3PBVA

Crystal structure of the mutant i96t of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAITVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanobacterium thermoautotrophicum
molecule tags Lyase
molecule keywords Orotidine 5'-monophosphate decarboxylase
total genus 87
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pbvA00
2V2CA 3UYCA 3W7OA 1LCOA 3YPIA 3NL6A 3PSWA 4HNNA 2TPSA 3EKZA 2PCQA 4S1FA 1F6PA 4XQ6A 1DV7A 4PL1A 3IIXA 2ZZ7A 5D38A 3W2NA 4MPQA 4KKXA 1TRDA 1FXQA 1RPXA 1WAUA 5FI8A 1VZWA 3W1MA 4ONVA 4AMAA 1R2RA 4RXGA 4R53A 1QPRA 5CPNA 1IIGA 3TQ0A 1U83A 4PL2A 2GPTA 3FS2A 6TIMA 2QCEA 2V81A 2Y7DA 4PC8A 4WOQA 3GYEA 2VELA 2ZTJA 4YWIA 2EPHA 1RQHA 4BFAA 2B0MA 4M19A 1B4KA 2AAMA 2J9YA 1TPEA 4O14A 1OFDA 3T44A 1VCVA 3UWUA 2VEIA 3QMSA 1HG3A 3W86A 3BLEA 4Z08A 4PODA 3VI2A 3Q2DA 1A53A 1ADOA 1SO5A 1TJPA 1SO4A 3W7NA 1QO2A 3RK8A 5AHEA 1XBXA 4ZQRA 1QOQA 4K6AA 2OMAA 4LTSA 3LI1A 4N2YA 3LCWA 2C15A 3NL5A 4N9EA 4HNUA 3SGUA 1OX5A 1KV8A 3W1XA 5F4XA 3U6WA 3KOFA 3QMRA 2Q3OA 2JGQA 1L9WA 3B06A 1YADA 5GVJA 3W1QA 4DF2A 5FF7A 4UIOA 1IXQA 3UD6A 1W8SA 3W76A 1FDYA 2P1FA 2RDUA 1H7RA 3LHWA 1LOLA 1Q45A 1DL3A 3BGJA 3LRLA 3W7GA 1OYAA 3TV8A 3MO7A 2YDAA 1OF8A 2HSAA 2HTMA 5G4WA 3TH6A 3CQ0A 3DI1A 3HG3A 2E68A 1G7UA 5HWJA 3GDKA 4O28A 1M7PA 3NZ1A 1KFEA 3TW7A 2G5WA 1O5KA 5LSMA 3I6RA 4LVGA 4UNKA 5AYYA 3JR2A 3QPYA 3NQMA 3EWXA 3GZ3A 3M44A 3CIXA 2NUWA 1GYLA 5I3FA 5HWMA 1I2PA 2YR1A 3EXTA 4CNNA 3G1FA 4ZQCA 3PM6A 2NV1A 3W2JA 2A1YA 4DPQA 2A6NA 1KTNA 3MJYA 4GWEA 5K4ZA 4ADTA 2QCMA 2Y88A 1KBJA 1XBVA 1W3TA 3LB0A 4WOZA 2RDWA 4NX5A 3T7VA 2QCCA 5DBTA 5HMSA 2EHHA 1TTPA 3IV3A 3LV6A 2JK2A 3LHUA 1Q6RA 4HKPA 4O19A 1ZAHA 3QZEA 2GJNA 2VKZG 5CZJA 2VEPA 1JULA 5KTLA 1VS1A 1F05A 1W5NA 2X2GA 3EXRA 5TQLA 1W5OA 2YFNA 2G97A 4UCGA 1KM1A 3W83A 4LOCA 3G24A 1KA9F 2ZCGA 4A2SA 4KFOA 3GNNA 6ALDA 4LY8A 3IVUA 3VE7A 1D9EA 1TV5A 3WK0A 2GVLA 3PG9A 2HS8A 4MOZA 4AEOA 2VFFA 4JX6A 3KVKA 1L6YA 1QR7A 3LCLA 5LNSA 1OYCA 3EXSA 3IIZA 3B0VC 3EX2A 2H8ZA 5AN7A 3FLUA 4ZMGA 4EWND 1SFJA 2Y7FA 5D09A 3VNDA 3W2LA 1SUXA 3W2UA 3MYOA 1N55A 3VKJA 2XN2A 1QO5A 2NUYA 3SFKA 3LHTA 4FO4A 2PC4A 2QCFA 1H7WA 4LVFA 4O1BA 5D37A 2J9ZA 1VC4A 5EA9A 1P0KA 4UFMA 1K8YA 1LBFA 4OU1A 3A24A 3AJXA 3WK1A 5KINA 4H6KA 1XFBA 3TFXA 5BRBA 3C2VA 2GVJA 1Z41A 3BLFA 4J9JA 3D0CA 3Q58A 3NQVA 3DHFA 1XBYA 1G4SA 1H60A 1OFEA 3NPVA 3QQ0A 3LHZA 4O1AA 3DXIA 1G69A 3EX6A 4ALDA 5D03A 1ZALA 1K8ZA 3QSTA 3M16A 4AH7A 3BK0A 1DJQA 2NX1A 2QCHA 3UXDA 1TV8A 3L65A 3R8RA 3BV4A 3CTLA 2Q8LA 1N7KA 3CC1A 2E5CA 3IGUA 1WYIA 4JN6A 1JJKA 5HUPA 1H7NA 3GDTA 3T55A 5DCDA 1ME8A 3TXVA 4LRTA 3F4NA 3GXPA 3WJSA 2FB2A 2G95A 4KFPA 4B5NA 1BKSA 4O12A 3P82A 1XDLA 4DEFA 2C18A 3PWAA 2Z0IA 3UXAA 3W9ZA 3W71A 1NVMA 2YYUA 3O15A 3KRUA 3NPUA 1VQTA 4AXKA 1VRDA 4BR1A 4K7YA 5L9FA 2YW3A 4JTLA 3A5FA 1EPXA 3B04A 3JRKA 1AW2A 4JTIA 3OIXA 3BLIA 4N9DA 3BG3A 1H1ZA 3EX3A 4YLWA 1I2QA 3NL3A 3CB8A 1CX9A 4NQ1A 5HNRA 1WOBA 1Q6OA 3C56A 3IIVA 4Y96A 1ZAIA 1VLIA 4WXZA 1MEWA 1VJIA 2PRHA 4DO5A 1O95A 4QAIA 1J2WA 3HPSA 4AWTA 3BARA 4LUIA 4OWGA 3UWWA 5C2XA 3STFA 3QRHA 2RHGA 5J5DA 5LZLA 2CZFA 1JCYA 3H55A 4KWWA 3B0UX 1LORA 1GG1A 4RR4A 3UZ5A 4XKYB 2Y63A 4C1KA 2NXGA 3GKAA 3W7RA 5G1YA 4UNLA 1SR9A 1B3OA 1ICSA 4ORIA 3I7RA 3W70A 1OVDA 1OX6A 2V2DA 3NQ2A 3M0ZA 4ZVJA 1RV8A 1ME7A 3EB2A 4NZFA 1FWNA 4UTKA 2F7FA 4NJJA 3O6YX 2VOMA 1YXYA 4IQLA 1GVSA 3KXQA 2ABAA 3L5AA 1EP1A 4RV8A 5F2MA 1TTIA 3PBVA 1VPXA 2Y89A 5CSSA 3TR2A 4XBKA 1CI1A 4RCXA 2FLIA 4ZQOA 5FESA 1SFLA 3GAKA 3PB0A 2YXGA 2C14A 2VENA 1SZEA 2VC6A 3W7JA 1TRIA 3NQAA 1EB3A 3L5MA 2DORA 4HN4A 3S42A 4H4IA 5AC7A 3NZRA 3R5EA 1QNVA 2WJZA 4QQ3A 4BI6A 1JCLA 3S1WA 1WXJA 4MY9A 1I2NA 3ZFHA 1LYXA 2RKXA 4PH6A 1KW1A 3M47A 1Z42A 1W31A 3EEGA 2X1UA 2E6YA 2ZQ0A 3MP4A 3TSBA 1EEPA 3TMLA 4A21A 3HG2A 2DZUA 3QSRA 3GXTA 4YL2A 3PBWA 5C55A 1Q3NA 5FF4A 5EMUA 4UTMA 3EWWA 1QOPA 4Y90A 4A3UA 5J5RA 4TU1A 2QCDA 2A4AA 1TPDA 5I3IA 1TCDA 5FEWA 2CFFA 5HJLA 3BO9A 3O6CA 1W3IA 3NGJA 4A29A 4JIQA 4JYDA 5F2LA 3ATYA 3GR8A 2ZYFA 4JTTA 5DN1A 4Z1AA 1SZNA 4CCDA 1HO1A 3LCHA 1BWKA 3VE9A 1UBSA 3QYQA 1WX0A 3CEUA 1IF2A 2VFHA 1GWJA 2NX3A 1XBZA 3NQCA 3TC7A 1FWWA 3OA3A 4Q4KA 2A85A 2I14A 3W75A 5L6UA 4MVAA 2VFDA 4XTIA 4OBTA 3GKFA 3PULA 3M43A 2QAFA 3KFTA 2DZSA 3TKFA 3HB9A 2PE4A 1T99A 3C52A 4HSOA 3QC3A 1C29A 4RZ6A 4FNPA 2Z2UA 1ZAJA 3MI3A 4UMBA 1M6JA 1KM0A 1VCFA 3B0PA 1ZY9A 3W7LA 4LT9A 4OQVA 3M1ZA 3MI6A 4ZQNA 5FEPA 1NFBA 3G3DA 1DKWA 1K7XA 1LOQA 4MFDA 3CIWA 5KMYA 4N6EA 3THQA 4JTSA 5LNRA 3ABSA 5HULA 4GUIA 1T0OA 1XUZA 3RNDA 5D30A 3NO5A 3TJLA 3TFCA 5TIMA 4GRSA 1JRCA 3TAOA 1GYNA 2H90A 4LNYA 3C2FA 5LHFA 1PCKA 1GG0A 5F4WA 1MZHA 3SY5A 4DXVA 4IX0A 3DU0A 3L0NA 1WOAA 3W6YA 1YYAA 1ZHAA 3KRZA 2CLKA 1RZMA 2YZRA 4Z0JA 3QMTA 2JKAA 3LTSA 2CZ5A 3E49A 3LCIA 1ONRA 1SW0A 1Q6LA 3N3MA 1LRQA 3N9SA 2IQTA 4I7VA 5CZTA 3TK7A 3TSDA 1H7OA 3W7HA 1K03A 2CZEA 3M6YA 4WUIA 3UY8A 5G4EA 1P4CA 1NF7A 5IM51 1TPFA 1HTIA 3ANYA 4UMAA 3ZR4A 1SZFA 2QDHA 5CGQA 3NL2A 2VEMA 4G1KA 1GPWA 1NAL1 1YDVA 3S5ZA 4UTWC 3R13A 4M7SA 1G4TA 1DBTA 1FCBA 3ATZA 4IMDA 4WQ6A 5EBUA 3DFOA 3S1XA 2EF9A 4L4MA 3TX9A 3T40A 5F1UA 1FDJA 4O54A 4JTJA 1FCVA 4JX4A 4GUJA 2ATMA 5K4XA 3LV5A 1A5SA 4IJBA 1ZCOA 5U4NA 3OVQA 1D3HA 2G96A 3L0GA 3W7KA 2C19A 4Y6GA 1ZNNA 3IEBA 4JS3A 3P80A 4HNTA 5TBOA 4O50A 3TROA 4OV4A 3SGZA 1OK4A 5F4SA 4UC5A 3TDFA 2Y6ZA 4AAJA 1OX4B 2Y85A 4PTNA 2Z1BA 4CQ8A 3M7WA 4R33A 1A5BA 3P8IA 1S3HA 3W7QA 3TU9A 3W7DA 5K9CA 2ZA3A 3NQDA 1AG1O 1OFBA 2NLIA 4WZHA 3AO0A 4ZQPA 3BW4A 3A9IA 4M6QA 3ZWTA 5AC8A 1UUMA 3KVLA 3RU6A 3TJXA 1A5CA 1G67A 4NJHA 3W1NA 4XBSA 1F5ZA 4E2BA 1EX5A 1TIMA 3W2MA 3LLDA 2J9XA 3OHIA 4O4WA 3TQKA 2WKJA 5FEXA 3NOEA 2WPBA 1KLZA 2OCZA 1LP6A 2C3ZA 3TA6A 5DLCA 3W23A 1ZENA 4U4MA 3T78A 3GVGA 4CCCA 3BVJA 4UUIA 3NYZA 5AHIA 2AGKA 3LHYA 1GQNA 5E93A 4JGDA 1GVRA 3TIMA 3L66A 2Q8ZA 2DZXA 2QAPA 4FNSA 1V5XA 3E0IA 4CQAA 1SQ7A 4Y9AA 5K9XA 5FF3A 4OT7A 4O52A 1F2JA 3P60A 1XXXA 1JCNA 4JDYA 4QISA 4UTHA 1KV5A 3LXAA 4JDBA 3S5OA 3L0KA 1SO3A 4NUWA 5T26A 4GXMA 1K7EA 2V9DA 1OFPA 1OX4A 2FIQA 4FEZA 1I4NA 4DO4A 2DU2A 3TXZA 2WQPA 4MZ1A 2FQIA 3G8RA 2NWRA 3HIJA 4CCEA 4HIBA 1K3UA 3DAQA 3N73A 4QJ1A 5MHBA 3DFSA 4ZZ9A 3MHFA 2ZRWA 1BWLA 4M5PA 3HBLA 5F1VA 1H61A 4N02A 3O1NA 3EX1A 2PRMA 3N14A 1KM5A 4U28A 4UTLA 3MHGA 1AW5A 4O1DA 3WJXA 3NR0A 3N19B 2H3DA 1GJPA 5KITA 2CLLA 3G0UA 1X6UA 1IXNA 1YPFA 1ICPA 3BPWA 4NNCA 2A21A 3NQEA 1C8VA 2RDTA 1G6CA 3FEMA 3NQ8A 1LBLA 4XUGA 4LRSA 1UB3A 3C2OA 2FJKA 4DQWA 5DCEA 3W3OA 1X1OA 2ISVA 3NEVA 5G2WA 3W85A 3IGXA 4UTUA 3PG8A 4JTGA 1YXCA 3F4WA 3JS3A 3TCEA 2YGYA 4K7VA 1W54A 1W5PA 4UXDA 2TYSA 1JUKA 1T96A 1LZOA 1R46A 3OVRA 1UCWA 3S5NA 1MEIA 2CLMA 4JNMA 4X3ZA 2O7SA 5LGXA 1KFKA 2ZRXA 1DQWA 3QW4B 3NXFA 2UV8G 1F6KA 1K8XA 3NQ6A 3GR7A 4LVAA 4LUJA 2J6XA 4O53A 1TPUA 3DENA 4O4VA 4LVDA 1Y0EA 2P10A 1KBIA 5F2IA 3QH2A 5DY3A 1AL8A 2Y61A 3S1VA 3LHVA 1N8FA 4LS2A 3SW6A 3QPZA 5K7JA 4CNPA 4I7WA 5G2HA 4K39A 4Y8FA 3UWQA 2GQAA 3MUXA 2ZZ4A 4BK9A 2BTMA 1EP3A 1UUOA 1IXPA 3W73A 4JTHA 2CLOA 4JTEA 4JXCA 3TE9A 1QPQA 2QKFA 4A2RA 5A8GA 1X7FA 2TMDA 3TSMA 4O17A 1F73A 4JICA 1I2OA 1FWSA 3STEA 3DGRA 4WJEA 2X30A 3B05A 3G0SA 4CQ9A 1S5TA 1L6WA 5D2XA 3TUUA 5CG7A 1TTQA 1KFBA 2ABBA 4QIUA 3C8FA 2CLHA 4OV9A 1FCUA 1I45A 4Z0SA 4MKNA 3UQNA 2DZVA 3NNTA 1VCGA 2E5BA 4MJMA 4IMCA 3TQVA 1DVJA 3GAYA 3G8EA 1TYGA 2EKCA 2ZRVA 4ML9A 2VEKA 1OFAA 2NXIA 1YDOA 3L21A 1JUEA 3L9CA 3GK0A 3O6DA 4YCPA 5DY2A 1C9DA 2R94A 5D04C 4Q33A 2QR6A 2EAWA 4FNTA 1ZFJA 4FIQA 4NJIA 5H91A 2A7PA 3P74A 3FOKA 2NX9A 1SZGA 1TB3A 4FB7A 3SIZA 3E96A 5LHEA 4AWSA 3NG3A 1QPOA 3MI2A 5D05A 1XUUA 3W1TA 1W56A 2C0AA 3PUOA 4OE7A 3BW3A 4UMCA 4EVZA 1VYRA 3HGOA 1OABA 1YTEA 3VCRA 4M6PA 2DZPA 3O8AA 3P5ZA 4KFNA 5D32A 4AHPA 4UFHA 5AHNA 2QJHA 3TNOA 5ABTA 4Z1DA 4N6FA 1RQEA 3LXCA 1NEYA 4NXKA 3QQ1A 3NM1A 1LLWA 4GUFA 5EYWA 3NAVA 4C1LA 3LBCA 1LOSA 1QCWA 4XKYA 5HR7A 3BW2A 3WJYA 1OJXA 2GJLA 1M5WA 3MYPA 2NZLA 3BGGA 1E51A 4GUHA 1U5JA 3FKKA 4P2VA 1BTMA 4UTWA 4XTDA 3S1UA 1O4UA 4IMGA 1TJRA 3W1RA 3O16A 3LDVA 1OK6A 3A23A 5CZ0A 3FFSA 4E38A 2QDGA 4JR5A 3WJZA 5KSWA 3G1AA 4DO6A 4N4QA 2QCLA 4XZ9A 3Q94A 4TR9A 4WD0A 4MZYA 2E5DA 4IWWA 4NT0A 1W5QA 2WSRA 3PSVA 4X2RA 2DZTA 1VLWA 3NQFA 2YW4A 3G18A 3PAJA 3B8DA 1PCWA 3HQ1A 4WY0B 4GUGA 2CLIA 2V5BA 1X8FA 1M7OA 3C3NA 3G1VA 3F03K 5HINA 2VFGA 3KVJA 1QMLA 4LV9A 5EKYA 3C4UA 2ZRUA 1GVOA 4IXXA 1LRTA 3W2KA 3FJLA 3ZS4A 3W7IA 2A7NA 1L2UA 4FHAA 1BEUA 2C16A 4EOUA 3M41A 2VFEA 2ZFAA 4O8RA 4RXFA 3GLCA 1XI3A 3USBA 2V2HA 2HMCA 3DFPA 4K36A 3V1PA 4UTIA 1H1YA 1OHLA 4GFSA 1I2RA 2BWGA 4GBUA 1AMKA 1LLZA 5G2IA 5DBUA 2E1DA 3GX9A 3PY2A 4FX6M 2ZBTA 5AHLA 4N9CA 5K2ZA 2PRLA 4K8HA 1W3NA 5E1QA 3W7EA 3EWYA 1A5AA 3KX6A 2QCNA 3L2IA 3R12A 4L4LA 2V8ZA 1FUYA 2A2IA 1AL7A 3ABRA 2YFOA 4PEKA 5HUOA 4LS0A 3CU2A 2JGYA 4FNRA 1LM1A 3GDRA 4DBEA 2CLEA 3B03A 4RLIA 4DF0A 1ME9A 1YPIA 4IXHA 2JKPA 3I7QA 1LBMA 2ZZ1A 3DFTA 3HGRA 2OZ0A 2TRSA 3N9RA 3LTYA 3W84A 4MIMA 1W1ZA 1EUNA 4O16A 3QEZA 1G7VA 5D33A 4MY8A 4M6VA 3IIPA 4EIVA 3V75A 3LTPA 4TIMA 3FYPA 3K30A 3UPWA 1DORA 4S2CA 2R8WA 3G1YA 2CU0A 3IRDA 1H62A 1WV2A 1SW3A 3ZWSA 2GVGA 1KM4A 2PURA 3GNDA 4JEQA 1UJPA 3W1AA 3P62A 4FF7A 4X9SA 5CZSA 1VHCA 4R34A 2B4GA 2LLEA 2QEZA 3R2GA 1L6SA 3SJ3A 4K37A 4MFEA 1KM2A 5C6MA 2A0NA 3UZJA 1XL9A 3N2MA 2ZA2A 3LLFA 1Z44A 3N2XA 3W07A 1SU5A 1S5WA 2DJXA 2XFWA 3P61A 2FTPA 1W5MA 1GEQA 3ELFA 1JRBA 3HF3A 1GT8A 3W22A 1DHPA 2WV8A 2VXNA 3CEPA 3SI9A 2YSWA 3W87A 3OEXA 1TPC1 4DPPA 4UTJA 1EIXA 2V82A 1QDSA 1YXDA 3E12A 1EWEA 4CLMA 3A21A 3QM3A 2RH9A 3EX4A 4BWLA 4N4PA 2ZZ6A 2H8XA 5U7SA 1OFQA 2H6RA 3QF0A 2YCEA 2NV2A 3GIYA 3SZ8A 1WA3A 2WNNA 1GVFA 1J5TA 5DELA 4E2DA 4AWUA 2GOUA 4MZ8A 2QCDB 3MHUA 4JD4A 4LU0A 4YXGA 2ZRYA 3G1DA 1JCXA 3P8JA 4NVTA 4LC8A 3STGA 4FXSA 5E0KA 3PUDA 4X22A 2R14A 5I3GA 3HPZA 7TIMA 3MP3A 2C13A 4NX0A 3M9YA 1QAPA 1THFD 3GDMA 1H7PA 1TTJA 4UR7A 5BMXA 1EWDA 1TPVA 1GZGA 4ICNA 4JTFA 1F7BA 3NQ7A 1G4PA 3G1SA 4RK8A 1I8JA 2GQ9A 2XN0A 3HPXA 2QCGA 1YTDA 3UNDA 2ZZ5A 3DZ1A 1GTHA 3G1HA 2JKEA 3HO8A 1MSSA 3HOJA 2FFCA 1UASA 3R89A 8TIMA 1JCMP 2ZA1A 3PBUA 1K7FA 4EF9A 4AB4A 5CPLA 4JIPA 2E09A 4BF9A 3LERA 3I65A 3PVFA 2J27A 2Y70A 1IGSA 4BI7A 3EWUA 2Q3RA 3UWYA 4HPJA 3INPA 1SSGA 1PVNA 5DXYA 2B7NA 4FIRA 4XWUA 1W37A 3G0XA 1K02A 1SO6A 2W6RA 4WY0F 3LOTA 5FF0A 5CKSA 1GTEA 5FF2A 1JQVA 1JCJA 4IMFA 1ALDA 2I1OA 1EA0A 3TW6A 3LXBA 1TO3A 1ICQA 5AYZA 1PS9A 5LNUA 1RQBA 1QPNA 3H54A 3LBMA 2YX0A 5EY5A 3W1PA 1P1XA 1RD5A 2V30A 3FKRA 5KZEA 3DHDA 3KHJA 1FXPA 2YYTA 2FDSA 4MJZA 4MY1A 1PV8A 3C2RA 1JVNA 3MW7A 1VYPX 1WQ5A 3DI0A 4FXRA 4BWLC 3KRSA 3HGJA 1WBHA 4POCA 4PCFA 4HT3A 4NXSA 3PS7A 5SWUA 2B7PA 1NSJA 2CZDA 4ADUA 1YLVA 3LRMA 1FCQA 5IBXA 4JTUA 4K38A 4S2BA 2ALDA 2FPYA 1T8XA 3B4UA 4O13A 3WK3A 4UTTA 3L67A 1LDCA 3MWAA 3T4CA 1LROA 3M5YA 1KTBA 2ISWA 3NPXA 1AK5A 1FDZA 2H3BA 4TMCA 3DBPA 4EF8A 2JBMA 1VR6A 5AFDA 1OFRA 4LVBA 3M5XA 3FJ6A 3WK2A 2YPIA 1H5YA 3HG5A 4YCOA 1MXSA 1JR1A 3ABOA 1S5VA 4UFKA 2FPVA 1XM3A 3UPBA 2X16A 4LW7A 1QFEA 3DFQA 1O5XA 2DZWA 3DH7A 3E02A 4O0KA 1FQ0A 5AB3A 3G3MA 3TC6A 1FWTA 1A50A 3GXNA 4MYAA 4QSHA 5BW6A 2NWSA 4LV4A 4I7UA 4RX0A 3C6CA 1TQXA 2OT0A 4QM1A 1GVQA 4IUOA 4HPXA 1RR2A 2E6AA 1KFLA 1KM3A 1HFBA 3KVMA 4P61A 1R47A 1CW2A 1TV7A 1Z48A 2NUXA 4JX5A 4FNQA 3SR7A 4GNJA 4A22A 1W0MA 3W1LA 1RVGA 3W72A 3N34A 1QWGA 3I7SA 3O05A 1R2SA 5I3HA 1DQXA 3LCFA 1TSIA 2Y62A 5D2WA 2NXHA 3A22A 2ZZ3A 1JQXA 1VYSX 3SECA 1TMHA 3W88A 2P0OA 3EWBX 3E9AA 1F74A 2D73A 3SSJA 3S0CA 3S8HA 2A5HA 4HHPA 2B7OA 3CWOX 1OF6A 3BG9A 3CHVA 2X1TA 3O06A 3C61A 2QUVA 2O7QA 2X1RA 1TPB1 3P7YA 2W79A 4W9TA 1LTDA 2VFIA 1OG0A 2ATSA 3MMTA 1P5BA 3HMJG 5HR6A 1PE1A 3PC0A 3F1QA 2BZNA 3FA5A 3UY7A 3BG5A 5BNKA 2DJLA 3GDLA 3S6DA 1TREA 2F84A 1Q6QA 4JTKA 1WBJA 1MO0A 1XKYA 2AQWA 3MBDA 5A5WA 4IMEA 5I3KA 5K9DA 2QUUA 3WFAA 5HWNA 2ZTKA 3TMQA 3EKLA 5D2VA 3W1UA 4FX7A 1FX6A 1B4EA 3L68A 3TAKA 4UFIA 3PUEA 4JYFA 4WXYA 2E77A 4JY8A 5F2GA 3IVTA 3W74A 3NM3A 1H50A 2WO5A 3IVSA 2FPTA 4FNUA 4TO8A 4BI5A 4JYEA 4MLJA 2WSYA 5H2ZA 3CLMA 4MUZA 2CLFA 3LCGA 2WNQA 2BX7A 4FX8A 1PHWA 5D2YA 3U2OA 2XN1A 2Y7GA 4PA8A 1PIIA 2J88A 5FEZA 2V5LA 3U8GA 1R2TA 3RFAA 4Q32A 5DCBA 5DXXA 2EGZA 4OGZA 3DFNA 2Z6IA 3DKLA 3C2EA 3LX9A 3UWZA 4DBDA 3S9YA 4WY0A 2CW6A 3QJAA 5IBXC 1V7YA 2E6FA 2J24A 4ADSA 4NZJA 3O63A 3CT7A 4NJKA 5CPOA 4WX2A 1YTKA 4QNWA 1IXOA 4I9AA 5AOUA 3MP5A 2QJGA 1IIHA 5LNWA 4JY9A 2BXVA 1EUAA 3LGEA 1D3GA 2QUTA 5AHMA 4IPIA 2BLEA 3NDOA 4AF0A 5D02A 5K3VA 2ZZ2A 4RZ4A 2Y7EA 4LWWA 1O60A 4DELA 1PL9A 3P67A 2Z6JA 4KWVA 4N9BA 5BMWA 1VH7A 4GC4A 5C54A 2KZHA 1SPQA 3LRKA 2CWNA 3QFEA 5LKYA 3P5YA 3I68A 3PF3A 4ORMA 4RJEA 4CNOA 4AHOA 3VFLA 4AHQA 4O18A 1OFOA 3RMJA 5C5YA 1AW1A 3MBFA 4IOTA 3W7PA 5BOOA 1F76A 5EPDA 1ZJIA 5HQEA 5AHFA 3NA8A 4MLRA 2X1SA 2GQ8A 2ZDRA 2WOQA 3NVTA 3HGSA 3M5ZA 3ABQA 4O10A 3IGSA 3CM4A 4E0CA 1KTCA 5AYXA 1O94A 1R30A 1NF0A 1YDNA 4MYXA 1G4EA 4UFLA 2I9EA 3OVPA 4M7TA 1TQJA 4IX2A 1SW7A 3EWZA 4ZL1A 2V0TA 3QW3A 3WJWA 5CSRA 1HL2A 1FY6A 4O57A 1MEHA 2OJPA 5KZMA 5D2TA 2HS6A 1EP2A 2QJIA 3KAOA 2RFGA 4LS1A 3L5LA 4QITA 2TSYA 4UFJA 1XC4A 1DJNA 2FB3A 4H3DA 1J4EA 4O1CA 1KLYA 3THAA 4R7JA 2E6DA 2W0UA 2WNZA 3OG3A 3C0JA 3PR2A 4GE8A 3HG4A 3H53A 2B7QA 4TMBA 1FWRA 1OYBA 4IPJA 3LM7A 3DKJA 2WSQA 5CPMA 3FYOA 3RLVA 1B57A 3M5VA 5G1TA 1SSDA 1KFCA 3A5VA 1HO4A 3P81A 2C6QA 2OT1A 3W7CA 3W7MA 1KM6A 4O0ZA 2BSLA 3RLUA 4HSNA 4RZ5A 4UR8A 4O15A 1FBAA 3FIGA 1TPWA 3PB2A 2A7RA 4IGHA 3RF9A 3OBKA 4NNAA 3Q37A 1VGAA 4YMZA 1XCFA 4RKAA 3IIOA 3P84A 1HUVA 3G22A 2R91A 4OHQA 2DP3A 4Z1BA 4PFMA 1JUBA 5AC6A 1H7XA 4D2JA 1ML1A 4K8EA 1WDWA 4HNVA 1DOSA 4NJGA 1H63A 3CPRA 5I3JA 1GOXA 1KFJA 1LRNA 1VHNA 3G1XA 5EL1A 3NPWA 3GB6A 3UWVA 3PBYA 3O07A 1P0NA 5KZDA 2GUUA 4NNBA 2ISSA 4TX9A 3HJZA 3LI0A 5G5IA 1XDMA 3NQGA 4AVFA 3CWNA 1B9BA 4AF0B 2QF7A 1X1ZA 4O11A 2C1HA 4UTTC 2ZRZA 3LCXA 4DF1A 1PHQA 4ZQMA 3S5YA 1TPH1 2OX1A 4LC6A 1H51A 4Z1CA 5LGZA 4QNEA 4GJ1A 5LNVA 4NU7A 2A6LA 3STCA
chains in the Genus database with same CATH superfamily
2V2CA 2B31A 3P0WA 3T42A 3ZVHA 4V15A 1LCOA 3VC6A 3W53A 4HNNA 1XICA 3EKZA 1ZBVA 3IIXA 4P8UA 4MPQA 3OO2A 3VFCA 1YQ2A 1VZWA 2YA1A 4DAIA 4YJ5A 3CL7A 2QUMA 3WQDA 4ONVA 4AISA 2RGLA 4H1ZA 3LS9A 1QPRA 1XLDA 2XZ7A 4PL2A 3FS2A 6TIMA 3DN5A 2P8BA 2V81A 3ITCA 3I4KA 4OUIA 2VELA 2B0MA 2EG7A 4M19A 4XD4A 1B4KA 5LIUX 3LK6A 5CPSA 1EHNA 4O14A 3DESA 3UWUA 5A6JA 3UR5A 3BAYA 2INZA 2OEKA 3BLEA 4QS6A 4Z08A 5F7UA 4URIA 2Y5EA 1A49A 4L6DA 3CUZA 2EEXA 3MVTA 1UZDA 3UESA 3VMOA 1RP8A 1DXIA 1XBXA 4N7QA 1UKPA 4K6AA 2RJGA 3UERA 2WMIA 4H2CA 4N2YA 5IOBA 4K1GA 4N9EA 1P6WA 3TTOA 4JKLA 1KV8A 3GXFA 4KEMA 2VRKA 3UW6A 3PNUA 4UQAA 4B5XA 3VOIA 1ISZA 4BJHA 3QMRA 3EKGA 3B06A 3QQWA 2P1FA 4F0KA 1E6XM 2XH0A 3LRLA 4FPSA 5LIKX 3AHXA 3MO7A 1DIOA 1T7LA 4J2MA 2G37A 3W38A 3DI1A 4ZA0A 3HG3A 3M07A 1VBRA 4O28A 3CMFA 1KFEA 3DDMA 3LGDA 1YE4A 4LVGA 2PCEA 3O7UA 1FFRA 2P8CA 5AYYA 1JYVA 3EWXA 2CITA 3SUVA 2Y24A 5I3FA 3OLDA 4L9ZA 4Y9PA 4K8GA 2I16A 2QZRA 2VR2A 4ZQCA 4BY3A 2EO7A 2A1YA 4DPQA 1Z8AA 3S2JA 3LNPA 4H7VA 1W3TA 4WOZA 3NCOA 4Z2JA 1E9ZB 4J4KA 5HMSA 1HN1A 3IV3A 3LV6A 1ZL1A 1Q6RA 2GJNA 1E1CA 5CZJA 1GQJA 1MW3A 1NELA 4EXQA 5LXEA 1JULA 5KTLA 1VS1A 1F05A 1ZLPA 1GHSA 4DN1A 2YFNA 4W93A 1HQTA 3EOLA 4A2SA 3RPTA 2ACQA 2J8FA 4FLRA 4KFOA 1AH0A 5ECUA 1XLBA 1V03A 5CC7A 1D9EA 3TYZA 3TYCA 2HS8A 3GG0A 1L6YA 2E28A 3EWCA 3OQ8A 4PYSA 1K9DA 2HE8A 1E3ZA 3KOYA 3B0VC 4FLSA 3EX2A 2H8ZA 3GRIA 1KQYA 3T2QA 2Y7FA 5D09A 2VM8A 3VNDA 4GG9A 3GH5A 1RCXB 4LB4A 3FDGA 3PWIA 1PXGA 5D37A 4DYEA 5EA9A 2BFGA 4OU1A 1MYRA 1LG2A 2QV4A 3POHA 4JFUA 3S83A 3U7BA 1KD0A 4QS5A 3TFXA 5I09A 4J9JA 3QOKA 4C6CA 1K4HA 1G4SA 1H60A 1P0DA 1OFEA 1QNPA 2P53A 3R1ZA 4JIHA 1B0IA 3DXIA 3EX6A 2FYMA 5HMDA 3C0SA 1ZALA 3M16A 4NI8A 3A64A 4TVUA 3BK0A 1DJQA 1BRLB 3W29A 1E40A 3OOQA 1TV8A 3L65A 4AIBA 2PDXA 3R11A 2FVLA 4NL1A 2HBVA 2ZE3A 1J01A 1JJKA 5JMUA 3T6CA 4YIWA 3TXVA 4EAMA 3ME3A 4LRTA 4HPHA 1BYBA 1HVQA 4B5NA 1ZS2A 1UA7A 4EK7A 1NARA 1QW9A 3PWAA 4PMZA 3O15A 4GQGA 4I6VA 3K46A 1VQTA 1WPCA 1VRDA 3VD5A 1QTWA 3L4VA 4JTLA 1EPXA 1JDFA 5HAOA 1OGBA 3BLIA 3EX3A 4MKSA 4HYVA 3C3UA 4AYGA 1M41A 4I9MA 4OZOA 3C56A 3NEHA 1PZ0A 4JQ2A 1MEWA 4DO5A 4QAIA 2PD9A 3BARA 4OWGA 3UWWA 5C2XA 2CZFA 1RD6A 1R3SA 3H55A 1KXVA 2C0HA 3MKVA 4C1KA 2NXGA 3KS6A 3RU8X 1H3GA 3PTQA 1OX6A 3M0ZA 5C71A 3FDKA 3EB2A 4NZFA 4UTKA 2F7FA 5KEZA 1GVSA 1JXJA 1EP1A 4RV8A 1TTIA 3APGA 3GTFA 5CSSA 3TR2A 2YA2A 1SFLA 3ECQA 3N04A 3QZ6A 4JFSA 5H8UA 3N17A 1TRIA 1UWUA 3FW6A 2BGNE 2FHCA 1EB3A 3L5MA 3N2CA 4AX6A 5ABFA 5AC7A 3ZYZA 4ZR8A 4Q8PA 1WXJA 3V5CA 3DCPA 2GVEA 3ZFHA 3QTGA 3H26A 3UU0A 3GNOA 2HWGA 3B9DA 2ZQ0A 2NQZA 1EEPA 1CLKA 4FI4A 1GJWA 3UVIA 1S2UA 5HATA 1VRXA 3IJ9A 3EWWA 4UTMA 1UP2A 3LLXA 4Y90A 4A3UA 3VUSA 2YOCA 4TU1A 3MMDA 2ZC8A 2A3LA 1D2KA 1TR9A 1YIXA 1HJUA 5FEWA 1TWSA 2CFFA 1E0TA 4XO7A 5HJLA 1G1YA 1W3IA 4M51A 4A29A 1BFNA 4NY2A 3VOGA 3AU2A 3KBNA 4D6FA 4DLMA 5JBDA 1TZ9A 2ZYFA 3CUFA 4R3UA 2GGEA 1SZNA 2GGHA 4CCDA 1HO1A 3H21A 4D6DA 3GG1A 1WX0A 1RA5A 3FHQA 3WIJA 1GNXA 1RY0A 1FWWA 4Q4KA 2BB0A 3U2EA 2A85A 4LCQA 4CEUC 1X6NA 2VFDA 1VJSA 2WVSA 4US5A 3QHMA 2QAFA 3KFTA 3HB9A 4BS0A 3C52A 1XLJA 4HSOA 2VZOA 3T2PA 1C29A 2DSWA 3HA1A 4FNPA 4HNOA 2Z2UA 1ZAJA 2AOSA 4UMBA 2NSOA 3BV7A 4M29A 3W7LA 4OQVA 2V6AA 2WWDA 1DKWA 2O9RA 2YL9A 1UUQA 1AZ2A 4BQ3A 1XDJA 3WH8A 5IHSA 3TFCA 3NO5A 3A4XA 2QMJA 5BXRA 4AD2A 3I4EA 4UBPC 3C2FA 4M8UA 2J7FA 5C7HA 1V6WA 2PF8A 1YEYA 1V6YA 3T0TA 4IX0A 1PYMA 4HA4A 1EZWA 1S39A 1WOAA 1HW6A 1ZHAA 3IPWA 3W27A 1XX1A 2VI0A 1EIBA 2CLKA 5H8MA 4GX8A 3R6IA 3TVAA 3OLGA 1X1NA 3E49A 1ONRA 1SW0A 5EU9A 1OCNA 3N3MA 1LRQA 1FTXA 1WZAA 2IQTA 4H6QA 2OYMA 4XKMA 3L7RA 2ZX8A 5LIXX 3VTRA 2AL1A 5IM51 1BG9A 3POCA 4Q8WA 3H2MA 1SZFA 2QDHA 2ZIDA 3NL2A 4KBXA 4WHBA 1JFHA 1UZ1A 4M7SA 1DBTA 1FCBA 3VGBA 3S1XA 3A4WA 2OGYA 2EF9A 4L4MA 1Q2RA 1FDJA 4FAMA 1FCVA 4JX4A 4GUJA 4A8IA 2ATMA 4CQBA 3LV5A 2XSXA 2Z28A 3WD0A 5CAHA 2QV5A 4P5UA 3L0GA 4UR9A 2X0SA 4Y6GA 3ITGA 3EYPA 4JS3A 3P80A 2VO5A 4JHMA 5TBOA 4IIHA 3SGZA 3V36A 2VZSA 4TX8A 2YXOA 2JIEA 2HPMA 2HXTA 2PP3A 2Y6ZA 1OD8A 3BL3A 4AAJA 1JL8A 4PTNA 1WCGA 2Z1BA 3OBAA 4CQ8A 1R9ZA 4MWAA 2EJ1A 1BF2A 4GYPA 3FHAA 2NLIA 3P0XA 3AO0A 4CVUA 4D6CA 1LJYA 3TJXA 2CXGA 1G67A 3GNXA 4NJHA 3AJ7A 1EX5A 3NFUA 2GGIA 4W4QA 2BS9A 4EANA 3GVWA 3W2MA 3W02A 3TQKA 4NAEB 2AGTA 3TTSA 3NOEA 1MXDA 4QX4A 1WDQA 1IT7A 3QC0A 1OC6A 1TUXA 1LP6A 4C6IA 5DLCA 3W23A 5PTDA 3T78A 4UUIA 3KHDA 1FKWA 5HMEA 1SYTA 1GQNA 5E93A 3RXZA 1GKPA 3BLLA 1YNYA 2WM0A 3WMLA 1GVRA 4GXPA 1XJBA 1O1ZA 3P6LA 4HSHA 3VAVA 4GQQA 1SQ7A 4Y9AA 4OT7A 3P60A 3PPCA 4R85A 4JDYA 1SO3A 2EJAA 4C7DA 3WQFA 3VIHA 1SJCA 3AUOA 3TZNA 3OBEA 4RDWA 1OQFA 2CBUA 3KL5A 1SFTA 4GH1A 3SCQA 3BJSA 3N73A 4HBKA 3DFSA 3MHFA 1BWLA 3DECA 1H61A 3BUVA 4U28A 3HMCA 1AW5A 4XZWA 4F79A 5CJNA 3NR0A 3KWSA 2CNCA 3D5HA 3NZGA 2CLLA 4ZOBA 4A3YA 4OTKA 2W67A 4AFYA 2FZDA 1ICPA 1YKWA 4DM1A 4WKHA 3BPWA 3NQEA 2PDPA 2WCAA 3PTMA 1C8VA 2RDTA 1EO5A 5CSUA 4W85A 2FJKA 2QUNA 5DCEA 2FTWA 2ISVA 3GHTA 3W85A 3VKAA 4UTUA 3ARXA 4QG6A 3JS3A 4Q4SA 4S3BA 2EQDA 4K7VA 3OA5A 1JCTA 4UXDA 1I6NA 1JUKA 3G5EA 4TVDA 1T96A 1LZOA 1UCWA 5A6AA 3A3WA 2CLMA 1DTNA 1XIIA 2ZRXA 1GPFA 3N18A 3QW4B 3NXFA 1M3UA 1ZJBA 3E74A 1E9LA 1Q6CA 1XLLA 4YYCA 2L5HA 3UT0A 3GR7A 4I9TA 2IQDA 8XIMA 1Q7ZA 1GCYA 3EZ4A 1KBIA 2J78A 3RITA 1AL8A 1DP0A 2Y61A 3S1VA 1CYGA 2REQB 1XYLA 5K7JA 5I07A 4I7WA 1K6WA 2WQDA 3IGHX 3UWQA 1E73M 1IXPA 4PTWA 1ZB5A 4JTEA 1J6PA 4S3CA 3T05A 2PDBA 3TSMA 4O17A 2BXZA 3H12A 1RJQA 4PB5A 1UH3A 1FWSA 1QNRA 5EMJA 4CQ9A 1S5TA 5D2XA 4RPQA 4WSHA 2I5IA 5CG7A 1UKQA 3LU2A 1KFBA 2CLHA 1U30A 4OV9A 3B40A 4Z0SA 1I45A 2CXEA 4LAKA 4MKNA 3IJ8A 3UQNA 1J2BA 2B81A 3ZJ6A 1AJ2A 2XZ9A 4IMCA 1GOKA 1OY0A 4AZBA 2OU4A 4DZHA 1YDOA 2DIEA 1NFPA 3L9CA 4FOUA 3GK0A 4YCPA 3HM7A 3ZQ9A 3AZSA 3CK5A 3G2GA 3WL1A 4FNTA 2D2OA 1OEPA 1UW9A 5H91A 1KGXA 3FOKA 3PPGA 3LQLA 3CTTA 2VDGA 5LHEA 3MSYA 2BHUA 3EDJA 4JHZA 5CBBA 1W56A 1DWJM 3BW3A 3KP0A 4AX7A 4UMCA 2Y8VA 3VCRA 1A3XA 4A05A 4PMXA 2PGFA 5M3WA 3TYUA 3KM8A 1GKQA 5GNYA 2PDIA 2V38A 3LXCA 2F38A 4NXKA 3QQ1A 3NM1A 4JZ5A 4UOZA 1LLWA 5EYWA 3UWEA 3AXHA 4C1LA 1TJ1A 4JIIX 2QJNA 2BVDA 1F6YA 3WQGA 3WJYA 2GJLA 1J0HA 3GG7A 4GNVA 2E8ZA 3BGGA 5M17A 4HMEA 3OYZA 1GQLA 3DOPA 5TNVA 4XTDA 3EOOA 3MZ2A 1E71M 1OK6A 3A23A 5CZ0A 3FFSA 2OR2A 2QDGA 5B7YA 1LL7A 3G1AA 2F2KA 4DO6A 1WDSA 3PTDA 2XHYA 2RAGA 3WBAA 4XZ9A 3LNMA 3Q94A 4TR9A 2OWCA 3TZFA 2J4GA 4IWWA 4NT0A 3PSVA 2DZTA 1Q4NX 4BEQA 3FXYA 1UMYA 5DQPA 3B8DA 1YX1A 2D2HA 1PCWA 2VGGA 2BHYA 2ONEA 4KCTA 5FJTA 1NOFA 1ELSA 1XWYA 4GUGA 2WMIB 1BVWA 3C3NA 4XAZA 1QMLA 4Q6JA 3C4UA 3GTHA 2R1NA 4IXXA 3WEMA 1LRTA 4C6NA 1BAGA 1MUMA 1BEUA 1W9PA 5A6BA 4EOUA 2PDCA 2ZFAA 3GLCA 1KXTA 4H7ZA 3USBA 1WKFA 3DFPA 3V1PA 2GSJA 1I2RA 4N9CA 5K2ZA 5JBEA 4ZOEA 4I90A 4O1FA 1E1CB 3KE0A 4NP7A 4OBRA 1W3NA 4KGLA 1YHTA 5E1QA 1QWKA 3RX4A 4NZCA 5C8BB 2QCNA 4L4LA 5IFPA 4MDOA 2V8ZA 1FUYA 4PEKA 5HUOA 1E3XA 4K68A 3RLHA 3GU9A 1DJZA 1LM1A 3ZVHB 2CLEA 3RM8A 5C9ZA 5FA5A 4L1XA 4RNHA 3VZYA 3EMZA 3ZR5A 5D8WA 2ZUNA 3DFTA 2HJPA 3N9RA 1JIBA 3W84A 4MTVA 3BMWA 4C6LA 4O16A 1WXZA 1G7VA 3BAKA 5D33A 1PWMA 3DG6A 1P0EA 4JFVA 1QXLA 4TIMA 3FYPA 2IPFA 5GJNA 3UPWA 3WLNA 4WSKA 2WMJA 3FGCA 1BSLA 1WKYA 3T1GA 1A5LC 1KM4A 2PURA 3GNDA 1PBGA 3EMCA 2F61A 4IGSA 3WQ5A 3U3HA 1VHCA 2R82A 4KGJA 4MNJA 3R2GA 5AC5A 1L6SA 4H8UA 3LZ5A 2HVOA 4K37A 5C6MA 1KFWA 3ID7A 4DVOA 1XL9A 3N2XA 3W07A 1HJSA 2XFWA 2QHAA 2Y8KA 5EGRA 4W86A 3KCOA 3S2LA 2A79A 4UB9A 3S6TA 2WMGA 4GO8A 4DZAA 3T8LA 1JFXA 3RN6A 2IQ0A 1QDSA 2ZVIA 3WLHA 4DYKA 4OKDA 1W1YA 1TA3B 1UA3A 3QM3A 2RH9A 2XFYA 4BWLA 2H6RA 2XH2A 3SZ8A 2WNNA 1GVFA 2HNEA 2PTZA 6ENLA 4IGMA 2ISDA 3MHUA 4LU0A 4IIGA 2Z26A 3KTCA 4DXKA 5CJ5A 1BPLB 1TKKA 4JTDA 7TIMA 1THFD 1H7PA 2OLAA 2NLYA 1EWDA 1TPVA 5D9MA 4JTFA 1G4PA 3KUMA 4IQEA 2F6XA 4HMNA 1FWDC 1H49A 3CZJA 2GQ9A 1HL9A 3HPXA 2QCGA 2DVTA 2PLCA 1KXHA 4W5ZA 3G1HA 3URNA 2YCLB 3BJTA 4YHGA 2JKEA 1GQIA 1MSSA 2WZMA 1BWVA 1HJVA 8TIMA 1JCMP 2ZA1A 4W8LA 4D1IA 4EF9A 4AB4A 1S1PA 3M0JA 4MNLA 1VFHA 4JIPA 1AVAA 3PVFA 4DY1A 1ZBKA 1FWIC 4BI7A 1PWLA 2Q3RA 1SSGA 2OWXA 3CZ8A 2B7NA 4INFA 4B5SA 1TX2A 4NZ5A 2PDLA 1H0IA 2QS8A 3L4WA 4NAFA 3LOTA 3V0UA 3GH7A 5CKSA 1PUDA 3SRFA 5FF2A 2I1OA 3JZEA 3AMGA 2WVTA 3UG8A 1TO3A 3TW6A 4E2VA 1PTGA 4OVXA 2X42A 1QPNA 3W1PA 1BXNA 1P1XA 2XTKA 4Y9MA 2WSKA 2YYTA 2FDSA 2DVXA 1WQ5A 4IL0A 1VP5A 4HOZA 1JD7A 3IAPA 4POCA 4NXSA 1UD8A 4YN5A 3W25A 3AIRA 2J66A 4ADUA 5IBXA 2GUYA 2OELA 1XFCA 4R9OA 1DIDA 3B4UA 4UTTA 3MWAA 4PUEA 1BXCA 1KTBA 1FDZA 3AYTA 4TMCA 3B0XA 3OZYA 2W91A 3RO6A 3WK2A 1DIKA 2YPIA 3A47A 1KCZA 1JYXA 1JR1A 3UCDA 2EG6A 1S5VA 4AZHA 4LBRA 4ECLA 2DZWA 1PAMA 3MU7A 3UPMA 3LPPA 3TC6A 1UZ4A 4DJEA 5BW6A 4I7UA 4Q4OA 4GPNA 1TQXA 5CJMA 3R4IA 4HPXA 3TOYA 3KBMA 3V4BA 1RR2A 3ITOA 1ECQA 1OT2A 3KP1A 4MF4A 4DBUA 4B4FA 3IJ6A 1Z48A 1NP0A 4GNJA 1H09A 1W0MA 1JNDA 1R38A 1UC4A 4LYQA 1RVGA 4QR6A 1QWGA 3HV9A 3O05A 3RMEA 3URAA 3NOYA 5I3HA 1XKJA 3R43A 1TSIA 4PCSA 4XUYA 1BGGA 1U33A 3BOXA 1F8MA 1S1RA 1VYSX 5E5CA 1W1TA 1YMYA 3S0CA 2XUCA 2PDGA 1BSIA 2A5HA 2B7OA 4J3TA 3CWOX 3BG9A 2VC9A 4G8TA 3O06A 3C61A 1EFZA 2XINA 3K1DA 1XV8A 1LLOA 3P7YA 2W79A 4W9TA 2IUZA 1MRAA 4LANA 1V3IA 1OG0A 2ATSA 2VFIA 2ZKMX 5HR6A 3IARA 3C8NA 3UY7A 5BNKA 2F84A 2PDUA 3GU2A 1A0DA 4HHLA 4IMEA 4GA8A 2OB3A 3GU1A 2HQAA 3WFAA 2XSBA 5T8GA 4DNMA 1FX6A 4JYFA 4YVPA 2AQVA 5C2CA 3KLLA 3W74A 1ZUAX 3IVSA 4TO8A 3OB8A 4AZGA 3MSRA 4JYEA 3T8QA 4NKCA 5EMYA 3UF9A 4CQDA 2BX7A 1PHWA 4G6CA 2XN1A 4QDWA 5FEZA 4JKMA 3U8GA 3WF1A 5B80A 1R2TA 2GWNA 3ZJKA 1NWUA 4Q32A 5DCBA 4AYSA 3DFNA 3QOMA 1O1HA 2DFAA 4DBDA 3W6MA 2QJJA 8CGTA 1NQ6A 1UBPC 2CW6A 1V7YA 5HNUA 5A94A 3CT7A 1YTKA 4DHGA 5AVNA 1EYEA 4DJEC 1EUAA 1D3GA 2VMFA 3ABZA 3UVAA 3NDOA 2Z1SA 4GI9A 4DELA 3P67A 3E2VA 1QHOA 4GC4A 3FEQA 3AMCA 2PDJA 4ORMA 4AHQA 4M81A 5C5YA 2X7VA 3GXDA 1AW1A 3V18A 1IV8A 4CN6A 5EPDA 4BKNA 2XIBA 2X1SA 2DQWA 1GOMA 2JQXA 1QI2A 1CXLA 4I5XA 3HGSA 2BXYA 1A5NC 3CM4A 4IHCA 1KTCA 5AZ1A 3GM8A 1N2VA 2I9EA 1XF0A 2GFTA 3EWZA 2V0TA 3I6TA 3QW3A 5BXPA 2Q8XA 2CKRA 1AUSL 4ERGA 4O57A 5KZMA 5D2TA 2HS6A 4QG8A 2QJIA 3KAOA 1M03A 1XC4A 1DJNA 3M0LA 4JTCA 3MC5A 3AMDA 2W0UA 4GE8A 2B7QA 3ZT6A 3NSMA 4IPJA 3DKJA 3FYOA 3AROA 7ODCA 1WAWA 2YCJA 5G1TA 2WK2A 4Z2KA 3OP2A 2DPEA 5A1AA 2C6QA 4L56A 4GQBA 1KO0A 1CCWB 1T40A 3T81A 1W9XA 4HSNA 1HKIA 4LSBA 4Q7BA 3QV6A 4LGXA 1KBKA 3BXWA 2A7RA 3RF9A 4JTAA 3OBKA 1VGAA 4QE4A 1W9VA 3IIOA 1ITCA 1D7KA 3G22A 3AI0A 2IKJA 2R1MA 2J7EA 2R91A 2DP3A 2OOFA 4DWSB 4S3EA 4Z1BA 1IR1A 3QKZA 4LUSA 5AC6A 1K9FA 5T91A 1PB0A 1EGMA 3O9NA 3F4VA 1GOXA 1CXEA 1KFJA 3JU2A 1VHNA 2G4FA 4L6OA 2AKZA 3K4AA 3MO4A 4CN4A 5C70A 4RZBA 1RCOB 3ONBA 4ZFCA 4O11A 4ENLA 3SRHA 4DF1A 3WQPA 3SUUA 2CZVA 3NVDA 4GY0A 4Z1CA 5LGZA 4TTGA 3AXKA 1O68A 1FHUA 2VQTA 3CZKA 3UYCA 4HJWA 1DE6A 2WSPA 3YPIA 1C8YA 2ZICA 3K1GA 3KOZA 1F6PA 2GDUA 2E3ZA 4WJ8A 1V3MA 3SRDA 2QJMA 3FX4A 7CGTA 1R2RA 1W1PA 2ZXBA 4JL2A 1XYAA 3IUHA 3TQ0A 2Y7DA 3I3EA 1M65A 4WOQA 2J77A 4DB7A 4YWIA 3QKEA 4BFAA 3VIJA 4W89A 4WIWA 3SCVA 2KAUC 3OHMB 3T44A 1NWRA 3BDKA 2VEIA 1HG3A 3WDRA 3PZGA 1FWCC 2HBXA 2R1KA 3VI2A 1ADOA 1RALA 1TJPA 1SO4A 3RK8A 4QROA 4LTSA 4X2PA 5A3HA 1QRQA 1A4MA 4HNUA 2WJDA 3S2MA 5FJJA 5F4XA 3EA2A 4HNCA 3CUHA 5CZKA 1KNWA 2SFPA 2BVTA 4BF7A 1TE6A 1L9WA 3WO8A 1YADA 4YHEA 2FFIA 1E4MM 5FF7A 1IXQA 4H9TA 3UD6A 3L4YA 5JH1A 3REQB 3BZGA 2C1GA 3W7GA 4EWJA 1OYAA 1POKA 3DHUA 1HKMA 2F2HA 3ZSSA 4AUBA 4BA0A 4AZCA 1W91A 2E68A 1BYCA 1G7UA 3VD9A 2XH7A 3UEQA 4HOXA 1UZHA 2G5WA 3N6HA 1KR1A 2ZWZA 2HROA 3I6RA 5BRPA 1QPKA 1IQ8A 4UQBA 2XGIA 1RXOB 2ISFA 3JR2A 3NQMA 2IS7A 5A8OA 2NUWA 2DSUA 1T6MA 5HWMA 4JN8A 3EXTA 4CNNA 3FK4A 3G1FA 1SR0A 3GE7A 2NV1A 1Y8BA 3W2JA 3CHDA 1KTNA 4A6GA 4GWEA 4RDZA 1BF6A 5K4ZA 3VGFA 4QSFA 3Q67A 4XG1A 4ADTA 1IT0A 1XBVA 3LB0A 5DANA 4IH3A 3K4DA 5FKYA 4D1JA 5IFTA 4C60A 2JK2A 4HKPA 2WMKA 4O19A 4LNCA 2OTDA 3RO8A 1LUCB 1RBLA 1W5NA 2X2GA 1W5OA 4B9YA 3A3HA 3VKBA 2ZCGA 1EGVA 5TAOA 6ALDA 4PMNA 5JH2A 1HX0A 3VE7A 1B3XA 2C8NA 3WK0A 4AEFA 3IK4A 3PG9A 4FALA 4MOZA 1DYSA 7TAAA 1TUFA 4XZLX 4HU3A 3EXSA 1DJYA 2WC3A 5AN7A 3VPLA 4EWND 5FD0A 1SFJA 4AY1A 4L9XA 4CNTA 3WQEA 3W2LA 3OZPA 3W2UA 3MYOA 5LA2A 2XN2A 1B1YA 1QO5A 3SFKA 3LHTA 2QCFA 1H7WA 1JAEA 2PLKA 4FF5A 4KETA 1KRAC 3RG6A 1K8YA 3RRAA 3MUAA 1QK2A 4F0HA 4Y9OA 4EKJA 4WKAA 2GVJA 2YCIX 5CC5A 3EAUA 1FH8A 4H9UA 1R3QA 4S3KA 1XBYA 5FJOA 3QQ0A 1PTDA 1NDYA 3IWPA 2D24A 4O1AA 4QLLA 1K8ZA 1D7FA 2YIHA 2PWHA 4AH7A 3O6AA 1OSEA 4XBJA 1TWWA 1U5HA 3CTLA 3WLTA 3APTA 3CC1A 3EOUA 3MUY1 1WYIA 2A3BA 1H7NA 3GDTA 3T55A 5BRQA 2XIMA 1Y5WA 3F4NA 1MXGA 3KLKA 5DRCA 3WJSA 3B9OA 1FHDA 2FB2A 2G95A 4JNYA 3QV7A 4J3XA 1Q66A 1R3VA 3P82A 4DUWA 5HA7A 1SGJA 3ALFA 1XDLA 3DYMA 2Z0IA 3UXAA 3W9ZA 3W71A 1EBGA 2YYUA 5H1WA 4I9JA 3N29A 3U2ZA 1A3WA 3NPUA 3QZAA 4AXKA 4QJ3B 3N13A 4BR1A 1SM9A 2YW3A 5MKGA 3JRKA 2J74A 1C90A 2OYLA 9XIAA 3LYEA 4N9DA 3SFWA 3BAWA 3BG3A 1H1ZA 4YLWA 3W26A 3CB8A 3NL3A 5HNRA 2F6KA 1Q6OA 3ZT5A 1ZAIA 1ONWA 4WXZA 4MAZA 4PGLA 1V0NA 2PRHA 1TE1A 7XIMA 4H6EA 1RJRA 2PWVA 4GK8A 2Y5SA 4LUIA 1XLKA 1JCYA 3HU7A 1OADA 1FWFC 4U10A 3B0UX 2E1WA 3OTRA 1LORA 4CKQA 1L2QA 4XAGA 3UZ5A 3GKAA 1PZ2A 4KEVA 3KDOA 4UNLA 1B3OA 3ZXWA 2C1IA 1J0ZA 5M03A 2V2DA 1JYNA 4ZVJA 1XRTA 4LCRA 3UG5A 3O6YX 2ABAA 3VNZA 3VMNA 5F2MA 4B3ZA 3IK2A 4DJDA 2Y89A 4O0QA 4XBKA 1GYMA 1CI1A 4HPGA 5FESA 5HBFA 3E0LA 4Q8NA 4XX6A 4Q8QA 2OFJA 3GAKA 3PB0A 1F61A 4YTRA 3W7JA 3S9IA 2P76A 4I8YA 2V5DA 1WP6A 4JQ3A 3S42A 2NVDA 3PZNA 1MZRA 4KWOA 4PN2A 3GXMA 2WJZA 4M82A 1KGWA 1JCLA 5BU9A 4GXWA 1AD4A 1DJIA 1Y5VA 1I2NA 1GZJA 1LYXA 4PH6A 2AMXA 3L23A 4ATDA 4IP4A 1KW1A 1Z42A 3UXIA 3EEGA 2X1UA 3KL3A 3TSBA 2GSHA 3TMLA 4A21A 3HG2A 4XB3A 3G6LA 3AHVA 4YL2A 5C55A 5FF4A 2QF8A 3WD4A 3TWAA 4WCJA 5J5RA 4NSBA 5I02A 1XLIA 1TCMA 1EZ2A 1ODUA 1S5NA 5H8PA 3W00A 3GO2A 2NSXA 3ITYA 1IR2A 2EKGA 4U3AA 3O6CA 4QE1A 2VC7A 3NWRA 1DPMA 4EAYA 3WH7A 5F2LA 4QE5A 1PIFA 4PCNA 1V4YA 3VX0A 5BROA 4Z1AA 3LCHA 1BWKA 1W3HA 4RL3A 3QYQA 1XIJA 4PRTA 3JZUA 4KS0A 5MKGB 1GWJA 4EACA 3CQIA 1KR0A 3TC7A 1XW8A 4H19A 2PDNA 3K5XA 2Z1WA 2I14A 3W75A 5L6UA 4D6IA 4MVAA 1PKYA 3NO3A 3VD7A 1G9HA 3M43A 2YJQA 3E3HA 2DZSA 3TKFA 1UH2A 2CPUA 2E4TA 3QC3A 4MGGA 3MI3A 5D9OA 3QV8A 3CNYA 1ZY9A 4G2DA 2VVSA 4GCAA 5A95A 3WKZA 3RGTA 3MI6A 3SN1A 1S3TC 2OXNA 5AVHA 1QI0A 3CIWA 3H70A 5KMYA 2BGSA 1B2YA 5LNRA 2IKGA 2Q71A 3ABSA 1XUZA 5DMNA 3RNDA 4R88A 3W82A 1EJXC 1GYNA 3E5PA 3A13A 4U5IA 3KOWA 3ZZ1A 2MANA 3ONCA 1GG0A 2IKIA 5F4WA 3M0VA 4LAOA 3SM0A 4DXVA 2WNWA 3DU0A 3L0NA 5AY7A 3W6YA 1YYAA 2PODA 3KRZA 3H7VA 4FXJA 1AQFA 3AALA 3CH9A 2CZ5A 1Q6LA 2OWWA 3W4RA 2C7FA 2VD9A 4KERA 4CD7A 4I7VA 4MB4A 3TK7A 3OLIA 3TSDA 1H7OA 4JL1A 3NURA 1K03A 3C86A 1W3LA 5G4EA 1P4CA 1FVPA 3UY8A 1NF7A 3MDWA 1M7JA 3ANYA 3CAKA 5CGQA 1LQ2A 4G1KA 1NAL1 5JIWA 3TTYA 1QT1A 3S5ZA 1I0BA 1G4TA 3LPGA 3CT2A 1XG4A 2EPOA 1OGSA 1XSIA 4BF5A 3MKCA 3VGEA 5F1UA 3K4WA 3CAVA 3SCNA 3T0BA 3L2MA 3RM4A 3H2FA 3N6JA 1A5SA 5E70A 2XVNA 5U4NA 3M0HA 3AMKA 3U5UA 1XP3A 5HJYA 3OG2A 3BCFA 1U2YA 2C19A 2XIQA 3WBXA 3ARYA 1DHKA 4HNTA 1UD5A 1LL4A 3TROA 3AIUA 3FSTA 1OK4A 3UETA 4NRRA 3QGAC 1JGMA 4UC5A 3SURA 2Y85A 4C6BA 5I0DA 3PPHA 5EMKA 1S3HA 5K9CA 2ZA3A 1OFBA 1I60A 6A3HA 2O9TA 4M6QA 3A9IA 4A8RA 2UWFA 3ZWTA 5AC8A 1HVXA 4N0RA 3AS2A 2FGLA 3QBUA 1J6OA 3ITLA 4XBSA 5FJPA 1F5ZA 1Q85A 3TWBA 5FJIA 2WVUA 2POTA 4MJ4A 3PJTA 2XGZA 3P2VA 1Z89A 4GVFA 4ZB0A 2DW6A 1UROA 5FEXA 3VDGA 2Y1HA 2DIKA 2WPBA 4ZFMA 2C79A 1GVYA 3B8SA 2DEPA 1CIUA 5C2GA 3TA6A 2OX4A 4ZB5A 1EDTA 9CGTA 2ICSA 3TYEA 4OOUA 3VCNA 4XVDA 1JDAA 1IT8A 1DWFM 1R9XA 4KCUA 3MZNA 3RM9A 4MNKA 2DZXA 2P50A 4LBSA 3MUIA 4CQAA 3PZUA 4P7RA 3EMQA 1XRFA 3MV11 2XISA 3UJEA 3BCDA 3VVGA 3RCMA 3QXBA 4XSLA 4QISA 2EPKX 4AW7A 3LXAA 3S5OA 5TD4A 5A8QA 2G3IA 3U7VA 4GXMA 3WFLA 2V9DA 1CGVA 2FIQA 4GVGA 2PC8A 1DTUA 2DU2A 3TXZA 1WZKA 1FH9A 2WQPA 4A3QA 1K9TA 4ATWA 2QXWA 4MZ1A 2OEMA 2FMOA 3G8RA 3HIJA 4CCEA 5CBIA 2IKHA 2NVAA 3LY0A 1M68A 2YLAA 4M5PA 2CESA 4RDVA 4ZODA 3CHEA 5F1VA 1G94A 4QHRA 2FZ9A 3P14A 6TAAA 1CBGA 5CGMA 3W81A 2CBIA 3MHGA 4O1DA 3BMXA 3TNBA 2YL6A 2JFEX 3BOFA 5KITA 1OZQA 5T9BG 3T2OA 1X6UA 1IXNA 3AS0A 1E6PA 1V0LA 2GL5A 3GC4A 4NNCA 3ZM8A 1G6CA 1OCJA 8XIAA 1IWPA 4LRSA 1UB3A 4RDYA 2CBVA 1UG6A 4IISA 2OO6A 3R94A 5G2WA 3IGXA 3F4WA 3MSGA 3TCEA 2ZE0A 5D4YA 2YGYA 4DBSA 1W54A 1W5PA 2TYSA 1GZ1A 3G6MA 4IICA 4AMCA 3S5NA 1R7OA 1MEIA 4JNMA 1QASA 1GORA 3ZLHA 5LGXA 1CNVA 4F48A 5EBAA 1KFKA 4IQJA 1DQWA 1A5OC 1F6KA 1RSCA 1JD9A 2V5CA 4O53A 2XG9A 3BOLA 5BWFA 4CGTA 1Y0EA 3PN8A 4BHYA 2HRWA 3QH2A 4LS2A 4CNPA 1V6VA 1Q7MA 4K39A 4Y8FA 4KCVA 2BTMA 3BMVA 2CLOA 3WUFA 3TTEA 3BZJA 3TE9A 1QPQA 4O1EA 2J7GA 3DFHA 5A8GA 6REQA 3LSBA 3CIVA 1F73A 4JICA 2ZOXA 1MDRA 4X0VA 2X8RA 1I2OA 1UD6A 3WNPA 1I1XA 4ILSA 4D72A 3CHFA 1SMDA 3M7SA 4FSAA 4QIUA 3C8FA 3B4YA 1FCUA 3WDIA 4GVIA 3MV01 3KOXA 3AICA 4PTMA 1VCGA 4MJMA 1DVJA 1TYGA 4ML9A 2ZRVA 1ZCCA 3ZLFA 2YBUA 3B97A 4Z17A 2OYKA 4CU8A 1QW8A 3O6DA 5DY2A 2X1IA 4Q33A 2EAWA 1XR2A 3H8AA 4K2SA 2XVKA 3P74A 5ABGA 1BTCA 1SZGA 1I0DA 1TB3A 2H9AA 4F40A 2O55A 5EFFA 3WNOA 2WANA 4L4PA 5D05A 4F66A 4IG2A 2NVCA 1V02E 1OC7A 1REQB 3V5FA 1O12A 4V1YA 5CLTA 5EFDA 1VYRA 1OABA 4IIEA 3REQA 3P5ZA 2FHFA 1CWYA 3UA3A 1ODZA 4KFNA 4AHPA 5AHNA 3TNOA 4Z1DA 1NEYA 1TG7A 1H1NA 2POZA 3ARRA 4PB3A 3PTKA 1QCWA 5J04A 3DC0A 1OJXA 2W4XA 1M5WA 3WYZA 1NQKA 3M0MA 3OW1A 3MYPA 2PGWA 5ENLA 2PGEA 3AYVA 2WKLA 3FKKA 5I79A 3UZXA 1TZZA 1E6RA 3A9BA 3LM3A 4HPNA 3VNKA 1UYQA 4IMGA 1MQPA 2J79A 3O16A 3LDVA 4JQ1A 1TV3A 4M3PA 1R6WA 4JR5A 5KSWA 1PKLA 2E67A 1EYWA 3V0TA 3VCCA 3WL0A 4WD0A 4P8VA 1WDPA 4HA1A 4MZYA 4P7NA 4XZNX 4L1GA 3QHNA 1EA9C 1B30A 4X2RA 2O4MA 3OZOA 3PNZA 2W9MA 1IGWA 3UP8A 1EOKA 1NDZA 4M1BA 3RJXA 1JDCA 3KVJA 2ZRUA 3EDKA 3KBWA 4J28A 1Z9AA 3MSDA 4B90A 3ALGA 2O9PA 3WUBA 2IW0A 1X97A 1E6ZA 4FHAA 3TN5A 2BBFA 1W1VA 3C0QA 3HQOA 4WF7A 1ITUA 1BXBA 1EF3A 4TX6A 4DUOA 4J27A 4EPEC 2BWGA 4GBUA 5IXEA 1AMKA 1XIEA 3GX9A 3SN4A 2ZBTA 4JOMA 4H01A 1J0IA 2O0TA 4ICMA 3SY8A 4PZVA 4RW5A 2X0HA 4PULA 4C6FA 3W7EA 3R12A 3L2IA 2BHZA 3K8LA 4MKVA 4TV6A 3CU2A 5IRPA 5JVLA 5JQ9A 2FJUB 1LT8A 4LUSB 5AYIA 4AZ7A 4DF0A 3ORWA 1GOWA 5BOEA 1YPIA 1I9CB 2VL4A 3LGGA 2JKPA 2OPJA 4RW3A 3S3GA 3VA8A 4LCSA 1A47A 4GYJA 1UR1A 1W32A 2GJPA 1W1ZA 3O2LA 1EUNA 4MY8A 3CS2A 1QNQA 3V75A 3WQ6A 2VYOA 1BGAA 3MMUA 4XAFA 3G1YA 3R79A 3IRDA 3WMBA 1SW3A 2GVGA 5A6MA 1J5SA 5FL1A 4PTVA 1MMFA 3MQTA 1IEWA 4FF7A 3DYOA 4ACZB 1NOUA 2O4QA 2QEZA 1V08A 1JNEA 3WD2A 4MFEA 5CBJA 2A0NA 1XGDA 3MCOA 5E9XA 1DXFA 4B5TA 2ZA2A 3LLFA 3LN3A 1M1BA 1Z44A 3LPOA 2ZXQA 2VURA 3P61A 4M0XA 3WNLA 2BY3A 1M04A 5E9AA 3W22A 3CEPA 2WV8A 3SI9A 2OG9A 2YSWA 3HTWA 4S3DA 3OEXA 1TPC1 4UTJA 1EIXA 2V82A 4I8DA 3E12A 2D3NA 3DC8A 1EWEA 4CLMA 4W87A 2ZUTA 3CZLA 3EX4A 2YL8A 2ZZ6A 2QPXA 2H8XA 5BYWA 3QF0A 2YCEA 2NV2A 1EPVA 1F3TA 4LUTA 1X39A 1XD0A 4AWUA 4YTTA 4MZ8A 2QCDB 3SBFA 4V28A 4YXGA 3P93A 3TN3A 4DJFA 4KIRA 4LALA 4LC8A 3STGA 1MDLA 1RA0A 2OOGA 4X22A 5CAKA 4GIRA 2OLSA 3OVGA 4FMVA 1E0UA 2C91A 4UR7A 3G1RA 4HYWA 4ICNA 1F7BA 1T41A 1J93A 3G1SA 2ACRA 3VNIA 1Z7AA 1I8JA 2ZUWA 3QGKC 4U2ZA 3HO8A 3EWDA 5BU6A 3HOJA 4DI9A 3AWOA 2XVPA 3FCPA 1K7FA 5CPLA 4Z1YA 1MFVA 1UR9A 1XLHA 2DSKA 1EX1A 3LERA 1TR1A 3EWUA 3UWYA 1MQQA 4HU4A 1VJZA 5CXPA 3D46A 4QLKA 3GW3A 3N6QA 4XWUA 1K02A 1SO6A 4C1NB 1MNZA 1XYFA 4WY0F 1ESWA 3WQ4A 1JQVA 1VFSA 1PX4A 1OM0A 2PD5A 5C0QA 1PS9A 2QGHA 4DJFC 3H54A 2Y0FA 3GNPA 1RD5A 3RHGA 3FKRA 5DT7A 1SZRA 2V5JA 4MJZA 2X7WA 1A5KC 2YBVA 2VGFA 4CCZA 4Q8OA 5LA0A 1U5VA 2YDRA 2FVMA 3KRSA 3PS7A 5I6SA 3R8GA 3MJMA 4DJDC 1NSJA 2CZDA 2Z1KA 1GHRA 1Q6EA 1AQHA 4K38A 4LJ3A 1T8XA 4O13A 4UTFA 3L67A 4JBRA 1E5NA 1QU4A 3UR2A 1LDCA 2VR5A 3NPXA 1AK5A 1KWGA 3DBPA 4RPPA 4E8CA 2JBMA 5AFDA 1OFRA 4LVBA 1H5YA 1UP0A 3ABOA 4DLFA 3N15A 4WGHA 4LW7A 3RJYA 2Z1XA 3VIMA 3LUTA 4QG9A 3MPGA 5AB3A 2NQHA 2QVHA 3GVRA 1A50A 1GEHA 3F2DA 3GXNA 4ZE5A 4MYAA 3TLQA 2NWSA 4RX0A 3DGBA 1O5QA 3KEHA 1MNSA 3DFYA 2BODX 2OT0A 4QM1A 1C8XA 2E6AA 1KFLA 4DUXA 3WLOA 1YPXA 3WLQA 1UD4A 1QBBA 1IZJA 3T0CA 1CW2A 3AIQA 1MW0A 1TV7A 2PDFA 4FNQA 3R0KA 5E6YA 5HANA 3DEQA 3W1LA 2YCLA 3W72A 3QLLA 7PTDA 1UQYA 3LCFA 2DUXA 2NXHA 1NDVA 3A22A 2E7FA 4JN7A 1TMHA 3W88A 3FYYA 3EWBX 3EA1A 1GK8A 4OFCA 4WDTA 5GJMA 3S8HA 5CC6A 3RX2A 1V3LA 4JIEA 5AECA 4EPKA 2X1TA 4QJ5B 2X09A 3VC5A 2O7QA 3HV8A 1LTDA 1LT7A 1VIZA 3VO0A 1X6LA 3HMJG 2X2YA 2BZNA 2W62A 3BG5A 3O0KA 3S6DA 1AH3A 2G0WA 1Q6QA 4FK9A 1WBJA 4HQVA 2NT1A 4HZ8A 1V79A 1JPDX 2VWTA 5I3KA 2QIIA 3WBEA 2QUUA 1UR0A 3TMQA 3EKLA 3TONA 2CEQA 1R3YA 3LG3A 3DIPA 3TAKA 4D71A 2D69A 4GYKA 1FWHC 2E77A 1OCQA 3IVTA 1H50A 2Y2WA 2PPGA 2FPTA 4FNUA 5BWAA 1VFMA 2X40A 4FZIA 2XIOA 3UJFA 1ISWA 1VFTA 5H2ZA 3CLMA 2CLFA 3NSNA 3LCGA 2OQHA 1F3XA 1XINA 5D2YA 2OZ3A 3U2OA 2Y7GA 2Y8UA 4G7EB 2WLYA 4DIAA 1UR3M 3V5OA 2JEQA 2QW5A 5M5DA 4JNZA 2PDKA 3IJQA 2Z6IA 2G41A 3C2EA 3UWZA 2VOTA 4GQ0A 3QJAA 3SUWA 4DWSA 4H6RA 1VEOA 2E6FA 1C3FA 5FSEC 1W2VA 4ADSA 2GOKA 4C65A 5CPOA 1IXOA 3BSMA 4X60A 4XV0A 3QFWA 3GHRA 3WD1A 4F4RA 5JU6A 3LD5A 4GMEA 1NU5A 2PSNA 4HB7A 4C7GA 4AF0A 4RNFA 4LWWA 1O60A 4N9BA 5BMWA 1R3RA 5C54A 4B2DA 2CWNA 3QFEA 1REQA 2XH4A 1QNOA 3BAXA 3CV7A 4S39A 1P1MA 1HKKA 4O18A 3VM5A 1TV4A 1UPPA 5FJRA 3MBFA 1MI3A 4IOTA 3FN9A 1PX3A 2GK1A 5HQEA 3WDHA 3NA8A 4MLRA 2GQ8A 3NVTA 5JUVA 1HJQA 3MCMA 2V69A 4V33A 3ABQA 3R7MA 4O10A 4E8GA 2D0HA 1ITQA 2GDVA 5AYXA 1QI5A 4HK7A 4MYXA 2X05A 3OVPA 4WK9A 1PEZA 1SW7A 4PMUA 2XJ7A 3WJWA 4XZMX 1MEHA 2ZX5A 3CWHA 3AZRA 4QITA 3L5LA 2TSYA 4HJFA 1J4EA 3THAA 4R7JA 3SUTA 3PR2A 3STPA 3C0JA 3HG4A 2FGZA 3E6EA 1FWRA 1AJ0A 5GJPA 1OYBA 2WSQA 3AXIA 3M5VA 4PSPA 3P3BA 1AA1B 3P81A 3BSHA 1O7AA 2OT1A 3GBEA 2IXVA 1IE7C 3M4HA 4FR1A 1E43A 3ARWA 3FV9A 4PMDA 4O0ZA 2BSLA 1PTAA 2Z2BA 4UR8A 1TPWA 1PYFA 3PB2A 3U5YA 1GOIA 2F6UA 4CD8A 4RKAA 1R8LA 2PI6A 4B4HA 1HUVA 1EO7A 3VZZA 1B3VA 4ACYA 3SGGA 4PFMA 3CUXA 4P7QA 2ZX6A 4IMAA 4K8EA 4HNVA 2VUYA 1DOSA 4ZE4A 2QULA 1XISA 3CV6A 5I3JA 4MG4A 1O5RA 1TA3A 3CQKA 5EL1A 3O07A 1P0NA 2ISSA 3BE7A 4TX9A 3LI0A 3NQGA 1DXEA 3UZWA 1B9BA 4HD5A 2J47A 4UTTC 5HK4A 3LCXA 1QHPA 2A3AA 4ZO6A 4AXNA 2PF0A 5HMFA 4Q4RA 4GD0A 3GW0A 4QNEA 5LNVA 3E38A 4NU7A 4A4AA 2A6LA 3STCA 4M56A 3W7OA 1GW9A 2PP0A 3NL6A 1JDDA 2TPSA 3VU2A 2PCQA 1DV7A 4PL1A 2DSVA 2ZVRA 4KKXA 5I7GA 4ZTYA 4JFWA 2YCKX 1RPXA 5FI8A 1XIHA 1W1A1 1VD6A 4AMAA 2EPNA 4MUPA 4PUKA 4R53A 3VIFA 3B3DA 1PDZA 1E0WA 5CPNA 1U83A 1HP5A 2GPTA 3CGTA 1E55A 5HXMA 4PC8A 3FA3A 3GYEA 2ZTJA 3N2OA 2EPHA 1RQHA 4D6HA 3RILA 1UKSA 2AAMA 2J9YA 3LEPA 1JI1A 4LYPA 2HEJA 3TTQA 3W86A 1CGTA 4AVOA 1A53A 4I5UA 4GINA 2YZ5A 1SO5A 3IACA 3W7NA 4ZQRA 1W9DM 1QOQA 3TCSA 2OMAA 2FZBA 1UC5A 3R0DA 3NL5A 2C15A 4JCLA 2NV9A 3CO4A 3MANA 1XIGA 4CUCA 2CC0A 4B15A 4JTRA 2Q3OA 1RP9A 4QXIA 2JGQA 4W7WA 3SAZA 3M0XA 2XIIA 1X38A 1RK6A 2RDUA 1N8IA 3LHWA 1LOLA 3RCNA 1Q45A 5M1TA 1DL3A 3BGJA 3TV8A 1V3JA 3VIIA 3MTWA 4ASTA 5G4WA 3TH6A 3CQ0A 3ARZA 3HURA 5CCZA 5HWJA 3GDKA 2VUNA 1US3A 1Q4WA 3JW7A 1O5KA 4CQCA 1BD0A 3MS8A 4UNKA 4C6JA 3WDQA 3QPYA 3GZ3A 3M44A 1WO2A 1GYLA 1SMAA 1I2PA 2YR1A 2ZWYA 3PM6A 2VNCA 1XIMA 2DDXA 3MJYA 1GJUA 2CHNA 1DEDA 4LF2A 3CUIA 5I23A 2QCMA 2Y88A 2UZ9A 3WY1A 1KBJA 4NX5A 3T7VA 2QCCA 1FFQA 2EHHA 4J2PA 1XRSA 3QZEA 2VKZG 2Y5JA 3FAWA 2G97A 4UCGA 2HISA 4NZ3A 3G24A 1BQCA 2W66A 4UZSA 5DMYA 4HA0A 1BYDA 3GHUA 5IDIA 4U33A 4AIOA 1TV5A 1PZ3A 4PCPA 3DYPA 1KRCC 4IGNA 2EPLX 4ZBCA 3KVKA 1LF1A 3UBPC 1QR7A 1FWGC 2FTYA 3LCLA 5LNSA 1EC8A 3IIZA 4Q8VA 2J7DA 2ZDSA 1SUXA 1N55A 1AMYA 2NUYA 4FO4A 5CSYA 4LVFA 1JGIA 4O1BA 3BCJA 2DIJA 1VC4A 4OJYA 3A24A 5A6BD 1K9EA 3WK1A 5KINA 2I56A 1ISXA 1XFBA 5BRBA 3D0CA 4H9MA 3Q58A 3NQVA 3D3AA 3DHFA 3NPVA 3LHZA 1XLCA 4ALDA 1CGYA 5D03A 4ERAA 2VC5A 2QCHA 3BLPX 3UXDA 3CBWA 2ZUMA 2G8ZA 1C91A 4ACZA 1S2WA 5E6ZA 3EB4A 1Q6GA 2E5CA 3IUIA 4JN6A 1QJWA 2ZUUA 1EJSC 3BH4A 1FHLA 4WDXA 3ARQA 1XIDA 4C6MA 1X8CA 2I5GA 3GXPA 1EDQA 4S3FA 2YBTA 4KRTA 3WN6A 2JF7A 1BRLA 2OZTA 1JPKA 4DEFA 2C18A 3RX3A 2D3LA 3KRUA 1IZCA 4UCFA 1J18A 4GZEA 2WCGA 4K7YA 3V35A 3WEZA 1US2A 1ISYA 4IIDA 3A5FA 1J11A 3O0FA 1AW2A 2YXXA 2RUSA 4JTIA 3QVQA 5EMLA 4F9DA 5I24A 1I2QA 1N82A 2ZC1A 1CX9A 1WOBA 2ESCA 3IIVA 1VLIA 4A8NA 4C6KA 3EEZA 3HPSA 4L65A 4AWTA 1KXQA 1KB3A 2GK1B 3SN0A 3STFA 5LZLA 5J5DA 4AC1X 1FH7A 1X7IA 2PTXA 3KL0A 4RR4A 1CB7B 4XKYB 1UKOA 3W7RA 5G1YA 1HJWA 3H4WA 1ICSA 3SO7A 4ORIA 3I7RA 3W70A 1OVDA 1Q65A 1JEZA 1RV8A 1ME7A 1CXHA 2OKTA 4DX3A 1YBQB 3H2AA 4NJJA 4LBUA 2OQYA 4IQLA 3KXQA 3VIKA 3L5AA 1RJPA 2FLIA 3M6DA 2E9BA 1P0BA 3QTPA 4G1NA 4CD5A 1SZEA 3VKCA 2VC6A 3NQAA 4HN4A 4GY7A 4H4IA 3NZRA 4QQ3A 2PS2A 3ZJ7A 2WKGA 5LIWX 4PUNA 4QLJA 2RKXA 4J3WA 3VIOA 4B5VA 2INEA 3VGDA 3M47A 4F2TA 4OOZA 5GPRA 3WNMA 1W31A 2VEFA 2E6YA 3MP4A 4U2YA 1WE5A 4HCDA 2DZUA 4XO6A 3GXTA 4U3CA 3AXMA 4AZ5A 1ENUA 4IPNB 3OYXA 3PBWA 1E4NA 2G3MA 1Q3NA 5EMUA 3RIKA 4G7FA 1QOPA 3CAWA 1TPDA 9RUBA 3SSZA 1A3HA 3CQHA 3QYSA 2WZHA 4WRHA 3BO9A 1S38A 3CV2A 4JIQA 1OB0A 1C7TA 3L4UA 4JYDA 1F8IA 3H7RA 1TZ7A 3ATYA 3WLKX 3GR8A 4D8LA 5DN1A 1WUFA 2BVYA 4I6KA 4HHHA 4Z2GA 1OINA 1UBSA 1NJJA 3CEUA 1IF2A 1Z6KA 2WW5A 2NX3A 1VF8A 3QLDA 3NQCA 2WBGA 3OA3A 3TN6A 2HCVA 3E2SA 4C5YA 1BQGA 1W9BM 2FZNA 2Q01A 5A6TC 4XTIA 5HOSA 2J7BA 3PULA 2W3ZA 2PE4A 2E8YA 3AIEA 5CH9A 4GNKB 1M6JA 1YRRA 3FXGA 3B0PA 1EJ7L 4ZQNA 2BY2A 1J0JA 1K7XA 3B8TA 3W37A 1VBJA 1R87A 4N6EA 1E70M 1FP9A 4CD4A 3VD4A 4GUIA 3T9PA 5D30A 3CYVA 4GRSA 3ITTA 2AAAA 2H90A 4LNYA 4PBEA 1P6CA 3S4TA 4CU7A 1MZHA 3OIHA 5D9NA 1KRMA 4KRUA 3DX5A 1J0KA 4D6EA 1XG3A 4S23A 3T09A 1RZMA 3GBDA 4Z0JA 3NDYA 2JKAA 3LTSA 4GBDA 2BDQA 3ZOAA 4ROPA 3N9SA 2D22A 5LXXA 2PTYA 2G3FA 5CZTA 1UWQA 2AMGA 1Q63A 3H4GA 3V7PA 2CZEA 4WUIA 3BURA 2P0IA 1HTIA 2FMNA 4UMAA 3MB9A 4MB3A 2VEMA 3WD3A 1MWOA 1YDVA 5HNNA 3R13A 5EMMA 2Q09A 1XYBA 4HCLA 3ATZA 4IMDA 2J6VA 2E25A 4F0SA 3ZJ8A 3SEPA 2HVMA 3T40A 1U1HA 4JTJA 2ASHA 1YNQA 2QNEA 3WLRA 5K4XA 2INFA 3ZLGA 4FOJA 1D3HA 1QI4A 3SY1A 2D0FA 2ANUA 1ZNNA 3IEBA 3WNKA 4OV4A 3PJWA 5FAJA 3TR9A 4W84A 4NASA 5F4SA 3T07A 3TDFA 5DT5A 3L2LA 3KCJA 1X96A 4GH3A 1V0KA 3WMSA 1UWIA 4GYFA 4DUVA 3M7WA 3TU9A 4ZENA 2WHMA 1LWIA 1WDRA 3U4AA 1AG1O 3OODA 3FVDA 4C5ZA 5I2UA 2ZXDA 3USZA 3KVLA 3RU6A 4H2HA 1E6QM 2J13A 3W1NA 3UXLA 3H2CA 4E2BA 2IXUA 2QLYA 1EL3A 3SCPA 3LLDA 4O4WA 4TV5A 2WKJA 2FDMA 2YL5A 1U1UA 4DAFA 2OCZA 3BC9A 4F0RA 3L12A 2YDQA 2C3ZA 1ZENA 4U4MA 4AWEA 3GVGA 3BVJA 3NYZA 2AGKA 3LHYA 3S9ZA 2ALRA 1UH4A 1VFFA 3ZMRA 1UIOA 1AQMA 1B54A 3RDKA 2Q8ZA 3ZR6A 2G50A 2QAPA 3E0IA 3N2TA 5K9XA 1QNSA 2W5FA 5FF3A 4O52A 3S6OA 1VFLA 2V3DA 1JCNA 4GCXA 3SADA 4UTHA 1KV5A 1C93A 4JDBA 2OSYA 4S3JA 3UJ2A 4RV3A 4NUWA 2CHOA 3R58A 1KWKA 2IPJA 1UOZA 2PDQA 4R5EA 1K7EA 1OFPA 1OX4A 2V3FA 8A3HA 1I4NA 4DO4A 1XGEA 4XD3A 4AY8A 2FQIA 2NWRA 4KEUA 2PBGA 4HIBA 1QOXA 3SRKA 5MHBA 2ZRWA 2WC7A 4CVWA 3XISA 2BP1A 1RY8A 3O1NA 1M7XA 3B8UA 4X61A 2HDJA 2G4JA 1EGZA 3V0SA 1NM9A 3WNNA 1V6UA 1GJPA 1VAHA 3GS6A 2V67A 3V1HA 3AXXA 2A21A 2E40A 4HGXA 3IANA 3FEMA 1V02A 4W7UA 1TWIA 1LBLA 2Z00A 4KH2A 4XUGA 4EP8C 1X1OA 2ZX7A 3VGHA 3NEVA 4YTUA 4Q22A 1E4LA 1XCWA