3PBVA

Crystal structure of the mutant i96t of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
219
structure length
219
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAITVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-monophosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanobacterium thermoautotrophicum
molecule tags Lyase
total genus 87
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pbvA00
3VCRA 2Y88A 1OYAA 1TRIA 4WJEA 3DXIA 4CLMA 3KRZA 3O63A 1TTJA 3W7RA 4BI6A 1PCKA 5DXXA 2C0AA 3DKLA 1OF8A 3LXCA 4O12A 1VLWA 2ZZ2A 5I3IA 4DF2A 2A1YA 1QR7A 5K9XA 3B0UX 2V2CA 4UTTC 5LSMA 4CCCA 4PTNA 4JTLA 2RFGA 3W7PA 2ZBTA 1H60A 1OK4A 3NDOA 3GDRA 3PR2A 4JTSA 4AWSA 1XC4A 4OQVA 1G7UA 3W1PA 3C2RA 2FLIA 4YWIA 4ORIA 2WO5A 2ZRWA 3LV6A 2QCFA 5HQEA 5AYYA 1CW2A 1GVFA 2OX1A 2JKPA 3W74A 3NG3A 3M7WA 3E9AA 4BFAA 1ML1A 3R13A 3PBUA 5F1UA 3GXPA 4NNAA 1TO3A 3S1UA 2LLEA 4DO6A 3SR7A 5EMUA 1ZALA 1A5BA 2AGKA 2C16A 3OVRA 3E49A 4O14A 2G97A 4JR5A 2VXNA 3L0GA 1TJPA 3EXRA 3QM3A 4PEKA 3TXZA 1EUAA 2ISVA 2Y7GA 4H3DA 1SSDA 4QM1A 3EWUA 3YPIA 3W73A 3R8RA 4NNCA 1YTKA 3HG5A 1J4EA 2OT1A 2VEIA 2ZA3A 5FEPA 2ZRYA 4K7YA 1FDYA 2DP3A 1Y0EA 1RV8A 1TPUA 4RX0A 3N19B 3BLEA 5K9CA 4RZ6A 3QJAA 3P81A 1JUEA 2CLLA 3I65A 5K9DA 4BK9A 2WPBA 3KVMA 4NUWA 4Y8FA 3TQVA 1P0KA 5D03A 2V8ZA 2Y63A 3LTSA 3ABRA 2I9EA 4O1AA 1J2WA 4XTIA 1QNVA 3QMTA 5FI8A 4N4PA 2X1UA 1H7WA 4NJGA 2EPHA 5EKYA 1TPDA 1KV5A 2DZXA 4CNOA 4POCA 2C15A 4MYXA 3KRSA 1NFBA 1TIMA 2GJNA 2V2DA 1GJPA 2FPTA 1AW5A 3G1VA 3UWWA 3USBA 3I7SA 2GQ8A 2QAPA 4Z1BA 3UY7A 1YLVA 3CQ0A 1IIGA 1GPWA 4TO8A 2VFDA 1QWGA 3LRMA 4WY0F 5D09A 3IV3A 1G7VA 5HUPA 1TPFA 4WZHA 1LOSA 3DI1A 3MP5A 3UWZA 3W1QA 1LZOA 4WXZA 3MBFA 3GLCA 5LGXA 4MVAA 3WJSA 3EEGA 3EWZA 4OV9A 4U28A 2WSRA 3F03K 1W5PA 1QMLA 3W84A 3IIXA 2XN2A 1GVQA 2CZ5A 5F2MA 3IIPA 4MFEA 4O1BA 4L4MA 2E5CA 3HJZA 2V30A 5J5DA 3TQKA 2Z2UA 3CEPA 3QW3A 2GVJA 3CB8A 5E93A 1TPEA 1OFAA 3C2EA 1VR6A 2CLKA 1AMKA 4NNBA 2Y7FA 1X6UA 1JCYA 5HWMA 1OG0A 3BW2A 2FDSA 3MUXA 3TQ0A 1FCQA 1IGSA 1OX6A 3DFQA 3TDFA 3QC3A 1SO4A 4RZ4A 3OHIA 2VEPA 3M6YA 4O53A 2QCGA 3GDLA 3R89A 2ABAA 3ZR4A 3NQDA 1FUYA 1G4EA 4UFKA 3U2OA 5G2HA 4YLWA 4NU7A 1PS9A 3W1AA 4NX0A 2WNZA 1KBJA 1KTNA 1H5YA 3DHDA 3M5VA 4DO4A 2FPYA 3HMJG 1I2OA 1KFBA 4XKYB 4DO5A 1UASA 4G1KA 1TPB1 1HG3A 4PFMA 2ZTKA 3ZWTA 3W75A 3RK8A 3O07A 3S5YA 2CLEA 4CQAA 3OVPA 5LGZA 4LY8A 2FB3A 4JDYA 1IF2A 5MHBA 4RXFA 1DORA 4UMAA 3DKJA 1AG1O 3THQA 5I3JA 1KFLA 1D3GA 3RF9A 2EGZA 4UR8A 3FJLA 2VKZG 4O50A 3LLFA 3HIJA 1ALDA 2VFIA 4IWWA 3M5ZA 3C56A 3PWAA 1Q6LA 1S5WA 1K03A 3I7RA 1EWEA 4QITA 3MHGA 4DBDA 1QPNA 3GYEA 5CGQA 2EAWA 5G5IA 1U5JA 1OFDA 4JX4A 1RR2A 3T78A 1O60A 3WJXA 2VFHA 4N6FA 4LS0A 1K3UA 3CIXA 2A85A 4CQ8A 1IXOA 2BTMA 3A23A 3P5ZA 4ZL1A 1UUMA 2NX3A 4FEZA 4IUOA 1T99A 5C55A 3LHWA 3U8GA 2BZNA 3LCXA 4JNMA 3SJ3A 4AWTA 1WYIA 5D2YA 3LHVA 4H4IA 1ME8A 5BRBA 3P74A 3SECA 3A22A 4Y6GA 3W7GA 3SW6A 2CU0A 3O15A 1LOLA 3UPWA 2Q8ZA 4FIQA 3UD6A 4E38A 4UTWA 2WOQA 3E02A 3NVTA 1GZGA 1WBJA 4MLJA 1O95A 1OHLA 4MZ8A 3W87A 1R2TA 2RH9A 3MWAA 3O8AA 1J5TA 1EUNA 4RLIA 3NEVA 3INPA 4JN6A 4KWWA 1TV7A 2R14A 3NQEA 4HSOA 1DJNA 1W3NA 1GVSA 3B03A 3LCGA 3BO9A 1FCBA 5IBXA 2OT0A 4KFOA 3AJXA 4Y9AA 1RQHA 3TSBA 3C61A 3S1VA 5EA9A 3TCEA 2ALDA 5AHLA 2ZYFA 1TQJA 1TPVA 3NQ6A 2DZWA 3LHTA 2NXIA 3STGA 1H7NA 1SFJA 1DQXA 1TTQA 2QCLA 1VYSX 2CFFA 1A50A 2B7OA 3BK0A 3HBLA 4GXMA 4E2DA 3OVQA 4UFHA 4I7VA 4IX0A 3M16A 1NF7A 2X1SA 4O17A 5KINA 3EX1A 4AXKA 1OFRA 3G1SA 3CHVA 3NAVA 4HT3A 2NWRA 5AHIA 3TW6A 2HSAA 4AF0A 1S5VA 3A5VA 2V5BA 3W86A 1F74A 2ZDRA 1KBIA 3W7LA 2DU2A 5DBTA 4KFPA 4W9TA 4BR1A 3W88A 4OHQA 1QCWA 2E77A 4LC8A 3GVGA 3PBYA 3EWYA 2Z0IA 2WNQA 1B4KA 3W85A 3B4UA 3PBVA 4PL2A 4FXRA 3M41A 3P8JA 4OU1A 5C6MA 5A8GA 3BV4A 3I6RA 1AL8A 4AH7A 1VCFA 3U6WA 4BF9A 1QAPA 3CIWA 1ICSA 4OE7A 3NXFA 1ZAHA 4WY0B 4FNPA 3TC7A 4O19A 4P61A 4AVFA 1H1YA 3N2XA 4K38A 3MO7A 1SU5A 2YFNA 4K8HA 4LT9A 2A4AA 2VOMA 3LOTA 1LBFA 3NQMA 2QUTA 4M5PA 3TFXA 1EP3A 2C14A 1XUUA 1AW2A 5BW6A 1XBZA 5D04C 3CC1A 3GAYA 5DN1A 1F6KA 4OGZA 1M6JA 4NXKA 1S5TA 3ATZA 4NXSA 1LDCA 2GVGA 4XZ9A 3P62A 5CSSA 1Q6RA 1JULA 2XN1A 2V5LA 1Q6OA 3G1XA 3P82A 1TV5A 2A21A 2WKJA 5LKYA 4XTDA 2TSYA 1M7PA 2E6AA 3M44A 1H62A 4UTIA 1FXPA 3W1TA 3W76A 3STFA 3W7HA 3LXBA 4AHOA 4M7SA 4QAIA 5F4WA 1ZAIA 4PC8A 4N02A 3EWBX 4DEFA 3FEMA 1P1XA 5HJLA 3HO8A 3O6YX 3IVTA 1P4CA 2GOUA 5FEZA 1VHNA 5F1VA 3CWNA 3P7YA 4LV4A 5FF7A 3NM3A 4PCFA 1GVOA 5AHMA 3LGEA 5D2WA 3TFCA 5H2ZA 2H90A 3GNDA 1LP6A 1R2RA 1KV8A 3FS2A 4JY8A 1GYLA 4GE8A 1W3IA 2GQ9A 2WSQA 4AHPA 1KM5A 4I7WA 1I4NA 4UTWC 1CI1A 4GC4A 3KXQA 1VCVA 2A7RA 2JKEA 4N9BA 4QNWA 2OJPA 1F76A 1QO2A 4LV9A 4UTLA 1WXJA 4O10A 2W6RA 4CCEA 3C8FA 1G4PA 2YGYA 1TMHA 3NA8A 1PCWA 2ZRUA 3SZ8A 4H6KA 3UZ5A 1SQ7A 3EX4A 4XBKA 2YDAA 2RDWA 3GX9A 4P2VA 3SFKA 4XQ6A 1IXPA 1ICPA 3G1HA 4A3UA 4OV4A 3UZJA 1FXQA 3QPZA 3TJXA 3W1RA 1L9WA 3HPSA 5HR6A 2E6YA 4PA8A 2X30A 3IVUA 2Y85A 4RJEA 3LV5A 4IMDA 2V0TA 4X3ZA 4BI7A 1FCVA 3G3DA 4JD4A 2WNNA 3WK2A 1RZMA 1KM0A 3N2MA 3UWUA 2YFOA 2QJHA 1DQWA 2NUXA 1L6WA 3GKAA 3QMSA 2CLFA 1MZHA 1VC4A 1XUZA 2Y7EA 2TPSA 3KRUA 4UC5A 2QJGA 4UTKA 1RQBA 1L6SA 5C54A 3UQNA 5LNSA 1VZWA 1AL7A 3DFSA 1OFOA 2WJZA 2GUUA 1YXCA 1KM1A 1SZEA 1TTPA 1D9EA 2ABBA 1E51A 1AK5A 4X9SA 2ATSA 1G67A 3DBPA 5KTLA 3NL6A 1MO0A 1X1OA 3W23A 2QAFA 5F4SA 3ZS4A 3EX2A 1KLZA 1BWLA 1KTCA 1KFJA 3TE9A 1WOAA 2A5HA 3NNTA 3PVFA 4RR4A 2NUWA 2H6RA 1VQTA 5D2TA 4GUJA 4WOQA 2VC6A 1HL2A 2QDGA 4JTGA 1IXQA 4UNLA 4YCOA 5DELA 3WK0A 1TYGA 4FNTA 2VENA 1SO5A 3GR8A 1FBAA 3CM4A 3NQCA 4LRTA 3NO5A 4O4VA 2RDTA 1WV2A 1OABA 1QOPA 3CEUA 1LM1A 3NQVA 3W7OA 3B0VC 1O5KA 3IRDA 4JTJA 5BOOA 5G1TA 5EYWA 4UUIA 3HG3A 5K7JA 3UPBA 3SSJA 3GB6A 2ZZ7A 3TMQA 1DJQA 4LVBA 4O8RA 1I2PA 2CZFA 1VJIA 1NVMA 5LNWA 1N7KA 4ZQNA 2EF9A 4ZQOA 1QFEA 1GOXA 2CW6A 3FIGA 4JTTA 4JX5A 5CPNA 2Q3RA 3HOJA 3M47A 3T44A 1MSSA 4RK8A 1W3TA 2QCDA 4EVZA 1HUVA 2FQIA 2HMCA 1ZAJA 4IX2A 5KITA 1YTEA 3B05A 3NL2A 5E0KA 4QNEA 4JS3A 1W54A 2KZHA 3EKZA 2E6FA 3QQ1A 2FIQA 1ME7A 3LRKA 3L5AA 3S5NA 1H7XA 4O16A 1JCXA 3TMLA 2ISSA 1FWNA 3LM7A 1L6YA 1MXSA 4O28A 4UIOA 2QCCA 1SSGA 4HPJA 3MHUA 1K7EA 3MI3A 1LRTA 4IOTA 3TAKA 4O1CA 5G1YA 4UTUA 1JJKA 3ATYA 3N73A 2FJKA 1DHPA 4O4WA 4WD0A 3G1DA 4IMGA 3R2GA 4EF9A 4R7JA 3S1WA 4M6VA 1OFPA 3FYOA 3LTPA 2YW4A 3DFNA 2R8WA 4FNRA 2BSLA 2ZTJA 1JUKA 2C6QA 5AFDA 1LYXA 4L4LA 3T4CA 4KKXA 2CLMA 1DBTA 4JTIA 3ZFHA 2QCHA 4LS2A 4AB4A 1HO1A 3QF0A 3QMRA 5LNVA 3NL5A 2A2IA 1H61A 2TYSA 1ZCOA 4CQ9A 3ANYA 4M6QA 1YDOA 2DZSA 3ABOA 4XUGA 3E12A 1XKYA 1F7BA 2ZZ6A 2QKFA 4Z1DA 3FJ6A 3NYZA 3TC6A 1HTIA 3WJWA 3M0ZA 4HIBA 2R91A 1K7XA 1W5OA 5IM51 3SGZA 3TA6A 4O11A 5CZTA 1P0NA 3PB0A 3IGUA 1Q3NA 3DGRA 4S2BA 4MJZA 3OIXA 5AC8A 1C8VA 1FY6A 4FB7A 1HO4A 2JKAA 1EA0A 3L9CA 4LW7A 4NZFA 4A2SA 3BGJA 3C4UA 3FLUA 2NX9A 3QEZA 2JBMA 4DPQA 4K37A 2YZRA 1W0MA 3LTYA 1SPQA 3C2FA 1K02A 2ZRVA 1LRNA 3FKKA 1PIIA 4DBEA 3UWYA 3W1UA 3NQ7A 4LC6A 2EHHA 3C3NA 3A5FA 2ZZ1A 5TQLA 4UNKA 4KFNA 4MY9A 2W0UA 2J9YA 3DFTA 4GBUA 1I2RA 3CLMA 1C9DA 4AF0B 1H7RA 5G4WA 5DCDA 3C0JA 2YR1A 4O52A 3IGSA 4S1FA 3W1XA 3NQ8A 1FWTA 1F6PA 4ONVA 3S1XA 1W37A 3B04A 1SZGA 1BKSA 3ABQA 3W7NA 1YTDA 1OX5A 5BMXA 3HGJA 2ISWA 4BI5A 4JXCA 1L2UA 3W2KA 2P0OA 5CPOA 4O1DA 3W71A 1A53A 1SW7A 4M7TA 2B0MA 2QDHA 3W2JA 1KLYA 4LS1A 3W70A 4WXYA 3UY8A 4Z0SA 1JCNA 3F4WA 4QJ1A 4CCDA 4LVAA 4YXGA 1XI3A 2WQPA 3QSTA 3TW7A 3IGXA 4X2RA 4HHPA 5GVJA 1EB3A 2VEKA 3P84A 5HULA 3R5EA 3N9SA 1X7FA 3GDKA 4O54A 1SR9A 2BXVA 3JS3A 1S3HA 5CSRA 2XN0A 3LDVA 3NL3A 3LX9A 4NT0A 1GYNA 3BLIA 2Q3OA 2J27A 3MI6A 2F7FA 3LCWA 5FF2A 5C5YA 1ZHAA 3PS7A 3P60A 5K3VA 4IXXA 2G96A 1N55A 4FHAA 3G3MA 3LCHA 2ZRZA 4HNNA 3KHJA 2CZEA 2RHGA 1W5QA 5D2XA 5HUOA 1UJPA 3I68A 3QH2A 5I3FA 4K36A 1R2SA 2JGQA 2G5WA 3FYPA 2DZPA 4MY8A 1TV8A 4JYDA 3VKJA 2V82A 4A2RA 4QSHA 1D3HA 4MUZA 4UMCA 5FEWA 1LLZA 3O1NA 2QJIA 1VHCA 3VE9A 2JGYA 1LBMA 4M19A 5EBUA 3QPYA 3FOKA 2Q8LA 3W7IA 5I3GA 2J9ZA 2DZVA 5LNRA 2CLIA 4MZ1A 1F73A 1EP1A 3KVJA 3W7JA 1MEWA 4UTTA 1WA3A 3KFTA 1B9BA 4K39A 3PSVA 1ZY9A 2Y7DA 4BWLA 1LBLA 3NPXA 5DXYA 3G22A 4DPPA 3CTLA 3L5LA 1IIHA 3NOEA 4JTHA 3DU0A 2O7QA 2VFFA 1Z48A 2UV8G 2NXHA 4DF1A 4NJJA 4N9CA 4PL1A 2BX7A 2ZCGA 3W2MA 3HGSA 5D02A 3TUUA 3A9IA 1WOBA 3BGGA 2PRHA 3T55A 4AWUA 2YPIA 1GVRA 3M5XA 4HNUA 2QF7A 3ZWSA 5HWNA 4N2YA 1ZENA 4JYFA 3MYPA 4TMBA 1G69A 3IIOA 2XFWA 1H63A 1F05A 4ADSA 2VEMA 2B7NA 4I7UA 3HB9A 4IMCA 4K8EA 2J6XA 3MJYA 3QRHA 5KZDA 4Z1AA 3TXVA 3PUDA 4PODA 3W3OA 2ZFAA 5I3KA 4MIMA 4TR9A 2B7PA 4ZMGA 5KZMA 1Z42A 1Q45A 4UFIA 3MI2A 3W2LA 2E6DA 2C19A 4N4QA 3SIZA 1GG1A 4EIVA 3EWWA 4JTKA 1EP2A 3K30A 3W22A 4ADUA 4IGHA 4IMEA 2P10A 4FX6M 3NQFA 4LUJA 1JQVA 4A29A 2V81A 1DV7A 3SGUA 5DY2A 3LCIA 3Q2DA 1T96A 3BG9A 1BEUA 4OBTA 4O57A 3Q58A 5G2IA 4UTHA 1XBYA 4K6AA 3B0PA 3G24A 3M5YA 1BTMA 1DOSA 2QR6A 5HR7A 3PBWA 5C2XA 3VFLA 3LBCA 1NSJA 4LTSA 4WUIA 3RU6A 1K8XA 4UXDA 4Z0JA 1TPWA 3L68A 2NZLA 4R33A 3BW3A 1O5XA 3FFSA 4S2CA 1UB3A 3GZ3A 4UR7A 3KOFA 2C1HA 3W7EA 3EB2A 3JRKA 4RXGA 2R94A 3CWOX 4LOCA 3TNOA 4EOUA 1FWRA 3EX6A 3W83A 3PAJA 3GXTA 3WK3A 1K7FA 4PH6A 4NJHA 4DXVA 5D38A 1N8FA 4JDBA 3IEBA 3NZRA 2J9XA 3LHZA 2H3DA 4C1LA 3GK0A 5IBXC 3W2UA 5HNRA 4DQWA 2E5BA 4UCGA 5CZ0A 4NX5A 3UXAA 3SI9A 1H7PA 4TMCA 1OF6A 3S0CA 3OBKA 4ZQRA 5EPDA 3W72A 2AQWA 1FWSA 1YDVA 4DF0A 3NR0A 2ATMA 4IJBA 1OX4A 4MPQA 1TQXA 1A5CA 1QOQA 2YW3A 1OFBA 4NQ1A 4LVDA 1H50A 3LHUA 2DJLA 3TSMA 3EKLA 4GRSA 5LNUA 2B7QA 5D05A 1W31A 1A5AA 4UFLA 3RFAA 3W7MA 4GUFA 1HFBA 2JK2A 4R53A 4Q32A 2WSYA 2QCNA 4IPIA 3W1MA 1KTBA 2A6LA 5AOUA 3S8HA 5F4XA 1TPC1 1I45A 3PC0A 2ZZ5A 3KVKA 1GWJA 3LLDA 2QCDB 4ZQPA 1X1ZA 2Z6JA 5BMWA 4YCPA 5FESA 3V1PA 4JX6A 3TJLA 1LOQA 2D73A 1K8ZA 3O6CA 3WK1A 1JQXA 3F1QA 5LHFA 4N6EA 4O0ZA 3LHYA 4XBSA 1MEIA 1YYAA 1SZNA 1XL9A 3TAOA 1TREA 1Z41A 4JEQA 4BWLC 4FO4A 3KAOA 3H55A 3T40A 4LRSA 1SFLA 1PL9A 4GFSA 3RMJA 2ZA2A 4FF7A 3LI0A 1PE1A 1QO5A 3N14A 3HF3A 3HGOA 4B5NA 3Q94A 4ALDA 3TV8A 1A5SA 5AB3A 2PE4A 1ZJIA 3PB2A 3M43A 3THAA 5K2ZA 4ZZ9A 3VE7A 1TTIA 3G8RA 2CLHA 4JIPA 5A5WA 3RLUA 2NLIA 1KM6A 1I2NA 2NV1A 1YADA 3Q37A 4KWVA 3TU9A 1VPXA 3PUOA 3GR7A 5K4ZA 2W79A 1QDSA 1U83A 3G18A 1PV8A 2FB2A 5D32A 4IXHA 2RDUA 1Z44A 2EKCA 3CU2A 4FIRA 3O6DA 1R30A 1SW0A 4HN4A 5T26A 2GQAA 1QPOA 3L2IA 4EWND 1W1ZA 4N9EA 1JR1A 3QYQA 3M9YA 5HWJA 4FX8A 5TBOA 4NJKA 4Y90A 4LUIA 1SO6A 4GUIA 1GEQA 2YYUA 1UBSA 1JUBA 1C29A 5FF4A 1XFBA 4LVGA 3STEA 3HPZA 4MJMA 4HNTA 1ME9A 1EEPA 3BG5A 1EIXA 3BW4A 1GQNA 2H8XA 3HGRA 1SW3A 1LRQA 3PSWA 3L0KA 3LERA 4NVTA 5KSWA 4LVFA 2V9DA 1AW1A 1G4TA 3O06A 3QFEA 4MKNA 2Y62A 3N34A 1WDWA 5AC7A 3IIZA 2HS6A 5FF0A 3WFAA 5AYZA 4GJ1A 3ELFA 1OYBA 2Y70A 1QPQA 3NGJA 2DJXA 2NXGA 3P80A 1TCDA 1KM2A 4O15A 2A7PA 1R47A 4HSNA 1WAUA 1LCOA 2E1DA 1VH7A 1NEYA 1V7YA 3QQ0A 2E5DA 4ADTA 1VYRA 3MBDA 4ICNA 3VNDA 4MZYA 1TSIA 1PHWA 3DAQA 5H91A 4QQ3A 2TRSA 3DI0A 5CG7A 3B06A 5D33A 4LNYA 2BWGA 1WBHA 3L0NA 3N9RA 5L9FA 1JCJA 3G1YA 2AAMA 3I7QA 2ZZ4A 2NV2A 3UWQA 4CNNA 3A24A 5LZLA 2X16A 1XDMA 3W6YA 3MHFA 2FPVA 1FWWA 3GXNA 4IMFA 3PY2A 4QISA 5G4EA 4DELA 5F2GA 5AN7A 3IVSA 1O94A 2DZUA 3MYOA 1JVNA 1T0OA 3E0IA 3KX6A 1WQ5A 4E2BA 4YMZA 4UTJA 2X1RA 4JY9A 2QUVA 4D2JA 2DORA 2J24A 3MP3A 4O13A 3TSDA 4N9DA 1VCGA 4NZJA 3LI1A 3L67A 3HG2A 1PVNA 4JTUA 5EL1A 3W7CA 1LROA 3W07A 3JR2A 3P8IA 4JGDA 4Z1CA 1GTHA 3G1AA 3G0UA 1OYCA 1XBXA 2CLOA 3TROA 3PM6A 1FX6A 3H53A 3RNDA 5HINA 3EXTA 3W1NA 3QZEA 4Z08A 2BLEA 2OCZA 4LU0A 3L21A 3MW7A 3DHFA 2YXGA 5BNKA 3GAKA 1EWDA 1LLWA 4QIUA 4WX2A 2RKXA 2ZRXA 4E0CA 1W56A 3BLFA 1H1ZA 4O0KA 1W5NA 1R46A 3DENA 2ZA1A 2G95A 3HQ1A 3GDMA 3L66A 1LTDA 3NQAA 5K4XA 3DFPA 1GG0A 3PF3A 3A21A 1B4EA 3NQ2A 1JRCA 1YPFA 1DVJA 1RPXA 1YXDA 2A0NA 2X1TA 3HPXA 4MLRA 4ZQCA 2H8ZA 3OG3A 3G0SA 5LHEA 3WJZA 5DLCA 4IPJA 4ML9A 3G1FA 2ZZ3A 5KZEA 2CZDA 3LCFA 3O16A 2Y6ZA 3CPRA 4ZVJA 5F2IA 2PC4A 1RQEA 4AMAA 1W8SA 1ICQA 2E68A 1DKWA 2C13A 1YPIA 4MOZA 3M1ZA 1XCFA 5TIMA 4RV8A 4MFDA 2NX1A 3W2NA 2ZQ0A 3NPVA 5CZSA 2C18A 3S42A 2GJLA 5CPMA 4FNQA 3W9ZA 4TIMA 3R12A 1UCWA 4XWUA 4TU1A 3C52A 4LWWA 1YXYA 2E09A 3NZ1A 1XXXA 4UTMA 8TIMA 4R34A 3DZ1A 4HPXA 3UXDA 4XKYA 1UUOA 2VFGA 1XDLA 3BVJA 5D2VA 5CKSA 5U7SA 4NJIA 1VGAA 3RLVA 4IQLA 4MY1A 3WJYA 3BARA 2PRLA 4RKAA 1CX9A 3LB0A 4AEOA 3FA5A 4Q33A 4WOZA 3ABSA 4OT7A 4TX9A 3DH7A 4UFMA 1ADOA 1EPXA 3P61A 1KFEA 5ABTA 4FX7A 3P67A 3BPWA 2QCEA 1WX0A 5AHNA 4FXSA 1VRDA 1OFEA 1I8JA 3S6DA 4JIQA 1NAL1 2V2HA 4K7VA 4ORMA 2OMAA 1M5WA 3E96A 3P5YA 5L6UA 1Q6QA 3PUEA 3GKFA 1THFD 3TIMA 2HTMA 1KW1A 4J9JA 3B8DA 4YL2A 3UYCA 2C3ZA 3EWXA 2YSWA 3UNDA 3MMTA 3FKRA 4UMBA 1NF0A 5U4NA 3HG4A 6TIMA 2Y61A 5G2WA 3PULA 1T8XA 5D37A 3GDTA 2NWSA 4U4MA 7TIMA 1GTEA 2I14A 5J5RA 5CZJA 2X2GA 3GIYA 1P5BA 3W7DA 3STCA 1BWKA 1OVDA 3EXSA 1EX5A 1O4UA 2IQTA 1SUXA 1ZNNA 3SY5A 2YCEA 2A7NA 1TJRA 1SO3A 5AHFA 2HS8A 1I2QA 2OZ0A 1SZFA 3T7VA 5D30A 4X22A 3LCLA 1TPH1 3C6CA 1RD5A 1X8FA 3H54A 4MYAA 2H3BA 1V5XA 3L65A 5AHEA 1OX4B 3C2OA 1F2JA 5SWUA 2FFCA 3F4NA 5DY3A 1KM3A 4GWEA 4UFJA 5I3HA 1IXNA 3S9YA 2PCQA 4JTFA 2GPTA 4JTEA 1G6CA 5EY5A 1JRBA 5DCEA 3EX3A 3S5ZA 2VFEA 1FQ0A 4FNSA 3CT7A 4O18A 5KMYA 3GNNA 1H7OA 1XM3A 3PG9A 3QW4B 3UWVA 2Z1BA 1YDNA 2F84A 2GVLA 3TK7A 1K8YA 2FTPA 2WV8A 4EF8A 1JCLA 3D0CA 5F2LA 1B57A 1OFQA 3NM1A 1OJXA 3OEXA 1G4SA 3S5OA 4HKPA 3DFOA 4HNVA 3PG8A 3N3MA 4RCXA 4AHQA 3LBMA 2NUYA 1VS1A 5DBUA 2TMDA 4A22A 1KA9F 2B4GA 4RZ5A 2A6NA 3L5MA 5AYXA 4GNJA 2DZTA 3W7KA 2J88A 4GUGA 3V75A 4A21A 3W1LA 4FNUA 3NPUA 1FCUA 3TX9A 4ZQMA 4OWGA 5HMSA 2QCMA 2Y89A 3W7QA 4GUHA 4WQ6A 1KFKA 1MEHA 4Q4KA 4M6PA 3LRLA 1W5MA 2YYTA 1ZFJA 4WY0A 1VLIA 2Z6IA 1FDZA 1DL3A 5AC6A 4Y96A 5FF3A 1VYPX 1XBVA 4AAJA 3O05A 3TH6A 2VELA 1QPRA 2PURA 1PHQA 3TKFA 1B3OA 1KFCA 4CNPA 5E1QA 3G8EA 4I9AA 1ONRA 1GT8A 3AO0A 5DCBA 3G0XA 3NQGA 1TB3A 3IIVA 4JICA 3C2VA 1KM4A 4C1KA 5CPLA 3MP4A 2QEZA 3KVLA 2CWNA 1RVGA 3BG3A 3NPWA 3LXAA 3QSRA 2I1OA 1H51A 2QUUA 2P1FA 6ALDA 1JCMP 3VI2A 1M7OA 1FDJA 1TRDA 4JYEA 3TR2A 1LORA 3OA3A 1OK6A 5FEXA 2YX0A 2PRMA 1F5ZA 2O7SA
chains in the Genus database with same CATH superfamily
3LG3A 3ZJ6A 2Y88A 4DI8A 1HGYA 2Y4SA 1TRIA 4R5EA 4GK8A 4CLMA 2VR5A 2C0AA 3DKLA 5IOBA 1CIUA 3GXMA 1VLWA 1AQHA 3GU2A 4DF2A 5HBFA 4UTTC 3T0DA 5LSMA 4CCCA 1K9EA 4QLKA 2RFGA 2QPSA 1TWDA 2ZBTA 4A4AA 4UQAA 2QDEA 4Z2JA 1MUWA 3GDRA 3WNNA 1RSCA 3SRFA 3BZGA 4ORIA 3MUAA 5HQEA 1IT7A 4C1NA 3M7WA 4C6PA 3TTSA 1ML1A 3PBUA 4HK7A 3TW9A 2FHBA 5XIMA 5AVHA 3F5KA 5CXPA 1ZALA 2Z1VA 2XDFA 2C16A 3G77A 3H4GA 4O14A 4K68A 3CV1A 2C7FA 3QM3A 4PEKA 2YDSA 2ISVA 3TXZA 4AUBA 4EE9A 1JPIA 1XH0A 3H2CA 3R8HA 4NL1A 3HG5A 3IJIA 1L8PA 2YB4A 2VEIA 3EA3A 5FEPA 4K7YA 4REQB 4DJDA 4RZBA 4V28A 4DNMA 4HNLA 4LEFA 4LB3A 3EAUA 3QJAA 4OVXA 2E3ZA 2FGLA 2WPBA 3ITOA 3KVMA 3UXIA 2A3AA 1X6LA 2V8ZA 2Y63A 3LTSA 2I9EA 1V08A 2W67A 2Z1KA 4GPNA 3QMTA 1EXBA 3IJ8A 4N4PA 5IRPA 1R0MA 1TPDA 2DZXA 4HZ7A 4H8NA 2C15A 1YRRA 3VINA 5DMNA 1TIMA 4Y9OA 2GJNA 2OKOA 2V2DA 1GJPA 1AW5A 1Q6GA 2GQ8A 3I7SA 4Z1BA 3UY7A 1HKKA 1XGEA 2XGIA 2WM0A 1UP0A 2PDLA 3BV7A 1QNOA 4HNOA 5REQA 2IMRA 3LRMA 4WZHA 2Q02A 3MP5A 4WJ8A 1PB0A 3U2CA 3B40A 1LZOA 4XIAA 4GOAA 2KX9A 2VRJA 3ES8A 3V0TA 5LGXA 3QR0A 4HBKA 4LF1A 3EEGA 1B54A 2GJPA 1Y65A 4WDWA 2XFRA 2QVHA 3NO1A 3MCNA 1KR0A 4MFEA 2E5CA 4PYSA 3TQKA 4QCEA 1PXGA 1V93A 2PDGA 4LQ1A 1VR6A 3SDOA 1OGSA 3NTYA 1UD8A 3CMGA 3M0KA 2B31A 2FDSA 3MUXA 3DFQA 1TJ2A 4MTVA 1WDPA 4RZ4A 3OHIA 3WDHA 1AJZA 2YBVA 2Q01A 4O53A 2V3EA 3GDLA 1NWTA 1G4EA 3U2OA 5G2HA 3QHMA 3II1A 4B9ZA 4QTGA 4LAMA 3M5VA 4DO4A 2CBVA 3V4BA 1I2OA 3A9BA 4E8GA 1AQMA 1EL3A 4G1KA 4GXWA 2CLEA 3CMJA 4RNIA 3WQ4A 5LGZA 5FOOA 1SM9A 4KEVA 7ODCA 1V03A 4RXFA 1DORA 4UMAA 1Q2SA 4HYRA 2INZA 4IQEA 1IWAA 3AS0A 3DYOA 1K1DA 2VFIA 2FHFA 4IICA 2F6KA 1S5WA 2DH3A 3GTNA 2Z29A 3VIIA 3WLOA 4M56A 4U3AA 2SFPA 1JFHA 4DBDA 3R79A 1CB2A 1U5JA 2DVUA 4JX4A 2V5JA 2I7GA 1RR2A 1M41A 1O60A 1K3UA 1W8GA 4IQJA 2VD8A 1IXOA 3C0SA 2X05A 2DW6A 2NX3A 3CPUA 4RNJA 3M64A 5C55A 3LHWA 2J8TA 2XGBA 2QGYA 3LHVA 1ME8A 2Z28A 4ROPA 4HCDA 1ISYA 1B9ZA 3A22A 4XB3A 4XAPA 1D7FA 4BQ2A 3B4YA 4F9DA 4E38A 2WZHA 3VIOA 2ESCA 3RGTA 1EF2A 1GZGA 1WBJA 4LUSA 2PTXA 3W87A 4IISA 2RH9A 1FWEC 3O8AA 5CPQA 4B5VA 2PDWA 1EUNA 4IQDA 4TX6A 5B80A 2CBJA 5CC6A 1HKVA 4RLIA 1MZRA 1L6GA 1UG6A 1JYVA 2CITA 3B03A 1DJXA 3CAQA 3K4AA 1FCBA 3CH0A 3S4TA 4GYKA 5IBXA 2OT0A 3W00A 5M03A 2AAAA 3AJXA 4Y9AA 1RQHA 3C61A 3S1VA 2E28A 3IAQA 4D72A 5CPTA 2VCBA 2VOTA 3STGA 5I02A 1DQXA 3Q45A 1L2QA 2B7OA 3SN1A 3CL6A 1W1VA 3RRAA 3RCYA 4D1JA 3HBLA 2O56A 1UWRA 3OVQA 3NQBA 5KINA 4GVIA 5LA1A 2OPJA 3S2JA 4AXKA 1OFRA 3BMXA 3CHVA 4PUNA 1S1RA 1S5VA 3A5VA 2F6XA 3BOFA 3LM3A 4LPCA 3K8LA 4IIGA 3NO3A 5DBTA 4KFPA 3WELA 4BR1A 1IZCA 4FS9A 3W88A 1QCWA 5HNUA 1JYNA 5MKGB 4LC8A 3PBYA 3CB3A 2Z0IA 1PDYA 3KDOA 1NWUA 4HTYA 3B4UA 1TKKA 5I03A 4OU1A 1NOUA 3FA4A 2WCGA 3KW3A 5A8GA 3I6RA 1AL8A 1O12A 1K9TA 4AZGA 1QAPA 2OVLA 1J0ZA 1QNRA 1ZAHA 1HVXA 2BY3A 2XGZA 4FI4A 3M0YA 4AVFA 2ISDA 3MO7A 2A4AA 2VOMA 3PJWA 2PDMA 3EPMA 2NSXA 1SR0A 1LBFA 3MV11 1BVWA 1P0BA 2QUTA 3RR1A 3B0XA 2C0HA 3TP4A 3JU2A 4C7GA 1AW2A 5DN1A 5LXXA 4FOJA 3H6OA 1M6JA 1S5TA 3HTWA 5EBAA 3SUVA 3P62A 1Z32X 5CAHA 3NSNA 3ARQA 2V5LA 1Q6OA 1TV5A 2A21A 1UIPA 4XUYA 3STFA 3GNPA 5CLWA 2XH4A 4WEVX 5F4WA 1V3IA 4PC8A 4N02A 3FEMA 2YJQA 4H6RA 4RNFA 5BYWA 3CLWA 3E2QA 5FEZA 3AMDA 1ONWA 5E0FA 4LV4A 3RHGA 5FF7A 3LLXA 3PPGA 1EYEA 5D2WA 4M8UA 4XVDA 5ABHA 3TFCA 4DLMA 4I8YA 4GE8A 4U31A 2VC7A 1ONEA 1E0WA 2GQ9A 4W5ZA 1U5VA 2PEVA 1OT1A 1JDCA 3BSGA 3OODA 1B31A 3KZPA 1WKYA 3COTA 2P88A 2A7RA 4CNSA 3T9PA 2OJPA 4WKAA 1GORA 4Q4RA 2E8ZA 2W6RA 3C8FA 1G4PA 5ECUA 1D2KA 4XZMX 2ZRUA 3SZ8A 1NELA 3R0DA 3OHMB 4H9ZA 2RJHA 3OZMA 3GX9A 3KS6A 4XQ6A 3V35A 4HYVA 1ICPA 3QPZA 3LS9A 3PZNA 4ZO8A 3EDDA 1V0MA 1CTNA 3VK5A 4EP8C 3H4WA 2VVSA 4AISA 4NI3A 3G3DA 4XZIA 3SQLA 1I1WA 5M17A 1LG2A 3UWUA 3GXIA 2YFOA 4S23A 1DQWA 2V38A 1L6WA 1QI4A 1ITQA 3QMSA 1JZ6A 1XUZA 4Y7EA 2TPSA 2QJGA 4UTKA 4UCFA 4A3YA 3UQNA 1AQFA 1E4NA 1EKOA 2VGFA 1YXCA 2TAAA 4QS6A 1IT8A 1E51A 3NL6A 4ZO7A 1R9XA 5HOSA 3CIVA 1YHTA 4U2YA 1WOAA 2A5HA 2NLYA 3PVFA 3VCNA 5A6LA 5D2TA 2HRWA 4FAMA 3SUSA 2CXGA 3VILA 4UNLA 4Z17A 2WPGA 3WDIA 2WMIA 1XICA 3M7SA 2D22A 3DC8A 1I9CB 3PZQA 3GR8A 3TOPA 3N15A 4LRTA 1FTXA 2HCVA 4L64A 5CBJA 1UA7A 3R8GA 2AOSA 3W7OA 5BOOA 4DYEA 3S6OA 5EYWA 3GUGA 4UUIA 4LBSA 3FSTA 3V1HA 3SSJA 2WJEA 2ZZ7A 4Q4SA 2YDRA 2I17A 4X0VA 3SM0A 1DJQA 3H2AA 5E6ZA 3MSDA 4J35A 3WLRA 4AZBA 2CZFA 1VJIA 4OFCA 4UZUA 2OOFA 3KBWA 2Y8VA 4JTTA 3HOJA 3M47A 2OZ8A 1OIMA 1HUVA 1XHGA 4IFKA 2BP1A 4IX2A 1OZQA 5KITA 3NL2A 3FN9A 1V6YA 1VFMA 1W54A 1UWIA 2FIQA 3S5NA 2QJNA 1A5MC 1W1YA 4O16A 1JCXA 1GQJA 4HPNA 5HANA 3WNLA 4EPKA 2EBNA 2YXOA 3HQOA 3MHUA 3VMOA 1QBBA 4ICMA 5TF0A 3MI3A 1DJZA 4UQBA 2RGLA 3SIMA 3ATYA 3G1DA 4IMGA 1RALA 3AXIA 5BROA 1EF3A 2Q6ZA 3DFNA 1Z3NA 3QR1A 2R8WA 1P48A 5E09A 2BSLA 1RK6A 2FGBA 4ZFMA 3VO0A 5HAOA 2Z27A 4KRUA 4WSJA 5AFDA 2BHUA 4L4LA 4DJDD 3T4CA 3FJ4A 4H9XA 2D2HA 3QMRA 5LNVA 1V3HA 2O9TA 3NL5A 2A2IA 4PUEA 4JQ1A 4M6QA 4BZYA 4AZCB 3E12A 2ZZ6A 1XLIA 1FRBA 4ERIA 1FWGC 1HTIA 2VVNA 4HIBA 2PF0A 2AQOA 3TA6A 1ITXA 2Z2AA 3RXZA 3WQEA 3FCPA 3PB0A 3TQPA 4S2BA 4AZ5A 2C8NA 4QDWA 1K6WA 3C4UA 3VDBA 2Z00A 2E9BA 3PHAA 4V27A 1CCWB 2CESA 1TG7A 1PTDA 1F8MA 1TX0A 1QTWA 5D9NA 3NQ7A 4ZO6A 3VIFA 3A5FA 1ZZMA 4GIYA 1NOFA 2W0UA 2J9YA 3JVAA 3DFTA 1I2RA 1QNQA 4A8RA 4H7VA 4S1FA 3W1XA 3H2OA 4DUOA 1FWTA 3BJSA 1UR3M 1W37A 3B04A 1SZGA 3UVIA 1FWJC 1H5VA 1U30A 3RM9A 4H9TA 1GQKA 1QBAA 5BMXA 1DIEA 1MFUA 4PBGA 3L4UA 4QG9A 4RUBA 1HP4A 3H2EA 2B0MA 3B8TA 3W70A 1DJHA 3UY8A 4Z0SA 3F4WA 4HB7A 4LVAA 1DXFA 3KTCA 3FHAA 2NQLA 2DT1A 2VEKA 3P84A 3R5EA 3AIQA 1SR9A 4HGXA 4S3FA 2BXVA 2BVWA 4EACA 2ACUA 5BXRA 1YE4A 4DNHA 3LDVA 4NT0A 1ADDA 4L6HA 4PRTA 3BLIA 5A8OA 1R3RA 1JG9A 1KXQA 3OIHA 3CL8A 1ZHAA 3PS7A 3TWBA 2G96A 2VUYA 3LCHA 9XIMA 3LUTA 4E3TA 4HNNA 5C7HA 2NSOA 5HUOA 3IANA 4K36A 1R2SA 3WL1A 1EQCA 1DWHM 3WLQA 5J8LA 4JYDA 1EJSC 4A2RA 4NAEA 4UMCA 3WDQA 4DY1A 3O1NA 1JPDX 1LBMA 3MSRA 2OFJA 1EX1A 1ZCCA 3QKZA 2DZVA 3UPMA 2GLKA 3B8UA 3ZT5A 1HKMA 2QUNA 5BCAA 5A2CA 1EP1A 2C91A 4W89A 3DERA 1WA3A 4D9PA 3H7UA 1SGJA 5BWFA 2ZX7A 2W5FA 1LBLA 4HHLA 3OBAA 5DXYA 3UJ2A 3RX3A 4LYPA 3AFBA 3RX4A 3RLGA 2FHCA 4JTHA 3KOWA 2UV8G 4DF1A 4MWAE 3W2MA 4GQRA 1V7AA 2NQHA 3SQMA 4AWUA 1C92A 3DG6A 5LA0A 4IT1A 4N2YA 4DM2A 1ZENA 1UR8A 1G69A 3LGGA 1GJUA 5GNZA 2HROA 4A3RA 1F05A 4ADSA 4I7UA 5FJOA 4Q8TA 5LA2A 3IUDA 2HEJA 3QRHA 5KZDA 4PODA 4D8ZA 2OEJA 4TR9A 2VZTA 3VGHA 3SY1A 4UFIA 3EOUA 1H41A 4KS0A 3SIZA 3P14A 2PDBA 4FP1A 4HK6A 5DEZA 2VZOA 3W22A 3D3FA 4TXEA 3KLLA 4DI9A 5CSYA 4LUJA 1JZ8A 2V81A 1DV7A 1H49A 1TWSA 1OSEA 3GIPA 1W9UA 4I5UA 3Q58A 1H09A 2NVDA 3ZYZA 4K6AA 3B0PA 2G4JA 3WF2A 3RPDA 1DOSA 3UW6A 3E0FA 2X8RA 3IRSA 3HU7A 1NSJA 3DYPA 4WUIA 4ZE5A 3H7VA 2RGMA 3PWIA 4Z0JA 3L68A 4CNTA 1EDTA 3FFSA 4D6CA 1EIBA 3GZ3A 4DUVA 2C1HA 3EB2A 1HL9A 4Q8MA 2XZ9A 3GNXA 1JNEA 4LOCA 4NG3A 3ZVHA 1KB3A 3W83A 3H4XA 3GXTA 1H1NA 3WK3A 1U1UA 3MMWA 1K7FA 2ZVIA 4PH6A 3ALGA 4NJHA 4KRZA 3OZOA 4UQDA 3GBEA 1KWGA 4XZNX 4CEUC 4AD4A 2J9XA 4PRWA 3AICA 2QW5A 3E3HA 2WKGA 1XSJA 4X60A 3ARUA 3CZKA 2JEPA 2WC4A 1E9ZB 3SI9A 3AS3A 1OF6A 4HPHA 3OBKA 2YL5A 4JHOA 4UBPC 2EKGA 2DUAA 4QFUA 1VENA 4JFWA 4NQ1A 3TSMA 3TWAA 4INFA 5D05A 3ZQ9A 3RCMA 4UFLA 4GUFA 4Q32A 3TJIA 6PTDA 2ACQA 5F4XA 4DHGA 3PC0A 2ZZ5A 1V77A 4ZQPA 1X1ZA 4YCPA 1MUMA 4B9YA 1U22A 4JX6A 3O6CA 3F1QA 1YW1A 4XVEA 3UF9A 4W5UA 4N6EA 3SCSA 4XBSA 3TAOA 3MQTA 4JEQA 2D2GA 3T40A 1V0NA 2WVVA 5EFDA 2X2YA 1E9IA 1LWIA 4DUWA 1S2WA 2Y5SA 3LI0A 1AZ1A 3HF3A 4EPEC 3IJLA 4JAWA 1E72M 1B3VA 3TV8A 1QI0A 1ZJIA 2PB1A 3THAA 4ZZ9A 5JIWA 1TTIA 2E9MA 3G8RA 1XYBA 1CGXA 3AWOA 1I2NA 2NV1A 1VBGA 4H7ZA 3GG1A 4XO6A 1YE6A 2W79A 4RDZA 3G18A 1PV8A 4NZ4A 3B97A 1NIUA 2XM1A 2EJ1A 4FIRA 4EPDC 1SW0A 5T26A 4YVVA 3AUOA 4PULA 4LYQA 5FKYA 1L8NA 3PTKA 1F4HA 1AA1B 3XIMA 3AXKA 2X42A 5HWJA 2J7BA 3C86A 3U48A 2YYUA 3QXBA 1UBSA 1C29A 4JTDA 4LVGA 8RUCA 1JXKA 3PZ9A 2YLLA 1UOKA 2VZUA 3BW4A 1GQNA 4AD1A 1V02E 2CBIA 4O1FA 4HOXA 1SW3A 2QMJA 3PSWA 3L0KA 2Z1SA 4XZHA 2JFEX 4NVTA 3AHVA 5KSWA 4IG2A 3C8NA 1AW1A 1G4TA 3QFEA 3TCSA 5G4HC 1V0LA 3AZTA 1JF5A 5ABEA 3ELFA 4J28A 2Y70A 1CGUA 2NXGA 3P80A 4HU8A 2WZEA 2E1DA 4G7FA 2E5DA 3MBDA 1FHDA 4MZYA 4WDXA 4IUGA 1PHWA 1BYBA 1RP8A 5CG7A 3AXHA 4ZGYA 3ZSTA 5HDRA 3N9RA 3GTIA 2CNCA 1ZRQA 3IJ6A 5L9FA 2AAMA 3I7QA 2ZZ4A 1UKSA 3ITLA 3K4DA 4CNNA 1WXZA 4ECLA 1JGMA 1UW9A 2J4GA 2OB3A 5B7ZA 3QBUA 3NZQA 3W53A 1NDYA 3BGAA 4GZEA 1UP3A 5G4EA 5F2GA 4DXKA 3WH5A 2WZTA 3MYOA 1T0OA 3VX1A 1WQ5A 2QUVA 4D2JA 2VCCA 5FJTA 4M3PA 4MNKA 4MDOA 3GW3A 3MZ2A 1DPMA 3VOGA 1PVNA 1UR4A 4L65A 3W7CA 3T2OA 1LROA 1HKWA 4ATDA 2UY5A 4E2VA 2DV0A 3PM6A 3LN3A 1NDWA 5HINA 2PDFA 3QZEA 4FSAA 3S2CA 3N3TA 3DHFA 3SN4A 5BWAA 3GAKA 1AVAA 1QPKA 1VEOA 2PGRA 4QIUA 4HN8A 4WRHA 4WX2A 2RKXA 5JBFA 4GI9A 1W56A 1I0DA 1EGVA 3OQ8A 1R5YA 4TQTA 2ZA1A 1XD0A 4S3BA 3NQAA 1LTDA 5K4XA 4OTKA 1B4EA 1DIOA 2VZVA 3VNMA 5HMFA 2XSAA 4B15A 1Q65A 1DVJA 1K8CA 3GFYA 4AEEA 3G0SA 2PWEA 4IPJA 3W6MA 1TMLA 5KZEA 1J12A 3O16A 2Y6ZA 4ZVJA 1TV2A 3T08A 3VGDA 3F2CA 4AMAA 1ICQA 3L12A 3M0LA 3C5QA 3M1ZA 5TIMA 4RV8A 4HU0A 1A5KC 5AYIA 4JN7A 5TNVA 2Z2BA 1XSIA 2GJLA 3HJEA 1V3JA 4TIMA 3R12A 3VVGA 1H0IA 4GZ7A 1H2JA 4LWWA 2E09A 5J04A 3GZAA 8TIMA 1XIIA 4JPGA 4Y2WA 4HPXA 3WQFA 1DE5A 4CD7A 3UXDA 2INEA 5DMYA 5AVNA 2AL2A 4GLEA 5E5CA 4DZHA 3M0IA 4B3KA 1XDLA 5CKSA 1XS2A 1REQB 4IQLA 2BOFX 3K2GA 1GVEA 4MNLA 3ABSA 4G2DA 4TX9A 4JNYA 3RJXA 1B5TA 4DZAA 1UZ1A 1UKTA 1ZSXA 3TN3A 4GIRA 5AHNA 4FXSA 1VRDA 3OQEA 4BCEA 2PA6A 2DEPA 4JIQA 1NAL1 2OMAA 3E96A 3P5YA 1Q6QA 4ZSUA 1THFD 1A4MA 3BLDA 1KW1A 1UIOA 3BAIA 2HQAA 1RD6A 3I4KA 2DZBA 1XRTA 5A6MA 2IW0A 2C3ZA 5DANA 2BFGA 3CUFA 3AS2A 3MMTA 4UMBA 1NF0A 2R1LA 3HG4A 6TIMA 4RL3A 3PNUA 4IP4A 1XYAA 2NWSA 3SO7A 4PB3A 3OW1A 1W9BM 3CUIA 2IQ0A 3I3BA 3STCA 1DIDA 2CZVA 3AYSA 3SY5A 2F2KA 4MDPA 2WQDA 5EFFA 3RO8A 3E74A 1XCXA 1HKJA 1QRQA 3BCJA 1OX4B 3C2OA 4XSLA 1FH9A 5DY3A 3H22A 1NU5A 1M68A 2FMOA 1MVYA 1IXNA 2QZRA 3S9YA 4P7LA 2PCQA 1BXBA 3Q4DA 1HIZA 1RCQA 1V0KA 3CHCA 4Q3MA 1J0IA 4FNSA 4C6OA 5KMYA 3VKBA 4IIFA 4KQNA 2XJ7A 4H2CA 2WSPA 1XP3A 2ZE0A 2GVLA 1K8YA 3LPFA 2WV8A 3URNA 2QDDA 2BODX 3PPFA 3T05A 3D0CA 1S2VA 1G4SA 4I5XA 3NZPA 4FA3A 5AYBA 4S3EA 4RCXA 3LBMA 2FVKA 1VS1A 2TMDA 2ZUMA 3DYMA 1TR9A 3SJNA 3V3WA 4LAUA 4ZCWA 3WX7A 4FOUA 3RO6A 4A21A 1TWZA 1E1CB 1GOKA 2O92A 4TX8A 3W1LA 1FCUA 4JKKA 2J6VA 5HMSA 2QCMA 2BGQA 2Y89A 4GUHA 5H8MA 4WQ6A 4LBUA 1MEHA 3Q65A 4BA0A 4QDPA 4D6FA 2QYGA 2J77A 3LRLA 2YYTA 4B5SA 4Y96A 4ZB0A 5FF3A 2AMGA 2PURA 1PHQA 4KH2A 5E1QA 1X6NA 3W24A 1VP5A 1GT8A 1EZ2A 3NQGA 4GZJA 4C1KA 5CPLA 3RU8X 1KD0A 1IQ8A 3BG3A 2VC9A 3LXAA 1MQQA 1BG9A 2I1OA 1EJRC 3EWDA 1H51A 4IM4A 2QUUA 2GGGA 3PTQA 3U4FA 1SVDA 3OA3A 2YX0A 1F5ZA 4GIEA 2OLAA 1EJXC 1BGGA 1SYTA 4J5NA 3DXIA 4PMZA 3QTPA 3W7RA 2XFYA 2QJMA 1UOZA 5I78A 4O12A 2P50A 2BY1A 5I3IA 3GHTA 3VD7A 3B0UX 4B16A 1V51A 1XLDA 2E40A 1FH8A 4JTSA 4AWSA 1VFUA 3SY8A 1JNDA 5A94A 3WQ8A 2HK1A 2WO5A 3PZVA 3A3XA 5AYYA 1CW2A 4CQCA 3B9OA 3W74A 1WCGA 5A6AA 4BFAA 3CZGA 4D6EA 1ITUA 4Y9NA 5F1UA 4ICCX 1NDVA 3TR9A 3U5UA 2LLEA 5EMUA 3QVQA 2G8ZA 2AGKA 3M0VA 3E49A 4Z2IA 2GK1B 1IWPA 3L0GA 3FSUA 4HA3A 1TJPA 1HXJA 1EUAA 3WQDA 2GGEA 4QM1A 4GX8A 1UPMB 4NZCA 1JYXA 3DOPA 1CLXA 1Q8JA 2ZA3A 2QF8A 1Y0EA 5M2FX 3BLEA 5K9CA 4AU0A 4RZ6A 3P81A 1T41A 2CLLA 1BQCA 3GUWA 4AYSA 4IFRA 3AZRA 4NUWA 4Y8FA 1P0KA 5D03A 3ABRA 3N4AA 3TVAA 1QNVA 4J7RA 5FI8A 2YDQA 4BY3A 5D9MA 3AUJA 3S1GA 3BOLA 3KRSA 1NFBA 1IZKA 3VIKA 1XLGA 4DJEA 3USBA 4P7RA 3B8IA 1R86A 1Q6CA 1YLVA 1Q8AA 3N2OA 1GPWA 2VFDA 1QWGA 1ZJBA 3UJEA 5D09A 3IV3A 1V6WA 2QULA 4PRRA 4LX4A 2C1GA 3UWZA 4GC3A 5CJ5A 4DM1A 4HA4A 4QEEA 4TTUA 4CQDA 3WCZA 1MFVA 4MVAA 5CEWA 8A3HA 2PLKA 4GABA 4MWAB 4W86A 2G4FA 3PP7A 4Y9MA 2EQDA 3BCFA 3F03K 2EO7A 5CC5A 1W5PA 3CT2A 2PLJA 2XN2A 4UR9A 5F2MA 2YL6A 1Q85A 3HJZA 5J5DA 4ZOEA 1OM0A 2BVYA 3VNZA 3CUHA 3WFZA 3JUGA 1PKMA 1Z6KA 1VFTA 4G9PA 2CLKA 1Q4WA 2CKRA 3LPGA 1FCQA 1IGSA 1OX6A 3RIKA 2DSZA 4JQ2A 1SO4A 5CSUA 3M6YA 3ZR4A 1RA0A 4NRRA 1ZLPA 3ONBA 1QK0A 2WBGA 3W25A 3L4WA 1H5YA 2EJAA 4GQQA 3E0WA 2FPYA 1KFBA 4XKYB 1CYGA 1UASA 5AC5A 3QN3A 2VYOA 3ANUA 4J3SA 3OVPA 4KEMA 1IF2A 3THQA 2JE8A 1D3GA 3MJMA 3EWCA 4UR8A 3FJLA 1Q6DA 2VKZG 4IJCA 3HIJA 4IWWA 4AQLA 1IE7C 2NT0A 2CERA 5IXEA 1A47A 1Q6LA 3I7RA 1W9PA 4ZSTA 4E2OA 5CJMA 3EB3A 2A79A 1TV4A 5CGQA 5G5IA 1W3KA 3ZT7A 2BOEX 2PDJA 4N6FA 1QASA 4LS0A 4HD5A 1W3LA 4PMRA 4ML4A 2BTMA 3A23A 4ZL1A 4IUOA 2YBTA 3MCOA 1DWIM 4WSHA 4L1XA 3FHQA 3SJ3A 5D2YA 4R85A 3MPGA 3STPA 3MUCA 4H4IA 5BRBA 3P74A 3SECA 3S47A 3MUY1 2ZDSA 4Y6GA 3SRDA 4F0MA 3W7GA 3BAXA 4LYRA 3O15A 1LOLA 1TJ1A 3UPWA 2Q8ZA 2HK0A 4FIQA 3UD6A 3KE0A 2NQ5A 3F4DA 3EOEA 4B4FA 1X98A 5LIYX 3E02A 2EG7A 3NVTA 2UWFA 1UD5A 4JIHA 3KCLA 1R2TA 4F8XA 1UMLA 2IXUA 4PE8A 1J5TA 4HMCA 3FVDA 2HV5A 6A3HA 1KQZA 2R14A 2VMFA 4HSOA 1DJNA 1W3NA 3LCGA 2P8CA 1CWYA 3BO9A 3EGJA 3GS6A 1XIMA 1WKFA 4KFOA 1UD6A 6REQB 1OCNA 5EA9A 5E0CA 2ALDA 2ZYFA 3WY1A 1FKWA 1W3HA 3BOXA 3LHTA 3EA2A 1IEVA 2QCLA 4CQBA 1VYSX 1E3ZA 1A50A 3GVVA 3GSMA 2F61A 4IP5A 3VUSA 3AMCA 2PDUA 2ZC1A 4ILSA 4HU3A 4E2DA 4GI6A 4I7VA 4QROA 1VJZA 3EX1A 1POJA 3UG5A 5AHIA 4W7UA 3HPFA 2D23A 2XISA 1F74A 2ZDRA 3SCTA 1W9XA 2I57A 5DMMA 1US3A 2DU2A 1CB7B 4JTRA 3SCPA 4GG9A 2J74A 3NCOA 2E77A 3EWYA 2P53A 4A3HA 3PBVA 3DHUA 5C6MA 1H0GA 2XFFA 3BV4A 2VGIA 3BL3A 1SMDA 4AH7A 2PMQA 3U6WA 1FWDC 9XIAA 3RLHA 5F7UA 4OE7A 1PYFA 3VNYA 5IHRA 4WY0B 4FNPA 4P61A 3SCOA 1UQYA 2P3EA 3N2XA 1DHKA 3C0QA 8XIMA 1C8YA 4K38A 1RJQA 1RUSA 4LT9A 2Y5EA 3IARA 3LOTA 4E8DA 3NQMA 1EP3A 4XO7A 1UROA 3GAYA 1M7JA 2OU4A 2QPXA 4GKLA 4NXKA 4NXSA 2XH2A 2GVGA 5MF5A 4XZ9A 2VEGA 5CSSA 3CUXA 2XN1A 3Q67A 3W02A 3P82A 3W37A 3WKZA 2TSYA 2PP3A 1H62A 3QY7A 1FXPA 4ACYA 1UH3A 3W7HA 4C5YA 4AHOA 3RCNA 4QAIA 3UR8A 4DEFA 2QS8A 5JBEA 1X39A 5HJLA 3WBWA 3NFUA 4HZMA 4I8DA 1P4CA 1F6YA 4E4PA 3CWNA 1OCQA 4GY7A 3FEQA 4FXFA 2OQLA 5A2BA 3CHDA 1GVOA 3PPHA 5AHMA 4ERGA 3FGCB 3CL7A 3GNDA 1VBHA 3V16A 2Y8UA 3N1AA 1GYLA 1W3IA 4PMNA 5FJJA 1YQ2A 3BANA 4L1WA 4PSPA 1FWHC 1RP9A 4HA0A 4PTMA 1R3SA 2QT3A 3JZUA 4QNWA 3FJNA 2PU1A 2PDYA 3SUUA 4NZ5A 2W91A 1KRCC 3D46A 3LK6A 4O10A 1TMHA 2RDXA 2D1ZA 3UZ5A 2YCIX 4D71A 2XWDA 4XBKA 4BQ3A 5T8GA 3K8MA 1CBGA 2PBGA 4A3UA 3ZJKA 4MB4A 5FCZA 3W1RA 1E4LA 2P8BA 5HR6A 4PA8A 3TLLA 1M1BA 3SEPA 4RPPA 5LYRA 4ZFCA 2G3JA 4C7FA 4GCAA 2WZIA 3VZXA 4IMDA 1NM9A 1UD3A 2VEFA 4LUTA 4AD0A 4JD4A 2WNNA 1PX4A 3WK2A 1RZMA 3N2MA 2G3FA 4EAMA 2WSKA 2VQTA 2P76A 2AKMA 2DIEA 1YBQA 2VCAA 2CLFA 3AU2A 1VC4A 5C9WA 4WVXA 2FTWA 1KFWA 2FZNA 2WZMA 1AL7A 3MTWA 4GIAA 1XD1A 3WEOA 1K6AA 2WJZA 4AWEA 1SZEA 3IGHX 1TTPA 1D9EA 2ABBA 4Y8EA 3IUHA 1XWYA 2ACSA 3PPCA 2V63A 1PZ3A 1KLZA 1KTCA 1XLLA 3FNDA 1R6WA 1K4GA 5A6KA 1B3WA 2H6RA 3B9EA 1S2AA 2I5QA 4P7NA 3WQOA 4GUJA 3WNPA 5I5RA 4DJFA 3D6NA 1LLOA 2O4QA 5JU6A 4JTGA 3N4EA 3WK0A 3QQWA 4FNTA 1PKYA 3UU0A 1SO5A 1JIBA 3WDPP 3U3HA 3MUIA 3GC5A 3L23A 3NQCA 1NFPA 4GMEA 3HN3A 3JW7A 2FZDA 1YIXA 3NQVA 3IRDA 4JTJA 3XINA 4KERA 2QHAA 3B3DA 3TYUA 1O5RA 2F9RA 3HURA 3TMQA 1BF2A 3CAVA 2W63A 4LVBA 4QG6A 4O8RA 4L61A 3UETA 2ZKMX 4AIBA 1N7KA 5I24A 2EF9A 3GHRA 1GOXA 3KL5A 2CW6A 3QKEA 1OC7A 1XFCA 3KL0A 2Q3RA 3NOYA 2OLHA 5I2UA 3ZOAA 4ATWA 1ZAJA 3MSYA 3LPPA 5E0KA 3SB0A 2ZC8A 4S38A 1HZYA 1UD2A 3QQ1A 3EKZA 2E6FA 4A8IA 3LRKA 1E4IA 3L5AA 1WDRA 3TMLA 5GPRA 2BY0A 1MXSA 1V3MA 4HPJA 3UCQA 3HQPA 1SJCA 4Z2HA 1P7TB 4Q4MA 4DRSA 4O4WA 1VFLA 4D1IA 2VO5A 3K1DA 1PIGA 2VTFA 4DWSA 3S1WA 1O1HA 4M6VA 1OFPA 3VD4A 3FYOA 2YW4A 3E0LA 4TV6A 2R1PA 4YVXA 4FNRA 2VR4A 3NDYA 3CTTA 4RW5A 4HMEA 2ZTJA 2RAGA 1JUKA 3L4ZA 4W88A 1R3QA 3UCDA 5HNNA 4KKXA 2CLMA 3ZFHA 2QCHA 3OGRA 3VFCA 4AB4A 2X0YA 1KR1A 2YIHA 5A6TC 4LAOA 1A5UA 2BHZA 4KRTA 1GOIA 1ZCOA 2OKTA 3ANYA 4F40A 2IQDA 4J3XA 3RITA 2O9PA 3NYZA 4Q4PA 3WG6A 1HJUA 3K46A 3W29A 3POCA 3WJWA 3QC0A 3M46A 3MDUA 2XH7A 3S5SA 4Q8UA 2PWUA 1Q3NA 4DJED 5C7VA 4FB7A 3DX5A 1EA0A 2IS7A 2XVNA 1WO2A 1MRAA 3NZGA 2NX9A 1OIFA 2JBMA 4DPQA 2YZRA 1W0MA 3LZ5A 1DE6A 1K02A 4UOZA 2P3ZA 3WQ5A 2WJDA 4DBEA 3UWYA 1HJSA 3S46A 4HP5A 3AHXA 3RR4A 2BG5A 4WF7A 1NDZA 4GBUA 3ARWA 1C9DA 1I75A 4AF0B 3AMGA 5A6SA 3C0JA 4HTBA 4PUJA 1LQ0A 2YR1A 1XLCA 3RJYA 1HX0A 3MKKA 1F6PA 1AJ0A 3DCPA 4ONVA 3S1XA 5IDIA 3IJ7A 3ABQA 1S2UA 2ASHA 4KGJA 4O1EA 3W7NA 1YTDA 1AJ2A 3WENA 4GNKB 1ECQA 3WEZA 4JXCA 2FH6A 2D3NA 1L2UA 2XU2A 3W2KA 4O1DA 3VDHA 3BSMA 4AY8A 4M7TA 3GTHA 1KLYA 4NILA 1DXIA 4QJ1A 4CCDA 1B0IA 3QOMA 2PTWA 3TW7A 3IGXA 2HE8A 1ODUA 3GDKA 4O54A 3N6JA 4F79A 5CSRA 3MMDA 4G7EB 2ZVRA 1MMFA 1OQFA 4F0KA 1XV8A 2J7HA 4B5XA 2XIOA 2Q3OA 2E7FA 2F7FA 3BLPX 1P6WA 1QNSA 5K3VA 1C93A 5JMUA 5LIUX 1FHLA 1V6VA 2ZRZA 7CGTA 2RHGA 2BOGX 1ZPTA 4BQ5A 1YNPA 3WD4A 4Q7IA 1CXLA 5C9ZA 2DSKA 2V82A 1I1XA 4XD6A 3RG6A 2JF7A 3ZR5A 5FEWA 4PZVA 3TN4A 4KMQA 2GDUA 7REQB 1XGZA 3UR5A 3VE9A 4MSSA 3IJQA 3CMFA 3QLLA 3AAMA 4IF2A 5EBUA 3WFLA 1H3GA 4DWSC 5I3GA 3CV6A 3KCJA 2OXNA 2Y5JA 1CPUA 4UTTA 4Q7NA 4NASA 1C7TA 3AXXA 1JYWA 5EMJA 1M3UA 2IKHA 1GVYA 3MVTA 2FMNA 2BV9A 3U9IA 3C0LA 3NOEA 1PX8A 4H00A 4NIRA 2H9AA 2O7QA 2CHNA 2VFFA 1Z48A 2D2JA 4NJJA 4IL2A 4OBSA 3HGSA 3T55A 2REQB 2YPIA 1GVRA 3M5XA 3WLJA 1IZJA 3ZWSA 3CV2A 2DGAA 2UBPC 3M0JA 3IIOA 2E25A 4UTFA 1H63A 2OR2A 3VYLA 4IMCA 2B7NA 4K8EA 3HB9A 1R9ZA 2V6AA 3TXVA 2ZFAA 4U3CA 1QVBA 5I3KA 3VOHA 3VM7A 2B7PA 5KZMA 1E6PA 3UESA 3MI2A 3W2LA 4EIVA 1F61A 1X1NA 3CO4A 4KCTA 4ADUA 3T2QA 4WLCA 2OWXA 1TUFA 2P10A 2WVSA 4FX6M 4JTAA 5DY2A 3Q2DA 1EJ7L 2OOGA 2J8GA 4OBTA 4O57A 4UTHA 3LYEA 1KKOA 3G24A 1BTMA 3EPOA 5C2XA 1AMYA 3KHDA 5IHSA 3VNLA 3O3RA 1R3YA 3GVQA 1GOQA 1O5XA 2DY3A 3WF3A 3P0WA 4UR7A 2AGTA 1C7SA 4ATLA 1HN1A 4RXGA 2R94A 3UCCA 4WSKA 4WIWA 1TCMA 3EX6A 3QYSA 4RPQA 4KBXA 4DXVA 3NURA 5D38A 3N17A 3DFYA 3O0KA 3IEBA 3NZRA 3FY1A 3LHZA 1C8XA 1G0CA 4C1LA 1VBRA 1Z89A 1CNVA 1TA3A 2V67A 3BAYA 4AD2A 1R87A 3W2UA 1UR0A 4DQWA 2E5BA 4UCGA 4R9OA 4JL1A 5HQLA 3CUJA 3S0CA 1FWSA 1YDVA 2WMGA 3NR0A 2ATMA 3VPLA 4K2SA 3QV7A 5BRQA 4MPQA 1J79A 3AC0A 3VC5A 2BGNE 4R3UA 3R94A 5HPOA 4ZXOA 4GRSA 5LNUA 2I5IA 1W31A 1WAWA 2XIMA 3CPGA 1HFBA 3F4CA 4YTSA 4I90A 3W1MA 1KTBA 5AOUA 1JDDA 1WXYA 2QCDB 1XX1A 5BMWA 3G5EA 2PI6A 1RBAA 3TNBA 3TTEA 3TJLA 2VT0A 1LOQA 2D73A 1JQXA 3LA4A 2W92A 1HJQA 1MEIA 1XL9A 2PDIA 1UH2A 3KBMA 4LRSA 3AU6A 3RMJA 2OQHA 3R7MA 4FF7A 1FFQA 3P0XA 1PE1A 3AHTA 4M24A 3RYSA 3WMCA 3IJ9A 1W6TA 2NQ9A 3PTMA 1W91A 5K2ZA 3MVIA 4XAGA 4C91A 4JIPA 5A5WA 2NLIA 3WLSA 1YADA 3Q37A 3ZZ1A 3N13A 1DWJM 4PMVA 4P7QA 1XIDA 1QDSA 1U83A 3PZIA 2FB2A 2BMBA 5D32A 4IXHA 1Z44A 3CU2A 3O6DA 3K4WA 4C5ZA 6ENLA 1XLHA 4F2BA 3BCDA 1KQYA 1UWSA 5AC4A 3QYQA 3M9YA 1GKQA 3MO4A 5A8QA 1XIBA 4MNJA 1RBOB 4FX8A 1KNWA 5TBOA 1XYFA 4NJKA 2VQUA 3CH9A 3MV01 1TUXA 3WO8A 4MJMA 1RHCA 1EEPA 3H2FA 1EIXA 4YHEA 3O9NA 3VD3A 3GNRA 3OGSA 3ERPA 3F2BA 1V79A 1ZS2A 3ZJ8A 4EAYA 3HGRA 5ABFB 2IKJA 4S3DA 1XLJA 2NVCA 4CEXC 5CPSA 1OBAA 2ZUUA 2Y62A 1WDWA 5AC7A 4V15A 3SCVA 4D8AA 4TV5A 3WFAA 1UZHA 4NKCA 4GJ1A 1EH9A 5TD4A 1VBUA 2WWDA 5HATA 4DJFD 1IHIA 1U33A 3VUPA 1TCDA 4LBRA 3N29A 1KM2A 4O15A 4HSNA 2A7PA 1R47A 2HE5A 1K9DA 3K13A 1ZUAX 4Q22A 1V7YA 4JIRA 4ICNA 4QQ3A 2TRSA 3CV7A 3B06A 2R24A 4LNYA 3IS4A 1WBHA 3FAWA 4A05A 2R1KA 3L4XA 2ZWYA 2OQYA 1JCJA 3G1YA 4IJRA 5C9XA 2QQ6A 1LL6A 2X16A 1W1PA 1E43A 2Y8KA 3GXNA 1Q13A 3PUGA 4IMFA 4QISA 4REQA 5AN7A 4I3GA 1J18A 2X0HA 2BS9A 4W87A 3ARRA 4YMZA 4UTJA 4LY4A 2DORA 4O13A 1XCWA 1PKNA 4N9DA 1VCGA 4XAZA 5TAOA 4PMUA 3THUA 1AUSL 3LY0A 1XRFA 1WZKA 2I16A 1D3CA 3P8IA 4JGDA 5HPCA 1E40A 3G0UA 3G1AA 4GGBA 4J1OA 3H53A 4PCNA 3P6LA 3QV6A 2GL5A 4Z08A 5H8UA 2OCZA 5GNYA 5BNKA 2BDQA 4MJ2A 1EWDA 2Q71A 3V0SA 4DWSD 3AROA 4E0CA 1H1ZA 4CD6A 3DENA 3PBGA 1DEDA 3L66A 3DFPA 3PF3A 1KCZA 3B8WA 4UB9A 2A0NA 1YXDA 3IJDA 1US2A 2X1TA 4DB7A 3OG3A 5LHEA 1EJTC 3TTYA 4GVGA 2VDHA 4NF7A 3CPRA 3FA3A 1A49A 3CO8A 4L6DA 3IK4A 1W8SA 3FV9A 2HPIA 4B91A 1DKWA 1RJRA 2EPOA 3TZNA 1YPIA 4MOZA 3A47A 3SUTA 2NX1A 3W2NA 2WXDM 2ZQ0A 1UUQA 1WDDA 3N2CA 5CCZA 1EO7A 3WUBA 1UKPA 1MQRA 3SGGA 1ZJAA 1UCWA 4TU1A 3C52A 1YXYA 3NZ1A 4IP7A 1XXXA 4F2UA 3SCQA 1KBKA 1ADSA 3QGAC 2RJGA 5HQMA 2QVNA 4GCXA 3DHPA 3LQLA 3ZMRA 2W4XA 5XIAA 3BVJA 1V6TA 4J40A 5D2VA 4D6JA 3DESA 2UY4A 3BARA 3DIPA 5I07A 2PRLA 2YKKA 2XPKA 1CX9A 5FJRA 3TC3A 4OT7A 4XV0A 3AJ7A 4BS0A 3QZAA 2XG9A 1Z69A 1KFEA 3AYVA 1XRSA 5I09A 4FX7A 3BPWA 4XD3A 3OZPA 1WX0A 5BXPA 4L1GA 4QDMA 2A3BA 5CBBA 4C6CA 1IYXA 3BZJA 2XVPA 4R88A 1NJJA 3TIMA 4AEFA 2WLYA 3VOIA 2BASA 2GWNA 1QW9A 3W01A 3B8DA 3UYCA 2XWEA 4EKJA 4U10A 2YA2A 4GO9A 2YSWA 1W3JA 2I9UA 3UNDA 2J7CA 3B9AA 4KW2A 2Y61A 5G2WA 3GDTA 4K8GA 4U4MA 3V5CA 1GTEA 4M0XA 3SSZA 3SADA 2I14A 5J5RA 5CZJA 1P5BA 1YPXA 3EXSA 1EX5A 4GD0A 2IQTA 2GOKA 3ZXWA 5KETA 2YCEA 5FA5A 5H1WA 1AD1A 1RBLA 2HS8A 2OZ0A 4JNZA 5D30A 1RD5A 1IT0A 1V5XA 1LUCB 2GVYA 1TE6A 4UQCA 5AHEA 3WQ6A 2GDQA 5EMKA 5JQ9A 1FWAC 2VX6A 3F4NA 5DMLA 4D6IA 4GWEA 3BXWA 5I3HA 1MXGA 2BGSA 2PF8A 1JF6A 3QGKC 4U5IA 5EY5A 3CNYA 3GFZA 1ONXA 5DCEA 2PWVA 3M6DA 3GNNA 1H7OA 1XM3A 3PG9A 3VKCA 3QW4B 1TV3A 3WLNA 4US5A 1I60A 4FR1A 4MHBA 4URIA 2XYLA 1XIHA 4LJ3A 5F2LA 3GYCA 4DZ5A 4B5TA 2IUZA 3PG8A 2BXZA 4TVCA 2B4GA 2A6NA 1E9LA 3VAVA 5MKGA 2PTZA 5AYXA 4GNJA 3W7KA 2J88A 4GUGA 1FP9A 3V75A 2D2OA 4R9XA 1BRLB 3LENA 4FNUA 3CQIA 4OWGA 4KWSA 1ISVA 4M6UA 2NT1A 4Q4KA 3EMCA 5AECA 2YCLB 1TVLA 1ZFJA 1FDZA 3TEVA 3O05A 3TH6A 1QPRA 1A0DA 2DSUA 2FZ9A 1X8CA 1PYMA 4IPPA 1EJVC 4JN8A 3VGBA 6XIMA 3E2SA 1XG4A 1HQTA 3WF1A 4DVOA 1M65A 4TVDA 1KGWA 4Q8NA 3GY1A 3C2VA 3BAWA 5GJPA 3NSXA 1RVGA 2V5CA 2DUZA 3RILA 4GJIA 1BF6A 3QSRA 1XQLA 3SAZA 1KKRA 2A3LA 2P1FA 4K1WA 1TRDA 1UWTA 4JYEA 1WKEA 3NJ3A 1LORA 1VFHA 1OK6A 3IAPA 3P93A 4E3VA 2PRMA 5A6BA 4L56A 3CUGA 1BYDA 1OYAA 1IEXA 4XG1A 4MPKA 1QHPA 3T8LA 3V5OA 4X61A 1QOXA 4BI6A 5DXXA 2ZUSA 4EXQA 3BAJA 1FP8A 2J7EA 2A1YA 1QR7A 2GWGA 3BQ6A 1U1JA 2PODA 4AC1X 2G41A 3UG3A 4ZBCA 1H60A 1SMAA 1YX1A 3NDOA 1XC4A 4OQVA 3EMZA 3W1PA 2A3HA 3APTA 3C2RA 3UZZA 2FLIA 3ME3A 3A4WA 3KL3A 1K9FA 2QCFA 2X1IA 4GISA 2PWGA 3PTDA 4PB4A 2JKPA 3ID7A 3W27A 3E9AA 1B1YA 3GXPA 2CETA 3TYAA 1TO3A 4PFHA 3S1UA 1NH6A 5M5DA 1A5BA 3TYDA 2BNJA 3QHNA 2V5DA 4H83A 3L4VA 3OJGA 4Z2GA 3OTRA 2V3FA 4H01A 2Y7GA 4H3DA 3YPIA 3W73A 1US0A 4HNCA 3R8RA 1ZBKA 3CHEA 3O6AA 3ITTA 3RM4A 2ZRYA 1EHAA 4FZIA 1FDYA 1RV8A 4H8VA 3N19B 4TUFA 2NQZA 4YHGA 1JUEA 1EZWA 1HGWA 5CBIA 1ZB5A 2PAJA 4BK9A 4MKSA 1ISXA 3TQVA 4KIRA 2ZWZA 1J2WA 3FXYA 2X1UA 3OBEA 6XIAA 3AALA 4J3TA 1KV5A 2WBKA 3VD5A 4POCA 2VR2A 1QXLA 1R7OA 3UXLA 4MYXA 3HM7A 3VDGA 1W17A 4XIMA 3UWWA 3G1VA 2POZA 1ENUA 3CQ0A 1EBGA 4PMYA 4KT2A 3ANVA 3PJTA 3IACA 1TPFA 3VM5A 3DI1A 4W8LA 2PPGA 4WXZA 3BDKA 4UQEA 1Y7VA 3MBFA 3KOZA 3MS8A 1BVZA 3EWZA 1JAKA 4OV9A 1ZBVA 4W8BA 2WSRA 1CZ1A 1QMLA 3IIXA 1DJGA 2CZ5A 1DTNA 1E0VA 3IIPA 2CEQA 3RRXA 4L4MA 1Q6FA 1ZTVA 4H04A 3UP8A 2VJXA 1CGYA 3CEPA 1DQUA 2GVJA 3L2MA 3DC0A 2PBOA 1EQPA 4IHCA 5AKQA 1OFAA 5GNXA 3C2EA 3PJXA 5EB8A 5B7YA 1X6UA 1XYMA 1CGVA 5HWMA 1F07A 1Z8AA 1OG0A 3BW2A 1KBBA 3TQ0A 4V33A 4MAVA 4QE5A 3APYA 3QC3A 1J8VA 2PTYA 2XZ7A 2VNCA 3H8AA 1TX2A 2ZXAA 5CZKA 2ABAA 3NQDA 4AY7A 3S2MA 4UFKA 2GSJA 1OG6A 4NU7A 4ZR8A 1HJWA 4NX0A 1KBJA 3DHDA 4W85A 4FMVA 2NW0A 4DO5A 1M04A 5GJNA 3E2VA 1HG3A 4PFMA 2ZTKA 1Q5MA 3RK8A 2DVTA 3O07A 4O0QA 1C9WA 1J0JA 2FB3A 4WKFA 5MHBA 3DKJA 3RX2A 3ARTA 5I3JA 3RF9A 4OBRA 4P8UA 1WPCA 3PZGA 4O50A 2TODA 3LLFA 4CVWA 1ALDA 2XSXA 3M5ZA 4IL0A 3FDKA 3C56A 3PWAA 4JFUA 1UZDA 4U33A 4H19A 4W93A 3GVWA 2E9LA 3MHGA 4ZTXA 3EB4A 4CD8A 3GD6A 2EAWA 4D6HA 4L9XA 3UZWA 3WJXA 3ITVA 2WVTA 4US6A 2E0PA 3P5ZA 3VMPA 1UUMA 4UWMA 1T99A 3CGTA 5GQBA 1VF8A 4NZ3A 4F66A 1R3TA 2BZNA 4FF5A 4JNMA 1AODA 1TZ7A 2OWCA 4AWTA 4ACZB 3EEZA 2WC3A 3CHFA 4GA8A 3SW6A 3RMEA 4PUKA 4HHMA 2PLMA 2Y1HA 2WOQA 1EGZA 1ISWA 1O95A 1OHLA 4HHHA 4MZ8A 4AZCA 2W62A 1C90A 3TZFA 4QX4A 1V6UA 1V6XA 1X97A 1GW9A 3E0VA 3MCMA 3NEVA 1JAEA 3UG8A 3INPA 4JN6A 4KWWA 1ZBWA 2EG6A 3NQEA 1GVSA 3VNJA 3W6LA 2D69A 3GVRA 4LF2A 3T0CA 5CC7A 3TSBA 3B9NA 3A4XA 4RDYA 4C6MA 3PZOA 2YL9A 1BWVA 1JDFA 1TPVA 1N2VA 1Q7MA 2DZWA 2NXIA 1SFJA 4YTRA 1TTQA 4TOQA 3FVMA 1FWFC 3VKAA 1EHNA 3ARXA 3BUVA 2PGFA 1OD0A 5DF0A 4GINA 4PEEA 3QZ6A 2VX4A 3EDFA 1NF7A 2X1SA 3ABZA 5D4YA 4YS1A 4HT3A 3ENLA 2NWRA 1Q66A 3TW6A 2HSAA 3EDJA 1PIFA 1CENA 5H6HA 2V5BA 4LH8A 1EYWA 1PX3A 4W9TA 4OHQA 3WIJA 1TMQA 3GVGA 3WLLA 2DIJA 2WAGA 4XISA 4PL2A 4IGSA 2DUXA 1MDLA 3VU2A 3G2GA 4S3KA 3WMSA 3OO2A 1BXCA 2YA1A 8XIAA 1VCFA 4BF9A 1MW3A 1MNSA 3CIWA 1ICSA 2HXUA 2NVAA 3S2LA 3THDA 3TC7A 4C6FA 3GWQA 3V0UA 4MUPA 1SU5A 2YFNA 2XIIA 2C1IA 4E4UA 4ZOAA 3C2YA 4M5PA 3GHSA 4M1BA 1ZQ5A 4NAFB 2C14A 3N25A 1XBZA 1A0CA 5D04C 3CC1A 4OGZA 1JDEA 2BVDA 7PTDA 3ATZA 2BBFA 1LDCA 4TVUA 3G1XA 4MG4A 3M07A 3W4RA 4LB4A 4UTIA 3GTXA 3U5YA 4D6DA 4AG0A 3W76A 4Q4QA 1GQIA 4MAZA 3DFHA 3LXBA 4F0SA 1Y5VA 2PWDA 2PS2A 4M7SA 1ZAIA 5BOFA 3EWBX 1P1XA 1W9DM 3HO8A 3IVTA 2QUMA 4JQ3A 4H9YA 5F1VA 3AHZA 2J7FA 3PZUA 1S2TA 3KS5A 2D0FA 4PCFA 4L9ZA 1MUCA 3LGEA 2H90A 3IK2A 1O5QA 1LP6A 1R2RA 1KV8A 4JY8A 5JH2A 5ECVA 3UEQA 2WSQA 4AHPA 1M53A 4HOZA 4ZOBA 4I7WA 4YVPA 1I4NA 2FFIA 4C1NB 1CI1A 2WMFA 1B3XA 3P3BA 1VCVA 1G01A 2JKEA 2Y2WA 1P43A 4N9BA 3V5FA 4CD5A 1N8WA 3GHUA 3AYTA 1NTHA 2QLYA 4LV9A 1H4PA 1PCWA 1OEPA 4H6KA 1GKRA 3RPMA 3EX4A 2QNEA 4QSFA 2YDAA 4FLSA 3SFKA 4P2VA 3WQWA 2OSXA 4HJWA 3LZ3A 1IXPA 5CG0A 2GUBA 1E5NA 1QW7A 1XLMA 5CH9A 4C6KA 3TN6A 2WW5A 1FXQA 3TJXA 3PNZA 2X30A 4RJEA 4US5D 1NWRA 4L6OA 2ZXQA 2V0TA 2XHYA 3MUZ1 4OUIA 4KCVA 4GH3A 5JUVA 1YKWA 1NY1A 2JIEA 1N82A 4BKNA 1S5MA 1M03A 3GKAA 4QHRA 4JIEA 1MZHA 1PEZA 4QR6A 2Y7EA 1GKPA 4UC5A 1RQBA 4GY0A 1DJYA 1L6SA 5LNSA 1EC8A 3DFSA 1OFOA 5REQB 3RAOA 4EXAA 1SFTA 3WH8A 2ATSA 5ENLA 2IXVA 2HBVA 3DBPA 1X1OA 1J6PA 1QI2A 4U5KA 1SJAA 3VZZA 3ZS4A 3MT1A 3BJTA 3EX2A 3VOCA 1UWUA 3VIHA 2YL8A 4OKDA 3LGDA 3TE9A 1P0DA 3UR2A 2NUWA 1XGDA 4ZODA 4EWJA 4D6GA 2VC6A 1PO9A 3W81A 4QAWA 2QDGA 3DUGA 1IXQA 3F5LA 4AVOA 1GOWA 1R8LA 5DELA 1R85A 1TYGA 4QCFA 1W32A 1WZAA 4QP0A 1UHVA 3S6TA 4ZTYA 3OYZA 2O0TA 2PFHA 1WV2A 1QOPA 3CEUA 3CASA 5PTDA 1LM1A 3QPEA 3B0VC 2G0WA 3EZ4A 5A6BD 1O5KA 5G1TA 2CLPA 1PAMA 3HG3A 2YA0A 3GB6A 1OINA 1VD6A 1OC5A 2EG8A 3BLOA 4GI8A 4NP7A 2PTDA 1EGMA 4ZQNA 1LQ2A 3A13A 4AD3A 1QFEA 3FIGA 2INFA 5CPNA 4DXXA 1IR1A 3QTGA 2GQ3A 1W3TA 4EVZA 1MYRA 1O66A 3B05A 3WUFA 2D0HA 4JS3A 2KZHA 2ZX6A 3UA4A 1E70M 1ME7A 3SCWA 1W2PA 3SRKA 4Q6JA 1DJIA 1T5AA 2ISSA 2FYMA 1BYAA 2G3NA 1VJSA 2QCCA 3VDAA 5C0QA 2VRKA 1LRTA 4O1CA 4UTUA 2FJKA 1DHPA 1BVNP 2VL4A 4G1NA 4R7JA 4HCLA 3QGVA 4Q8VA 1EDGA 5IFPA 1XRVA 5FIPA 1O1ZA 3U2ZA 5LIKX 1JPMA 2C6QA 2DVXA 2VM8A 4DYKA 1LYXA 3H2MA 5GJMA 2ZIDA 4JTIA 1GCYA 1JGIA 4LUSB 1YDOA 1OC6A 2DZSA 2F2HA 1R3WA 1XKYA 1F7BA 2QKFA 3I10A 4W84A 2BB0A 1RY8A 4Z1DA 3CZEA 3TC6A 5E9XA 4GBDA 3VIMA 1F3EA 4F0RA 3M0ZA 2R91A 1K7XA 5CZTA 5LIWX 1P0NA 4H7CA 1QJWA 3THCA 4DAIA 3H26A 1NARA 1IGWA 2JKAA 5JVLA 2Z1XA 1OCJA 3L9CA 1E73M 3FLUA 1O6IA 4IIBA 2W3ZA 4JTCA 4K37A 3OP2A 3IWPA 5HMEA 1SPQA 2ZRVA 1LRNA 3R0KA 2V69A 3W1UA 3HV8A 2OYKA 4LC6A 1QI5A 2WMHA 3C3NA 2ZZ1A 4UNKA 3KRBA 4PTVA 4KFNA 1IEIA 4C6EA