KXXA 1P2RA 2J4YA 1L33A 1VFBC 1IXFA 2L78A 3NS0A 1QKPA 4AQNA 1T8FA 1AZFA 1UIFA 211LA 4GN5C 4NGIA 150LA 4LYZA 3S8GB 1PQJA 5E4PA 4MCKA 5A3EA 1Q5JA 4W96A 1E12A 3AYNA 4PRQA 3A92A 1G7HC 5ITCA 1ZVHL 2Z37A 1JGJA 1X0SA 3G3WA 5L3HA 3DMXA 4KT3A 3WU7A 3PDSA 4EKSA 1OUIA 1L12A 4LZTA 2W1XA 1QIOA 1LZ1A 3OJPA 4XJBA 5DN4A 1LZTA 2BQBA 1KXYA 4PXKA 1C6CA 1CNSA 2OTZX 1KIQC 5G28A 2G87A 1DI3A 1GAZA 1QSQA 1NHEA 4NG1A 3DKEX 3HTDA 1B7SA 3W6EA 213LA 1GB5A 2YBHA 3GXKA 1L55A 1J1XY 3C80A 7LYZA 1T6HA 2XBSA 1P36A 3DN3A 4NG8A 1C6LA 1HERA 1DYBA 4GBRB 1HF4A 4XADA 3LYZA 4ET8A 1L13A 5I4YA 1AT9A 3DDLA 2BQNA 2F47A 2B6XA 1LYJA 1IP4A 5LZMA 2ZZLA 1L60A 1L53A 1SWYA 4ARMA 1L73A 5A8EA 4XT1A 4DAJA 2B6ZA 4IJ4A 1C6QA 185LA 2W1YA 5APFA 4WO9A 5F16A 258LA 1YL0X 1LYSA 215LA 170LA 3QBLA 1LPYA 4WOAA 104LA 4O34A 1R2NA 3EH5B 1PXRA 1B5UA 3TXJA 2RSCA 1IC4Y 3UZCA 1L18A 4EJ4A 3G3VA 5F9UA 3F8VA 1LSGA 4DKLA 1UIDA 4LDOA 3PXOA 2I6ZA 1CJ8A 3W3EA 2EPEA 1KIPC 4XENA 232LA 2JAFA 4NSIA 1FDLY 1QUHA 2IFFY 5DHGA 4DWXA 2VT4A 4B4IA 1BQLY 2I25L 1L20A 3C8RA 4B4JA 138LA 3GXRA 2X72A 1G1WA 2MEEA 4I7MA 2Z2EA 4DD9A 4IAQA 3CT5A 3TXBA 1LYEA 4MD1A 1LI6A 4MQTA 2BPUA 134LA 3C7ZA 2Y00A 1L65A 2YBNA 4TWSA 2KSAA 1LZDA 4LGKA 1L62A 1QTCA 1B7LA 205LA 1GFJA 3ABWA 1LZSA 1LMCA 2Y04A 1D0KA 3HH3A 1C10A 1C6EA 2RBOA 1QDTA 1L34A 1F4ZA 1OV7A 2JAGA 1GWDA 4UWVA 1NWGA 4Z46A 1CJ6A 167LA 2B7XA 1LLHA 4DDBA 1I56A 1A4VA 3S3CB 1D6QA 1JUGA 2MEFA 220LA 182LA 1L08A 4XJGA 1EQ5A 4HV1A 4M6DA 162LA 5KXXA 4EOFA 4RDSA 137LA 1IWXA 4QIDA 5LVKA 253LA 3PWHA 1GUEA 1CV0A 3RUNA 4OWAA 1B7QA 4KNFA 1JTNA 3QE8A 1KG9A 3HU9A 4AMJA 1WQRA 5LA5A 3HANA 1L03A 5B1FA 1L23A 5APDA 2RH1A 1LGWA 4LYBA 1S51A 1JSFA 3VGAA 3J4GA 3WUNA 2NTHA 237LA 5LAFA 2WARA 2AT9A 1V7TA 4OWCA 4ML7A 2DQDY 5H2PA 245LA 1IWYA 1C60A 2G4NA 193LA 1UAZA 1C6JA 5HQ1A 4YENA 4I7NA 236LA 3ODUA 1JSEA 5JJNA 5KXTA 1QUGA 1GDWA 5F9XA 4DQJA 1GE1A 108LA 256LA 1GZMA 1L94A 1L24A 1L17A 1L52A 1LI2A 1OVHA 5KKJA 1IWZA 1A2YC 2BQKA 4WL6A 1QT6A 3W6AA 2O79A 2DQCY 1L19A 1P7SA 1L15A 3W6DA 3ZEKA 3VVKA 3LYMA 1GF7A 4TSCA 2D4IA 1LYHA 1T3PA 1OYUA 1IWVA 143LA 3N9AA 1L14A 5B34A 5F8UA 2HU1A 4EKPA 2CGIA 2MEAA 1EL1A 4AGAA 4DD1A 1LSBA 4G7QB 1GB9A 4WM1A 1XEJA 3GUMA 1Q5IA 3AYQA 3WU9A 3EH4B 1P8UA 4UHRA 3W6FA 1LJ3A 2RB1X 4FJRA 1FBBA 1KGBA 1GBYA 1L0MA 4HWLA 1P64A 4YX7C 1LJEA 1CX7A 1P2LA 4QGZA 1LSAA 1ZURA 1TAYA 1LI3A 158LA 5JJJA 4FAAB 1L40A 3WMKA 5HMVA 1L35A 5FSTA 1XGRC 1F50A 5LVIA 1JJ1A 4J7VA 1IWTA 127LA 1L95A 5ILCA 1ZV5L 3DNAA 4G4CA 1PQIA 4YOPA 119LA 2EKSC 2O7AA 1HMLA 1IP7A 1TBYA 2MECA 1LJJA 4J1AA 2HUBA 146LA 3NY8A 1IWWA 1RE2A 2KSBA 4Z41A 1UCOA 3N9EA 2RAZX 5FEKA 2LYMA 4G71B 4CFOA 1HFYA 4XT3A 5B2NA 4B4EA 1LJIA 3RFMA 1AKIA 5ITEA 4NGWA 3HBEX 9LYZA 4HTKA 4GCDA 1HEMA 123LA 1LKSA 2Y8PA 1J1OY 1FLWA 1L88A 1GBXA 1LSMA 1XEKA 3SN6R 1LZEA 1B7MA 2Z18A 4GLAA 3TXHA 1M0KA 1IO5A 2RB2X 2MEBA 4ARQB 1DYAA 1L01A 1NMMA 5B6ZA 3VG9A 4H8ZA 1GBZA 5IELA 2F2QA 4XJIA 4H9BA 3RU5A 1IOTA 1IW6A 3WPJA 165LA 4S0WA 1JISA 4W94A 1GXXA 1NDMC 2FBBA 1CWQA 1VJMA 111LA 3ZEVA 241LA 4I7JA 8LYZA 1G0KA 5KXZA 1LYZA 1CTWA 1J1PY 2DKVA 2CJLA 164LA 4WAVA 4JKVA 4NC3A 3ZVQA 1D0MA 2OU8A 4BUOA 169LA 1XGPC 1XSFA 1LYDA 1QT8A 1NHBA 4NGOA 5K7OA 1YAQA 1GFTA 1BRXA 4GP4B 187LA 1TDYA 4H91A 3EMLA 1S8JA 1H68A 2W1MA 1LSDA 4AXTA 1OUEA 1L89A 2VB1A 4H9EA 4HSFA 3HARA 4RW1A 1QT7A 3QJSB 1GBWA 1I20A 3QJTB 1MGYA 1CJ7A 1L50A 1L42A 2FYCA 1L30A 4LT2A 1HHLA 2M3GA 2RBRA 2YDOA 5JJEA 4GP8B 126LA 2B6TA 2XBRA 1CU3A 5B59A 2OU9A 1L27A 1G1VA 5KJ9A 1JQUA 130LA 246LA 4LYMA 128LA 110LA 109LA 4GLVA 4NIJA 1S53A 2HEAA 1LYYA 1PQMA 2YDVA 4HYJA 4E97A 1L04A 1BVKC 5LVHA 1LHMA 1L06A 209LA 3HDFA 3HT9A 4DS7E 5ILFA 1K28A 1VATA 4I7PA 3ZPRA 199LA 1IOSA 1DYGA 1UIGA 112LA 1HENA 3AW7A 1B5XA 5LWEA 1LJHA 3K2RA 1JHLA 1QSAA 3C9MA 4GRVA 1B5YA 2NTGA 1GEZA 4I7KA 1TN5A 4H9IA 1PS5A 5DHHA 3WH1A 3A96A 2OTYX 1IX0A 1QTVA 4MR1A 1P37A 3GUJA 3FADA 4NFVA 1SX2A 2YCYA 4MBSA 1SSWA 1LMOA 2LYZA 4BVNA 1GFHA 3WQJA 1GXV2 1VDPA 3CSQA 4DDAA 1JV6A 221LA 1LZRA 1OUHA 4DQ5A 4G4HA 1HNLA
chains in the Genus database with same CATH topology
4R0FA 118LA 1S54A 1CKDA 3B6LA 1X0I1 1CU6A 214LA 4Z98A 5LAGA 1CU5A 1QQYA 2H9JA 1L68A 4NGKA 3J6KA 148LE 3L2XA 5DYSA 1LZYA 132LA 1WQPA 2F2NA 1DZBX 4W51A 1CKCA 4C5FA 1D3NA 1P3NA 4I7RA 4X32A 4GPOA 5AHZA 5M1YA 1HSXA 4J1BA 177LA 1L98A 1YKZX 3A3QA 4N0JA 3B0IA 1BGIA 5IHGA 1REXA 1L21A 4OV0A 1N4FA 4MQSA 2N5ZA 1B5ZA 1JV7A 4NHSA 1LSPA 1L99A 222LA 1WQQA 4DYGA 1LAAA 107LA 2DBTA 3LZ2A 4AMIA 2BQGA 3CDVA 2HUKA 1L29A 4G49A 4ARPA 6LYTA 1L77A 1G7JC 1C61A 1D9UA 5KXYA 1C6DA 2XJWA 3F9LA 1C46A 1L0JA 1GE4A 1VDTA 4PJZA 5C6IA 1L74A 2EI4A 1GB0A 3CT1A 180LA 1LSCA 5KXPA 3MGWA 4E3UA 1QTDA 2CUUA 3B0KA 1C68A 1AT6A 122LA 1XMEB 5H2KA 4EIYA 4RLMA 1OUCA 3G3BB 3W6BA 1LJGA 4ETAA 4Y9HA 2YCZA 2Z2FA 3QBGA 1KY0A 2EIZC 4WM3A 1JITA 1CV6A 2CDSA 4IB4A 157LA 1JTOL 1P5CA 5H2LA 257LA 4ARJA 1GFUA 3S8FB 4YEOA 3HTGA 1GB3A 1GFAA 1CV1A 1BWJA 3GULA 1LN6A 172LA 1C6NA 4BADA 5KXSA 4B49A 1YQVY 1JIYA 2C8PA 197LA 5A45A 3N9CA 4UWUA 4TSBA 1NQIA 1GPQC 1HEOA 4GCCA 5AZDA 1IC5Y 5ETZA 5B6WA 1FKVA 1REMA 3RT5X 1DYDA 1L97A 1CJ9A 1RJCB 3X3CA 1TEWA 3A6CY 1UIEA 2ZIJA 198LA 1IW9A 1L45A 4NSHA 3IJUA 5DM9A 1L59A 147LA 4XJFA 2ZWBA 3FA0A 4L6RA 3WXUA 171LA 3EO5A 4DT3A 173LA 3TMXA 1C66A 4UG2A 1L07A 4U3XB 1QTEA 3AW6A 1LKRA 1L86A 3VW7A 3QAPA 260LA 1KMEA 2FBDA 1DQJC 1L69A 3C83A 2LYOA 4BAPA 3LZTA 1GF9A 3P0GA 1M0LA 3TMUA 4D9ZA 4N4WA 1JKDA 4FA7B 1F6RA 3CQLA 1T97A 1AT5A 4OW1A 4W58A 3REYA 1QM8A 1GFEA 3D4SA 3HTFA 3LN2A 1L85A 4GN3A 5AHYA 2Y03A 4CJ2A 5LIOA 4OWHA 2ZQ3A 4LYCA 2EQLA 229LA 5H2IA 4XTOA 1LZNA 1GFGA 1SLYA 2DQGY 1IOCA 2YBIA 5B35A 1B7RA 4PXFA 228LA 4PJ2C 1L41A 1L64A 1PZYA 1M0MA 5LA8A 178LA 3AYMA 1LCNA 1IC7Y 2PC2A 3V2WA 1CUPA 1D3JA 1AM7A 1LJFA 239LA 230LA 1IP3A 1YILA 3EXDA 1QUSA 5I4XA 1QT3A 3SBBC 1B7OA 1E0PA 1REZA 3LYTA 3GUIA 1Z55A 2MEDA 3A34A 1L22A 1L93A 2D4KA 224LA 4EA3A 1BWIA 159LA 5C6LA 5LXWA 1BVXA 1B0DA 3CSRA 3DN1A 3T45A 3WUAA 235LA 4GCEA 210LA 2F95A 1OUDA 4H94A 4NSGA 2DQIY 1QTHA 1YANA 4G9SA 3FI7A 3C8QA 3OE0A 4TUNA 3E3DA 3HH6A 102LA 2DQHY 1L61A 2ZFEA 3G3XA 1X0K1 4PPOA 4G70B 3GUKA 2LNLA 3SP3A 4ET9A 1L72A 1XGTC 2I20A 1CKFA 3BKHA 1L56A 2B75A 1QT5A 2QPDB 2Q9DA 103LA 1D3FA 2ZNWY 3DN8A 1L63A 5E9RA 2ZYPA 1KY1A 231LA 1DPXA 2MEIA 4HJYA 3LYOA 3IWRA 3AZ6A 1GBSA 1LSYA 3D3DA 5DL9A 3WYHA 4ETEA 1T6VL 3DN4A 5HMJA 3UTWA 1JKCA 4NGLA 3QJVB 1F10A 1JPOA 3WVYA 2FYDA 2BQEA 227LA 1QUTA 4LFXA 1D2WA 3AGIA 5D5CA 4CHXA 4W59A 2ZNXY 3M18B 219LA 4YM8A 4G7RB 1IP5A 2B73A 1L82A 4EXMA 1KG8A 1GF6A 1LMAA 3QBKA 5G36A 1JTTL 212LA 3TMWA 2I21A 4C3WA 1NBZC 4WM6A 1UIAA 1C6GA 4ETDA 2YBMA 4NHIA 5B07A 4JR8A 4ARQA 2ZQ4A 4NGJA 161LA 3SB5A 3AB6A 2RBPA 2D91A 3DMVA 1L76A 1GU8A 2YBJA 1ZYTA 2ANVA 3A3RX 1OVKA 1B7PA 1QUDA 5FELA 4G4BA 1XFPL 4H8XA 1C64A 3P68A 2HEEA 218LA 4NHPA 1DZEA 1IR9A 1CUQA 168LA 1GDXA 2MEGA 1L57A 1HEPA 4XJHA 1G0PA 2DQAA 1SX7A 223LA 141LA 4RW2A 1L91A 1C6BA 2B5ZA 5G2CA 1D9WA 3WXTA 2Y01A 3P65A 1L00A 5F14A 1ZMYL 1XEPA 151LA 201LA 3C8SA 1BB6A 4KL7A 255LA 1GF3A 5H2JA 5KY1A 4TX7A 3C7WA 5HNCA 1O23A 4DD0A 1DYFA 4BEYA 1L80A 5FHWA 4B0DA 1F6SA 1C6PA 5HNLA 4ZEEA 1FBKA 1DYEA 3CDRA 3L64A 259LA 2RBSA 4HJVA 4DC4A 2D4JA 1D3MA 2Z55A 3CDOA 1LJKA 1WQMA 2BQHA 4OOOA 2ZIYA 4PGJB 5AX0A 1LZBA 3CODA 4HTQA 4NGYA 1D2YA 1VEDA 1CVKA 1L75A 2Z39A 3RNXA 4H9FA 244LA 3NY9A 190LA 1LYFA 1HC0A 4LYOA 2QB0B 3DN2A 1HEQA 1UBZA 3A6BY 5I14A 5II3A 5J7AA 2R4RA 2RBQA 4G7SB 3JR6A 3A7KA 1HMKA 3W6CA 1WQNA 1L28A 3HUKA 2Q9EA 4HTNA 1LZ5A 249LA 1T8AA 3CDTA 3AM6A 4L35A 1L79A 234LA 1YKXX 2Z73A 4UWNA 2LZTA 1QTZA 1YKYX 200LA 1DXJA 252LA 3HASA 1P8IA 4WLDA 4ZPUA 166LA 4QEQA 2ZYCA 4ETCA 2HTXA 1REYA 5LINA 1GB7A 1IP6A 1LSFA 1LZGA 1XJUA 5B06A 1C6FA 2W1LA 4BS7A 4HV2A 1MELL 1HZXA 4J0LA 4QY9A 3UTVA 1GEVA 145LA 1UC0A 5LYMA 206LA 2C8OA 153LA 2I1XA 1L26A 2A7DA 2RB0X 4H9CA 4X3BA 4LZMA 2BQDA 4H1PA 2X0AA 5DLAA 5HLLA 5KKHA 2B74A 1LOZA 1QHJA 1L32A 2GV0A 3C81A 3HT7A 247LA 3A95A 4N1CC 1G7IC 1YAMA 2BQJA 3EMSA 1LJNA 1CU0A 2DQEY 3EH3B 3QJQB 3T6UA 3QJRB 1I1ZA 1QSWA 4ZFPA 2ANXA 3SB8A 208LA 4EKQA 5G2DA 1IVMA 2R4SA 2OE4X 1T8GA 3FI5A 2G4QA 3TXKA 4FPDA 4GP5B 195LA 183LA 1LPIA 3HBDA 1OUAA 1W6ZA 3TXFA 1BWHA 1C62A 4DD3A 1IWUA 1TCYA 3A67Y 1TN0A 3DQBA 5LVGA 4GBRA 5KXKA 4LT0A 5EN0A 1U19A 1H6MA 1OVJA 4HPEA 3PBLA 5FDJA 4Z3MA 4BAFA 1L83A 4PRUA 1F0WA 2F4AA 5FCPA 1QT4A 3F6ZA 1GFVA 1GB6A 1C45A 3GUPA 3QJUB 4GCFA 2YBLA 3A90A 1GBOA 240LA 5KXWA 3OE6A 2BLXA 1C3WA 1G0GA 1QTKA 2F4GA 4WG1A 3UZAA 4X1HA 1EHKB 163LA 1IR8A 3OAXA 1B2KA 5F81A 1BB3A 1VAUA 1YL1X 1C6KA 250LA 4LT3A 3GUNA 4WM2A 1DKKA 3PQRA 5L9JA 3A8ZA 4W54A 1LYIA 4H90A 3RZEA 5APCA 4H9AA 4QDNA 1FBIX 4EMNA 3HT6A 5G2AA 3RZ4A 1FLUA 2LZ2A 1C6TA 3G3AB 1GF4A 3AGHA 1WTNA 4R6CA 1L37A 1OQMA 4IASA 3KAMA 3B0OA 1B9OA 4N5RA 1EQEA 149LA 4WMGA 2NWDX 2B70A 115LA 1L39A 2PEDA 1HEWA 1L31A 4DD2A 1IP1A 2H5ZA 1C43A 4ZIXA 1L25A 1OWYA 1ALCA 2LZMA 2Z19A 261LA 4IAPA 3X3BA 5J7CA 1BRRA 3AZ4A 1GE0A 4YF2A 139LA 1LMPA 2F32A 3TXDA 1V7SA 2BQAA 2HEFA 1VDQA 5H2NA 3HU8A 3HT8A 1VDSA 1CX6A 2YVBA 140LA 4MSTA 1HELA 1P6YA 186LA 4CGEA 3AGGG 3HAOA 4I7LA 1LWKA 3P4ZA 2HEBA 2F30A 2CWIA 3S3BB 1HFXA 1LSEA 1P2CC 4H9HA 120LA 1JFPA 1IY4A 1WVVA 1C6HA 5LVJA 5B1GA 1I6SA 3LZMA 3A94A 1OUFA 1SSYA 1F88A 154LA 2QPEB 233LA 3CB7A 4OWEA 2HPYA 3GUOA 1E8LA 1L47A 4RLNA 6LYZA 5LYZA 1KXWA 1GB2A 4A7DA 1L92A 5B6YA 4H92A 226LA 2A4TA 1C63A 160LA 1LHHA 1WVUA 3CDQA 4IATA 1HFZA 1FLQA 1GAYA 2IGCA 1LZ6A 2HUMA 4NHQA 2LC9A 131LA 1G0MA 2B6WA 175LA 4CFPA 3ZPQA 3QDCA 4QRYA 4ARMB 2G4PA 1LJ4A 4PK0A 254LA 4N8ZA 4YXAC 3M3UA 1MLCE 3UG9A 1C8SA 4G72B 2I26L 4ANRA 5C1MA 189LA 1LZCA 5I54A 5C6JA 3C9LA 4WM5A 4B1AA 2LCBA 1GF0A 1PQOA 1NDGC 1L49A 4KPMA 2IHLA 3BVDB 1B7NA 133LA 1DI5A 1G0QA 1WTHA 135LA 1BRDA 1NF5A 1S52A 1XGQC 1BB7A 4WO6A 1QDRA 3HAQA 1PQKA 2LHMA 1L02A 2Z6BA 4N6HA 1L44A 1QS5A 2Q0MX 5H2HA 2MEHA 5A44A 4WLTA 4ETBA 1LZ4A 1YIKA 4OWBA 5KXMA 3QAKA 1C6MA 1VGOA 1LMQA 2Z12A 4W53A 2BQMA 3UONA 3WUMA 3EBAB 3ULRA 5FJGA 1DI4A 1UA6Y 2DQJY 1L70A 3WULA 207LA 1C7PA 5G53A 1LSZA 2OEAX 3KJ6A 3VWOA 1L46A 4OOTA 3WVXA 243LA 1FN5A 7LZMA 5KXLA 4L41A 1RI8B 3B72A 2HEDA 1IR7A 4LT1A 4WG7A 4XN6A 1GE2A 2F93A 1L58A 1JTPL 4WLYA 3WPLA 4PHIA 5I53A 1G7LC 1IY3A 1LYOA 1GD6A 1P56A 3WU8A 114LA 217LA 4P2EA 1WTMA 5AWZA 1IP2A 174LA 1GFRA 1L66A 4YXCA 1P46A 4I7TA 152LA 4KXIA 1H2SA 2HULA 1O0AA 3C82A 3DN0A 1NBYC 4BWBA 4DQ7A 2YCWA 4OO9A 1HSWA 1OUJA 3HAPA 2ZIKA 3OK0A 144LA 3VHZA 4M4OA 1KW7A 5KXNA 4LDEA 1LSNA 1L54A 3SB6A 4BEZA 4IARA 2L6XA 3COCA 2DQFC 1KNIA 3OE9A 4ARLA 1UIBA 3A91A 5IDDA 125LA 1D6PA 1FLYA 225LA 4NHTA 4DD7A 192LA 1G7MC 2KSYA 3CAPA 4YEMA 1BHZA 4HP0A 3OE8A 1LZAA 1BM1A 1L48A 1DYCA 5KXRA 1B5WA 194LA 1LW9A 2B72A 1UCQA 1LHKA 1QTBA 4K5YA 1EQ4A 2OE7X 113LA 1JTMA 4FDYA 3NSBA 2I35A 1L71A 129LA 1DPWA 3HDEA 4DDCA 216LA 1LYGA 4W57A 3BKVA 4LYTA 1D0LA 1ZWNA 1GHLA 1P8HA 2BQLA 4W55A 1C6AA 2RAYX 5EBHA 1YAOA 2YDGA 4N9RA 248LA 4A4MA 1LHLA 4W56A 3SB7A 6LZMA 3HWLA 1JKAA 1LZ9A 1C8RA 1UICA 2HU3A 1OUBA 4WW3A 4XXJA 1TLAA 4I7SA 1GF8A 1QSBA 2Y02A 142LA 1L36A 2BQOA 3ATOA 3TXGA 4I7OA 4N4YB 4X31A 5KKIA 2BAAA 5DN5A 5APEA 4GCBA 1SQ2L 3WW5A 2BQFA 5AMYA 4EPIA 1WQOA 1EPYA 4EKRA 1ZVYB 1PXSA 2QARC 1L84A 3WW6A 1C6IA 3UTYA 4TTDA 3QNGA 4I7QA 2NTUA 1L05A 4KLYA 1LMTA 1B6IA 5I5QA 2XTHA 3AZ5A 1JKBA 2XQOA 242LA 4NSJA 3LHMA 2BQIA 1LGUA 4NWHA 1JEFA 1L09A 3RW8A 1BB5A 1NKHA 3IJVA 1LHIA 1L38A 4GYCA 5L3IA 3HH4A 3HUAA 1QUOA 156LA 3MBVA 2WJLA 1OUGA 1S8LA 3D9AC 5TGZA 1YAPA 1G07A 3NYAA 3P66A 4LDLA 3HH5A 2H9KA 2Z38A 2O4WA 1L16A 5H2MA 5G54A 3DN6A 191LA 3P64A 1YROA 188LA 1CV3A 5I4WA 3UTXA 1L10A 3TXIA 3VI0A 181LA 1DKJA 4DJHA 4XTLA 4NEBA 1PY6A 1JJ0A 1JWRA 1SWZA 1XEIA 2OU0X 4XTNA 5B6VA 184LA 1L43A 3ATNA 3WL2A 2B6YA 2BRDA 4BV0A 5B6XA 1IORA 1H87A 1UIHA 3SBAA 4HJZA 2YCXA 1L67A 2OE9X 4QI1A 5JENB 3QY4A 1CV4A 4JQ6A 1KIRC 1GFKA 155LA 2WJKA 3SB9A 1KS3A 4HYXA 4TL3A 176LA 1GE3A 4W52A 3HFMY 4II8A 1CU2A 1PQDA 4EPFA 5A3ZA 3AJNA 5AX1A 1GF5A 196LA 3TMVA 1IIZA 4NGZA 5BR2A 5T3FA 1IEEA 4WM4A 1B5VA 1C67A 4J4QA 1XJIA 1L87A 2D6BA 1C69A 4NGVA 3A93A 1GB8A 4WLXA 4FBZA 4LFPA 3WPKA 3S3DB 3C7YA 4NWEA 1QS9A 5BR5A 4I8SA 1G06A 1XJTA 4I0CA 1INUA 1JJ3A 3AZ7A 2KS9A 5D5FA 4GN4A 3FE0A 4N1EI 1L51A 3CSZA 1BB4A 1LZ8A 1L90A 3K3TA 1IOQA 4WL7A 1L11A 3QBIA 3T36A 262LA 1CV5A 2ZILA 3HBHA 1L0KA 5LYTA 1FKQA 1OV5A 2A7FA 3ZVQB 4NY5A 1LHJA 1RCMA 5B05A 2BQCA 1AP9A 3TXEA 1QKOA 1XIOA 1RFPA 3DMZA 5B0WA 1LMNA 1LGXA 2NTWA 4H93A 2YSSC 1OP9B 251LA 3CT0A 1LWGA 2RBNA 4XYYA 4HPIA 1LTMA 1W08A 1C65A 1UACY 4H8YA 3HUQA 1UUZC 1XGUC 1L81A 5H2OA 238LA 1C08C 2HECA 1R84A 1L96A 4XJDA 4MD2A 5KXOA 1G0LA 1G0JA 1CKGA 3V2YA 1OWZA 1L9HA 2AUBA 1CKHA 3HTBA 1KW5A 2BLYA 1KXXA 1P2RA 2J4YA 1L33A 1VFBC 1IXFA 2L78A 3NS0A 1QKPA 4AQNA 1T8FA 1AZFA 1UIFA 211LA 4GN5C 4NGIA 150LA 4LYZA 3S8GB 1PQJA 5E4PA 4MCKA 5A3EA 1Q5JA 4W96A 1E12A 3AYNA 4PRQA 3A92A 1G7HC 5ITCA 1ZVHL 2Z37A 1JGJA 1X0SA 3G3WA 5L3HA 3DMXA 4KT3A 3WU7A 3PDSA 4EKSA 1OUIA 1L12A 4LZTA 2W1XA 1QIOA 1LZ1A 3OJPA 4XJBA 5DN4A 1LZTA 2BQBA 1KXYA 4PXKA 1C6CA 1CNSA 2OTZX 1KIQC 5G28A 2G87A 1DI3A 1GAZA 1QSQA 1NHEA 4NG1A 3DKEX 3HTDA 1B7SA 3W6EA 213LA 1GB5A 2YBHA 3GXKA 1L55A 1J1XY 3C80A 7LYZA 1T6HA 2XBSA 1P36A 3DN3A 4NG8A 1C6LA 1HERA 1DYBA 4GBRB 1HF4A 4XADA 3LYZA 4ET8A 1L13A 5I4YA 1AT9A 3DDLA 2BQNA 2F47A 2B6XA 1LYJA 1IP4A 5LZMA 2ZZLA 1L60A 1L53A 1SWYA 4ARMA 1L73A 5A8EA 4XT1A 4DAJA 2B6ZA 4IJ4A 1C6QA 185LA 2W1YA 5APFA 4WO9A 5F16A 258LA 1YL0X 1LYSA 215LA 170LA 3QBLA 1LPYA 4WOAA 104LA 4O34A 1R2NA 3EH5B 1PXRA 1B5UA 3TXJA 2RSCA 1IC4Y 3UZCA 1L18A 4EJ4A 3G3VA 5F9UA 3F8VA 1LSGA 4DKLA 1UIDA 4LDOA 3PXOA 2I6ZA 1CJ8A 3W3EA 2EPEA 1KIPC 4XENA 232LA 2JAFA 4NSIA 1FDLY 1QUHA 2IFFY 5DHGA 4DWXA 2VT4A 4B4IA 1BQLY 2I25L 1L20A 3C8RA 4B4JA 138LA 3GXRA 2X72A 1G1WA 2MEEA 4I7MA 2Z2EA 4DD9A 4IAQA 3CT5A 3TXBA 1LYEA 4MD1A 1LI6A 4MQTA 2BPUA 134LA 3C7ZA 2Y00A 1L65A 2YBNA 4TWSA 2KSAA 1LZDA 4LGKA 1L62A 1QTCA 1B7LA 205LA 1GFJA 3ABWA 1LZSA 1LMCA 2Y04A 1D0KA 3HH3A 1C10A 1C6EA 2RBOA 1QDTA 1L34A 1F4ZA 1OV7A 2JAGA 1GWDA 4UWVA 1NWGA 4Z46A 1CJ6A 167LA 2B7XA 1LLHA 4DDBA 1I56A 1A4VA 3S3CB 1D6QA 1JUGA 2MEFA 220LA 182LA 1L08A 4XJGA 1EQ5A 4HV1A 4M6DA 162LA 5KXXA 4EOFA 4RDSA 137LA 1IWXA 4QIDA 5LVKA 253LA 3PWHA 1GUEA 1CV0A 3RUNA 4OWAA 1B7QA 4KNFA 1JTNA 3QE8A 1KG9A 3HU9A 4AMJA 1WQRA 5LA5A 3HANA 1L03A 5B1FA 1L23A 5APDA 2RH1A 1LGWA 4LYBA 1S51A 1JSFA 3VGAA 3J4GA 3WUNA 2NTHA 237LA 5LAFA 2WARA 2AT9A 1V7TA 4OWCA 4ML7A 2DQDY 5H2PA 245LA 1IWYA 1C60A 2G4NA 193LA 1UAZA 1C6JA 5HQ1A 4YENA 4I7NA 236LA 3ODUA 1JSEA 5JJNA 5KXTA 1QUGA 1GDWA 5F9XA 4DQJA 1GE1A 108LA 256LA 1GZMA 1L94A 1L24A 1L17A 1L52A 1LI2A 1OVHA 5KKJA 1IWZA 1A2YC 2BQKA 4WL6A 1QT6A 3W6AA 2O79A 2DQCY 1L19A 1P7SA 1L15A 3W6DA 3ZEKA 3VVKA 3LYMA 1GF7A 4TSCA 2D4IA 1LYHA 1T3PA 1OYUA 1IWVA 143LA 3N9AA 1L14A 5B34A 5F8UA 2HU1A 4EKPA 2CGIA 2MEAA 1EL1A 4AGAA 4DD1A 1LSBA 4G7QB 1GB9A 4WM1A 1XEJA 3GUMA 1Q5IA 3AYQA 3WU9A 3EH4B 1P8UA 4UHRA 3W6FA 1LJ3A 2RB1X 4FJRA 1FBBA 1KGBA 1GBYA 1L0MA 4HWLA 1P64A 4YX7C 1LJEA 1CX7A 1P2LA 4QGZA 1LSAA 1ZURA 1TAYA 1LI3A 158LA 5JJJA 4FAAB 1L40A 3WMKA 5HMVA 1L35A 5FSTA 1XGRC 1F50A 5LVIA 1JJ1A 4J7VA 1IWTA 127LA 1L95A 5ILCA 1ZV5L 3DNAA 4G4CA 1PQIA 4YOPA 119LA 2EKSC 2O7AA 1HMLA 1IP7A 1TBYA 2MECA 1LJJA 4J1AA 2HUBA 146LA 3NY8A 1IWWA 1RE2A 2KSBA 4Z41A 1UCOA 3N9EA 2RAZX 5FEKA 2LYMA 4G71B 4CFOA 1HFYA 4XT3A 5B2NA 4B4EA 1LJIA 3RFMA 1AKIA 5ITEA 4NGWA 3HBEX 9LYZA 4HTKA 4GCDA 1HEMA 123LA 1LKSA 2Y8PA 1J1OY 1FLWA 1L88A 1GBXA 1LSMA 1XEKA 3SN6R 1LZEA 1B7MA 2Z18A 4GLAA 3TXHA 1M0KA 1IO5A 2RB2X 2MEBA 4ARQB 1DYAA 1L01A 1NMMA 5B6ZA 3VG9A 4H8ZA 1GBZA 5IELA 2F2QA 4XJIA 4H9BA 3RU5A 1IOTA 1IW6A 3WPJA 165LA 4S0WA 1JISA 4W94A 1GXXA 1NDMC 2FBBA 1CWQA 1VJMA 111LA 3ZEVA 241LA 4I7JA 8LYZA 1G0KA 5KXZA 1LYZA 1CTWA 1J1PY 2DKVA 2CJLA 164LA 4WAVA 4JKVA 4NC3A 3ZVQA 1D0MA 2OU8A 4BUOA 169LA 1XGPC 1XSFA 1LYDA 1QT8A 1NHBA 4NGOA 5K7OA 1YAQA 1GFTA 1BRXA 4GP4B 187LA 1TDYA 4H91A 3EMLA 1S8JA 1H68A 2W1MA 1LSDA 4AXTA 1OUEA 1L89A 2VB1A 4H9EA 4HSFA 3HARA 4RW1A 1QT7A 3QJSB 1GBWA 1I20A 3QJTB 1MGYA 1CJ7A 1L50A 1L42A 2FYCA 1L30A 4LT2A 1HHLA 2M3GA 2RBRA 2YDOA 5JJEA 4GP8B 126LA 2B6TA 2XBRA 1CU3A 5B59A 2OU9A 1L27A 1G1VA 5KJ9A 1JQUA 130LA 246LA 4LYMA 128LA 110LA 109LA 4GLVA 4NIJA 1S53A 2HEAA 1LYYA 1PQMA 2YDVA 4HYJA 4E97A 1L04A 1BVKC 5LVHA 1LHMA 1L06A 209LA 3HDFA 3HT9A 4DS7E 5ILFA 1K28A 1VATA 4I7PA 3ZPRA 199LA 1IOSA 1DYGA 1UIGA 112LA 1HENA 3AW7A 1B5XA 5LWEA 1LJHA 3K2RA 1JHLA 1QSAA 3C9MA 4GRVA 1B5YA 2NTGA 1GEZA 4I7KA 1TN5A 4H9IA 1PS5A 5DHHA 3WH1A 3A96A 2OTYX 1IX0A 1QTVA 4MR1A 1P37A 3GUJA 3FADA 4NFVA 1SX2A 2YCYA 4MBSA 1SSWA 1LMOA 2LYZA 4BVNA 1GFHA 3WQJA 1GXV2 1VDPA 3CSQA 4DDAA 1JV6A 221LA 1LZRA 1OUHA 4DQ5A 4G4HA 1HNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXO A;  3DN0 A;  4BWB A;  118L A;  1S54 A;  5AX0 A;  2YCW A;  4OO9 A;  3COD A;  1D2Y A;  3HAP A;  1X0I 1;  1CU6 A;  144L A;  214L A;  232L A;  2JAF A;  3VHZ A;  1CVK A;  1L75 A;  1KW7 A;  1QUH A;  5DHG A;  4LDE A;  1CU5 A;  2VT4 A;  1L54 A;  3SB6 A;  1L68 A;  244L A;  1L20 A;  3C8R A;  4BEZ A;  3NY9 A;  190L A;  148L E;  138L A;  1LYF A;  3L2X A;  2X72 A;  5DYS A;  4IAR A;  2QB0 B;  2L6X A;  1G1W A;  3COC A;  1KNI A;  3DN2 A;  3OE9 A;  4I7M A;  5I14 A;  5J7A A;  2R4R A;  4ARL A;  2RBQ A;  4W51 A;  3JR6 A;  3A7K A;  4G7S B;  4IAQ A;  125L A;  1D3N A;  1L28 A;  1P3N A;  4I7R A;  1LYE A;  225L A;  4GPO A;  1LI6 A;  2Q9E A;  3HUK A;  4MD1 A;  4MQT A;  5AHZ A;  192L A;  249L A;  3C7Z A;  2Y00 A;  2KSY A;  1L65 A;  1T8A A;  1L98 A;  3CDT A;  177L A;  2KSA A;  3AM6 A;  1L79 A;  3CAP A;  234L A;  4L35 A;  3OE8 A;  1L62 A;  2Z73 A;  1QTC A;  1BM1 A;  1QTZ A;  200L A;  1L48 A;  205L A;  252L A;  1DYC A;  3ABW A;  3HAS A;  1LW9 A;  2B72 A;  1UCQ A;  1L21 A;  4OV0 A;  1QTB A;  4K5Y A;  2Y04 A;  3HH3 A;  2OE7 X;  113L A;  1JTM A;  1C6E A;  1P8I A;  3NSB A;  2RBO A;  4MQS A;  2I35 A;  1JV7 A;  1L34 A;  1L71 A;  4ZPU A;  1F4Z A;  166L A;  129L A;  1OV7 A;  2JAG A;  3HDE A;  1L99 A;  222L A;  167L A;  2B7X A;  1LLH A;  216L A;  107L A;  1LYG A;  4AMI A;  4W57 A;  3S3C B;  3CDV A;  1XJU A;  1ZWN A;  2HUK A;  1P8H A;  4W55 A;  220L A;  182L A;  1L08 A;  1C6F A;  1L29 A;  4ARP A;  1C6A A;  1L77 A;  2RAY X;  1HZX A;  248L A;  4A4M A;  3UTV A;  162L A;  4W56 A;  1C61 A;  3SB7 A;  6LZM A;  1C6D A;  145L A;  3F9L A;  1L0J A;  3HWL A;  4PJZ A;  206L A;  1C8R A;  1L74 A;  2EI4 A;  1L26 A;  2I1X A;  4WW3 A;  137L A;  1TLA A;  2RB0 X;  4I7S A;  4XXJ A;  2Y02 A;  1QSB A;  4LZM A;  180L A;  142L A;  4QID A;  1L36 A;  253L A;  4I7O A;  4N4Y B;  4X31 A;  3PWH A;  1GUE A;  1CV0 A;  1QTD A;  2CUU A;  5KKH A;  2B74 A;  3RUN A;  1C68 A;  122L A;  4EPI A;  1QHJ A;  1XME B;  5H2K A;  4EIY A;  1L32 A;  4KNF A;  1JTN A;  1KG9 A;  3HU9 A;  3C81 A;  4AMJ A;  1EPY A;  247L A;  3HT7 A;  4EKR A;  4Y9H A;  2YCZ A;  3HAN A;  1PXS A;  3QBG A;  1L03 A;  2QAR C;  1KY0 A;  1L23 A;  1L84 A;  1C6I A;  2RH1 A;  1LGW A;  3UTY A;  1CV6 A;  4IB4 A;  1CU0 A;  157L A;  4I7Q A;  2NTU A;  1L05 A;  1S51 A;  4KLY A;  3EH3 B;  1P5C A;  1B6I A;  3QJQ B;  3VGA A;  5H2L A;  2NTH A;  3QJR B;  257L A;  4ARJ A;  3S8F B;  237L A;  2AT9 A;  2ANX A;  242L A;  3HTG A;  3SB8 A;  4EKQ A;  5G2D A;  1CV1 A;  3GUL A;  1LGU A;  1LN6 A;  2R4S A;  2OE4 X;  5H2P A;  1T8G A;  1L09 A;  172L A;  1C6N A;  245L A;  3FI5 A;  1C60 A;  4GYC A;  1L38 A;  1UAZ A;  3HH4 A;  1C6J A;  4FPD A;  4GP5 B;  3HUA A;  1QUO A;  156L A;  3MBV A;  4I7N A;  236L A;  3ODU A;  2WJL A;  197L A;  195L A;  1S8L A;  5TGZ A;  1G07 A;  3NYA A;  183L A;  4LDL A;  3HH5 A;  5JJN A;  1QUG A;  5A45 A;  2O4W A;  1L16 A;  5H2M A;  1C62 A;  5G54 A;  108L A;  3DN6 A;  256L A;  1GZM A;  1L94 A;  191L A;  1L24 A;  1L17 A;  1L52 A;  1TN0 A;  3DQB A;  1LI2 A;  1OVH A;  188L A;  4GBR A;  1CV3 A;  5AZD A;  3UTX A;  1L10 A;  5ETZ A;  5B6W A;  3VI0 A;  5EN0 A;  181L A;  1U19 A;  1QT6 A;  1DYD A;  1OVJ A;  2O79 A;  4DJH A;  1L19 A;  1L97 A;  1P7S A;  3PBL A;  1L15 A;  4XTL A;  3VVK A;  1L83 A;  3X3C A;  1PY6 A;  1LYH A;  1SWZ A;  1OYU A;  1QT4 A;  2OU0 X;  198L A;  1IW9 A;  1L45 A;  4XTN A;  5B6V A;  3GUP A;  3QJU B;  143L A;  184L A;  240L A;  1L59 A;  147L A;  3OE6 A;  1C3W A;  1L43 A;  3FA0 A;  4L6R A;  1G0G A;  2B6Y A;  171L A;  1L14 A;  2BRD A;  5B34 A;  4BV0 A;  5B6X A;  3UZA A;  173L A;  4X1H A;  3SBA A;  5F8U A;  1EHK B;  1C66 A;  4UG2 A;  2YCX A;  163L A;  4EKP A;  1L07 A;  1L67 A;  3QAP A;  1L86 A;  2OE9 X;  3VW7 A;  4QI1 A;  3OAX A;  260L A;  1CV4 A;  4JQ6 A;  1KME A;  155L A;  2WJK A;  4G7Q B;  3SB9 A;  1KS3 A;  4HYX A;  1L69 A;  3C83 A;  176L A;  4TL3 A;  3GUM A;  1Q5I A;  4W52 A;  3P0G A;  1C6K A;  250L A;  1CU2 A;  1PQD A;  4EPF A;  1M0L A;  4N4W A;  3GUN A;  4FA7 B;  3EH4 B;  1P8U A;  1T97 A;  5AX1 A;  3PQR A;  4UHR A;  4W54 A;  1LYI A;  2RB1 X;  1FBB A;  4W58 A;  3RZE A;  1KGB A;  196L A;  1QM8 A;  3REY A;  1L0M A;  3D4S A;  3HT6 A;  3HTF A;  5G2A A;  1L85 A;  5BR2 A;  4HWL A;  1P64 A;  4YX7 C;  5AHY A;  1C6T A;  1C67 A;  2Y03 A;  4J4Q A;  1XJI A;  1CX7 A;  1L87 A;  1P2L A;  1C69 A;  229L A;  5H2I A;  1ZUR A;  4FBZ A;  4XTO A;  1L37 A;  1LI3 A;  158L A;  3S3D B;  3C7Y A;  5JJJ A;  5B35 A;  1QS9 A;  4PXF A;  5BR5 A;  228L A;  4FAA B;  1L40 A;  1G06 A;  1XJT A;  1L41 A;  1L35 A;  149L A;  1L64 A;  2KS9 A;  1F50 A;  1M0M A;  178L A;  3V2W A;  3AYM A;  1L51 A;  1CUP A;  1D3J A;  115L A;  1L39 A;  2B70 A;  127L A;  1L31 A;  1L95 A;  239L A;  2PED A;  230L A;  3DNA A;  1L90 A;  1PQI A;  1L25 A;  1OWY A;  2LZM A;  1L11 A;  3QBI A;  1QT3 A;  119L A;  3SBB C;  261L A;  2O7A A;  1E0P A;  262L A;  4IAP A;  3X3B A;  1CV5 A;  1BRR A;  1L0K A;  3GUI A;  146L A;  139L A;  2F32 A;  3NY8 A;  1OV5 A;  2KSB A;  1L22 A;  1L93 A;  4EA3 A;  224L A;  5H2N A;  3HU8 A;  159L A;  1AP9 A;  3HT8 A;  2RAZ X;  1QKO A;  1CX6 A;  1XIO A;  4G71 B;  3DMZ A;  5B0W A;  4XT3 A;  5B2N A;  3DN1 A;  3T45 A;  1LGX A;  235L A;  140L A;  3RFM A;  210L A;  2NTW A;  2F95 A;  5ITE A;  1P6Y A;  1QTH A;  186L A;  251L A;  3C8Q A;  3OE0 A;  123L A;  3HH6 A;  102L A;  3HAO A;  1L61 A;  1L88 A;  1LWG A;  2RBN A;  4I7L A;  1LWK A;  3G3X A;  1X0K 1;  2ZFE A;  3SN6 R;  4G70 B;  1M0K A;  3S3B B;  3GUK A;  2RB2 X;  2LNL A;  1C65 A;  120L A;  1JFP A;  4ARQ B;  1L72 A;  2I20 A;  1DYA A;  1L01 A;  3HUQ A;  5B6Z A;  3VG9 A;  1C6H A;  1L56 A;  1I6S A;  1L81 A;  2B75 A;  3LZM A;  5H2O A;  1QT5 A;  1SSY A;  238L A;  2Q9D A;  2QPD B;  2F2Q A;  1F88 A;  1R84 A;  2QPE B;  1L96 A;  4MD2 A;  103L A;  1D3F A;  1IW6 A;  1G0L A;  3DN8 A;  1L63 A;  165L A;  233L A;  1KY1 A;  1G0J A;  231L A;  3V2Y A;  2HPY A;  1OWZ A;  1L9H A;  3GUO A;  4S0W A;  1L47 A;  3HTB A;  1KW5 A;  1CWQ A;  1VJM A;  1P2R A;  111L A;  2J4Y A;  3ZEV A;  1L33 A;  241L A;  4I7J A;  5B6Y A;  1L92 A;  1G0K A;  1IXF A;  4X32 A;  2L78 A;  3NS0 A;  1QKP A;  4AQN A;  1T8F A;  211L A;  1CTW A;  226L A;  3DN4 A;  2A4T A;  3UTW A;  1C63 A;  160L A;  150L A;  3S8G B;  3QJV B;  3CDQ A;  1PQJ A;  164L A;  2IGC A;  4WAV A;  4JKV A;  1Q5J A;  1E12 A;  4NC3 A;  3AYN A;  227L A;  2HUM A;  2OU8 A;  4BUO A;  169L A;  1D2W A;  5ITC A;  1LYD A;  4W59 A;  2LC9 A;  1QT8 A;  131L A;  1NHB A;  1G0M A;  2B6W A;  175L A;  3G3W A;  1JGJ A;  1X0S A;  219L A;  3ZPQ A;  3QDC A;  3DMX A;  4G7R B;  4QRY A;  4ARM B;  1BRX A;  3PDS A;  2B73 A;  254L A;  4PK0 A;  4GP4 B;  1L82 A;  4EKS A;  4YXA C;  187L A;  4EXM A;  1KG8 A;  3UG9 A;  3EML A;  3QBK A;  1L12 A;  1S8J A;  1C8S A;  4G72 B;  1H68 A;  5G36 A;  212L A;  5C1M A;  189L A;  2I21 A;  3C9L A;  1L89 A;  2LCB A;  1C6G A;  1PQO A;  4JR8 A;  1L49 A;  4ARQ A;  4PXK A;  1C6C A;  2OTZ X;  3BVD B;  3HAR A;  1QT7 A;  161L A;  5G28 A;  3QJS B;  3QJT B;  3SB5 A;  1MGY A;  1L50 A;  1L42 A;  2RBP A;  2G87 A;  1L30 A;  1QSQ A;  1G0Q A;  3DKE X;  1L76 A;  1WTH A;  3DMV A;  3HTD A;  1GU8 A;  1ZYT A;  2M3G A;  2ANV A;  2RBR A;  2YDO A;  1BRD A;  5JJE A;  4GP8 B;  213L A;  126L A;  1OVK A;  2B6T A;  1S52 A;  1QUD A;  1CU3 A;  1L55 A;  2OU9 A;  1L27 A;  1G1V A;  1C64 A;  3C80 A;  1JQU A;  3HAQ A;  130L A;  1PQK A;  246L A;  1T6H A;  128L A;  110L A;  1L02 A;  218L A;  2Z6B A;  1DZE A;  4N6H A;  109L A;  1P36 A;  1CUQ A;  1L44 A;  1QS5 A;  5H2H A;  3DN3 A;  1S53 A;  5A44 A;  1C6L A;  168L A;  1DYB A;  1PQM A;  2YDV A;  4HYJ A;  4GBR B;  4E97 A;  1L04 A;  1L57 A;  1G0P A;  1L06 A;  209L A;  3HDF A;  3QAK A;  3HT9 A;  1C6M A;  1L13 A;  4W53 A;  1SX7 A;  1AT9 A;  1VGO A;  1K28 A;  4I7P A;  3DDL A;  223L A;  2F47 A;  3UON A;  141L A;  2B6X A;  1L91 A;  1LYJ A;  5FJG A;  1C6B A;  5LZM A;  199L A;  5G2C A;  3ZPR A;  1D9W A;  1DYG A;  1L70 A;  112L A;  2Y01 A;  2ZZL A;  1L60 A;  5G53 A;  1L53 A;  1SWY A;  2OEA X;  4ARM A;  1L00 A;  1L73 A;  3KJ6 A;  5A8E A;  5LWE A;  1L46 A;  4XT1 A;  3K2R A;  1XEP A;  151L A;  2B6Z A;  201L A;  243L A;  4DAJ A;  3C9M A;  3C8S A;  1C6Q A;  4GRV A;  255L A;  185L A;  2NTG A;  5H2J A;  7LZM A;  4I7K A;  3C7W A;  1TN5 A;  258L A;  5DHH A;  1DYF A;  4BEY A;  1L80 A;  215L A;  2F93 A;  1L58 A;  2OTY X;  170L A;  1QTV A;  1P37 A;  3QBL A;  1LPY A;  3GUJ A;  1C6P A;  1P56 A;  3FAD A;  1FBK A;  1DYE A;  114L A;  217L A;  104L A;  5AWZ A;  1SX2 A;  2YCY A;  1R2N A;  3CDR A;  4MBS A;  3EH5 B;  1SSW A;  1PXR A;  3L64 A;  174L A;  4BVN A;  259L A;  2RBS A;  1L66 A;  3UZC A;  3WQJ A;  1L18 A;  4EJ4 A;  1P46 A;  3G3V A;  4YXC A;  4I7T A;  152L A;  1D3M A;  2Z55 A;  1JV6 A;  3CDO A;  221L A;  3F8V A;  1H2S A;  2HUL A;  4DKL A;  1O0A A;  2ZIY A;  3C82 A;  4LDO A; 
#chains in the Genus database with same CATH topology
 4R0F A;  118L A;  1S54 A;  1CKD A;  3B6L A;  1X0I 1;  1CU6 A;  214L A;  4Z98 A;  5LAG A;  1CU5 A;  1QQY A;  2H9J A;  1L68 A;  4NGK A;  3J6K A;  148L E;  3L2X A;  5DYS A;  1LZY A;  132L A;  1WQP A;  2F2N A;  1DZB X;  4W51 A;  1CKC A;  4C5F A;  1D3N A;  1P3N A;  4I7R A;  4X32 A;  4GPO A;  5AHZ A;  5M1Y A;  1HSX A;  4J1B A;  177L A;  1L98 A;  1YKZ X;  3A3Q A;  4N0J A;  3B0I A;  1BGI A;  5IHG A;  1REX A;  1L21 A;  4OV0 A;  1N4F A;  4MQS A;  2N5Z A;  1B5Z A;  1JV7 A;  4NHS A;  1LSP A;  1L99 A;  222L A;  1WQQ A;  4DYG A;  1LAA A;  107L A;  2DBT A;  3LZ2 A;  4AMI A;  2BQG A;  3CDV A;  2HUK A;  1L29 A;  4G49 A;  4ARP A;  6LYT A;  1L77 A;  1G7J C;  1C61 A;  1D9U A;  5KXY A;  1C6D A;  2XJW A;  3F9L A;  1C46 A;  1L0J A;  1GE4 A;  1VDT A;  4PJZ A;  5C6I A;  1L74 A;  2EI4 A;  1GB0 A;  3CT1 A;  180L A;  1LSC A;  5KXP A;  3MGW A;  4E3U A;  1QTD A;  2CUU A;  3B0K A;  1C68 A;  1AT6 A;  122L A;  1XME B;  5H2K A;  4EIY A;  4RLM A;  1OUC A;  3G3B B;  3W6B A;  1LJG A;  4ETA A;  4Y9H A;  2YCZ A;  2Z2F A;  3QBG A;  1KY0 A;  2EIZ C;  4WM3 A;  1JIT A;  1CV6 A;  2CDS A;  4IB4 A;  157L A;  1JTO L;  1P5C A;  5H2L A;  257L A;  4ARJ A;  1GFU A;  3S8F B;  4YEO A;  3HTG A;  1GB3 A;  1GFA A;  1CV1 A;  1BWJ A;  3GUL A;  1LN6 A;  172L A;  1C6N A;  4BAD A;  5KXS A;  4B49 A;  1YQV Y;  1JIY A;  2C8P A;  197L A;  5A45 A;  3N9C A;  4UWU A;  4TSB A;  1NQI A;  1GPQ C;  1HEO A;  4GCC A;  5AZD A;  1IC5 Y;  5ETZ A;  5B6W A;  1FKV A;  1REM A;  3RT5 X;  1DYD A;  1L97 A;  1CJ9 A;  1RJC B;  3X3C A;  1TEW A;  3A6C Y;  1UIE A;  2ZIJ A;  198L A;  1IW9 A;  1L45 A;  4NSH A;  3IJU A;  5DM9 A;  1L59 A;  147L A;  4XJF A;  2ZWB A;  3FA0 A;  4L6R A;  3WXU A;  171L A;  3EO5 A;  4DT3 A;  173L A;  3TMX A;  1C66 A;  4UG2 A;  1L07 A;  4U3X B;  1QTE A;  3AW6 A;  1LKR A;  1L86 A;  3VW7 A;  3QAP A;  260L A;  1KME A;  2FBD A;  1DQJ C;  1L69 A;  3C83 A;  2LYO A;  4BAP A;  3LZT A;  1GF9 A;  3P0G A;  1M0L A;  3TMU A;  4D9Z A;  4N4W A;  1JKD A;  4FA7 B;  1F6R A;  3CQL A;  1T97 A;  1AT5 A;  4OW1 A;  4W58 A;  3REY A;  1QM8 A;  1GFE A;  3D4S A;  3HTF A;  3LN2 A;  1L85 A;  4GN3 A;  5AHY A;  2Y03 A;  4CJ2 A;  5LIO A;  4OWH A;  2ZQ3 A;  4LYC A;  2EQL A;  229L A;  5H2I A;  4XTO A;  1LZN A;  1GFG A;  1SLY A;  2DQG Y;  1IOC A;  2YBI A;  5B35 A;  1B7R A;  4PXF A;  228L A;  4PJ2 C;  1L41 A;  1L64 A;  1PZY A;  1M0M A;  5LA8 A;  178L A;  3AYM A;  1LCN A;  1IC7 Y;  2PC2 A;  3V2W A;  1CUP A;  1D3J A;  1AM7 A;  1LJF A;  239L A;  230L A;  1IP3 A;  1YIL A;  3EXD A;  1QUS A;  5I4X A;  1QT3 A;  3SBB C;  1B7O A;  1E0P A;  1REZ A;  3LYT A;  3GUI A;  1Z55 A;  2MED A;  3A34 A;  1L22 A;  1L93 A;  2D4K A;  224L A;  4EA3 A;  1BWI A;  159L A;  5C6L A;  5LXW A;  1BVX A;  1B0D A;  3CSR A;  3DN1 A;  3T45 A;  3WUA A;  235L A;  4GCE A;  210L A;  2F95 A;  1OUD A;  4H94 A;  4NSG A;  2DQI Y;  1QTH A;  1YAN A;  4G9S A;  3FI7 A;  3C8Q A;  3OE0 A;  4TUN A;  3E3D A;  3HH6 A;  102L A;  2DQH Y;  1L61 A;  2ZFE A;  3G3X A;  1X0K 1;  4PPO A;  4G70 B;  3GUK A;  2LNL A;  3SP3 A;  4ET9 A;  1L72 A;  1XGT C;  2I20 A;  1CKF A;  3BKH A;  1L56 A;  2B75 A;  1QT5 A;  2QPD B;  2Q9D A;  103L A;  1D3F A;  2ZNW Y;  3DN8 A;  1L63 A;  5E9R A;  2ZYP A;  1KY1 A;  231L A;  1DPX A;  2MEI A;  4HJY A;  3LYO A;  3IWR A;  3AZ6 A;  1GBS A;  1LSY A;  3D3D A;  5DL9 A;  3WYH A;  4ETE A;  1T6V L;  3DN4 A;  5HMJ A;  3UTW A;  1JKC A;  4NGL A;  3QJV B;  1F10 A;  1JPO A;  3WVY A;  2FYD A;  2BQE A;  227L A;  1QUT A;  4LFX A;  1D2W A;  3AGI A;  5D5C A;  4CHX A;  4W59 A;  2ZNX Y;  3M18 B;  219L A;  4YM8 A;  4G7R B;  1IP5 A;  2B73 A;  1L82 A;  4EXM A;  1KG8 A;  1GF6 A;  1LMA A;  3QBK A;  5G36 A;  1JTT L;  212L A;  3TMW A;  2I21 A;  4C3W A;  1NBZ C;  4WM6 A;  1UIA A;  1C6G A;  4ETD A;  2YBM A;  4NHI A;  5B07 A;  4JR8 A;  4ARQ A;  2ZQ4 A;  4NGJ A;  161L A;  3SB5 A;  3AB6 A;  2RBP A;  2D91 A;  3DMV A;  1L76 A;  1GU8 A;  2YBJ A;  1ZYT A;  2ANV A;  3A3R X;  1OVK A;  1B7P A;  1QUD A;  5FEL A;  4G4B A;  1XFP L;  4H8X A;  1C64 A;  3P68 A;  2HEE A;  218L A;  4NHP A;  1DZE A;  1IR9 A;  1CUQ A;  168L A;  1GDX A;  2MEG A;  1L57 A;  1HEP A;  4XJH A;  1G0P A;  2DQA A;  1SX7 A;  223L A;  141L A;  4RW2 A;  1L91 A;  1C6B A;  2B5Z A;  5G2C A;  1D9W A;  3WXT A;  2Y01 A;  3P65 A;  1L00 A;  5F14 A;  1ZMY L;  1XEP A;  151L A;  201L A;  3C8S A;  1BB6 A;  4KL7 A;  255L A;  1GF3 A;  5H2J A;  5KY1 A;  4TX7 A;  3C7W A;  5HNC A;  1O23 A;  4DD0 A;  1DYF A;  4BEY A;  1L80 A;  5FHW A;  4B0D A;  1F6S A;  1C6P A;  5HNL A;  4ZEE A;  1FBK A;  1DYE A;  3CDR A;  3L64 A;  259L A;  2RBS A;  4HJV A;  4DC4 A;  2D4J A;  1D3M A;  2Z55 A;  3CDO A;  1LJK A;  1WQM A;  2BQH A;  4OOO A;  2ZIY A;  4PGJ B;  5AX0 A;  1LZB A;  3COD A;  4HTQ A;  4NGY A;  1D2Y A;  1VED A;  1CVK A;  1L75 A;  2Z39 A;  3RNX A;  4H9F A;  244L A;  3NY9 A;  190L A;  1LYF A;  1HC0 A;  4LYO A;  2QB0 B;  3DN2 A;  1HEQ A;  1UBZ A;  3A6B Y;  5I14 A;  5II3 A;  5J7A A;  2R4R A;  2RBQ A;  4G7S B;  3JR6 A;  3A7K A;  1HMK A;  3W6C A;  1WQN A;  1L28 A;  3HUK A;  2Q9E A;  4HTN A;  1LZ5 A;  249L A;  1T8A A;  3CDT A;  3AM6 A;  4L35 A;  1L79 A;  234L A;  1YKX X;  2Z73 A;  4UWN A;  2LZT A;  1QTZ A;  1YKY X;  200L A;  1DXJ A;  252L A;  3HAS A;  1P8I A;  4WLD A;  4ZPU A;  166L A;  4QEQ A;  2ZYC A;  4ETC A;  2HTX A;  1REY A;  5LIN A;  1GB7 A;  1IP6 A;  1LSF A;  1LZG A;  1XJU A;  5B06 A;  1C6F A;  2W1L A;  4BS7 A;  4HV2 A;  1MEL L;  1HZX A;  4J0L A;  4QY9 A;  3UTV A;  1GEV A;  145L A;  1UC0 A;  5LYM A;  206L A;  2C8O A;  153L A;  2I1X A;  1L26 A;  2A7D A;  2RB0 X;  4H9C A;  4X3B A;  4LZM A;  2BQD A;  4H1P A;  2X0A A;  5DLA A;  5HLL A;  5KKH A;  2B74 A;  1LOZ A;  1QHJ A;  1L32 A;  2GV0 A;  3C81 A;  3HT7 A;  247L A;  3A95 A;  4N1C C;  1G7I C;  1YAM A;  2BQJ A;  3EMS A;  1LJN A;  1CU0 A;  2DQE Y;  3EH3 B;  3QJQ B;  3T6U A;  3QJR B;  1I1Z A;  1QSW A;  4ZFP A;  2ANX A;  3SB8 A;  208L A;  4EKQ A;  5G2D A;  1IVM A;  2R4S A;  2OE4 X;  1T8G A;  3FI5 A;  2G4Q A;  3TXK A;  4FPD A;  4GP5 B;  195L A;  183L A;  1LPI A;  3HBD A;  1OUA A;  1W6Z A;  3TXF A;  1BWH A;  1C62 A;  4DD3 A;  1IWU A;  1TCY A;  3A67 Y;  1TN0 A;  3DQB A;  5LVG A;  4GBR A;  5KXK A;  4LT0 A;  5EN0 A;  1U19 A;  1H6M A;  1OVJ A;  4HPE A;  3PBL A;  5FDJ A;  4Z3M A;  4BAF A;  1L83 A;  4PRU A;  1F0W A;  2F4A A;  5FCP A;  1QT4 A;  3F6Z A;  1GFV A;  1GB6 A;  1C45 A;  3GUP A;  3QJU B;  4GCF A;  2YBL A;  3A90 A;  1GBO A;  240L A;  5KXW A;  3OE6 A;  2BLX A;  1C3W A;  1G0G A;  1QTK A;  2F4G A;  4WG1 A;  3UZA A;  4X1H A;  1EHK B;  163L A;  1IR8 A;  3OAX A;  1B2K A;  5F81 A;  1BB3 A;  1VAU A;  1YL1 X;  1C6K A;  250L A;  4LT3 A;  3GUN A;  4WM2 A;  1DKK A;  3PQR A;  5L9J A;  3A8Z A;  4W54 A;  1LYI A;  4H90 A;  3RZE A;  5APC A;  4H9A A;  4QDN A;  1FBI X;  4EMN A;  3HT6 A;  5G2A A;  3RZ4 A;  1FLU A;  2LZ2 A;  1C6T A;  3G3A B;  1GF4 A;  3AGH A;  1WTN A;  4R6C A;  1L37 A;  1OQM A;  4IAS A;  3KAM A;  3B0O A;  1B9O A;  4N5R A;  1EQE A;  149L A;  4WMG A;  2NWD X;  2B70 A;  115L A;  1L39 A;  2PED A;  1HEW A;  1L31 A;  4DD2 A;  1IP1 A;  2H5Z A;  1C43 A;  4ZIX A;  1L25 A;  1OWY A;  1ALC A;  2LZM A;  2Z19 A;  261L A;  4IAP A;  3X3B A;  5J7C A;  1BRR A;  3AZ4 A;  1GE0 A;  4YF2 A;  139L A;  1LMP A;  2F32 A;  3TXD A;  1V7S A;  2BQA A;  2HEF A;  1VDQ A;  5H2N A;  3HU8 A;  3HT8 A;  1VDS A;  1CX6 A;  2YVB A;  140L A;  4MST A;  1HEL A;  1P6Y A;  186L A;  4CGE A;  3AGG G;  3HAO A;  4I7L A;  1LWK A;  3P4Z A;  2HEB A;  2F30 A;  2CWI A;  3S3B B;  1HFX A;  1LSE A;  1P2C C;  4H9H A;  120L A;  1JFP A;  1IY4 A;  1WVV A;  1C6H A;  5LVJ A;  5B1G A;  1I6S A;  3LZM A;  3A94 A;  1OUF A;  1SSY A;  1F88 A;  154L A;  2QPE B;  233L A;  3CB7 A;  4OWE A;  2HPY A;  3GUO A;  1E8L A;  1L47 A;  4RLN A;  6LYZ A;  5LYZ A;  1KXW A;  1GB2 A;  4A7D A;  1L92 A;  5B6Y A;  4H92 A;  226L A;  2A4T A;  1C63 A;  160L A;  1LHH A;  1WVU A;  3CDQ A;  4IAT A;  1HFZ A;  1FLQ A;  1GAY A;  2IGC A;  1LZ6 A;  2HUM A;  4NHQ A;  2LC9 A;  131L A;  1G0M A;  2B6W A;  175L A;  4CFP A;  3ZPQ A;  3QDC A;  4QRY A;  4ARM B;  2G4P A;  1LJ4 A;  4PK0 A;  254L A;  4N8Z A;  4YXA C;  3M3U A;  1MLC E;  3UG9 A;  1C8S A;  4G72 B;  2I26 L;  4ANR A;  5C1M A;  189L A;  1LZC A;  5I54 A;  5C6J A;  3C9L A;  4WM5 A;  4B1A A;  2LCB A;  1GF0 A;  1PQO A;  1NDG C;  1L49 A;  4KPM A;  2IHL A;  3BVD B;  1B7N A;  133L A;  1DI5 A;  1G0Q A;  1WTH A;  135L A;  1BRD A;  1NF5 A;  1S52 A;  1XGQ C;  1BB7 A;  4WO6 A;  1QDR A;  3HAQ A;  1PQK A;  2LHM A;  1L02 A;  2Z6B A;  4N6H A;  1L44 A;  1QS5 A;  2Q0M X;  5H2H A;  2MEH A;  5A44 A;  4WLT A;  4ETB A;  1LZ4 A;  1YIK A;  4OWB A;  5KXM A;  3QAK A;  1C6M A;  1VGO A;  1LMQ A;  2Z12 A;  4W53 A;  2BQM A;  3UON A;  3WUM A;  3EBA B;  3ULR A;  5FJG A;  1DI4 A;  1UA6 Y;  2DQJ Y;  1L70 A;  3WUL A;  207L A;  1C7P A;  5G53 A;  1LSZ A;  2OEA X;  3KJ6 A;  3VWO A;  1L46 A;  4OOT A;  3WVX A;  243L A;  1FN5 A;  7LZM A;  5KXL A;  4L41 A;  1RI8 B;  3B72 A;  2HED A;  1IR7 A;  4LT1 A;  4WG7 A;  4XN6 A;  1GE2 A;  2F93 A;  1L58 A;  1JTP L;  4WLY A;  3WPL A;  4PHI A;  5I53 A;  1G7L C;  1IY3 A;  1LYO A;  1GD6 A;  1P56 A;  3WU8 A;  114L A;  217L A;  4P2E A;  1WTM A;  5AWZ A;  1IP2 A;  174L A;  1GFR A;  1L66 A;  4YXC A;  1P46 A;  4I7T A;  152L A;  4KXI A;  1H2S A;  2HUL A;  1O0A A;  3C82 A;  3DN0 A;  1NBY C;  4BWB A;  4DQ7 A;  2YCW A;  4OO9 A;  1HSW A;  1OUJ A;  3HAP A;  2ZIK A;  3OK0 A;  144L A;  3VHZ A;  4M4O A;  1KW7 A;  5KXN A;  4LDE A;  1LSN A;  1L54 A;  3SB6 A;  4BEZ A;  4IAR A;  2L6X A;  3COC A;  2DQF C;  1KNI A;  3OE9 A;  4ARL A;  1UIB A;  3A91 A;  5IDD A;  125L A;  1D6P A;  1FLY A;  225L A;  4NHT A;  4DD7 A;  192L A;  1G7M C;  2KSY A;  3CAP A;  4YEM A;  1BHZ A;  4HP0 A;  3OE8 A;  1LZA A;  1BM1 A;  1L48 A;  1DYC A;  5KXR A;  1B5W A;  194L A;  1LW9 A;  2B72 A;  1UCQ A;  1LHK A;  1QTB A;  4K5Y A;  1EQ4 A;  2OE7 X;  113L A;  1JTM A;  4FDY A;  3NSB A;  2I35 A;  1L71 A;  129L A;  1DPW A;  3HDE A;  4DDC A;  216L A;  1LYG A;  4W57 A;  3BKV A;  4LYT A;  1D0L A;  1ZWN A;  1GHL A;  1P8H A;  2BQL A;  4W55 A;  1C6A A;  2RAY X;  5EBH A;  1YAO A;  2YDG A;  4N9R A;  248L A;  4A4M A;  1LHL A;  4W56 A;  3SB7 A;  6LZM A;  3HWL A;  1JKA A;  1LZ9 A;  1C8R A;  1UIC A;  2HU3 A;  1OUB A;  4WW3 A;  4XXJ A;  1TLA A;  4I7S A;  1GF8 A;  1QSB A;  2Y02 A;  142L A;  1L36 A;  2BQO A;  3ATO A;  3TXG A;  4I7O A;  4N4Y B;  4X31 A;  5KKI A;  2BAA A;  5DN5 A;  5APE A;  4GCB A;  1SQ2 L;  3WW5 A;  2BQF A;  5AMY A;  4EPI A;  1WQO A;  1EPY A;  4EKR A;  1ZVY B;  1PXS A;  2QAR C;  1L84 A;  3WW6 A;  1C6I A;  3UTY A;  4TTD A;  3QNG A;  4I7Q A;  2NTU A;  1L05 A;  4KLY A;  1LMT A;  1B6I A;  5I5Q A;  2XTH A;  3AZ5 A;  1JKB A;  2XQO A;  242L A;  4NSJ A;  3LHM A;  2BQI A;  1LGU A;  4NWH A;  1JEF A;  1L09 A;  3RW8 A;  1BB5 A;  1NKH A;  3IJV A;  1LHI A;  1L38 A;  4GYC A;  5L3I A;  3HH4 A;  3HUA A;  1QUO A;  156L A;  3MBV A;  2WJL A;  1OUG A;  1S8L A;  3D9A C;  5TGZ A;  1YAP A;  1G07 A;  3NYA A;  3P66 A;  4LDL A;  3HH5 A;  2H9K A;  2Z38 A;  2O4W A;  1L16 A;  5H2M A;  5G54 A;  3DN6 A;  191L A;  3P64 A;  1YRO A;  188L A;  1CV3 A;  5I4W A;  3UTX A;  1L10 A;  3TXI A;  3VI0 A;  181L A;  1DKJ A;  4DJH A;  4XTL A;  4NEB A;  1PY6 A;  1JJ0 A;  1JWR A;  1SWZ A;  1XEI A;  2OU0 X;  4XTN A;  5B6V A;  184L A;  1L43 A;  3ATN A;  3WL2 A;  2B6Y A;  2BRD A;  4BV0 A;  5B6X A;  1IOR A;  1H87 A;  1UIH A;  3SBA A;  4HJZ A;  2YCX A;  1L67 A;  2OE9 X;  4QI1 A;  5JEN B;  3QY4 A;  1CV4 A;  4JQ6 A;  1KIR C;  1GFK A;  155L A;  2WJK A;  3SB9 A;  1KS3 A;  4HYX A;  4TL3 A;  176L A;  1GE3 A;  4W52 A;  3HFM Y;  4II8 A;  1CU2 A;  1PQD A;  4EPF A;  5A3Z A;  3AJN A;  5AX1 A;  1GF5 A;  196L A;  3TMV A;  1IIZ A;  4NGZ A;  5BR2 A;  5T3F A;  1IEE A;  4WM4 A;  1B5V A;  1C67 A;  4J4Q A;  1XJI A;  1L87 A;  2D6B A;  1C69 A;  4NGV A;  3A93 A;  1GB8 A;  4WLX A;  4FBZ A;  4LFP A;  3WPK A;  3S3D B;  3C7Y A;  4NWE A;  1QS9 A;  5BR5 A;  4I8S A;  1G06 A;  1XJT A;  4I0C A;  1INU A;  1JJ3 A;  3AZ7 A;  2KS9 A;  5D5F A;  4GN4 A;  3FE0 A;  4N1E I;  1L51 A;  3CSZ A;  1BB4 A;  1LZ8 A;  1L90 A;  3K3T A;  1IOQ A;  4WL7 A;  1L11 A;  3QBI A;  3T36 A;  262L A;  1CV5 A;  2ZIL A;  3HBH A;  1L0K A;  5LYT A;  1FKQ A;  1OV5 A;  2A7F A;  3ZVQ B;  4NY5 A;  1LHJ A;  1RCM A;  5B05 A;  2BQC A;  1AP9 A;  3TXE A;  1QKO A;  1XIO A;  1RFP A;  3DMZ A;  5B0W A;  1LMN A;  1LGX A;  2NTW A;  4H93 A;  2YSS C;  1OP9 B;  251L A;  3CT0 A;  1LWG A;  2RBN A;  4XYY A;  4HPI A;  1LTM A;  1W08 A;  1C65 A;  1UAC Y;  4H8Y A;  3HUQ A;  1UUZ C;  1XGU C;  1L81 A;  5H2O A;  238L A;  1C08 C;  2HEC A;  1R84 A;  1L96 A;  4XJD A;  4MD2 A;  5KXO A;  1G0L A;  1G0J A;  1CKG A;  3V2Y A;  1OWZ A;  1L9H A;  2AUB A;  1CKH A;  3HTB A;  1KW5 A;  2BLY A;  1KXX A;  1P2R A;  2J4Y A;  1L33 A;  1VFB C;  1IXF A;  2L78 A;  3NS0 A;  1QKP A;  4AQN A;  1T8F A;  1AZF A;  1UIF A;  211L A;  4GN5 C;  4NGI A;  150L A;  4LYZ A;  3S8G B;  1PQJ A;  5E4P A;  4MCK A;  5A3E A;  1Q5J A;  4W96 A;  1E12 A;  3AYN A;  4PRQ A;  3A92 A;  1G7H C;  5ITC A;  1ZVH L;  2Z37 A;  1JGJ A;  1X0S A;  3G3W A;  5L3H A;  3DMX A;  4KT3 A;  3WU7 A;  3PDS A;  4EKS A;  1OUI A;  1L12 A;  4LZT A;  2W1X A;  1QIO A;  1LZ1 A;  3OJP A;  4XJB A;  5DN4 A;  1LZT A;  2BQB A;  1KXY A;  4PXK A;  1C6C A;  1CNS A;  2OTZ X;  1KIQ C;  5G28 A;  2G87 A;  1DI3 A;  1GAZ A;  1QSQ A;  1NHE A;  4NG1 A;  3DKE X;  3HTD A;  1B7S A;  3W6E A;  213L A;  1GB5 A;  2YBH A;  3GXK A;  1L55 A;  1J1X Y;  3C80 A;  7LYZ A;  1T6H A;  2XBS A;  1P36 A;  3DN3 A;  4NG8 A;  1C6L A;  1HER A;  1DYB A;  4GBR B;  1HF4 A;  4XAD A;  3LYZ A;  4ET8 A;  1L13 A;  5I4Y A;  1AT9 A;  3DDL A;  2BQN A;  2F47 A;  2B6X A;  1LYJ A;  1IP4 A;  5LZM A;  2ZZL A;  1L60 A;  1L53 A;  1SWY A;  4ARM A;  1L73 A;  5A8E A;  4XT1 A;  4DAJ A;  2B6Z A;  4IJ4 A;  1C6Q A;  185L A;  2W1Y A;  5APF A;  4WO9 A;  5F16 A;  258L A;  1YL0 X;  1LYS A;  215L A;  170L A;  3QBL A;  1LPY A;  4WOA A;  104L A;  4O34 A;  1R2N A;  3EH5 B;  1PXR A;  1B5U A;  3TXJ A;  2RSC A;  1IC4 Y;  3UZC A;  1L18 A;  4EJ4 A;  3G3V A;  5F9U A;  3F8V A;  1LSG A;  4DKL A;  1UID A;  4LDO A;  3PXO A;  2I6Z A;  1CJ8 A;  3W3E A;  2EPE A;  1KIP C;  4XEN A;  232L A;  2JAF A;  4NSI A;  1FDL Y;  1QUH A;  2IFF Y;  5DHG A;  4DWX A;  2VT4 A;  4B4I A;  1BQL Y;  2I25 L;  1L20 A;  3C8R A;  4B4J A;  138L A;  3GXR A;  2X72 A;  1G1W A;  2MEE A;  4I7M A;  2Z2E A;  4DD9 A;  4IAQ A;  3CT5 A;  3TXB A;  1LYE A;  4MD1 A;  1LI6 A;  4MQT A;  2BPU A;  134L A;  3C7Z A;  2Y00 A;  1L65 A;  2YBN A;  4TWS A;  2KSA A;  1LZD A;  4LGK A;  1L62 A;  1QTC A;  1B7L A;  205L A;  1GFJ A;  3ABW A;  1LZS A;  1LMC A;  2Y04 A;  1D0K A;  3HH3 A;  1C10 A;  1C6E A;  2RBO A;  1QDT A;  1L34 A;  1F4Z A;  1OV7 A;  2JAG A;  1GWD A;  4UWV A;  1NWG A;  4Z46 A;  1CJ6 A;  167L A;  2B7X A;  1LLH A;  4DDB A;  1I56 A;  1A4V A;  3S3C B;  1D6Q A;  1JUG A;  2MEF A;  220L A;  182L A;  1L08 A;  4XJG A;  1EQ5 A;  4HV1 A;  4M6D A;  162L A;  5KXX A;  4EOF A;  4RDS A;  137L A;  1IWX A;  4QID A;  5LVK A;  253L A;  3PWH A;  1GUE A;  1CV0 A;  3RUN A;  4OWA A;  1B7Q A;  4KNF A;  1JTN A;  3QE8 A;  1KG9 A;  3HU9 A;  4AMJ A;  1WQR A;  5LA5 A;  3HAN A;  1L03 A;  5B1F A;  1L23 A;  5APD A;  2RH1 A;  1LGW A;  4LYB A;  1S51 A;  1JSF A;  3VGA A;  3J4G A;  3WUN A;  2NTH A;  237L A;  5LAF A;  2WAR A;  2AT9 A;  1V7T A;  4OWC A;  4ML7 A;  2DQD Y;  5H2P A;  245L A;  1IWY A;  1C60 A;  2G4N A;  193L A;  1UAZ A;  1C6J A;  5HQ1 A;  4YEN A;  4I7N A;  236L A;  3ODU A;  1JSE A;  5JJN A;  5KXT A;  1QUG A;  1GDW A;  5F9X A;  4DQJ A;  1GE1 A;  108L A;  256L A;  1GZM A;  1L94 A;  1L24 A;  1L17 A;  1L52 A;  1LI2 A;  1OVH A;  5KKJ A;  1IWZ A;  1A2Y C;  2BQK A;  4WL6 A;  1QT6 A;  3W6A A;  2O79 A;  2DQC Y;  1L19 A;  1P7S A;  1L15 A;  3W6D A;  3ZEK A;  3VVK A;  3LYM A;  1GF7 A;  4TSC A;  2D4I A;  1LYH A;  1T3P A;  1OYU A;  1IWV A;  143L A;  3N9A A;  1L14 A;  5B34 A;  5F8U A;  2HU1 A;  4EKP A;  2CGI A;  2MEA A;  1EL1 A;  4AGA A;  4DD1 A;  1LSB A;  4G7Q B;  1GB9 A;  4WM1 A;  1XEJ A;  3GUM A;  1Q5I A;  3AYQ A;  3WU9 A;  3EH4 B;  1P8U A;  4UHR A;  3W6F A;  1LJ3 A;  2RB1 X;  4FJR A;  1FBB A;  1KGB A;  1GBY A;  1L0M A;  4HWL A;  1P64 A;  4YX7 C;  1LJE A;  1CX7 A;  1P2L A;  4QGZ A;  1LSA A;  1ZUR A;  1TAY A;  1LI3 A;  158L A;  5JJJ A;  4FAA B;  1L40 A;  3WMK A;  5HMV A;  1L35 A;  5FST A;  1XGR C;  1F50 A;  5LVI A;  1JJ1 A;  4J7V A;  1IWT A;  127L A;  1L95 A;  5ILC A;  1ZV5 L;  3DNA A;  4G4C A;  1PQI A;  4YOP A;  119L A;  2EKS C;  2O7A A;  1HML A;  1IP7 A;  1TBY A;  2MEC A;  1LJJ A;  4J1A A;  2HUB A;  146L A;  3NY8 A;  1IWW A;  1RE2 A;  2KSB A;  4Z41 A;  1UCO A;  3N9E A;  2RAZ X;  5FEK A;  2LYM A;  4G71 B;  4CFO A;  1HFY A;  4XT3 A;  5B2N A;  4B4E A;  1LJI A;  3RFM A;  1AKI A;  5ITE A;  4NGW A;  3HBE X;  9LYZ A;  4HTK A;  4GCD A;  1HEM A;  123L A;  1LKS A;  2Y8P A;  1J1O Y;  1FLW A;  1L88 A;  1GBX A;  1LSM A;  1XEK A;  3SN6 R;  1LZE A;  1B7M A;  2Z18 A;  4GLA A;  3TXH A;  1M0K A;  1IO5 A;  2RB2 X;  2MEB A;  4ARQ B;  1DYA A;  1L01 A;  1NMM A;  5B6Z A;  3VG9 A;  4H8Z A;  1GBZ A;  5IEL A;  2F2Q A;  4XJI A;  4H9B A;  3RU5 A;  1IOT A;  1IW6 A;  3WPJ A;  165L A;  4S0W A;  1JIS A;  4W94 A;  1GXX A;  1NDM C;  2FBB A;  1CWQ A;  1VJM A;  111L A;  3ZEV A;  241L A;  4I7J A;  8LYZ A;  1G0K A;  5KXZ A;  1LYZ A;  1CTW A;  1J1P Y;  2DKV A;  2CJL A;  164L A;  4WAV A;  4JKV A;  4NC3 A;  3ZVQ A;  1D0M A;  2OU8 A;  4BUO A;  169L A;  1XGP C;  1XSF A;  1LYD A;  1QT8 A;  1NHB A;  4NGO A;  5K7O A;  1YAQ A;  1GFT A;  1BRX A;  4GP4 B;  187L A;  1TDY A;  4H91 A;  3EML A;  1S8J A;  1H68 A;  2W1M A;  1LSD A;  4AXT A;  1OUE A;  1L89 A;  2VB1 A;  4H9E A;  4HSF A;  3HAR A;  4RW1 A;  1QT7 A;  3QJS B;  1GBW A;  1I20 A;  3QJT B;  1MGY A;  1CJ7 A;  1L50 A;  1L42 A;  2FYC A;  1L30 A;  4LT2 A;  1HHL A;  2M3G A;  2RBR A;  2YDO A;  5JJE A;  4GP8 B;  126L A;  2B6T A;  2XBR A;  1CU3 A;  5B59 A;  2OU9 A;  1L27 A;  1G1V A;  5KJ9 A;  1JQU A;  130L A;  246L A;  4LYM A;  128L A;  110L A;  109L A;  4GLV A;  4NIJ A;  1S53 A;  2HEA A;  1LYY A;  1PQM A;  2YDV A;  4HYJ A;  4E97 A;  1L04 A;  1BVK C;  5LVH A;  1LHM A;  1L06 A;  209L A;  3HDF A;  3HT9 A;  4DS7 E;  5ILF A;  1K28 A;  1VAT A;  4I7P A;  3ZPR A;  199L A;  1IOS A;  1DYG A;  1UIG A;  112L A;  1HEN A;  3AW7 A;  1B5X A;  5LWE A;  1LJH A;  3K2R A;  1JHL A;  1QSA A;  3C9M A;  4GRV A;  1B5Y A;  2NTG A;  1GEZ A;  4I7K A;  1TN5 A;  4H9I A;  1PS5 A;  5DHH A;  3WH1 A;  3A96 A;  2OTY X;  1IX0 A;  1QTV A;  4MR1 A;  1P37 A;  3GUJ A;  3FAD A;  4NFV A;  1SX2 A;  2YCY A;  4MBS A;  1SSW A;  1LMO A;  2LYZ A;  4BVN A;  1GFH A;  3WQJ A;  1GXV 2;  1VDP A;  3CSQ A;  4DDA A;  1JV6 A;  221L A;  1LZR A;  1OUH A;  4DQ5 A;  4G4H A;  1HNL A; 
#chains in the Genus database with same CATH homology
 4R0F A;  118L A;  1S54 A;  1CKD A;  3B6L A;  1X0I 1;  1CU6 A;  214L A;  4Z98 A;  5LAG A;  1CU5 A;  1QQY A;  2H9J A;  1L68 A;  4NGK A;  3J6K A;  148L E;  3L2X A;  5DYS A;  1LZY A;  132L A;  1WQP A;  2F2N A;  1DZB X;  4W51 A;  1CKC A;  4C5F A;  1D3N A;  1P3N A;  4I7R A;  4X32 A;  4GPO A;  5AHZ A;  5M1Y A;  1HSX A;  4J1B A;  177L A;  1L98 A;  1YKZ X;  3A3Q A;  4N0J A;  3B0I A;  1BGI A;  5IHG A;  1REX A;  1L21 A;  4OV0 A;  1N4F A;  4MQS A;  2N5Z A;  1B5Z A;  1JV7 A;  4NHS A;  1LSP A;  1L99 A;  222L A;  1WQQ A;  4DYG A;  1LAA A;  107L A;  2DBT A;  3LZ2 A;  4AMI A;  2BQG A;  3CDV A;  2HUK A;  1L29 A;  4G49 A;  4ARP A;  6LYT A;  1L77 A;  1G7J C;  1C61 A;  1D9U A;  5KXY A;  1C6D A;  2XJW A;  3F9L A;  1C46 A;  1L0J A;  1GE4 A;  1VDT A;  4PJZ A;  5C6I A;  1L74 A;  2EI4 A;  1GB0 A;  3CT1 A;  180L A;  1LSC A;  5KXP A;  3MGW A;  4E3U A;  1QTD A;  2CUU A;  3B0K A;  1C68 A;  1AT6 A;  122L A;  1XME B;  5H2K A;  4EIY A;  4RLM A;  1OUC A;  3G3B B;  3W6B A;  1LJG A;  4ETA A;  4Y9H A;  2YCZ A;  2Z2F A;  3QBG A;  1KY0 A;  2EIZ C;  4WM3 A;  1JIT A;  1CV6 A;  2CDS A;  4IB4 A;  157L A;  1JTO L;  1P5C A;  5H2L A;  257L A;  4ARJ A;  1GFU A;  3S8F B;  4YEO A;  3HTG A;  1GB3 A;  1GFA A;  1CV1 A;  1BWJ A;  3GUL A;  1LN6 A;  172L A;  1C6N A;  4BAD A;  5KXS A;  4B49 A;  1YQV Y;  1JIY A;  2C8P A;  197L A;  5A45 A;  3N9C A;  4UWU A;  4TSB A;  1NQI A;  1GPQ C;  1HEO A;  4GCC A;  5AZD A;  1IC5 Y;  5ETZ A;  5B6W A;  1FKV A;  1REM A;  3RT5 X;  1DYD A;  1L97 A;  1CJ9 A;  1RJC B;  3X3C A;  1TEW A;  3A6C Y;  1UIE A;  2ZIJ A;  198L A;  1IW9 A;  1L45 A;  4NSH A;  3IJU A;  5DM9 A;  1L59 A;  147L A;  4XJF A;  2ZWB A;  3FA0 A;  4L6R A;  3WXU A;  171L A;  3EO5 A;  4DT3 A;  173L A;  3TMX A;  1C66 A;  4UG2 A;  1L07 A;  4U3X B;  1QTE A;  3AW6 A;  1LKR A;  1L86 A;  3VW7 A;  3QAP A;  260L A;  1KME A;  2FBD A;  1DQJ C;  1L69 A;  3C83 A;  2LYO A;  4BAP A;  3LZT A;  1GF9 A;  3P0G A;  1M0L A;  3TMU A;  4D9Z A;  4N4W A;  1JKD A;  4FA7 B;  1F6R A;  3CQL A;  1T97 A;  1AT5 A;  4OW1 A;  4W58 A;  3REY A;  1QM8 A;  1GFE A;  3D4S A;  3HTF A;  3LN2 A;  1L85 A;  4GN3 A;  5AHY A;  2Y03 A;  4CJ2 A;  5LIO A;  4OWH A;  2ZQ3 A;  4LYC A;  2EQL A;  229L A;  5H2I A;  4XTO A;  1LZN A;  1GFG A;  1SLY A;  2DQG Y;  1IOC A;  2YBI A;  5B35 A;  1B7R A;  4PXF A;  228L A;  4PJ2 C;  1L41 A;  1L64 A;  1PZY A;  1M0M A;  5LA8 A;  178L A;  3AYM A;  1LCN A;  1IC7 Y;  2PC2 A;  3V2W A;  1CUP A;  1D3J A;  1AM7 A;  1LJF A;  239L A;  230L A;  1IP3 A;  1YIL A;  3EXD A;  1QUS A;  5I4X A;  1QT3 A;  3SBB C;  1B7O A;  1E0P A;  1REZ A;  3LYT A;  3GUI A;  1Z55 A;  2MED A;  3A34 A;  1L22 A;  1L93 A;  2D4K A;  224L A;  4EA3 A;  1BWI A;  159L A;  5C6L A;  5LXW A;  1BVX A;  1B0D A;  3CSR A;  3DN1 A;  3T45 A;  3WUA A;  235L A;  4GCE A;  210L A;  2F95 A;  1OUD A;  4H94 A;  4NSG A;  2DQI Y;  1QTH A;  1YAN A;  4G9S A;  3FI7 A;  3C8Q A;  3OE0 A;  4TUN A;  3E3D A;  3HH6 A;  102L A;  2DQH Y;  1L61 A;  2ZFE A;  3G3X A;  1X0K 1;  4PPO A;  4G70 B;  3GUK A;  2LNL A;  3SP3 A;  4ET9 A;  1L72 A;  1XGT C;  2I20 A;  1CKF A;  3BKH A;  1L56 A;  2B75 A;  1QT5 A;  2QPD B;  2Q9D A;  103L A;  1D3F A;  2ZNW Y;  3DN8 A;  1L63 A;  5E9R A;  2ZYP A;  1KY1 A;  231L A;  1DPX A;  2MEI A;  4HJY A;  3LYO A;  3IWR A;  3AZ6 A;  1GBS A;  1LSY A;  3D3D A;  5DL9 A;  3WYH A;  4ETE A;  1T6V L;  3DN4 A;  5HMJ A;  3UTW A;  1JKC A;  4NGL A;  3QJV B;  1F10 A;  1JPO A;  3WVY A;  2FYD A;  2BQE A;  227L A;  1QUT A;  4LFX A;  1D2W A;  3AGI A;  5D5C A;  4CHX A;  4W59 A;  2ZNX Y;  3M18 B;  219L A;  4YM8 A;  4G7R B;  1IP5 A;  2B73 A;  1L82 A;  4EXM A;  1KG8 A;  1GF6 A;  1LMA A;  3QBK A;  5G36 A;  1JTT L;  212L A;  3TMW A;  2I21 A;  4C3W A;  1NBZ C;  4WM6 A;  1UIA A;  1C6G A;  4ETD A;  2YBM A;  4NHI A;  5B07 A;  4JR8 A;  4ARQ A;  2ZQ4 A;  4NGJ A;  161L A;  3SB5 A;  3AB6 A;  2RBP A;  2D91 A;  3DMV A;  1L76 A;  1GU8 A;  2YBJ A;  1ZYT A;  2ANV A;  3A3R X;  1OVK A;  1B7P A;  1QUD A;  5FEL A;  4G4B A;  1XFP L;  4H8X A;  1C64 A;  3P68 A;  2HEE A;  218L A;  4NHP A;  1DZE A;  1IR9 A;  1CUQ A;  168L A;  1GDX A;  2MEG A;  1L57 A;  1HEP A;  4XJH A;  1G0P A;  2DQA A;  1SX7 A;  223L A;  141L A;  4RW2 A;  1L91 A;  1C6B A;  2B5Z A;  5G2C A;  1D9W A;  3WXT A;  2Y01 A;  3P65 A;  1L00 A;  5F14 A;  1ZMY L;  1XEP A;  151L A;  201L A;  3C8S A;  1BB6 A;  4KL7 A;  255L A;  1GF3 A;  5H2J A;  5KY1 A;  4TX7 A;  3C7W A;  5HNC A;  1O23 A;  4DD0 A;  1DYF A;  4BEY A;  1L80 A;  5FHW A;  4B0D A;  1F6S A;  1C6P A;  5HNL A;  4ZEE A;  1FBK A;  1DYE A;  3CDR A;  3L64 A;  259L A;  2RBS A;  4HJV A;  4DC4 A;  2D4J A;  1D3M A;  2Z55 A;  3CDO A;  1LJK A;  1WQM A;  2BQH A;  4OOO A;  2ZIY A;  4PGJ B;  5AX0 A;  1LZB A;  3COD A;  4HTQ A;  4NGY A;  1D2Y A;  1VED A;  1CVK A;  1L75 A;  2Z39 A;  3RNX A;  4H9F A;  244L A;  3NY9 A;  190L A;  1LYF A;  1HC0 A;  4LYO A;  2QB0 B;  3DN2 A;  1HEQ A;  1UBZ A;  3A6B Y;  5I14 A;  5II3 A;  5J7A A;  2R4R A;  2RBQ A;  4G7S B;  3JR6 A;  3A7K A;  1HMK A;  3W6C A;  1WQN A;  1L28 A;  3HUK A;  2Q9E A;  4HTN A;  1LZ5 A;  249L A;  1T8A A;  3CDT A;  3AM6 A;  4L35 A;  1L79 A;  234L A;  1YKX X;  2Z73 A;  4UWN A;  2LZT A;  1QTZ A;  1YKY X;  200L A;  1DXJ A;  252L A;  3HAS A;  1P8I A;  4WLD A;  4ZPU A;  166L A;  4QEQ A;  2ZYC A;  4ETC A;  2HTX A;  1REY A;  5LIN A;  1GB7 A;  1IP6 A;  1LSF A;  1LZG A;  1XJU A;  5B06 A;  1C6F A;  2W1L A;  4BS7 A;  4HV2 A;  1MEL L;  1HZX A;  4J0L A;  4QY9 A;  3UTV A;  1GEV A;  145L A;  1UC0 A;  5LYM A;  206L A;  2C8O A;  153L A;  2I1X A;  1L26 A;  2A7D A;  2RB0 X;  4H9C A;  4X3B A;  4LZM A;  2BQD A;  4H1P A;  2X0A A;  5DLA A;  5HLL A;  5KKH A;  2B74 A;  1LOZ A;  1QHJ A;  1L32 A;  2GV0 A;  3C81 A;  3HT7 A;  247L A;  3A95 A;  4N1C C;  1G7I C;  1YAM A;  2BQJ A;  3EMS A;  1LJN A;  1CU0 A;  2DQE Y;  3EH3 B;  3QJQ B;  3T6U A;  3QJR B;  1I1Z A;  1QSW A;  4ZFP A;  2ANX A;  3SB8 A;  208L A;  4EKQ A;  5G2D A;  1IVM A;  2R4S A;  2OE4 X;  1T8G A;  3FI5 A;  2G4Q A;  3TXK A;  4FPD A;  4GP5 B;  195L A;  183L A;  1LPI A;  3HBD A;  1OUA A;  1W6Z A;  3TXF A;  1BWH A;  1C62 A;  4DD3 A;  1IWU A;  1TCY A;  3A67 Y;  1TN0 A;  3DQB A;  5LVG A;  4GBR A;  5KXK A;  4LT0 A;  5EN0 A;  1U19 A;  1H6M A;  1OVJ A;  4HPE A;  3PBL A;  5FDJ A;  4Z3M A;  4BAF A;  1L83 A;  4PRU A;  1F0W A;  2F4A A;  5FCP A;  1QT4 A;  3F6Z A;  1GFV A;  1GB6 A;  1C45 A;  3GUP A;  3QJU B;  4GCF A;  2YBL A;  3A90 A;  1GBO A;  240L A;  5KXW A;  3OE6 A;  2BLX A;  1C3W A;  1G0G A;  1QTK A;  2F4G A;  4WG1 A;  3UZA A;  4X1H A;  1EHK B;  163L A;  1IR8 A;  3OAX A;  1B2K A;  5F81 A;  1BB3 A;  1VAU A;  1YL1 X;  1C6K A;  250L A;  4LT3 A;  3GUN A;  4WM2 A;  1DKK A;  3PQR A;  5L9J A;  3A8Z A;  4W54 A;  1LYI A;  4H90 A;  3RZE A;  5APC A;  4H9A A;  4QDN A;  1FBI X;  4EMN A;  3HT6 A;  5G2A A;  3RZ4 A;  1FLU A;  2LZ2 A;  1C6T A;  3G3A B;  1GF4 A;  3AGH A;  1WTN A;  4R6C A;  1L37 A;  1OQM A;  4IAS A;  3KAM A;  3B0O A;  1B9O A;  4N5R A;  1EQE A;  149L A;  4WMG A;  2NWD X;  2B70 A;  115L A;  1L39 A;  2PED A;  1HEW A;  1L31 A;  4DD2 A;  1IP1 A;  2H5Z A;  1C43 A;  4ZIX A;  1L25 A;  1OWY A;  1ALC A;  2LZM A;  2Z19 A;  261L A;  4IAP A;  3X3B A;  5J7C A;  1BRR A;  3AZ4 A;  1GE0 A;  4YF2 A;  139L A;  1LMP A;  2F32 A;  3TXD A;  1V7S A;  2BQA A;  2HEF A;  1VDQ A;  5H2N A;  3HU8 A;  3HT8 A;  1VDS A;  1CX6 A;  2YVB A;  140L A;  4MST A;  1HEL A;  1P6Y A;  186L A;  4CGE A;  3AGG G;  3HAO A;  4I7L A;  1LWK A;  3P4Z A;  2HEB A;  2F30 A;  2CWI A;  3S3B B;  1HFX A;  1LSE A;  1P2C C;  4H9H A;  120L A;  1JFP A;  1IY4 A;  1WVV A;  1C6H A;  5LVJ A;  5B1G A;  1I6S A;  3LZM A;  3A94 A;  1OUF A;  1SSY A;  1F88 A;  154L A;  2QPE B;  233L A;  3CB7 A;  4OWE A;  2HPY A;  3GUO A;  1E8L A;  1L47 A;  4RLN A;  6LYZ A;  5LYZ A;  1KXW A;  1GB2 A;  4A7D A;  1L92 A;  5B6Y A;  4H92 A;  226L A;  2A4T A;  1C63 A;  160L A;  1LHH A;  1WVU A;  3CDQ A;  4IAT A;  1HFZ A;  1FLQ A;  1GAY A;  2IGC A;  1LZ6 A;  2HUM A;  4NHQ A;  2LC9 A;  131L A;  1G0M A;  2B6W A;  175L A;  4CFP A;  3ZPQ A;  3QDC A;  4QRY A;  4ARM B;  2G4P A;  1LJ4 A;  4PK0 A;  254L A;  4N8Z A;  4YXA C;  3M3U A;  1MLC E;  3UG9 A;  1C8S A;  4G72 B;  2I26 L;  4ANR A;  5C1M A;  189L A;  1LZC A;  5I54 A;  5C6J A;  3C9L A;  4WM5 A;  4B1A A;  2LCB A;  1GF0 A;  1PQO A;  1NDG C;  1L49 A;  4KPM A;  2IHL A;  3BVD B;  1B7N A;  133L A;  1DI5 A;  1G0Q A;  1WTH A;  135L A;  1BRD A;  1NF5 A;  1S52 A;  1XGQ C;  1BB7 A;  4WO6 A;  1QDR A;  3HAQ A;  1PQK A;  2LHM A;  1L02 A;  2Z6B A;  4N6H A;  1L44 A;  1QS5 A;  2Q0M X;  5H2H A;  2MEH A;  5A44 A;  4WLT A;  4ETB A;  1LZ4 A;  1YIK A;  4OWB A;  5KXM A;  3QAK A;  1C6M A;  1VGO A;  1LMQ A;  2Z12 A;  4W53 A;  2BQM A;  3UON A;  3WUM A;  3EBA B;  3ULR A;  5FJG A;  1DI4 A;  1UA6 Y;  2DQJ Y;  1L70 A;  3WUL A;  207L A;  1C7P A;  5G53 A;  1LSZ A;  2OEA X;  3KJ6 A;  3VWO A;  1L46 A;  4OOT A;  3WVX A;  243L A;  1FN5 A;  7LZM A;  5KXL A;  4L41 A;  1RI8 B;  3B72 A;  2HED A;  1IR7 A;  4LT1 A;  4WG7 A;  4XN6 A;  1GE2 A;  2F93 A;  1L58 A;  1JTP L;  4WLY A;  3WPL A;  4PHI A;  5I53 A;  1G7L C;  1IY3 A;  1LYO A;  1GD6 A;  1P56 A;  3WU8 A;  114L A;  217L A;  4P2E A;  1WTM A;  5AWZ A;  1IP2 A;  174L A;  1GFR A;  1L66 A;  4YXC A;  1P46 A;  4I7T A;  152L A;  4KXI A;  1H2S A;  2HUL A;  1O0A A;  3C82 A;  3DN0 A;  1NBY C;  4BWB A;  4DQ7 A;  2YCW A;  4OO9 A;  1HSW A;  1OUJ A;  3HAP A;  2ZIK A;  3OK0 A;  144L A;  3VHZ A;  4M4O A;  1KW7 A;  5KXN A;  4LDE A;  1LSN A;  1L54 A;  3SB6 A;  4BEZ A;  4IAR A;  2L6X A;  3COC A;  2DQF C;  1KNI A;  3OE9 A;  4ARL A;  1UIB A;  3A91 A;  5IDD A;  125L A;  1D6P A;  1FLY A;  225L A;  4NHT A;  4DD7 A;  192L A;  1G7M C;  2KSY A;  3CAP A;  4YEM A;  1BHZ A;  4HP0 A;  3OE8 A;  1LZA A;  1BM1 A;  1L48 A;  1DYC A;  5KXR A;  1B5W A;  194L A;  1LW9 A;  2B72 A;  1UCQ A;  1LHK A;  1QTB A;  4K5Y A;  1EQ4 A;  2OE7 X;  113L A;  1JTM A;  4FDY A;  3NSB A;  2I35 A;  1L71 A;  129L A;  1DPW A;  3HDE A;  4DDC A;  216L A;  1LYG A;  4W57 A;  3BKV A;  4LYT A;  1D0L A;  1ZWN A;  1GHL A;  1P8H A;  2BQL A;  4W55 A;  1C6A A;  2RAY X;  5EBH A;  1YAO A;  2YDG A;  4N9R A;  248L A;  4A4M A;  1LHL A;  4W56 A;  3SB7 A;  6LZM A;  3HWL A;  1JKA A;  1LZ9 A;  1C8R A;  1UIC A;  2HU3 A;  1OUB A;  4WW3 A;  4XXJ A;  1TLA A;  4I7S A;  1GF8 A;  1QSB A;  2Y02 A;  142L A;  1L36 A;  2BQO A;  3ATO A;  3TXG A;  4I7O A;  4N4Y B;  4X31 A;  5KKI A;  2BAA A;  5DN5 A;  5APE A;  4GCB A;  1SQ2 L;  3WW5 A;  2BQF A;  5AMY A;  4EPI A;  1WQO A;  1EPY A;  4EKR A;  1ZVY B;  1PXS A;  2QAR C;  1L84 A;  3WW6 A;  1C6I A;  3UTY A;  4TTD A;  3QNG A;  4I7Q A;  2NTU A;  1L05 A;  4KLY A;  1LMT A;  1B6I A;  5I5Q A;  2XTH A;  3AZ5 A;  1JKB A;  2XQO A;  242L A;  4NSJ A;  3LHM A;  2BQI A;  1LGU A;  4NWH A;  1JEF A;  1L09 A;  3RW8 A;  1BB5 A;  1NKH A;  3IJV A;  1LHI A;  1L38 A;  4GYC A;  5L3I A;  3HH4 A;  3HUA A;  1QUO A;  156L A;  3MBV A;  2WJL A;  1OUG A;  1S8L A;  3D9A C;  5TGZ A;  1YAP A;  1G07 A;  3NYA A;  3P66 A;  4LDL A;  3HH5 A;  2H9K A;  2Z38 A;  2O4W A;  1L16 A;  5H2M A;  5G54 A;  3DN6 A;  191L A;  3P64 A;  1YRO A;  188L A;  1CV3 A;  5I4W A;  3UTX A;  1L10 A;  3TXI A;  3VI0 A;  181L A;  1DKJ A;  4DJH A;  4XTL A;  4NEB A;  1PY6 A;  1JJ0 A;  1JWR A;  1SWZ A;  1XEI A;  2OU0 X;  4XTN A;  5B6V A;  184L A;  1L43 A;  3ATN A;  3WL2 A;  2B6Y A;  2BRD A;  4BV0 A;  5B6X A;  1IOR A;  1H87 A;  1UIH A;  3SBA A;  4HJZ A;  2YCX A;  1L67 A;  2OE9 X;  4QI1 A;  5JEN B;  3QY4 A;  1CV4 A;  4JQ6 A;  1KIR C;  1GFK A;  155L A;  2WJK A;  3SB9 A;  1KS3 A;  4HYX A;  4TL3 A;  176L A;  1GE3 A;  4W52 A;  3HFM Y;  4II8 A;  1CU2 A;  1PQD A;  4EPF A;  5A3Z A;  3AJN A;  5AX1 A;  1GF5 A;  196L A;  3TMV A;  1IIZ A;  4NGZ A;  5BR2 A;  5T3F A;  1IEE A;  4WM4 A;  1B5V A;  1C67 A;  4J4Q A;  1XJI A;  1L87 A;  2D6B A;  1C69 A;  4NGV A;  3A93 A;  1GB8 A;  4WLX A;  4FBZ A;  4LFP A;  3WPK A;  3S3D B;  3C7Y A;  4NWE A;  1QS9 A;  5BR5 A;  4I8S A;  1G06 A;  1XJT A;  4I0C A;  1INU A;  1JJ3 A;  3AZ7 A;  2KS9 A;  5D5F A;  4GN4 A;  3FE0 A;  4N1E I;  1L51 A;  3CSZ A;  1BB4 A;  1LZ8 A;  1L90 A;  3K3T A;  1IOQ A;  4WL7 A;  1L11 A;  3QBI A;  3T36 A;  262L A;  1CV5 A;  2ZIL A;  3HBH A;  1L0K A;  5LYT A;  1FKQ A;  1OV5 A;  2A7F A;  3ZVQ B;  4NY5 A;  1LHJ A;  1RCM A;  5B05 A;  2BQC A;  1AP9 A;  3TXE A;  1QKO A;  1XIO A;  1RFP A;  3DMZ A;  5B0W A;  1LMN A;  1LGX A;  2NTW A;  4H93 A;  2YSS C;  1OP9 B;  251L A;  3CT0 A;  1LWG A;  2RBN A;  4XYY A;  4HPI A;  1LTM A;  1W08 A;  1C65 A;  1UAC Y;  4H8Y A;  3HUQ A;  1UUZ C;  1XGU C;  1L81 A;  5H2O A;  238L A;  1C08 C;  2HEC A;  1R84 A;  1L96 A;  4XJD A;  4MD2 A;  5KXO A;  1G0L A;  1G0J A;  1CKG A;  3V2Y A;  1OWZ A;  1L9H A;  2AUB A;  1CKH A;  3HTB A;  1KW5 A;  2BLY A;  1KXX A;  1P2R A;  2J4Y A;  1L33 A;  1VFB C;  1IXF A;  2L78 A;  3NS0 A;  1QKP A;  4AQN A;  1T8F A;  1AZF A;  1UIF A;  211L A;  4GN5 C;  4NGI A;  150L A;  4LYZ A;  3S8G B;  1PQJ A;  5E4P A;  4MCK A;  5A3E A;  1Q5J A;  4W96 A;  1E12 A;  3AYN A;  4PRQ A;  3A92 A;  1G7H C;  5ITC A;  1ZVH L;  2Z37 A;  1JGJ A;  1X0S A;  3G3W A;  5L3H A;  3DMX A;  4KT3 A;  3WU7 A;  3PDS A;  4EKS A;  1OUI A;  1L12 A;  4LZT A;  2W1X A;  1QIO A;  1LZ1 A;  3OJP A;  4XJB A;  5DN4 A;  1LZT A;  2BQB A;  1KXY A;  4PXK A;  1C6C A;  1CNS A;  2OTZ X;  1KIQ C;  5G28 A;  2G87 A;  1DI3 A;  1GAZ A;  1QSQ A;  1NHE A;  4NG1 A;  3DKE X;  3HTD A;  1B7S A;  3W6E A;  213L A;  1GB5 A;  2YBH A;  3GXK A;  1L55 A;  1J1X Y;  3C80 A;  7LYZ A;  1T6H A;  2XBS A;  1P36 A;  3DN3 A;  4NG8 A;  1C6L A;  1HER A;  1DYB A;  4GBR B;  1HF4 A;  4XAD A;  3LYZ A;  4ET8 A;  1L13 A;  5I4Y A;  1AT9 A;  3DDL A;  2BQN A;  2F47 A;  2B6X A;  1LYJ A;  1IP4 A;  5LZM A;  2ZZL A;  1L60 A;  1L53 A;  1SWY A;  4ARM A;  1L73 A;  5A8E A;  4XT1 A;  4DAJ A;  2B6Z A;  4IJ4 A;  1C6Q A;  185L A;  2W1Y A;  5APF A;  4WO9 A;  5F16 A;  258L A;  1YL0 X;  1LYS A;  215L A;  170L A;  3QBL A;  1LPY A;  4WOA A;  104L A;  4O34 A;  1R2N A;  3EH5 B;  1PXR A;  1B5U A;  3TXJ A;  2RSC A;  1IC4 Y;  3UZC A;  1L18 A;  4EJ4 A;  3G3V A;  5F9U A;  3F8V A;  1LSG A;  4DKL A;  1UID A;  4LDO A;  3PXO A;  2I6Z A;  1CJ8 A;  3W3E A;  2EPE A;  1KIP C;  4XEN A;  232L A;  2JAF A;  4NSI A;  1FDL Y;  1QUH A;  2IFF Y;  5DHG A;  4DWX A;  2VT4 A;  4B4I A;  1BQL Y;  2I25 L;  1L20 A;  3C8R A;  4B4J A;  138L A;  3GXR A;  2X72 A;  1G1W A;  2MEE A;  4I7M A;  2Z2E A;  4DD9 A;  4IAQ A;  3CT5 A;  3TXB A;  1LYE A;  4MD1 A;  1LI6 A;  4MQT A;  2BPU A;  134L A;  3C7Z A;  2Y00 A;  1L65 A;  2YBN A;  4TWS A;  2KSA A;  1LZD A;  4LGK A;  1L62 A;  1QTC A;  1B7L A;  205L A;  1GFJ A;  3ABW A;  1LZS A;  1LMC A;  2Y04 A;  1D0K A;  3HH3 A;  1C10 A;  1C6E A;  2RBO A;  1QDT A;  1L34 A;  1F4Z A;  1OV7 A;  2JAG A;  1GWD A;  4UWV A;  1NWG A;  4Z46 A;  1CJ6 A;  167L A;  2B7X A;  1LLH A;  4DDB A;  1I56 A;  1A4V A;  3S3C B;  1D6Q A;  1JUG A;  2MEF A;  220L A;  182L A;  1L08 A;  4XJG A;  1EQ5 A;  4HV1 A;  4M6D A;  162L A;  5KXX A;  4EOF A;  4RDS A;  137L A;  1IWX A;  4QID A;  5LVK A;  253L A;  3PWH A;  1GUE A;  1CV0 A;  3RUN A;  4OWA A;  1B7Q A;  4KNF A;  1JTN A;  3QE8 A;  1KG9 A;  3HU9 A;  4AMJ A;  1WQR A;  5LA5 A;  3HAN A;  1L03 A;  5B1F A;  1L23 A;  5APD A;  2RH1 A;  1LGW A;  4LYB A;  1S51 A;  1JSF A;  3VGA A;  3J4G A;  3WUN A;  2NTH A;  237L A;  5LAF A;  2WAR A;  2AT9 A;  1V7T A;  4OWC A;  4ML7 A;  2DQD Y;  5H2P A;  245L A;  1IWY A;  1C60 A;  2G4N A;  193L A;  1UAZ A;  1C6J A;  5HQ1 A;  4YEN A;  4I7N A;  236L A;  3ODU A;  1JSE A;  5JJN A;  5KXT A;  1QUG A;  1GDW A;  5F9X A;  4DQJ A;  1GE1 A;  108L A;  256L A;  1GZM A;  1L94 A;  1L24 A;  1L17 A;  1L52 A;  1LI2 A;  1OVH A;  5KKJ A;  1IWZ A;  1A2Y C;  2BQK A;  4WL6 A;  1QT6 A;  3W6A A;  2O79 A;  2DQC Y;  1L19 A;  1P7S A;  1L15 A;  3W6D A;  3ZEK A;  3VVK A;  3LYM A;  1GF7 A;  4TSC A;  2D4I A;  1LYH A;  1T3P A;  1OYU A;  1IWV A;  143L A;  3N9A A;  1L14 A;  5B34 A;  5F8U A;  2HU1 A;  4EKP A;  2CGI A;  2MEA A;  1EL1 A;  4AGA A;  4DD1 A;  1LSB A;  4G7Q B;  1GB9 A;  4WM1 A;  1XEJ A;  3GUM A;  1Q5I A;  3AYQ A;  3WU9 A;  3EH4 B;  1P8U A;  4UHR A;  3W6F A;  1LJ3 A;  2RB1 X;  4FJR A;  1FBB A;  1KGB A;  1GBY A;  1L0M A;  4HWL A;  1P64 A;  4YX7 C;  1LJE A;  1CX7 A;  1P2L A;  4QGZ A;  1LSA A;  1ZUR A;  1TAY A;  1LI3 A;  158L A;  5JJJ A;  4FAA B;  1L40 A;  3WMK A;  5HMV A;  1L35 A;  5FST A;  1XGR C;  1F50 A;  5LVI A;  1JJ1 A;  4J7V A;  1IWT A;  127L A;  1L95 A;  5ILC A;  1ZV5 L;  3DNA A;  4G4C A;  1PQI A;  4YOP A;  119L A;  2EKS C;  2O7A A;  1HML A;  1IP7 A;  1TBY A;  2MEC A;  1LJJ A;  4J1A A;  2HUB A;  146L A;  3NY8 A;  1IWW A;  1RE2 A;  2KSB A;  4Z41 A;  1UCO A;  3N9E A;  2RAZ X;  5FEK A;  2LYM A;  4G71 B;  4CFO A;  1HFY A;  4XT3 A;  5B2N A;  4B4E A;  1LJI A;  3RFM A;  1AKI A;  5ITE A;  4NGW A;  3HBE X;  9LYZ A;  4HTK A;  4GCD A;  1HEM A;  123L A;  1LKS A;  2Y8P A;  1J1O Y;  1FLW A;  1L88 A;  1GBX A;  1LSM A;  1XEK A;  3SN6 R;  1LZE A;  1B7M A;  2Z18 A;  4GLA A;  3TXH A;  1M0K A;  1IO5 A;  2RB2 X;  2MEB A;  4ARQ B;  1DYA A;  1L01 A;  1NMM A;  5B6Z A;  3VG9 A;  4H8Z A;  1GBZ A;  5IEL A;  2F2Q A;  4XJI A;  4H9B A;  3RU5 A;  1IOT A;  1IW6 A;  3WPJ A;  165L A;  4S0W A;  1JIS A;  4W94 A;  1GXX A;  1NDM C;  2FBB A;  1CWQ A;  1VJM A;  111L A;  3ZEV A;  241L A;  4I7J A;  8LYZ A;  1G0K A;  5KXZ A;  1LYZ A;  1CTW A;  1J1P Y;  2DKV A;  2CJL A;  164L A;  4WAV A;  4JKV A;  4NC3 A;  3ZVQ A;  1D0M A;  2OU8 A;  4BUO A;  169L A;  1XGP C;  1XSF A;  1LYD A;  1QT8 A;  1NHB A;  4NGO A;  5K7O A;  1YAQ A;  1GFT A;  1BRX A;  4GP4 B;  187L A;  1TDY A;  4H91 A;  3EML A;  1S8J A;  1H68 A;  2W1M A;  1LSD A;  4AXT A;  1OUE A;  1L89 A;  2VB1 A;  4H9E A;  4HSF A;  3HAR A;  4RW1 A;  1QT7 A;  3QJS B;  1GBW A;  1I20 A;  3QJT B;  1MGY A;  1CJ7 A;  1L50 A;  1L42 A;  2FYC A;  1L30 A;  4LT2 A;  1HHL A;  2M3G A;  2RBR A;  2YDO A;  5JJE A;  4GP8 B;  126L A;  2B6T A;  2XBR A;  1CU3 A;  5B59 A;  2OU9 A;  1L27 A;  1G1V A;  5KJ9 A;  1JQU A;  130L A;  246L A;  4LYM A;  128L A;  110L A;  109L A;  4GLV A;  4NIJ A;  1S53 A;  2HEA A;  1LYY A;  1PQM A;  2YDV A;  4HYJ A;  4E97 A;  1L04 A;  1BVK C;  5LVH A;  1LHM A;  1L06 A;  209L A;  3HDF A;  3HT9 A;  4DS7 E;  5ILF A;  1K28 A;  1VAT A;  4I7P A;  3ZPR A;  199L A;  1IOS A;  1DYG A;  1UIG A;  112L A;  1HEN A;  3AW7 A;  1B5X A;  5LWE A;  1LJH A;  3K2R A;  1JHL A;  1QSA A;  3C9M A;  4GRV A;  1B5Y A;  2NTG A;  1GEZ A;  4I7K A;  1TN5 A;  4H9I A;  1PS5 A;  5DHH A;  3WH1 A;  3A96 A;  2OTY X;  1IX0 A;  1QTV A;  4MR1 A;  1P37 A;  3GUJ A;  3FAD A;  4NFV A;  1SX2 A;  2YCY A;  4MBS A;  1SSW A;  1LMO A;  2LYZ A;  4BVN A;  1GFH A;  3WQJ A;  1GXV 2;  1VDP A;  3CSQ A;  4DDA A;  1JV6 A;  221L A;  1LZR A;  1OUH A;  4DQ5 A;  4G4H A;  1HNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...