3PBVA

Crystal structure of the mutant i96t of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAITVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanobacterium thermoautotrophicum
molecule tags Lyase
molecule keywords Orotidine 5'-monophosphate decarboxylase
total genus 87
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3pbvA00
2V2DA 2JGQA 4LUJA 2C6QA 3R12A 4NT0A 2EKCA 4O11A 4UNKA 2J27A 5G4WA 3A5VA 3S8HA 1NEYA 2AGKA 4PH6A 1SO6A 2DP3A 4LW7A 1JJKA 1TTJA 1UUMA 4BWLA 3MYOA 3TQKA 3VE7A 3W22A 2X1RA 4I7WA 1VS1A 4LOCA 4A21A 2B4GA 5LNUA 3NZ1A 4O14A 1DV7A 1TPUA 4UC5A 4IXHA 4UFHA 3E9AA 1YTEA 4LS2A 5L9FA 2FB3A 4HN4A 1I2NA 2KZHA 4K7YA 4TMCA 3W1LA 3L9CA 3W86A 1S3HA 4RZ4A 3TAOA 1U5JA 2WOQA 2YXGA 3MW7A 2Z2UA 1WA3A 4MZYA 3LTSA 5U4NA 1JCNA 3EWUA 1LP6A 1VCVA 1XC4A 3LB0A 5CZTA 5DCDA 1OX4A 2CU0A 1XBZA 3M41A 3P67A 1T0OA 1T96A 1M6JA 3F4NA 1VR6A 1TRDA 2ZZ7A 4K8EA 3TFCA 2YCEA 2CZ5A 2ZRVA 1VLWA 2WNNA 2E5BA 4LVFA 3WJZA 3BLFA 4HKPA 3G1YA 2EHHA 1I2OA 1QR7A 4GJ1A 3TKFA 3UWVA 4LC6A 5BNKA 1F6PA 1ME7A 2G95A 1ZY9A 4AEOA 3LXCA 5CG7A 1GYLA 4ONVA 3KXQA 3W75A 4WXYA 3C52A 3OBKA 3HB9A 4GUHA 4LS1A 4XZ9A 5DXYA 3L0KA 3UNDA 3LBMA 1JUEA 2QCDA 4RV8A 5LHEA 1M7OA 2WQPA 3OHIA 1DORA 1UCWA 4NJHA 1WQ5A 1QNVA 1A5BA 2RDTA 3C61A 4YWIA 3TE9A 4DBEA 4JTGA 3T7VA 1FY6A 4S2CA 3W7LA 2DZWA 3W1XA 1JUBA 3B0VC 3LHVA 2B7NA 3PUEA 4FX8A 3LCHA 1TTQA 3G8RA 5DBUA 5BRBA 1QAPA 5F4WA 2YFOA 4LWWA 1QPNA 4CNNA 2H3BA 5C2XA 1H62A 2ZRZA 3BO9A 3C2RA 1LBLA 3BGJA 3LLDA 3OVQA 3WK3A 2C1HA 1JQXA 1RVGA 2PE4A 3GXPA 1F76A 3Q58A 2E6DA 5F4XA 1W8SA 1PL9A 5DY2A 1MO0A 4MLRA 1AW5A 5D05A 3O15A 1GQNA 2O7SA 5E0KA 1SU5A 1YDOA 3S5NA 3VKJA 1KM5A 1B57A 1O4UA 3B4UA 3O6YX 3UPWA 1TMHA 3RNDA 1BKSA 3M1ZA 1SR9A 1D9EA 4O53A 3W2UA 3S5YA 4GNJA 1LBFA 4NJJA 1KTCA 4NNAA 2HMCA 3HO8A 1LROA 1BTMA 2QF7A 1KA9F 3W7MA 1SZFA 3FKKA 2DZUA 2X2GA 2ABBA 4H6KA 4UIOA 5LGZA 1EB3A 2E1DA 3NQCA 1EP2A 4MOZA 3STCA 4ADSA 3NQGA 4FNUA 1OX4B 3T40A 4N4PA 3M5ZA 3NOEA 4KWWA 4AAJA 4IMDA 2J9ZA 1FCUA 3JR2A 3UY8A 3LTPA 4BR1A 5EPDA 2C16A 1TJPA 1ZHAA 3BLIA 3EWBX 3NPXA 4KKXA 1ZAJA 5C55A 5I3JA 3CEUA 3QEZA 1ALDA 1RD5A 4O18A 3E96A 3HG4A 3LGEA 3N9SA 2HSAA 3O05A 4C1LA 2E09A 1Q3NA 3W1UA 3DFSA 1PVNA 3HPXA 5AC6A 4YCPA 2R94A 1LOQA 2NXHA 3HIJA 2TMDA 5SWUA 3HOJA 1K02A 3GB6A 3N3MA 4UFMA 4O54A 4H3DA 4E2DA 3R89A 2QDHA 1DJNA 4PCFA 4IPJA 2NX1A 5FF7A 4JY8A 1WBHA 1W54A 2XN0A 1A5CA 2YX0A 4ZQNA 5AOUA 1GZGA 2GPTA 3ATYA 3F4WA 5G2IA 4GXMA 1S5WA 1YYAA 3UYCA 1VPXA 4MY9A 1W5QA 3QMRA 3A22A 1TPWA 3MJYA 3QPYA 4Y90A 4U28A 3FYPA 1E51A 1ICPA 3M5VA 2A0NA 3DI1A 4JX5A 1YPIA 2C3ZA 5AC7A 5HWNA 4CQ9A 4JDYA 2JKEA 1R46A 2BTMA 4IMCA 2HS8A 2ZZ4A 1H1YA 4OQVA 4UTKA 1O5XA 5C54A 2NUWA 3N9RA 2V5BA 1CX9A 4ZQRA 1OFPA 2CW6A 4IUOA 1UB3A 1Q45A 3MBFA 3EXSA 3TC7A 4JTIA 4JGDA 4K36A 3MHFA 2OMAA 3G1XA 2V2HA 3M0ZA 1OHLA 2W6RA 1VH7A 1LOSA 1JR1A 4NU7A 5I3FA 4JTFA 1FDJA 4HSNA 3W7EA 3H53A 5G1YA 4OBTA 2OT1A 3CPRA 3NNTA 4JTTA 2AAMA 2ZRUA 3EWWA 4LV9A 2PRLA 5CPMA 4O19A 4FIRA 3DZ1A 5J5DA 3NR0A 4TR9A 1Q6QA 1QPOA 2QDGA 2NWRA 2Y7FA 3JS3A 1DOSA 5HINA 1J4EA 4MIMA 3W71A 4E0CA 1PCKA 1EP1A 2CWNA 4JS3A 3RF9A 4FXSA 4RLIA 1TTPA 2ZA1A 4M5PA 1IXQA 1GOXA 2YW3A 2V81A 3W3OA 3LRLA 1SW0A 4JXCA 5AHFA 3W7PA 3EKLA 1IXOA 1H63A 1DBTA 3MP3A 1F6KA 4UMAA 4O13A 2GQ9A 5K7JA 1FQ0A 3O6DA 1H61A 4CCEA 4PL1A 1EUNA 3S1VA 3T4CA 1NFBA 1OK4A 3TSDA 1PHQA 2IQTA 3QRHA 5A8GA 5J5RA 1K8XA 1D3GA 4CNOA 1UASA 4UFLA 1SZGA 3GDLA 5AN7A 5D09A 1G67A 4UXDA 2CLEA 4UTUA 3B06A 1W1ZA 1ADOA 5G5IA 3UWZA 1C29A 1GEQA 4DO4A 3P60A 3E0IA 4LT9A 3DFTA 1ZAIA 3W1PA 3Q2DA 3BPWA 1Z48A 1YPFA 2V8ZA 3PUOA 3NYZA 3GDTA 1H50A 2JKPA 3IIXA 1Q6LA 2W79A 4FEZA 3IGXA 4CLMA 5AYXA 3PG8A 4EIVA 3TDFA 3W7OA 3NQ6A 1EA0A 2D73A 5EY5A 1KM6A 4N02A 2C19A 4JYDA 4RKAA 1KM1A 3DFPA 4ZZ9A 1QOQA 5KZEA 3I7RA 5MHBA 3G1HA 1Z44A 2J6XA 1SO3A 2C14A 2FLIA 2C13A 4KFNA 3I65A 5HR6A 3L0GA 1FXPA 3MI6A 5HNRA 3UZ5A 3NQAA 1NF7A 3LCIA 4OV9A 2Z6IA 3CWNA 2NUXA 1T99A 4XTDA 3DHFA 1SSGA 4IQLA 1TQJA 3NM3A 1PCWA 4HSOA 2OT0A 1KTBA 1RQHA 4O8RA 3CEPA 3L5LA 3A24A 3WJWA 4I7UA 4AHQA 4UFJA 1JCLA 3DKLA 3DGRA 4LVGA 3IVUA 3MYPA 4ZQPA 2DJLA 3CTLA 3I7QA 4Q33A 4QITA 4LRSA 4JYFA 2YDAA 5DN1A 5AC8A 3P7YA 3SSJA 2Q3OA 3V1PA 4S2BA 3W2KA 3C2FA 4GUFA 1NF0A 1OABA 5AYZA 2B7PA 2Z1BA 3L0NA 2FPYA 2QCLA 3CHVA 3NG3A 1W0MA 3LERA 3UQNA 5GVJA 3TQ0A 3LHYA 2Y61A 3NVTA 4DELA 3TW7A 3GDKA 1AK5A 2Y7DA 3PY2A 2Q8ZA 4PFMA 5LHFA 2PRHA 1N7KA 3BLEA 1VLIA 4FNPA 2ZZ6A 3M43A 3TXZA 4EVZA 1WXJA 5L6UA 1C8VA 3KVLA 2CZFA 2BZNA 3BG5A 3LI1A 3NEVA 4FF7A 1W31A 1R2TA 1LORA 1TPFA 3F1QA 2ZRXA 2WNZA 2Y70A 2XN2A 4X9SA 3C0JA 3G8EA 4WY0B 3T78A 2ZA3A 4HNUA 4DQWA 2WKJA 5K4XA 4DO6A 1R30A 1TREA 1TJRA 1BWKA 2EPHA 3RFAA 3LBCA 2QJGA 1IGSA 4M6QA 4O28A 1W5PA 3DFQA 3FS2A 4O0KA 2Y88A 2ZZ3A 2V5LA 5CPNA 3R8RA 4P61A 4HPXA 1K3UA 3NM1A 6TIMA 1OF8A 1KFCA 2ZYFA 1LLWA 3SGUA 1YXDA 5LNWA 3HPSA 5IBXC 1PIIA 4UMCA 1QO5A 3P61A 5HJLA 3IIZA 4JNMA 4N9BA 1GVFA 3TAKA 4OHQA 1P1XA 1ZNNA 4TIMA 3E49A 4O1AA 2QCNA 2ZDRA 1VHCA 3EB2A 4EF8A 4XUGA 1P0NA 2BSLA 2E77A 4DF0A 1HTIA 2Y62A 5K9DA 3CM4A 2A7RA 3W9ZA 3NQDA 5D04C 3LXAA 1RZMA 1O60A 3OIXA 4KFPA 2X1UA 5FF4A 4LVDA 1A5AA 1A5SA 2CLFA 2PURA 2TSYA 1WX0A 3B04A 5EA9A 4XKYB 3KX6A 1H7XA 2PRMA 2QKFA 3N14A 5EKYA 3NQ7A 1GYNA 2ZTJA 3DBPA 1XBXA 4MVAA 4R34A 4NNCA 3W84A 1H60A 4J9JA 2C15A 2FB2A 3PSVA 1W3IA 3VNDA 2WV8A 4MPQA 5K2ZA 3B0UX 3LRMA 1EP3A 3L66A 3L5AA 4WX2A 4JYEA 1OG0A 2X30A 4NQ1A 3E12A 4JTJA 1MEIA 5DBTA 1WBJA 1MZHA 2DORA 1IXPA 4L4LA 5HWMA 2Y7GA 4UNLA 3TJLA 1K8YA 4XBKA 1AG1O 3TCEA 4RZ5A 3UY7A 3THQA 3LV6A 1TPEA 2DJXA 4QM1A 3TNOA 3S9YA 3GX9A 4FNQA 3DFOA 4LS0A 2DZSA 2A6NA 1GVRA 3TJXA 4GWEA 4GUIA 5I3KA 5G2HA 3E02A 3TK7A 3LI0A 2Q8LA 1LRTA 1W3TA 3USBA 4K8HA 1L2UA 5K9XA 1F05A 2BX7A 4JDBA 3QC3A 3H54A 3ABRA 3L21A 2ZZ1A 3W74A 3QPZA 4OWGA 1KM3A 4BWLC 1OYAA 3VFLA 3W7QA 3EX3A 4MFDA 3O1NA 3ABQA 3NPUA 1L6YA 1XKYA 3O8AA 3RLVA 3WK0A 3PSWA 3QH2A 1K7XA 1SW3A 4N4QA 4HIBA 3P74A 1HL2A 2FDSA 2FTPA 5AYYA 2E6AA 3STGA 3W2JA 2VXNA 1M7PA 3PUDA 5D03A 1P0KA 1N55A 3QW3A 2NX9A 5A5WA 2XFWA 5EYWA 4ML9A 2J9XA 3HGSA 2Z6JA 3W87A 4XWUA 5KZMA 3KVJA 2CLKA 5CKSA 1W5MA 2CLIA 3W72A 3G1DA 2XN1A 2DZXA 4OGZA 3KHJA 4HNTA 4Y9AA 5KSWA 3LCFA 4IMFA 4BFAA 4DBDA 1KLYA 3BW4A 2OZ0A 3N73A 5D2VA 2QEZA 1XUZA 2EAWA 1LCOA 3DKJA 4JIPA 2YYUA 3G22A 3CWOX 4NX0A 1K8ZA 2G97A 1R47A 3INPA 1B9BA 3G3MA 2A7PA 3GAKA 4FX6M 2QAFA 1TO3A 2ATSA 3KAOA 4UTWA 3CIWA 1I8JA 1FWNA 2DU2A 2JK2A 1TIMA 2A21A 1L6SA 3LLFA 1WV2A 2VEPA 2VFFA 2OX1A 2NV2A 2YGYA 3G1VA 2YPIA 5DCBA 2WSRA 5D33A 3W07A 2QCEA 4GFSA 3I68A 1DL3A 2FIQA 1F74A 2X1SA 1XI3A 4EOUA 3M5XA 3DXIA 3HGRA 5CZSA 2GOUA 3MHGA 1GTHA 2HTMA 3TXVA 3PF3A 3TX9A 1XDLA 4QSHA 4IX0A 5TQLA 2QCGA 3R13A 4Q4KA 3A5FA 5FEXA 4YL2A 3TSBA 3PG9A 2VC6A 4Z0JA 3IIPA 3R2GA 4QNEA 3GK0A 4UFIA 4A2SA 1FWWA 4MZ1A 2DZPA 4JTEA 1IF2A 4AH7A 4O15A 1EWEA 3O63A 1NSJA 1XFBA 1XBVA 3OVPA 4ADTA 2RHGA 5TIMA 1CI1A 3LHZA 2ALDA 4ALDA 1KTNA 3CU2A 4BI6A 3B8DA 4Y6GA 1UUOA 4PA8A 2RFGA 4JTHA 4WY0A 4AWTA 1XBYA 2ZQ0A 3PB2A 1Z41A 4NUWA 5E1QA 3G18A 1TCDA 4MYXA 5D2WA 3ZS4A 4AHOA 4IOTA 3FKRA 3CQ0A 4ORMA 3UXDA 1QPRA 1O95A 5D32A 4MLJA 4XBSA 5KINA 1H1ZA 4LC8A 1ICSA 3BARA 1RPXA 4N9CA 4DPQA 5BW6A 1B3OA 2ZZ2A 5FF0A 3KRUA 2GJLA 3UWWA 3BG9A 2I14A 3BG3A 1XM3A 1ZALA 4NX5A 2JBMA 1QOPA 4D2JA 3W6YA 2A5HA 1Z42A 2HS6A 2JKAA 3R5EA 4CCDA 1KLZA 4UTHA 3TU9A 1CW2A 4O17A 1I2PA 3TA6A 3EXRA 3HJZA 5I3GA 1EIXA 2TYSA 3SZ8A 4JN6A 5FEPA 3GXTA 3LCWA 4O0ZA 2X16A 4E38A 1DJQA 1FXQA 3CT7A 1GVQA 4FNRA 1FCQA 4TU1A 4YLWA 5IBXA 1BEUA 1R2RA 4O16A 5D2XA 2CLMA 1HFBA 3KOFA 3NQFA 5EL1A 3ABSA 4P2VA 3IVSA 3LCLA 3G0XA 3O6CA 2RDUA 5DLCA 3CB8A 3C2OA 3EEGA 2ATMA 5K3VA 3LHTA 3SIZA 3W73A 2VKZG 1T8XA 3O16A 2NZLA 5FF2A 2VELA 4JTUA 1PE1A 4UTTC 1X7FA 3HGOA 5FI8A 3GDRA 2R14A 1XUUA 3U8GA 5HWJA 3OG3A 3ATZA 1H7OA 4NJKA 3RMJA 1TPC1 4EF9A 2ISVA 5KITA 5K4ZA 4GUJA 3WJSA 3LOTA 1LLZA 2CLLA 5D37A 3TC6A 4RXFA 1JCMP 1I2RA 3B05A 4A3UA 4EWND 3BK0A 1Y0EA 4XKYA 3QF0A 4UCGA 3KVKA 2OJPA 1J5TA 5FESA 4LNYA 2YSWA 1ZJIA 4WQ6A 1G4SA 3FLUA 3PBVA 3TQVA 3PBYA 3HG5A 5D2YA 1V5XA 2NLIA 1OYCA 4X3ZA 3W83A 1FDZA 2A1YA 4KFOA 4QIUA 5F2LA 1JRBA 3O07A 4IMGA 3W7CA 5EMUA 4O1DA 5HUPA 4Z08A 5DY3A 4BK9A 4UTWC 2PCQA 2YR1A 3A9IA 1GJPA 2YYTA 1W5NA 4M7TA 1HG3A 1DQWA 3NQMA 3O06A 4UFKA 1B4EA 3FIGA 4Y96A 3W1TA 5D02A 2ISSA 3MI2A 3YPIA 3G1SA 3VE9A 4AHPA 3W2LA 1SQ7A 4E2BA 5F2MA 1W37A 3BVJA 2ISWA 3EKZA 3W1NA 2H6RA 3PM6A 3TMQA 1J2WA 4TX9A 1X8FA 2RKXA 3IVTA 3B0PA 4NZJA 1EUAA 2E68A 3KVMA 4JICA 5CGQA 3SR7A 1QMLA 4PTNA 3QMTA 4Z1CA 1OFDA 5EBUA 3FJ6A 2VFHA 5CZJA 3ZWSA 1VQTA 4X22A 3U6WA 1MEWA 1IIGA 3EX2A 5FEZA 3CLMA 3PB0A 1LDCA 2V30A 5KMYA 3TROA 4NNBA 2GVJA 1OF6A 1IXNA 4LVAA 3WJYA 3TUUA 4QQ3A 5H2ZA 4AXKA 4MJMA 4RR4A 1XL9A 3P8JA 2A4AA 3WJXA 2LLEA 1DVJA 3EXTA 3MMTA 3DH7A 2TRSA 3QQ0A 3IEBA 3L5MA 1KW1A 3NL6A 2R8WA 3D0CA 4OU1A 1RQBA 1R2SA 1TTIA 2VFGA 4GBUA 3K30A 3SGZA 1MSSA 1L9WA 5HR7A 5LNRA 1L6WA 1LBMA 3P5YA 1TV7A 5G1TA 1FDYA 4AMAA 4HHPA 1F73A 1H7RA 1S5TA 4PEKA 4K37A 3TH6A 2NX3A 2GQAA 4O1BA 4NZFA 1FCBA 2H8ZA 3OVRA 1F5ZA 2P0OA 2WSQA 2H3DA 3MHUA 4IPIA 1QFEA 1VCGA 3IV3A 4GC4A 2H8XA 3W1MA 4ORIA 2WSYA 4O4VA 1AW2A 2BWGA 1XCFA 3ZFHA 1VHNA 3W1AA 4LUIA 3L65A 3DFNA 2VEIA 3S5ZA 1LTDA 4CQ8A 2G96A 3GR7A 4N9DA 4WOZA 1W56A 1QPQA 1SW7A 4MY8A 1GT8A 4AWUA 2A7NA 4FNTA 2F7FA 2VFIA 1FBAA 1VGAA 3QSRA 3DAQA 1JRCA 4JEQA 4XTIA 1ML1A 5T26A 3NL3A 5CSRA 3C6CA 1ZENA 4UTMA 5LGXA 3EX6A 2QR6A 3S1UA 4UTJA 5F1UA 3RK8A 2NXIA 4QISA 4JTSA 1OFBA 3MP4A 3G0UA 1SUXA 3NA8A 3MWAA 3SECA 4O52A 4HT3A 3EWZA 3UWUA 3TMLA 2QAPA 3M47A 3CC1A 4NJGA 3Q94A 4LY8A 5CPOA 5HMSA 4B5NA 4JX4A 3LHUA 1FX6A 2BXVA 2I9EA 3BV4A 1VYRA 1JULA 1F2JA 1TYGA 4WD0A 4DF2A 1U83A 1I2QA 2Y6ZA 1H7PA 3BW2A 1FCVA 3S0CA 2VOMA 2UV8G 3NAVA 4Z1BA 1GG1A 4IJBA 4UTLA 1KFLA 3W2NA 3ANYA 5F2IA 3C8FA 3CIXA 3M5YA 1LRQA 4MJZA 1OK6A 5HULA 5KTLA 2FJKA 4HNNA 1EEPA 4WXZA 1TSIA 3LDVA 3BW3A 5E93A 3LRKA 4N2YA 1TB3A 4AF0B 3A23A 4UTTA 2EGZA 2VFEA 4GRSA 5H91A 3IGUA 4FO4A 3HBLA 1KFJA 1S5VA 1PHWA 1LM1A 1G69A 3PVFA 3IGSA 4FNSA 1G4PA 1FWSA 3NQEA 2WJZA 4LTSA 3N19B 1RQEA 2NWSA 3VCRA 5AHMA 2TPSA 4CQAA 5FF3A 4A2RA 3PBUA 3U2OA 1OFQA 3I6RA 3W7NA 2QUTA 3QFEA 4NVTA 4LVBA 3GZ3A 1JCXA 1TV8A 2VFDA 1ZCOA 5CSSA 3PR2A 1I45A 4WZHA 1JCJA 4UR7A 2C18A 3A21A 1OFRA 2V82A 2CLOA 2X1TA 3S6DA 1KV8A 1FWTA 1A50A 1WAUA 4RXGA 3WFAA 4TO8A 4ZQOA 1TQXA 2WPBA 1RR2A 2V0TA 2FQIA 1Q6RA 3C4UA 1YLVA 3ZR4A 1KFEA 4RZ6A 1OFAA 3QMSA 1W5OA 3EWXA 3TFXA 4JTKA 3GNDA 4JX6A 4AWSA 1XXXA 2A6LA 2E5CA 3G24A 1K7FA 3IRDA 4UMBA 3FYOA 2NXGA 1KM2A 3W70A 4NJIA 3M7WA 5LSMA 1G4EA 3NL5A 2EF9A 2BLEA 3G1AA 1GVOA 4WOQA 1EWDA 4RCXA 1P4CA 4IWWA 4O50A 2W0UA 3GKFA 2A2IA 1JQVA 3PAJA 4N9EA 3GIYA 3M6YA 3NZRA 3TIMA 1N8FA 1KFKA 5F2GA 1AW1A 5DCEA 4MZ8A 4PODA 2RH9A 3GDMA 4I7VA 4LU0A 4BI5A 4RK8A 1VRDA 1K03A 1P5BA 4HPJA 3KRZA 3V75A 4FHAA 2YFNA 5AHLA 1YTKA 1H7NA 1THFD 3DHDA 3W7RA 4UUIA 3P84A 4K38A 5CZ0A 1WOAA 1ONRA 4QJ1A 3NQ8A 5KZDA 3W2MA 4MUZA 3QM3A 3GR8A 3I7SA 3SFKA 1SFLA 4CNPA 1VCFA 1GWJA 1ZAHA 2VEKA 1KM0A 5CPLA 2NV1A 1QDSA 5LNVA 3HPZA 3G1FA 2ZA2A 5IM51 1HO4A 3OEXA 3FA5A 5DXXA 4CCCA 4A22A 4LRTA 1H51A 3IIVA 1OX5A 1NVMA 3QJAA 1LYXA 1BWLA 3MBDA 3MUXA 5LNSA 3QSTA 4DEFA 3IIOA 4R7JA 4O1CA 3C3NA 2F84A 2QUUA 4BI7A 3LHWA 3FEMA 2E5DA 2C0AA 4ADUA 5LKYA 1B4KA 1X1ZA 1VC4A 3TW6A 3UWYA 3T44A 4JR5A 4L4MA 3PS7A 3EX1A 3NPVA 2WO5A 3QZEA 2AQWA 4M19A 1TPB1 4RJEA 2QUVA 1D3HA 1V7YA 1TPDA 4K7VA 1SFJA 3P62A 3HG3A 2V9DA 4QAIA 1WYIA 1RV8A 2VEMA 2Q3RA 3ABOA 1EX5A 5FEWA 1A53A 1KBIA 2Y7EA 4O4WA 3SW6A 4ZMGA 4DPPA 4PL2A 5BMWA 1HO1A 3DENA 1OVDA 8TIMA 1ZFJA 1GTEA 4Z0SA 4K6AA 5I3IA 4IXXA 5AHIA 4IMEA 4KWVA 2CZDA 3KRSA 1Q6OA 4R33A 4M6PA 2P10A 1IIHA 6ALDA 1X1OA 5AHEA 4LV4A 1ME9A 4DXVA 3Q37A 1O94A 4Q32A 3NDOA 4ZL1A 1OFEA 3W76A 1KBJA 3W23A 3GLCA 2CLHA 3W7GA 2G5WA 1LRNA 1AL8A 3NPWA 2E6YA 1JUKA 4G1KA 4AF0A 2QCHA 3C56A 3C2EA 3GAYA 3PBWA 4MKNA 4C1KA 2GUUA 2ZTKA 2GVLA 3LM7A 4POCA 4IGHA 1VJIA 4W9TA 5HUOA 3W88A 3LCXA 3GVGA 1SZEA 2QCFA 2O7QA 3G3DA 4NXSA 2ZFAA 4FX7A 1O5KA 3JRKA 5D30A 3VI2A 4BF9A 3FFSA 3HQ1A 4R53A 3S1WA 1GPWA 4Z1DA 2Y85A 1JCYA 3W7DA 2ZRWA 3WK2A 2FPVA 2GVGA 2ZRYA 3MP5A 2GJNA 3GKAA 1G7UA 3LX9A 4DF1A 1TPH1 3LTYA 3H55A 1QCWA 4IX2A 1WDWA 3PWAA 3B03A 2QJIA 1H7WA 4M7SA 5D2TA 1GVSA 4A29A 1LZOA 3UXAA 4JIQA 3S1XA 2OCZA 1K7EA 3NL2A 3EWYA 1C9DA 3PULA 5D38A 1F7BA 5C6MA 3W7HA 1KM4A 1DKWA 1I4NA 3ZWTA 1YTDA 1AL7A 1AMKA 3UPBA 2E6FA 4O12A 1TRIA 1WOBA 4AB4A 4MFEA 3L68A 4YCOA 3UD6A 2J9YA 4JD4A 5G2WA 4ZQCA 3RLUA 3HGJA 4UR8A 3QW4B 2QCDB 2QJHA 3FJLA 1PS9A 1DHPA 2J88A 4WY0F 4QNWA 3LXBA 3SJ3A 2DZTA 2R91A 5HQEA 3AJXA 7TIMA 3QQ1A 1ME8A 2DZVA 3HG2A 4MYAA 4NXKA 1LOLA 3LCGA 1SZNA 5U7SA 4WUIA 3LV5A 3W7IA 1UJPA 1OYBA 4ZVJA 2A85A 3TV8A 2YW4A 3W1RA 3NGJA 4K39A 2ZBTA 4N6EA 4H4IA 3KFTA 1OJXA 3NO5A 3NQVA 4M6VA 3THAA 3N2XA 3OA3A 3QYQA 4WJEA 3W7JA 2P1FA 3L67A 4Z1AA 3BGGA 1YDNA 1MXSA 5BMXA 3GYEA 3STEA 1G6CA 5F1VA 4OT7A 3PC0A 3W7KA 4JY9A 1YXYA 3RU6A 2FPTA 5BOOA 4X2RA 4HNVA 1GG0A 4RX0A 2VENA 1M5WA 4O57A 2CFFA 4UTIA 5I3HA 1G7VA 1KV5A 1MEHA 1XDMA 3S42A 1VYPX 3S5OA 3W85A 5AHNA 1QO2A 4S1FA 5F4SA 3UWQA 1SO5A 4MY1A 2WNQA 3L2IA 4ICNA 5C5YA 4OV4A 1JVNA 1SPQA 2Y63A 3AO0A 2YZRA 5TBOA 4FB7A 2ZZ5A 2CZEA 4YMZA 3TR2A 1EPXA 3P5ZA 1VZWA 1KFBA 3HF3A 2H90A 2I1OA 4OE7A 1OFOA 2QCMA 2RDWA 1NAL1 2FFCA 4JTLA 2B0MA 4FIQA 3MI3A 2ABAA 4TMBA 3DU0A 1PV8A 3UZJA 4I9AA 5AB3A 2GQ8A 3N34A 4GE8A 3P81A 1W3NA 1YADA 3N2MA 3DI0A 5ABTA 2J24A 1VYSX 1TPVA 2JGYA 3HMJG 4GUGA 3C2VA 1UBSA 1SO4A 2Y89A 2Z0IA 3WK1A 3M16A 3M9YA 2PC4A 3MO7A 1H5YA 3TSMA 3P8IA 4YXGA 4PC8A 3P82A 2ZCGA 4Y8FA 5G4EA 3FOKA 3GXNA 4XQ6A 3SY5A 1QWGA 1X6UA 3M44A 4O10A 2B7QA 1OX6A 3W1QA 4ZQMA 1YXCA 5DELA 1YDVA 5AFDA 1SSDA 1G4TA 1HUVA 4DO5A 1ICQA 1FWRA 3G0SA 2B7OA 3GNNA 4U4MA 3NXFA 2V2CA 4AVFA 1FUYA 5K9CA 3SI9A 3EX4A 3T55A 2NUYA 3NQ2A 1TV5A 5LZLA 4N6FA 4FXRA 3F03K 3STFA 1DQXA 3ELFA 3P80A 2QCCA
chains in the Genus database with same CATH superfamily
2V2DA 3VIFA 3WNLA 4LUJA 4PULA 2VGIA 4DWDA 3VIGA 3NIYA 2AGKA 1W2VA 2DP3A 1UUMA 4PCTA 3WO8A 3CWHA 3DOPA 4E4FA 2X1RA 4I7WA 1AH3A 5LNUA 4O14A 1DV7A 1TPUA 4UC5A 1FWIC 4UFHA 3FJ4A 4LS2A 3QV8A 4F0MA 1I2NA 4K7YA 4WDXA 4D1JA 2E1WA 3DYOA 4JQAA 3TAOA 2X7WA 3MWCA 2BOFX 1CGTA 2YXGA 3BZGA 3PANA 5U4NA 3RJXA 3ARSA 3ITYA 3EWUA 1DJYA 5CZTA 3UR8A 4PB4A 2ZC8A 1MW1A 4OBSA 3O7UA 3OJGA 3M41A 1T96A 4IPNB 1GQJA 4W88A 2YCEA 1WAWA 1JYWA 4EPDC 2YIHA 1YKWA 4QROA 1RD6A 3G1YA 3N9KA 4AVNA 2GUBA 4DXXA 5BNKA 2DEPA 1RCQA 3C86A 3FYYA 4QDWA 2PTWA 1GYLA 5CG7A 3V16A 5LYRA 3W37A 4LS1A 3LSBA 1JUEA 2QCDA 3DHPA 3L4ZA 5REQB 3PNZA 4M8UA 1M7OA 1W9XA 3DN5A 3OHIA 1JI2A 4LALA 1UCWA 4UQBA 2RDTA 1R0MA 3C61A 3JZUA 3T7VA 3WMCA 2GSHA 3W7LA 3GVRA 3LHVA 2QF8A 3S83A 3LCHA 1J0HA 3HQNA 1HGYA 3G8RA 2PU1A 3PZQA 1XSKA 1VENA 1F9CA 1DWFM 3C2RA 1NDZA 2V67A 1E72M 4D6HA 1RVGA 7REQB 2E6DA 5A2AA 3BOLA 4KWOA 5DY2A 4MLRA 1YEYA 5REQA 1J0YA 4ICCX 3V0TA 1Q4NX 5E0KA 1XIIA 4M1RA 3VKJA 4PMZA 1UD6A 1EFZA 4D9PA 2Z1XA 3UPWA 1TMHA 1BKSA 4O53A 1SR9A 3U48A 3W2UA 3S5YA 4LUSA 1LBFA 1S1RA 1KTCA 4URIA 1CB7B 3ARVA 4R9OA 5FL0A 3R10A 4ZO6A 3HO8A 2QF7A 1SZFA 2X2GA 2ABBA 4H6KA 4A8RA 5LGZA 1KWGA 2XIIA 3LSCA 3KP1A 3OHMB 3GTNA 3BC9A 4IFRA 3R8GA 3QGAC 4N4PA 4IISA 4TVUA 3LTPA 3C2YA 1E4LA 4BR1A 3ZSSA 5LIYX 4LPCA 3FGCB 1EYWA 3BLIA 5BXTA 3NPXA 1ZAJA 4GIRA 3IACA 5I3JA 3CEUA 2HZGA 1YQ2A 3ARWA 1MXDA 2W61A 2D24A 3V36A 4C1LA 4H01A 2E09A 4V33A 1Q3NA 3W6LA 3DFSA 4G8TA 3RRXA 5AC6A 3GNOA 3HIJA 4BQ3A 4YIWA 1FRBA 2RAGA 4H3DA 4E2DA 2PGEA 2PTXA 4Q3MA 4W8AA 4V1YA 1DJNA 4UTFA 2NX1A 3AIVA 2XIOA 3V5FA 2YX0A 1GZGA 2GPTA 3ATYA 3UETA 3F4WA 2CHOA 3R79A 1P6BA 4W7WA 1RBOB 1W5QA 1XFCA 2J7DA 1YPXA 2IKGA 1EO7A 1ELSA 2OYLA 7ODCA 2JIWA 4GA8A 3WQGA 4NZ4A 5B7YA 3VNMA 3TZFA 1OM0A 4OQVA 4AZCA 1YNYA 5I23A 3N9RA 4MNLA 1JPIA 4WGHA 3GC2A 1UB3A 3UZXA 3MBFA 3EXSA 2OZ3A 4JGDA 3QGVA 1H1NA 5CBIA 4WK9A 4OFCA 4GQRA 4JKLA 1U1JA 4JTFA 4GGHA 4G7EA 3H53A 4QDPA 3WQOA 2B31A 5CSYA 2DT1A 2H9AB 4D71A 2DVTA 5I06A 4O19A 1CWYA 4ACYA 3JS3A 4NF7A 1VBRA 3PWIA 5HINA 4QFUA 1EP1A 3RF9A 4FXSA 1E5NA 1CT5A 3UXIA 3VD3A 4M5PA 3GG1A 3VNJA 2V81A 3W3OA 2PWGA 3LRLA 1SW0A 4HU3A 4JXCA 1R9ZA 1F6KA 3DHUA 3MP3A 1ZCCA 1FQ0A 5K7JA 2JALA 2FH8A 3S1VA 4IL2A 4AWEA 3QRHA 5A8GA 3O2LA 3OZMA 1D3GA 5HA7A 4OECA 4UFLA 1J96A 3E2RA 2G8ZA 1TR9A 5AN7A 2E3ZA 1W9VA 3A6OA 2GZXA 3NYDA 2CLEA 3B06A 5G5IA 4DVOA 1C29A 2PCEA 1ZAIA 3BPWA 4G56A 3N2BA 3NYZA 2Z1SA 3GDTA 1Q6LA 1E1CA 5FAGA 4EIVA 3W7OA 3NQ6A 1EA0A 3EA2A 4N02A 1GORA 4RKAA 1GQIA 4QHRA 5I0DA 1R87A 5JUVA 4C5YA 3GUWA 5KZEA 2ZOXA 1GHSA 4PGLA 1SO3A 2JIEA 4CU7A 1P6CA 2C14A 2I17A 3VINA 4ZCWA 3I65A 3CMFA 5HR6A 2VZUA 1LQAA 3RX2A 2VZVA 3AS3A 4AFYA 4XZBA 1WCGA 2INFA 3MI6A 3NQAA 2G4FA 5TF0A 1NARA 1H4PA 2C8NA 2XZ9A 1CXLA 1SSGA 3VKDA 4IQLA 3QQWA 1TQJA 1PCWA 2OT0A 1KTBA 4O8RA 3CEPA 2A3BA 1W1A1 3KE0A 1LLOA 1JCLA 4ZR8A 2Q02A 5HAOA 4B15A 3ANVA 3VGEA 1QHZA 3QXBA 3K5XA 2CBUA 2FKPA 4JYFA 1BYDA 4MTVA 3TYAA 4CCZA 3C2FA 2Z1VA 4TV5A 1NF0A 2Q09A 2WZEA 2ZWYA 3OZOA 2FPYA 2QCLA 4Y7EA 3VFCA 3NG3A 2Z1KA 3LERA 3UQNA 2HQAA 3UU0A 4HOWA 3U7BA 3PPGA 5ABFB 1PZ0A 2VGBA 3LHYA 4YTUA 3HV8A 3NVTA 1O1HA 2G3IA 2ON3A 3W28A 3KW3A 4GZEA 2PRHA 4LCRA 1VLIA 2QJJA 3TXZA 4EVZA 3WLNA 4WVXA 4Q8OA 3RR1A 1WXJA 3H4WA 2QJMA 4DZ5A 1DIKA 4XZWA 3TCSA 3IUHA 3KCOA 1R3QA 3QTGA 3U4AA 1W31A 1LORA 1PDYA 5HMDA 4HOZA 5IFTA 4X9SA 2XN2A 3C0JA 3G8EA 1UMYA 3T78A 2ZA3A 3RJYA 1OEPA 4CKQA 1J10A 3UR7A 1PWLA 3LBCA 2HJPA 1J79A 2BV9A 4YTRA 1IWAA 5CPNA 4D6IA 4KIEA 1K9DA 1JNEA 4HPXA 2D23A 3FXGA 1KCZA 1H0IA 3NDZA 3PJUA 3GSMA 3G6LA 2ZYFA 2XJ7A 3DX5A 3SCWA 1PSCA 5CGTA 5IBXC 4UMCA 1KCXA 4ZODA 3P61A 1A5NC 5HJLA 4H04A 1UP3A 1LWJA 1GVFA 3AQUA 3I6EA 2GGIA 3MKKA 2FZ8A 1G0CA 3N1AA 2QCNA 1XH2A 4DAIA 4EF8A 1HL9A 5FJIA 4XBJA 3F4VA 2XHYA 4XUGA 1HKWA 3SRHA 4LCSA 2X2YA 4S3JA 3DYMA 3VGFA 3W9ZA 1VFSA 2R1KA 3AALA 2MANA 1O60A 4PUJA 1A5AA 2ONEA 1UPPA 2XWEA 5I2UA 3N4FA 3T4WA 2AKZA 5A95A 4HCLA 1ZP3A 2BNJA 3OA5A 1E5JA 3RM9A 2YCLB 3TLQA 4JQ3A 3T6CA 4H83A 4NNCA 4NL1A 1H60A 2C15A 2FB2A 5DMYA 2WV8A 4MPQA 3B0UX 3RX4A 3S5SA 4JYEA 3E12A 3TYCA 2VURA 2F2HA 4FF5A 1IXPA 5HXMA 1XW8A 1AG1O 4DJFC 3SCUA 1UYQA 3E1F1 2X42A 2DVUA 3UXLA 2DZSA 4C5ZA 7A3HA 4GWEA 4GUIA 4JIIX 4L9YA 1E15A 3NUKA 3CHEA 3QLDA 1YHTA 3VIOA 1LL4A 5K9XA 2F38A 2PF0A 4PZVA 3WMLA 3SRKA 1OYAA 4K1WA 4J1OA 3O1NA 3ABQA 1S5NA 5LA2A 2Y0FA 4BZYA 2ACRA 3GHUA 1KRCC 1XIFA 1XIJA 3STGA 1E1EA 2VXNA 1P0KA 5HDRA 4PFHA 4YN5A 3QW3A 5A5WA 4HHHA 2XFWA 4HD5A 4ML9A 5CC7A 3HGSA 1QVBA 2PODA 3I3BA 3AYSA 5KZMA 4AY1A 1A80A 3UGVA 2XN1A 1JXKA 4RUBA 3KHJA 5KSWA 1Z6KA 3LCFA 2VM8A 4IMFA 4WDUA 3HM7A 2OZ0A 1TR1A 2GGEA 5D2VA 3ZR5A 4JIPA 3CWOX 2G97A 1DTNA 3GAKA 1BXNA 4FX6M 3CIWA 1FWNA 3C0QA 1CXHA 2A21A 3NJ3A 3UJFA 5GQBA 2VEPA 2QT3A 2OVLA 1BG4A 3WEOA 1CBGA 5D33A 2WANA 4GFSA 3RCYA 3TYUA 4I5RA 1XI3A 4DJEC 1UD2A 4AY7A 3OB8A 1ITXA 3HGRA 5CZSA 4A8IA 6REQA 3GQYA 4PMUA 1QPKA 2HTMA 4DNHA 2DV0A 3PF3A 1U1UA 3LPGA 1CXEA 1M7JA 1EF3A 1R9YA 5TQLA 2QCGA 4Q4KA 3A5FA 2PDUA 3PG9A 1XLJA 3W81A 4QNEA 4UFIA 1FWWA 4E4PA 3KOYA 4HYRA 1AJZA 4HTBA 1NSJA 1EJ7L 1XFBA 1E6PA 1EEXA 3C5QA 4DJDC 3WLIA 4V1XA 1LG1A 1U2YA 2ALDA 4F9DA 5JIWA 1SJBA 4KCUA 1UUOA 3GVVA 6CGTA 4JTHA 4HJWA 1AQMA 1LF1A 2CESA 3VDCA 3SUVA 4QAWA 4JHMA 4Z2GA 4UB9A 8CGTA 4ORMA 4FXJA 1L8PA 1H1ZA 1XHGA 1UH2A 1ICSA 4OVXA 3W4RA 4RNFA 1ZRQA 3R7MA 4DPQA 3FA3A 4PTDA 4QG6A 4QTGA 5BW6A 4G7FA 3RO6A 3WD1A 1WDPA 2GJLA 4AIEA 3BG9A 3BG3A 2PP1A 4TTGA 3BLOA 2W66A 2JE8A 4UTHA 3TU9A 1CW2A 3BLLA 3HJZA 1J6OA 1GZJA 2TYSA 3SZ8A 4LGXA 3ZJ7A 4GOAA 3AUOA 2OQYA 1DJQA 1FXQA 4UQEA 1GVQA 4GH3A 4TU1A 3CZJA 3CJPA 1JXJA 5IBXA 1BEUA 3NQFA 3MQTA 5EL1A 3P6LA 4P2VA 2PSNA 2XU2A 4Q8UA 4YPJA 3O6CA 4XG1A 4I8DA 4JZ5A 3AAMA 4AQLA 2ATMA 5K3VA 1BLIA 3M46A 1KR1A 1UD4A 1CGYA 5EFDA 3O16A 1FHDA 5FF2A 1TV2A 5FI8A 3PK7A 3Q4DA 3BSMA 1U5HA 1GVIA 3BMVA 1H7OA 3RMJA 2W9MA 1RBAA 4K3ZA 4DJFA 3OLGA 4JIEA 5I3DA 5C7VA 2ZXQA 3BOFA 5D37A 3TC6A 4AX7A 4UOZA 2PLKA 3HURA 4HPGA 5ECUA 2A3EA 4XKYA 2EQDA 1TZ9A 3BANA 3QF0A 5G1MA 4GQGA 4GH1A 4LNYA 1G4SA 3TQVA 3PBYA 1BVZA 3HG5A 3SURA 5D2YA 2NLIA 2OB3A 1KCLA 3IJ9A 1DEDA 3UNTA 2A1YA 1E73M 3LLXA 1E3ZA 3W7CA 3B97A 2BXZA 1HKMA 2PCQA 2BFGA 3A9IA 4GYKA 2YYTA 3T0TA 1DQWA 3O06A 2VR2A 1GZ1A 3FIGA 2DGAA 2FZMA 2OOFA 3VE9A 2PTDA 1YBQA 1OADA 4C6LA 1KR0A 3GU9A 1A47A 1GOMA 3BVJA 2DZAA 2WCAA 3BCJA 1EJTC 2PD5A 1OB0A 1K4HA 1X8FA 2CBJA 2DSKA 1WKYA 3DFHA 4D6EA 4GBDA 4NZJA 2E68A 2CC0A 4JICA 3EEZA 3SR7A 2YCIX 4Q7NA 1XLBA 2HVNA 1OFDA 4PUDA 3FJ6A 1EHNA 3ZWSA 3WUGA 4H6EA 1W32A 1MEWA 3AZTA 1KQYA 3AHTA 5FEZA 1IHIA 5TAOA 1GJUA 1Z32X 4FOKA 3E5PA 4QLKA 1EJWC 4NNBA 2IQDA 3V0UA 4LVAA 3WJYA 4GJJA 4AXKA 4RR4A 5T91A 1TCMA 3WJXA 3MMTA 3DH7A 2TRSA 2P5NA 3L5MA 2G3NA 2XIMA 1RQBA 2VFGA 1MSSA 2P0IA 4JAWA 3CHDA 2FTYA 4HHPA 4PEKA 1XQKA 2NX3A 2EPLX 1R6WA 4NZFA 2P0OA 2WSQA 3NZQA 2VO5A 2FDMA 1VCGA 3IV3A 3M7SA 1RP9A 4O4VA 4XUYA 1AW2A 3ZYZA 4W87A 1YIXA 4A4AA 4LF1A 3F5LA 4RE3A 3IUIA 1C90A 4LUIA 2ZXAA 5CEWA 2RJGA 2VEIA 7TAAA 4TXEA 1WB0A 1XLKA 3LM3A 4M0XA 1FH7A 4ZOAA 4JNYA 1NWSA 2R1PA 1F4AA 1VBUA 1SW7A 4MY8A 3O0KA 3UG8A 4AWUA 3OP2A 1FBAA 1MFUA 3DAQA 3L7RA 4XTIA 3RIKA 4MPKA 4ACZB 5CSRA 3A3XA 3F2DA 5JBFA 1PIGA 1UROA 2OKTA 3NWRA 3GVWA 3AOFA 3USZA 4Q8WA 3GHRA 3PAOA 1E43A 3MP4A 1SUXA 3AYTA 3NA8A 2RJHA 2YL9A 3EAUA 1UZDA 4B5SA 5C70A 4O52A 4GI9A 2PTZA 3OG2A 1JD7A 2QAPA 5HJXA 3CC1A 4NJGA 3EDDA 3LHUA 5A3HA 3VNIA 2O9RA 5FOOA 2VD9A 2VGGA 1TYGA 3DYPA 4KW2A 1I2QA 1YMYA 1TE6A 4HB7A 3GE7A 2WW5A 5BRQA 1UWSA 2VOMA 3HU7A 2OU4A 5FA5A 3TYZA 2XVKA 3QR1A 1GG1A 4IJBA 4NRSA 2R82A 3T07A 2G4JA 1KFLA 2VX6A 1WKEA 5KTLA 2L5HA 3HJEA 2VZTA 1O68A 4ROQA 1TSIA 4OOUA 3MUAA 3A23A 4XSMA 4CN6A 5H91A 4QE4A 2QMKA 4FO4A 1EH9A 1G69A 3IGSA 3QBUA 3NQEA 4FNSA 1FWSA 2WJZA 4LTSA 1RQEA 3VU2A 3UESA 4MB1A 3KOWA 4A2RA 1HJWA 3PBUA 4F40A 2ZC1A 4A3HA 3U2OA 3I6RA 1IQ8A 3W7NA 2QUTA 3ZZ1A 1P7TB 1JCXA 1EDGA 2VFDA 3OO2A 3EYPA 4GX9A 4UR7A 2ASHA 1OFRA 2E67A 5LA0A 2W67A 2HNHA 2VC7A 1FWTA 1EJVC 1LQ2A 3WFAA 1TQXA 2ZKMX 2F61A 2E7FA 3K1DA 2FQIA 4IZGA 2QNEA 2AQVA 4JTKA 4HMNA 2A6LA 2E5CA 1E0VA 1AH4A 2JF6A 4RDYA 3FYOA 4XO6A 2NXGA 1KM2A 1V6TA 5G4HC 3IK2A 3M7WA 3GDBA 1G4EA 4M1BA 2BLEA 4WOQA 4G1NA 1RUSA 2BDQA 1JQVA 4M81A 4N9EA 3GIYA 3TIMA 3NZRA 3KLKA 4CQDA 1AW1A 4I7VA 4JNZA 1Z69A 5I78A 1VRDA 1EOKA 1P5BA 2XVLA 4HPJA 4H9MA 1EGVA 3JVAA 4ML4A 1H7NA 4WSKA 3DHDA 3EPNA 2FHFA 2Z26A 1UKPA 1QT1A 4QJ1A 3N25A 3NQ8A 2BVYA 3HFYA 2O4QA 2BS9A 2GFTA 3QM3A 3WLRA 1WNOA 1GJWA 3EWCA 1J93A 1V6VA 3GNPA 2UY4A 1KM0A 5LNVA 3G1FA 1HO4A 3OGSA 3MUZ1 4A22A 1H51A 4EXBA 3U0HA 3IRSA 3QJAA 1BWLA 3II1A 4PRWA 4ZB0A 5LNSA 3QSTA 3IIOA 1QI0A 3LHWA 3CMJA 4MJ2A 2PGWA 2BGSA 4G6CA 3VX1A 4UR9A 3UERA 3UWYA 2O9TA 3T44A 3PFRA 4L4MA 4QE1A 4MJ4A 5A8PA 1AVAA 1MFVA 2WM0A 1TVNA 3GHSA 4ATLA 1V0KA 3WLPA 4RJEA 2QUVA 5C9WA 3F5KA 1D3HA 1TPDA 4L65A 3WG6A 1NDWA 1XRFA 2W4XA 2O92A 1RV8A 4XD3A 4EPKA 5M5DA 1EJXC 1HIZA 4DPPA 1UR8A 1X6LA 3VKCA 1OVDA 2FGLA 3E2VA 4LUSB 1KWKA 4J40A 4IXXA 4ZE4A 2YDQA 1I0BA 1TELA 2ZUUA 4MWAA 2PP0A 1RLDA 3ZVHB 3FSUA 5FJPA 1DWAM 4ILSA 1ECQA 1O94A 3WEZA 1VBJA 1TV4A 2Q71A 1UWUA 1XLLA 1AL8A 4US6A 2AMGA 2OR2A 3C56A 4TQTA 1IV8A 2WHJA 4C65A 2PPGA 5A6SA 4GD0A 2GUUA 1ZZMA 3GUGA 3SBFA 5FD0A 5HUOA 3ENLA 2O7QA 3DDMA 2ZFAA 4FX7A 1O5KA 2WWDA 4YTQA 4Q4MA 2RGLA 2INZA 3JW7A 4KGJA 4Z1DA 5BU9A 3S1WA 2Y85A 2YB1A 3BAYA 1G7UA 3LX9A 3LTYA 1QCWA 3FXYA 3H55A 2ADAA 2O0TA 2QJIA 4M7SA 5D2TA 1GVSA 4A29A 1CENA 1LZOA 1XRVA 4RPQA 4JIQA 2OCZA 1E0TA 2ANUA 1S2VA 2A3HA 1F7BA 1JGMA 5C6MA 1KM4A 2GVYA 1DKWA 1I4NA 1H11A 3OOQA 3ZWTA 2E6FA 1XWYA 4LX4A 1TRIA 4QP0A 5G2WA 4W7VA 1VFUA 2WVVA 3WNKA 3B8VA 4UR8A 3FJLA 1GONA 3TWAA 4DBWA 1PS9A 1V3MA 4WY0F 4U10A 5I09A 3E38A 1K4GA 4QNWA 5EU9A 3MPGA 1IZCA 5AY7A 2NT0A 3AS1A 1F3XA 4JTAA 1E6NA 1ME8A 4MYAA 3GR4A 3LCGA 5U7SA 3URQA 1OYBA 4ZVJA 1K77A 5D9NA 3W1RA 3NGJA 2J7HA 4H4IA 4ASTA 3D46A 4RPPA 1QNPA 1ZJHA 1P0EA 2FGBA 4MWAC 3THAA 1DIDA 3N2XA 3OA3A 3S9ZA 3W29A 1UD5A 2YA0A 4Z1AA 4FR6A 5CQ1A 4DBSA 5F1VA 3PC0A 1E1FA 3AXXA 2FPTA 3WLSA 4X2RA 2D3LA 1XRSA 2VENA 4IIEA 3LPOA 5DT5A 1QI3A 2CFFA 2ZE0A 4UTIA 1QHPA 2C0HA 1US2A 1VYPX 3S5OA 1VFHA 1VBHA 4PB5A 2BMBA 3EA3A 5I07A 2W5FA 4QS6A 2GJXB 1IZKA 1EGMA 1OT1A 1XYFA 3PZMA 2QHAA 4CD4A 1PYMA 3TR2A 1EPXA 4P8UA 1G01A 1XLIA 3OGVA 2YKKA 4M56A 2D0GA 3RCNA 1UQYA 2RDWA 5GPRA 3AIEA 2FFCA 3PPCA 3CH9A 1JG9A 3HTWA 2VEGA 1V79A 2ABAA 2HPMA 3T08A 4L6HA 1W3NA 1BG9A 3N2MA 3DI0A 3TZNA 1TMLA 5J04A 1XINA 3HMJG 4GUGA 1P7TA 2XYLA 4LAOA 2Z0IA 4US5D 3M16A 3WLTA 1T40A 4CU6A 3M9YA 4C6JA 1H5YA 2PS2A 4PC8A 3P82A 2ZCGA 1PPIA 5LIWX 4C90A 2BB0A 4JFUA 2OO6A 1PKLA 1X6UA 4EAMA 3EBVA 5IFPA 3M44A 1WDQA 5DELA 1YDVA 2DW7A 3WMSA 1G4TA 3B9AA 1ICQA 3NVDA 1FWRA 5LIKX 1VFOA 1XYZA 4E8CA 1Y5WA 1XGDA 2DT2A 3T55A 3T09A 2NUYA 4I6VA 5LZLA 4ENLA 2X8RA 3IK4A 3ELFA 1HT6A 3FAWA 2QCCA 3EZ4A 2C6QA 3R12A 4GK8A 4AIOA 2VQUA 3ITTA 4Q8QA 3OQ8A 1AZ2A 4YVVA 4XX6A 4O11A 4UNKA 3A5VA 3H2FA 4PH6A 1SO6A 1ECEA 2RDXA 4BWLA 1XYMA 3M0VA 3ZT7A 3VE7A 3W22A 4M51A 1DJZA 3EDJA 4AX6A 2B4GA 1UR9A 3M0HA 4UBPC 3U2ZA 4IH3A 1V08A 4X63A 4DB7A 4HN4A 4CN4A 3PHAA 4TMCA 1N2VA 4OUEA 4RE4A 3L9CA 4RZ4A 3MUCA 2Y8UA 1JPHA 3MW7A 1OZQA 3GFXA 2EPMX 3WIJA 3LTSA 4GLEA 3EOUA 1XDJA 3LB0A 2NQ9A 2WCGA 1OX4A 5EB8A 3ZLHA 1M6JA 1VR6A 3AMCA 3TFCA 1MDRA 2CZ5A 2ZRVA 4KEUA 3H26A 1QR7A 4A6GA 4E3TA 3WF3A 3H4GA 3UWVA 3W02A 1F6YA 2G95A 1EA9C 5CJ5A 3LXCA 2HVMA 2WMFA 4CQBA 3SCQA 3KXQA 3W75A 2CHRA 3MMUA 3OBKA 4GUHA 1VP5A 5DXYA 2J13A 3LBMA 2INEA 1S5MA 4RV8A 5LHEA 4HOXA 3SJNA 4XIMA 1X96A 5A6MA 1WQ5A 2JQXA 3VZYA 4S2CA 1P6WA 3TTOA 1JUBA 1UA3A 4A3RA 3RITA 5BRBA 1QAPA 4B9ZA 3QY6A 1RK6A 3PZTA 2ZVRA 3BO9A 1LBLA 3OVQA 3WK3A 5A1AA 1TA3A 2C1HA 1JQXA 1W8SA 2VZOA 5HNUA 3ARRA 3O15A 2PGFA 3PJTA 3IPWA 1XP3A 3S5NA 4JL1A 3KL0A 3WBYA 3O6YX 3B4UA 3M0YA 4HZMA 4Q7BA 3E2QA 1OY0A 3RNDA 1D9EA 3BCFA 3QV7A 2HMCA 2V3EA 1LROA 3R6IA 4L6DA 1KA9F 3FKKA 4CN1A 1ZQ5A 1EP2A 5C2CA 3NQGA 3WF0A 2D2GA 4GI4A 5CBBA 3T40A 3MTWA 3WLLA 3M5ZA 4IJRA 3D6NA 1FCUA 4NHVA 3UY8A 1ISYA 2Z7KA 5H1WA 3GWQA 4IP7A 3QVQA 3W27A 2PD9A 5C55A 1U33A 3E96A 2QULA 3WH7A 3HG4A 1EZ2A 4FPSA 3N9SA 2GK1B 3RO8A 4EK7A 1PVNA 4YCPA 5HBFA 3LZ3A 4JCMA 5SWUA 5A6AA 3AMKA 1B90A 3TYBA 2Z4GA 3N3MA 2QPXA 4LH8A 1J9YA 1R3RA 2QDHA 5FF7A 3LMZA 1XYBA 4JHOA 3LUTA 4ZQNA 2QVHA 5AOUA 1XGEA 1J0ZA 5G2IA 2PDMA 1YYAA 3TJIA 4BA0A 3K4DA 4U31A 3A22A 5CC6A 3UP8A 1TPWA 4PMQA 3MJYA 3QPYA 4O0QA 1UWIA 1ICPA 2HXTA 2A0NA 4JX5A 2C3ZA 5AC7A 3T81A 4AD2A 1WDDA 5TNVA 1KO0A 4O8AA 1OZMA 4IMCA 2HS8A 3GW0A 2AL2B 3T8QA 1O5XA 2NSOA 4RV3A 5C54A 2NUWA 2WQDA 1UWTA 1P1MA 1OFPA 2CW6A 4B5UA 4IUOA 1ADDA 2XGIA 4JTIA 3R43A 4K36A 3NGFA 4GHRA 4I5XA 4EACA 1UD8A 4HN8A 2OMAA 2Z2AA 1SMDA 3WN6A 2W6RA 1QXLA 1VH7A 3SDOA 1TWSA 4HSNA 3W7EA 5G1YA 1D7FA 2ACSA 5CXPA 4PBFA 1U22A 4JFSA 4GY1A 2V68A 3NNTA 3ARTA 4JTTA 2HISA 1DQUA 2ZRUA 4ZFMA 4LV9A 4J3VA 2PRLA 5CPMA 1AD4A 3AZRA 4GXPA 5FIPA 2Y7FA 1Q6DA 1J4EA 4MIMA 4E0CA 3CUZA 1E9IA 3UEQA 1F8MA 5BROA 2DQXA 2ZA1A 3JU2A 2XH0A 3TWBA 1R86A 2FMOA 4NZCA 5EGRA 3SO7A 3UZWA 3RPMA 5AHFA 4RDZA 3GY1A 1DBTA 3CYVA 4Y9MA 2GQ9A 3WFLA 1VEOA 3O6DA 1H61A 4CCEA 4PL1A 1EUNA 3PWGA 3T4CA 1NFBA 5C8BB 1PHQA 1PXGA 2IQTA 1V02E 3IJ6A 3H2EA 3HV9A 4HPNA 3VDAA 4GXWA 3VOHA 4IT1A 2WBKA 1B0IA 5D09A 1G67A 4UXDA 2BY1A 1ADOA 3P60A 2NV9A 3VOGA 2CCRA 1JDEA 3MU7A 4LT9A 3DFTA 3W1PA 1Z48A 3PUOA 4OKDA 2JKPA 1A49A 4HZ8A 4IIGA 1Q8JA 3WL0A 3T0CA 2D73A 5LXEA 3BUVA 5XINA 1HN1A 3DG6A 5CLWA 3PBMA 1ZUAX 3DFPA 4UZUA 2F6XA 1QOQA 4LBSA 2O9PA 3G1HA 1BF6A 5A2CA 3BQ6A 3VZXA 5A6BD 5GNYA 2ZVIA 4U2YA 4PCPA 1OGBA 1FKXA 5HNRA 3UZ5A 1B2YA 1NF7A 4OV9A 5EFFA 2J78A 2NUXA 4NI8A 1FFQA 3DHFA 1N8IA 1A3WA 2OSXA 3H4XA 1RQHA 1VEPA 4GZJA 4AHQA 1V6WA 3DGRA 3VIKA 3IVUA 5CPSA 2OEMA 4QITA 2DIJA 4HYWA 3P7YA 1FWAC 3P0XA 1LT8A 3KL5A 3M4HA 5LIUX 3SN4A 3ES8A 2B7PA 1REQB 5CPQA 1WPCA 1W0MA 1SM9A 3AMLA 3H7RA 3AHXA 2KAUC 1A0DA 1BWVA 4P7QA 1PKMA 4DELA 3EWDA 4EAYA 1LL7A 3GDKA 1NJJA 1AK5A 2Y4SA 3DBNA 4GISA 4PFMA 5LHFA 1N7KA 2XH2A 4LYQA 1EYEA 5L6UA 1NM9A 4L4OA 3LI1A 3BG5A 3NEVA 4FF7A 1OD0A 3BH4A 1YNPA 2XIQA 2WNZA 2Y70A 4PTMA 4BQ2A 4JBRA 2GJXA 3EB3A 5K4XA 1BWKA 4G5DA 3RFAA 3WD3A 3PTKA 2QJGA 4US5A 3D3AA 4O28A 3BAXA 3WQEA 3RX3A 3HPFA 1EC9A 3W01A 1OT2A 2BHUA 3H22A 4Q6XA 5DMLA 3BGAA 1OF8A 4PMXA 3LPPA 3VM7A 1KFCA 4Z2LA 1GYMA 4AXNA 1UIOA 3OLIA 4IF2A 2EKGA 1I6NA 4JNMA 3SN0A 4N9BA 1E55A 5LIXX 2YB4A 1QNOA 4TIMA 4O1AA 3B8TA 1VHCA 3PZOA 3IANA 1XR2A 1P0NA 4HU8A 1CTNA 4H9YA 4DF0A 1HTIA 2Y62A 3GNRA 1A3HA 2X05A 1F3TA 4FALA 3TTQA 5K9DA 2A7RA 3LQLA 1KXQA 5D04C 3LXAA 2X1UA 1MNSA 3WKZA 1S2AA 2PURA 2CLFA 2WKLA 3CV6A 4YVPA 3DFYA 5CPTA 5EA9A 4HPHA 4WCJA 3KX6A 2PRMA 5HMFA 1UH4A 1CDGA 4J35A 2ZTJA 4F66A 3DBPA 4Q4SA 2DSVA 3KWXA 4ZOCA 1TJ0A 3W84A 4J9JA 2V38A 2OZTA 1F8IA 1W3IA 3VNDA 1QTWA 3FEQA 3LRMA 1EP3A 1NDVA 3WF1A 4WX2A 4MNKA 1OG0A 2Q6ZA 2X30A 4JTJA 1XG4A 4QEEA 3K8LA 3LNPA 4BF7A 1IR2A 1WBJA 1XIHA 2DORA 4L4LA 1UBPC 3RXZA 3S47A 4CEUC 2Y7GA 3TJLA 1K8YA 1VIZA 3TCEA 4RZ5A 3R94A 1OINA 4MUPA 1EKOA 3THQA 4DZAA 1TPEA 3LPFA 4H2HA 3S9YA 3UPMA 1XS2A 1B3YA 2QYGA 4LS0A 4KF1A 4E5TA 4ICMA 6ENLA 5I3KA 5EMYA 1B1YA 1XGZA 3TK7A 2Q8LA 1S2TA 1AQFA 1LRTA 1F61A 3F7JA 3PUGA 4CD6A 4H00A 4GKTA 5H8MA 3S9IA 4FXFA 1F05A 2BX7A 3M0XA 5I79A 3L21A 1K9FA 3QPZA 4BWLC 4XAYA 3CV2A 3VFLA 3W7QA 5A8QA 4MFDA 2E9BA 3NPUA 1D8CA 1L6YA 1XKYA 3R11A 4EE9A 1TX2A 3WCZA 3WK0A 1FOBA 4D6JA 2VOTA 4AD3A 3P74A 1HL2A 2FTPA 2E6AA 5D03A 2VWTA 4Q4QA 1HW6A 5EYWA 4QG9A 3W87A 4LAMA 1QI4A 3UJRA 3G1DA 1RH9A 1IT0A 4OGZA 3A64A 1TG7A 1BTCA 1JCTA 4DBDA 3N73A 4EKJA 4FP1A 4DJDD 2QEZA 4NX0A 3DKJA 1XSIA 4MGGA 1EXBA 3CAWA 3G3MA 2A7PA 4LB4A 3LU2A 3L2MA 4HNCA 4UTWA 3VD4A 4P8WA 4E8GA 4MWAD 1L6SA 3P14A 3H2NA 1WV2A 1JZ2A 1HKKA 1MUWA 4NAFA 4W4QA 1NQKA 4PTXA 4IGNA 2YPIA 3V7PA 4KEZA 4L9XA 3SCSA 3I68A 1DL3A 4AD4A 4JCLA 2YXXA 3M0MA 5LA1A 4D8ZA 1L6GA 1RCOB 1XDLA 4QQUA 1JYXA 3WBEA 1EBHA 5FEXA 3ITVA 4UWMA 3GBEA 4YL2A 5BRPA 3O0FA 3MY9A 5I02A 1OGGA 4QJ4B 3R2GA 4W89A 4ERAA 4GVIA 1R5YA 4YVXA 3ZM8A 2DZPA 1DJGA 3LQGA 1EWEA 1E4IA 3O63A 2Y8VA 2E4TA 1MW3A 2CITA 7CGTA 1J2BA 1AFSA 1CI1A 3LHZA 3V5OA 1BGGA 4RE0A 4ALDA 4AZBA 2AMXA 3OGRA 1EXPA 4Y6GA 3OBAA 1H0GA 3OIHA 2DIEA 5A69A 2HE5A 5I7GA 1XBYA 2NT1A 3PB2A 1Z41A 4ZENA 4NUWA 4OUIA 5E1QA 2ZUNA 3KZPA 4KQNA 5D2WA 3UXDA 1QPRA 5KINA 4MF4A 2EG7A 4UOQA 1CYGA 3BLKA 3WQ5A 5CCZA 1FKWA 2PWEA 1BSIA 3FA4A 3I6TA 3UWWA 1Q65A 4HQVA 2OELA 4NX5A 3N11A 3WX7A 1QOPA 2REQA 3W6YA 2JKAA 1US3A 1V3JA 2D22A 2J8TA 1W3HA 3N4AA 3H7UA 1TZZA 5M17A 3EXRA 4NIRA 1BPLB 3VUSA 4X60A 1TX0A 4H9TA 4B3LA 4O0ZA 2X16A 2D0FA 4FNRA 1FCQA 4P7LA 3VOFA 4YLWA 2AAAA 1XLEA 5D2XA 4WKFA 3VAVA 1QNSA 1HFBA 3KOFA 3VD9A 3IVSA 3S2MA 4L6OA 3OYZA 2RDUA 5DLCA 1ZSXA 3CB8A 2PP3A 3EEGA 4J2MA 3ZXWA 3LHTA 4ZO7A 3THUA 3P3BA 1T8XA 5HNNA 4IGSA 2VELA 4OOZA 4L9ZA 1IWPA 2R14A 1XUUA 3U8GA 3WBXA 3GC5A 4NAEB 3I10A 4NJKA 4B91A 2HCVA 4A8NA 1GKRA 4DUVA 4EF9A 4OJYA 5K4ZA 3CAKA 4HP5A 3K8KA 3WJSA 1FP9A 2CLLA 4MDOA 1I2RA 2F6UA 3B05A 4JQ4A 4A3UA 2CKSA 1Y0EA 1N82A 2NSXA 2ZX6A 1IEVA 3A3WA 4WQ6A 4CNTA 3FLUA 4F8XA 2V5JA 1V5XA 2PWHA 3W83A 5F2LA 1JRBA 2GSEA 1XIEA 3O07A 2HXUA 4GVHA 4Z08A 1GNXA 4IPPA 5DY3A 4UTWC 4EXAA 2YR1A 2Z27A 4M7TA 2WC7A 3SQMA 2GDQA 4GCAA 4UFKA 5IOBA 1HL8A 1WO2A 1B4EA 4Y96A 2GL5A 3EPOA 4PMDA 2XG9A 2V3DA 3QFWA 4X61A 2DIKA 3KHDA 1Q7ZA 2MNRA 3W53A 1QJWA 1QW8A 2H6RA 3ALGA 1E3XA 4TX9A 3Q67A 4IP4A 4WKHA 1F3WA 1EUAA 1QMLA 1L0PA 3QMTA 4F3HA 1KGXA 1RSCA 4XD4A 1VQTA 3PZNA 1Q85A 4M82A 3V0SA 3O9NA 1UR2A 2H9AA 3WYZA 1TKKA 3PB0A 3ARYA 2EO7A 4IG2B 2CLPA 3TUUA 1C8YA 3ERPA 2J75A 3CUHA 4XISA 1S1PA 1DVJA 3QQ0A 3IEBA 2V63A 3NL6A 3D0CA 2IXUA 4KS0A 1R2SA 1TTIA 3K30A 1QNQA 1L9WA 2Y5EA 2D20A 5JVLA 3P5YA 1TV7A 3UJEA 1H7RA 1S5TA 4K37A 1U30A 2GQAA 1FWCC 4GX8A 3H24A 1HP5A 5AKQA 2I16A 3GS6A 1IE7C 4GYPC 4GZIA 2H8XA 3V4BA 3W1MA 1KRBC 2OXNA 4EX4A 3N6HA 4E3VA 3OPSA 3HA1A 3VILA 2BWGA 1XCFA 2WJDA 3ZFHA 3GH5A 3XINA 3DC0A 1N8WA 2PF8A 4AEEA 3DFNA 4DLMA 4I8YA 3WLJA 4H8UA 3GU1A 1SZRA 3PZ9A 3GR7A 4NAFB 2ZE3A 3MS8A 3WQCA 1SJDA 5FSDC 1W9UA 2CHNA 2J7GA 4YJ5A 1FHVA 2QV5A 1GT8A 2A7NA 2F7FA 2XVGA 5T26A 3ZQ9A 1V51A 4DAFA 5JIPA 1E9LA 2BG5A 4DWSB 4UTMA 3MA8A 3EX6A 2QR6A 3LEPA 2IS7A 4W86A 3E5BA 4QISA 3SCOA 1OFBA 4C60A 3MWAA 3RDKA 2DDXA 3B9NA 4J3WA 3H6OA 3CYJA 3CQJA 3EWZA 1W1TA 2DT0A 3UWUA 1JZ8A 3Q94A 3O3RA 4LY8A 5CPOA 4JX4A 4PEEA 1UKSA 1FX6A 2VC5A 2XVNA 3B9OA 1H2JA 3BV4A 2EG8A 1JULA 3H2CA 1NP0A 4AYSA 1FVPA 3TTYA 1U83A 2PWDA 2Y6ZA 3S0CA 3FX4A 4M3PA 4Q4OA 2QMJA 3K8MA 2VI0A 4Z1BA 4MNMA 3LZ5A 2ZDSA 5F2IA 1LRQA 2CXEA 4MJZA 2WVTA 4IQEA 4LAUA 4CD7A 3CL7A 3ME3A 3BW3A 1CPUA 2DH3A 5HMEA 1NIUA 2NQHA 3LRKA 3VIJA 4N2YA 1Q6EA 3GFYA 1DWJM 1BQGA 2OLSA 4AF0B 1KD0A 3LNMA 2VFEA 4GRSA 4MG4A 2Y1HA 1KKRA 3CASA 2C1GA 1HGWA 4RE2A 2OWCA 1B3WA 5FF3A 1C91A 1KXVA 1XLDA 3ITCA 1TVLA 3QFEA 4NVTA 2WZMA 3GYCA 3G2GA 4DJFD 3QTPA 1MWOA 1ZCOA 5CSSA 3PR2A 1E9ZB 3A21A 3UYIA 2AOSA 3H21A 3KOZA 1KV8A 4S3CA 3VKKA 4IGMA 4ZQOA 2CYGA 2WPBA 5I6SA 3JZEA 1KC7A 3K1GA 2C1IA 2V0TA 1Q6RA 3C4UA 5JMUA 4XB3A 4RZ6A 3QMSA 4GIAA 5A8MA 3TFXA 4AWSA 1XXXA 3IRDA 4AZIA 2I7GA 2O55A 1UKQA 3W70A 4AZ7A 1D2KA 2JEPA 4HU0A 5LSMA 2WPGA 5ECVA 1OC5A 3TNBA 4IWWA 1XICA 2W0UA 3RLGA 3MZNA 2O56A 3R0UA 4QEHA 3M6YA 1KFKA 2QS8A 4I90A 3WH9A 1HNYA 2D2HA 4PODA 5C2GA 2RH9A 3GDMA 4H7CA 3S2CA 4BI5A 4F0HA 2QQ6A 3V75A 4GJIA 1EQPA 3L4UA 4FHAA 5AHLA 2OGJA 1K70A 2AQOA 4ZE5A 4FA3A 5FSEC 5T8GA 3DGBA 1A0EA 4UUIA 1ITUA 5CZ0A 1WOAA 3TA9A 1ONRA 3DC8A 4PMOA 3W2MA 4MNJA 4MUZA 3SFKA 3GIQA 3MUY1 1HZYA 4H1ZA 1ZAHA 2I9UA 2VEKA 2NV1A 1M68A 3PNUA 5IM51 3RM4A 3W6MA 5CG0A 3FA5A 4BQ4A 4JFTA 4AZGA 3B8SA 2I56A 3CZEA 1LYXA 1FP8A 2OX4A 3MBDA 2VVNA 5DMMA 4DEFA 2HBVA 1L8NA 4O1CA 3C3NA 4IPLA 1GEHA 2VCBA 4ADUA 4W93A 2VRJA 1Y8BA 3FK4A 1B4KA 8A3HA 5AC4A 4AC1X 3URBA 2PDBA 5GJMA 4V28A 3PS7A 3BWWA 4M19A 1TPB1 1XC6A 3FV9A 1CZ1A 1V7YA 3HG3A 1XF0A 1FWGC 5AYBA 4D1IA 5MKGB 2XISA 1WYIA 2VEMA 2DZBA 3BURA 4KGLA 2AGTA 1CLXA 1EX5A 2PDIA 3KTCA 1KBIA 1UWAA 3D3FA 5EMJA 3WNMA 4J5NA 8TIMA 2CWXA 1W6TA 4S23A 1JIBA 5AHIA 4DWSD 3KRSA 4M6PA 1IIHA 1X1OA 5AHEA 2ALRA 4UCFA 1R7AA 4DBUA 1K9EA 3LGDA 4XAGA 1CGWA 4Q32A 4ZSTA 1OFEA 2TODA 4AZCB 1KBJA 4XZMX 2CLHA 2PDPA 3FVMA 2G5WA 3WNNA 3EDKA 4HMCA 1VB9A 4XZLX 4AF0A 2VR5A 1ISZA 3C2EA 3GAYA 4C6KA 3AHYA 5F7UA 4NI3A 4DYJA 4C1KA 3DERA 3H70A 4V15A 3RN6A 3S2JA 4C6DA 3LM7A 2DFAA 4IGHA 2PZNA 3LCXA 1SZEA 3G3DA 4NXSA 4PUNA 1B30A 5D30A 3VI2A 4WJ8A 3FFSA 3HQ1A 4R53A 4F2BA 1M41A 3WUEA 4C6OA 4RW5A 3WK2A 2GVGA 2ZRYA 2D0HA 3MCOA 2CIPA 3GKAA 3MP5A 4OBRA 3BQ5A 3WY1A 1B3XA 4B4FA 4FK9A 1NOWA 1KFWA 4F2TA 3IAPA 2ZUTA 1GVYA 2VDGA 1KXHA 4KCWA 1H3GA 3NL2A 4CVUA 3TVAA 3APYA 2W3ZA 4XVEA 5CC5A 1AMKA 5A94A 3QYSA 4O12A 4DWSC 4AB4A 4MFEA 3L68A 4JD4A 3ARZA 2CERA 2QV4A 1M9HA 3QW4B 3VGGA 1KRAC 2J88A 2VRQA 5HQEA 3ARPA 3MSRA 3UVIA 1TUXA 4W5UA 7TIMA 1EOMA 3HG2A 3VTRA 4XIAA 4ZA0A 3M0KA 5DRIA 5D9OA 3STPA 2YW4A 5C9RA 2PDHA 2ZBTA 3BAKA 3FJNA 3MSDA 3KFTA 3NO5A 3NQVA 4TX8A 2ISDA 4N0RA 1DE5A 3W7JA 2GQ3A 4J2PA 3IAQA 2WKGA 4AD5A 3CPGA 4E6MA 2OYMA 1YDNA 1MXSA 2EXOA 3W7KA 4JY9A 5BOOA 3A13A 4IHCA 4HNVA 1GG0A 4RX0A 1G7VA 1QNRA 4YYFA 1XDMA 3S42A 3T0DA 1DWIM 3W85A 3C3UA 1SJAA 1YW1A 4S1FA 3ITXA 5F4SA 1JNDA 4CD8A 2WNQA 4OV4A 1EO5A 1JVNA 2Y63A 4ZTYA 4CUCA 3AO0A 2YZRA 2BY0A 1OC7A 4Z42C 3L4VA 4FB7A 4KPLA 3P5ZA 4P8VA 1TV3A 1VKFA 4Z2JA 1OFOA 3FGCA 3ZT5A 2B0MA 4FIQA 1V0NA 2OTDA 1CGXA 5CAKA 3MI3A 3U4FA 3AISA 1PV8A 4I9AA 5AB3A 2GQ8A 3N34A 3P81A 3BAIA 1S38A 3VNLA 1K6AA 3C2VA 2Y89A 3PJWA 1WZLA 3AJ7A 3TEVA 2Z7GA 1V93A 3P8IA 3UVAA 4YXGA 2NQZA 4XQ6A 2XZ7A 4HYVA 1BGAA 3T0BA 4YHGA 3GXMA 1Z89A 9CGTA 4JFWA 4DUOA 1HUVA 4DO5A 1X38A 2B7OA 3NXFA 2V2CA 1ZS2A 4AVOA 3F4DA 2HRWA 3NQ2A 4N6FA 4DN1A 2PLCA 3P80A 2WSKA 4NT0A 2EKCA 2J27A 4LBRA 5G4WA 4JFVA 1SMAA 3PP7A 4FOUA 2VZSA 1WXZA 3WD2A 4LW7A 1TTJA 2P8CA 3QHNA 4M6UA 3TQKA 1Y5XA 4F79A 1GOQA 3DG7A 1VS1A 2V69A 4LOCA 3NZ1A 3A3HA 2WCSA 1YTEA 3E9AA 5L9FA 2FB3A 4ATWA 2KZHA 1ZL1A 4A05A 3EB4A 4FLQA 4REQB 3QZ6A 3VDGA 1XLGA 2WOQA 5E0FA 2Z2UA 5CJNA 5BOFA 5FL1A 1PX8A 3S6TA 3GZAA 4HBKA 5DCDA 5AECA 2PWVA 2CU0A 1VBGA 1XBZA 3P67A 2XGBA 3SQSA 3HPAA 4W7UA 4DUWA 1TRDA 1V03A 2ZZ7A 3CO8A 3B0XA 1MMFA 4H8NA 2VCAA 1VLWA 5I5RA 2E5BA 3WUFA 4LVFA 3WJZA 3BMXA 3RMEA 3O6AA 3WD4A 4KIRA 1I2OA 4GJ1A 4S39A 3AWNA 1MVYA 2J7BA 3UT0A 4J3UA 2HEJA 4LC6A 3KZSA 3LK6A 1W1YA 1ZY9A 1I1WA 3AS0A 3HB9A 4YS1A 2F6KA 3ORWA 3L0KA 3N18A 2PDJA 3UNDA 3AICA 6TAAA 3DEQA 3I3EA 4ACZA 3FVDA 3BOXA 4MB4A 4NJHA 1L6FA 1QNVA 4YWIA 1PKNA 3CH0A 1FY6A 1LQ0A 2DZWA 2ESCA 3B0VC 2B7NA 4FX8A 4CNUA 4KRTA 1B3ZA 4ES4A 5DBUA 5F4WA 2ACQA 2Q8XA 1H62A 1O6IA 2GGJA 2J8FA 3GTFA 1QOXA 5H6HA 4F0LA 1JZ5A 5GJNA 2PE4A 1F76A 3T1GA 5F4XA 1PL9A 7REQA 3K4WA 4PCNA 2DSZA 2RUSA 5D9MA 1E6XM 1MQPA 1BVWA 1YDOA 2E8ZA 1V3KA 3VCNA 4S38A 4C1NB 4MKSA 3VOJA 4P5UA 1B57A 1O4UA 3RM8A 1BYCA 4GNJA 1R3WA 4NJJA 4HNOA 4GYJA 3KP0A 3SY1A 1GKPA 4DX3A 2P3ZA 1BTMA 1ZPTA 3VD5A 2DZUA 4UIOA 2D2JA 1EB3A 4ZXOA 3UW6A 3JUGA 3STCA 3FHQA 3CUGA 4FNUA 1B9ZA 1UH3A 1EQCA 6A3HA 3NOEA 3E3HA 1UP0A 4KWWA 2SFPA 4AAJA 4IMDA 1NELA 2NVAA 3L4WA 3T2PA 3A9BA 1S2UA 1QBBA 3MVIA 4AISA 5EPDA 2C16A 3NURA 4NRRA 2REQB 1ZHAA 2GDVA 4KKXA 2BP1A 4X9YA 2HSAA 3R0DA 3W1UA 1IEQA 1LOQA 2NXHA 3TYDA 4J3TA 2EBNA 4AEFA 3GB6A 3QPEA 4UFMA 4O54A 1EDQA 1GVEA 3MUIA 3N29A 3R89A 2PA6A 4B90A 4JY8A 1WBHA 3S3GA 3KBVA 3EOEA 3OQEA 1S5WA 3UYCA 1VPXA 3F2CA 2CETA 2WNWA 3EDEA 2W91A 3SCPA 3SIMA 5KZ6A 1H09A 2X0SA 2GWGA 3FYPA 1E51A 1YNQA 2ZUWA 3CNYA 1ITQA 1J0JA 5HWNA 4NYUA 1C3FA 3CQKA 2BGNE 4CQ9A 2EPKX 4JDYA 2JKEA 1R46A 2BTMA 1H1YA 3L12A 3T05A 4KESA 4P7RA 3CLWA 2V5BA 2PLJA 1RHCA 5BXSA 3TYEA 5CH9A 4LAZA 1Q45A 3AIRA 2VMFA 3TC7A 2XFFA 1VFFA 3MHFA 2EG6A 3G1XA 3M0ZA 1OHLA 3WFZA 3KUMA 1LOSA 5CBJA 1JR1A 4NU7A 4H8VA 4C7DA 4IMAA 5I3FA 3FHAA 1FDJA 4R3UA 1F4HA 3CPRA 4LJ3A 4JTCA 3CHCA 3SN1A 4QLJA 3UR2A 3EWWA 2Y8KA 2UZ9A 4AG0A 2XSBA 1X97A 5J5DA 4TR9A 1QPOA 3WF2A 1ZBVA 1YBQB 1DOSA 1MW2A 5A6LA 3U2CA 2A3AA 4JS3A 2MUCA 3VMPA 1TTPA 3CUXA 1E6RA 1E56A 3HZ3A 4QS5A 3A47A 1IXQA 2YW3A 4LEFA 4H6RA 1EHAA 4O13A 1V77A 4CEXC 4BEQA 3TSDA 1R38A 1R3TA 3IUDA 4CNOA 1LJYA 4S3KA 1UZHA 3GDLA 2OPJA 2R6OA 2DH2A 3NZGA 4KWUA 1UG6A 3QKEA 3XIMA 4DO4A 1WUEA 2PU0A 2XGZA 1LUCB 4FMVA 1POJA 3WENA 3Q2DA 4DYEA 2V8ZA 1YPFA 4GI6A 1B31A 1PX3A 3IIXA 2W79A 4FEZA 3IGXA 4JKKA 4CLMA 3PG8A 2E9LA 3GXDA 3NOYA 3ITGA 3AXHA 2PDKA 5GNXA 1HJXA 1EJUC 3CXOA 4JYDA 4Z2IA 1W1PA 4OZOA 3SUSA 5FJOA 5DANA 1EF2A 2FZDA 3CZKA 3I7RA 1Y7VA 5MHBA 1G1YA 3CV1A 4YHEA 5A8OA 2J6XA 2OQHA 2A3LA 2FLIA 2C13A 4KFNA 2G0WA 3L0GA 3AXMA 4RDVA 4N7QA 2DVXA 3REQB 4KCVA 3CWNA 3KWSA 3E0WA 1E9YB 4XTDA 1EPVA 2QXWA 4NAEA 3NM3A 4FS9A 4EWJA 4HSOA 4F48A 1TJ1A 4ZSUA 2TAAA 4WKAA 4JTQA 4I7UA 1Q7MA 4C6QA 1A5KC 4PUKA 3RILA 3QZAA 2OWXA 2GK1A 3MYPA 2WB5A 2DJLA 4NKCA 3CTLA 3I7QA 4Q33A 5FCZA 2P76A 3GFZA 1VJSA 2VEFA 1I75A 2YDAA 5AC8A 3SSJA 4QX4A 2Q3OA 2J7EA 3V1PA 1IR1A 2YJQA 3ABZA 4BQ5A 3W2KA 3WDQA 1OABA 3MJMA 5AYZA 2BVDA 2Z1BA 2WVUA 2P50A 1V6XA 3SCVA 2ISFA 3APGA 3OLDA 4LYPA 4N42A 2Y7DA 3PY2A 1XISA 1M04A 3BLEA 3I4KA 3KBNA 4DZIA 4FNPA 2ZZ6A 3UZZA 3M0LA 4L64A 1JAKA 1KB3A 3EMQA 1C8VA 4IUGA 3KVLA 2BZNA 1R2TA 1TPFA 3F1QA 4F2UA 1QI5A 2ZRXA 3BCDA 4HNUA 2WKJA 3ID7A 3UCCA 4NYYA 4DO6A 1TREA 1TJRA 4PYSA 4ERIA 4Q6JA 4M6QA 1VEMA 4DNMA 1IYXA 3DFQA 4O0KA 2XTKA 1XV8A 1XLFA 2Y88A 2ZZ3A 2V5LA 4P61A 4CVWA 6TIMA 2PDFA 2WC4A 5E09A 3ITLA 3TTSA 2I5IA 1R9XA 2UWFA 3SGUA 3NSNA 1YXDA 4LUTB 5LNWA 3HPSA 1PUDA 4UQ9A 5T9BG 5HK4A 1NU5A 1A5MC 1S2CA 1FWHC 4OHQA 1P1XA 1ZNNA 5EBAA 3WH8A 1QW7A 2BVWA 3BE7A 5HQMA 3H2OA 2BSLA 2E77A 4E2VA 1GCYA 3CM4A 2VGFA 5DRCA 3NQDA 4DJEA 1RZMA 2Y2WA 1Y65A 4KFPA 4LVDA 1ZB5A 2TSYA 1WX0A 3B04A 1CIUA 2YDRA 3POHA 1NDYA 3R1ZA 4FLSA 4XKYB 2D3NA 1BF2A 1OQFA 3WZ0E 5EKYA 1GYNA 4PN2A 4WR3A 5HANA 1ONXA 2PUZA 1OCQA 1XBXA 4B2DD 3W26A 1LT7A 3P93A 1DTUA 2FHBA 3BSHA 3L66A 1UW9A 3K4AA 1HF6A 3W24A 4GVGA 4NQ1A 1MEIA 2F9RA 3GHTA 3TONA 1VPQA 1MZHA 5ABEA 2XSAA 2J77A 4UNLA 3F5JA 3GO2A 3UY7A 3LV6A 4QM1A 1PB0A 4BCEA 1YE6A 2PI6A 3DFOA 2BBFA 2YL8A 3PPHA 1GVRA 2XVPA 4Q4PA 3DG3A 1R3VA 3ITOA 4LAKA 4CU8A 1W3TA 4K2SA 4RW3A 1L2UA 3V3WA 3AIBA 3UA4A 3TOYA 1TA3B 4GIEA 3H54A 2ZX8A 4L7ZA 5FACA 1NY1A 2GJRA 1RA5A 4MAVA 2G37A 3NXLA 3MVTA 3RLVA 1K1DA 1FWBC 3FDKA 3VIPA 1SW3A 3UA3A 4PSPA 3W2JA 3PUDA 1M7PA 5AVNA 4QJ5B 3AU6A 3AIQA 1N55A 4LYKA 1QHOA 2Z6JA 4C6NA 5FJTA 3KVJA 2GSJA 4GKLA 3N2CA 4YTTA 3WEMA 5CKSA 2NQLA 1W5MA 4WHBA 1DHKA 2DZXA 3RLHA 4HNTA 4Y9AA 2J79A 1OSEA 3LGGA 1KLYA 1PTAA 3MMWA 5M1TA 2PDXA 3FW6A 5J8LA 1MUCA 3RHGA 2EAWA 1LCOA 2QLYA 2YYUA 3MDWA 2YBUA 4P7NA 1R47A 3INPA 4AIBA 3WQWA 3KAOA 2ATSA 3V35A 1MRAA 1I8JA 4ZEPA 3V18A 2E40A 3LLFA 1LWIA 3N4EA 3PTQA 4PCSA 3VXGA 1XIMA 3LG3A 4IIBA 4F0RA 2NV2A 2IKHA 1C93A 4L1XA 2WSRA 5DCBA 3SEPA 6PTDA 5CAHA 3FDGA 2QCEA 2X1SA 2AKMA 3M5XA 4EOUA 4NP7A 1RY8A 3DXIA 1WDSA 3IJQA 1GTHA 5JBDA 2GVEA 2V5DA 3ZR6A 4B92A 4QSHA 1G94A