3PC2A

Full length structure of cystathionine beta-synthase from drosophila
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
500
structure length
500
Chain Sequence
RPADFIDPGKPSKCKWHLGTAEKSPHIHRGIAHRQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTIIEPTSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHARKLKKGQRCVVILPDGIRNYMTKFVSDNWMEARNFKEPVNEHGHWWWSLAIAELELPAPPVILKSDATVGEAIALMKKHRVDQLPVVDQDDGSVLGVVGQETLITQIVSMNRQQSDPAIKALNKRVIRLNESEILGKLARVLEVDPSVLILGKNPAGKVELKALATKLDVTTFIAAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CG1753, isoform A
publication title Structural basis for substrate activation and regulation by cystathionine beta-synthase (CBS) domains in cystathionine {beta}-synthase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Lyase
total genus 178
structure length 500
sequence length 500
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3pc2A03
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pc2A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pc2A02
1KFEB 5LXQA 1TDJA 4D9CA 2OOXE 3IQIX 5IXJA 2Q3CA 1TZ2A 2C2GA 2UV5A 5CGQB 2RIFA 5I7OA 3PC3A 4HN4B 1UIMA 2RH9B 1J0AA 3IQGX 1TYZA 3VSCA 4HPJB 5B1IA 4D9KA 2YVYA 4D96A 1A5AB 1K7XB 3TE5C 4XUGB 1C8VB 2CLLB 4HO1X 1TTQB 2QLVC 4D99A 3IAUA 4JBLA 5B1HA 4NOCA 4D9IA 1TZJA 4IY0A 5J43A 1OASA 4OREX 4FRYA 3R0XA 3ZEIA 1PVMA 4F4FA 2Q3BA 4NEGA 1VE1A 4AIRA 5DBHX 1P5JA 3BM5A 1M54A 4L27A 1Z7WA 1K7FB 3X44A 3VSDA 1A5SB 5CVCA 3KXRA 5HBGA 1V7CA 2OOYE 2TSYB 4HT3B 2D4ZA 4ZU1X 2CLKB 5T6MA 1PBJA 2CLMB 3OCMA 2QH1A 2YZQA 5K22B 4Y6GB 1WBJB 4IYSA 1RQXA 5C3UA 2QREE 1Y5HA 2ZPUA 3TDHC 1VE5A 4PCUA 1JBQA 4I1YA 3R0ZA 1FCJA 1J0EA 5KINB 1J0DA 2RKBA 2O16A 2CLHB 1O58A 2PFIA 1UBSB 4AECA 2UV6A 2ECOA 5D84A 1CW2B 4D9NA 3SS7X 2CLIB 3FCAA 1KFJB 2ZR8A 2RIHA 3FWSA 4D9BA 5I7RA 5B55A 5K24C 5B36A 4KKXB 4IY4A 2ZSJA 3AEYA 2GN2A 1KFKB 4DQWA 4QYSA 2ZY9A 1Y7LA 2J9YB 5I6DA 4IL5A 5B3AA 1BEUB 5IWCA 1PWHA 5DW3A 2DH5A 5IIPA 3VBEA 3SPXA 2CLFB 5DVZA 1O50A 1KFBB 3V7NA 2EMQA 3L6RA 3TBHA 1K8ZB 4GQYA 4FXSA 1Z7YA 2EFYA 1WDWB 3LV9A 2D1FA 4LI3X 1PWEA 3OCOA 4GQWA 3FNAA 3L31A 2OUXA 4OFXA 5MMZA 4P1GA 3PC4A 4L3VA 3L6CA 3FWRA 1A50B 4WX2B 5J5VA 1YAVA 2ISQA 2RHGB 2J9ZB 2EF7A 2UV4A 1K8YB 2DH6A 3FHMA 4D9EA 5I7AA 3DDJA 4GQVA 1XKFA 3VC3A 3DWIA 2ECQA 1E5XA 5JJCA 4UUUA 1TZKA 3DWGA 3SS9X 3HF7A 1F2DA 5K25C 1C29B 3X43A 1K7EB 3T4NC 5DBEX 2TYSB 3PR2B 3L6BA 4LMAA 2EGUA 1TJPB 4D8TA 5I7WA 2JC3A 3KPCA 4O9KA 5K23C 3FGPA 4D97A 4COOA 3VSAA 1WKVA 1K3UB 2TRSB 4HG0A 3HMKA 1VB3A 5KZMB 2QRDE 5BW6B 4D92A 4D9FA 1KL7A 4IY3A 1BKSB 1V8ZA 1J0BA 3OI8A 2RC3A 4ZU6X 4D9MA 2YZIA 4IY2A 4P1OA 3CEPB 4LMBA 5JISA 3LFZA 4D8WA 5KS7A 5I7HA 3K6EA 3KH5A 1X1QA 2P9MA 2PQMA 2CLOB 4H27A 2CLEB 3GBYA 5E0KB 1TZMA 1FUYB 2UV7A 1D6SA 1A5BB 4ZQCB 2GN0A 3FV6A 3I8NA 2BHSA 4NU8X 2O2JA 1QOQB 2NYCA 3AEXA 1KFCB 2C2BA 2J9XB 2V03A 4JBNA 5IW8A 5B53A 1WTCA 4L28A 2GN1A 2WSYB 3KPDA 2O2EA 3SL7A 3T4PA 4HPXB 1V71A 2QRCE 3ORGA 3L2BA 4D8UA 1K8XB 5EY5B 3LQNA 5D85A 3PC2A 4ESYB 3LHHA 1C9DB 2NYEA 5DW0A 1TTPB 3K2VA 2YVXA 1QOPB 3RR2A 1UINA 3IQHX 1CX9B 2Q3DA 3DKIA 3KPBA 4ESYA 2QR1E 5D86A 1J0CA 4D9GA 2BHTA 5D87A 2YVZA 4L0DA
chains in the Genus database with same CATH superfamily
5FUMA 5J2TF 4G5FA 3L1JA 5LXQA 3EZFA 5LYJF 1PDOA 3FCUB 1OC4A 2V4ZA 4IDNA 5K7SA 4RK6A 3IO5A 3NZEA 3IQIX 2CXTA 2B5VA 1D6NA 4P3XA 2JPDA 1S9HA 3RRBA 3SDSA 3SYKA 3UJ6A 3LUGA 3JWHA 1YIAA 5A7FA 2VHJA 4A0RA 3ZHCA 2JFQA 2QLNA 3HKDB 4J8PA 4HDSA 4EG4A 2ATVA 1A0OA 3EGXB 3VTAA 4CODB 2V6BA 3D6TB 3ENWA 3LY8A 2PKQP 5AJXA 3DZHA 4HBZA 4UCFA 2CV0A 2BI8A 1R0ZA 3E7DA 2GBCA 4RSGA 5K6RA 4LZZA 1KE2A 1XD9A 3KUCA 4BNXA 3WJ7A 2ZSEA 2PH7A 4D4LA 4MSUA 1WXHA 2NGRA 3VR4D 4ECAA 2FAXA 1TM7E 2ZBEA 4MR8A 3T94A 1N4DA 5DSXA 1R6XA 3ZHOA 5EUMA 5EMJA 3IMFA 3FROA 3A9SA 3K3PA 4S1TA 1V26A 2MMCA 4F04A 3AB8A 5ECYA 3WLFA 3AONB 4AICA 3ECAA 5C31A 1ESEA 1ESMA 2FZKA 3GJRA 3UXYA 2GEVA 1EWVA 4WUTA 2IODA 4K9MA 1RQGA 2ZR0A 2XWPA 1DKNA 4Z8YA 5TPZA 1EUDB 2FFHA 1Q74A 3PU6A 3KZMA 2B2NA 5BMVA 2VDOB 5A5DA 1ZD2P 5IDQA 4CLDA 1NIJA 4TLCA 2P90A 1JQEA 3CB2A 2JANA 3CPJB 3DQQA 3LP8A 3P32A 3QXJA 3KL2A 1EDOA 4KQKA 4LSWA 3FMGA 4FHCA 1NMQA 4QYIB 4WEOA 2JLXA 4LF9B 4DLTA 2QZJA 1KJNA 3IL2A 1UM8A 1WS6A 2NSYA 4M9ZA 4URUR 3ZWAA 4AWXA 4QDZA 1QIMA 4I08A 8ADHA 4HH3C 1YFLA 1MTOA 5IK2A 1MX3A 4NYJR 2XW6A 4TV8A 1SBNE 3A4IA 3GIDA 4HNTA 1TIBA 3N2GA 1TI7A 2RGRA 1LLQA 1T2FA 3OZTA 4RS4A 2O8FB 3VMFA 3ZLTA 2O0KA 3DMHA 4Y6PA 3D6VA 3VR3A 3WQSB 3IMKA 3TD2A 2VJQA 4DABA 4B2LA 3KC2A 3PNBA 2SCUB 4EPYA 1GLVA 4JP2A 4DS3A 1EK0A 5IKXA 1QCDA 5DI9A 3WGYA 3ZIAD 4ZGBA 1MO2A 2CMKA 1P0CA 2O5EA 1CY4A 1NVGA 2B36A 2CV1A 3M2PA 3RHZA 2DBVO 2WD8A 2EFEB 3IP5A 5EQFA 4K81B 5CB4A 5E6SB 1ZUWA 1C7EA 2XDYA 3DMDA 2AFIA 2OFXA 6NULA 5C52B 2QM0A 1ZW6A 1QKIA 2V54A 2IELA 1M2VB 4IIUA 4W6ZA 2WWWA 1JQLB 1NJ8A 1UFOA 1SCNE 2EZUA 3GN1A 3VSDA 4L50A 4TXHA 1CQIB 5E7JA 4GNKA 5HA5A 2X3YA 1YDHA 3BHMA 5F76A 2OOYE 1NXXA 4IZ6A 3NAMA 5KJEA 2AWNA 5LZ9A 4P7BA 3NHKA 1P33A 1OA1A 3EASA 3RSLA 1XRPA 3GX1A 2CHFA 3NT4A 4ME6A 2DGDA 4YRLA 4QU9A 3L8MA 1RYFA 5ESRA 5F7JA 3VHXA 3CZRA 2NO9A 3ZOKA 1LDEA 1X74A 3H9EO 4FZJA 3VC2A 4KIWA 1LDMA 4G0QA 3SEAA 1T91A 2FWBA 1JQDA 5JCJD 3INRA 1RTTA 2P9HA 1TVMA 2ZRAA 2W48A 1B0PA 4NEHB 1U8ZA 4O4JF 4I9UA 5TRTA 1LVUA 3SGLA 4EGSA 1X1RA 2JLSA 3GYGA 3VYRB 4YCNA 1N57A 3U37A 1XEFA 2C2YA 1MRNA 4J1TA 1NVKA 1YZGA 3JATA 5AO9A 5ELMA 4WK0B 5KYNA 5DYWA 1YS2X 4LTNA 5K22B 5LC1A 2GM3A 1KVRA 1BW9B 4I2VA 1Y0BA 3BMXA 4FFRA 4MMXB 1H2YA 3ZU5A 2JGFA 2O8BA 1U8FO 3ABIA 3AFGA 4XX1A 3QYJA 2QBYB 1EK1A 4L5YA 5T5QA 4B75A 3PXBA 4EKGA 4L5JA 3N3AC 3HJHA 1DKQA 2P9TA 1Q0HA 4MCIA 3IEIA 4PCUA 5EC8A 1W4ZA 2MSDB 1QMPA 1CYDA 3EDQA 5IMBA 3S44A 4IJUA 4Z99A 3TLZA 2PAFA 4LEIA 4XSHA 4XGIA 2XDQB 1RE0A 2GCIA 1Q16A 2V74B 2PUBA 4IUDS 2FMIA 3D4BA 1GPUA 3IJRA 1GYRA 1T0UA 3UB2A 1NP7A 1PL0A 2VR1A 3MQFA 5JALA 4DEXA 2E1RA 3HNRA 3TRFA 5K6AA 2NUTA 4FGWA 1YI8A 2NUAA 1C1HA 3BWMA 4LGMA 2NZXA 4NCNA 1NLZA 1R0WA 4OHXA 5I4IA 3I1YA 3PGJA 2ATXA 4JI0B 3OLYA 3WBKA 2ZWVA 4UFOA 5IAJA 1KWGA 1T2UA 4BKRA 1OLXB 4P3KA 4PRZA 4M1SA 4WIAA 4WOKA 3FUWA 4YV2A 1DFGA 2W6ID 3DZCA 5FWAA 1QHNA 1VJ0A 4JDUA 3NXSA 5HDBB 3ZKWA 1XU7A 4TYWA 1QHXA 3RC8A 1R8SA 2HFKA 3DEJA 4BCCA 4Y2TA 5A0FA 2R5WA 1CE8B 3EYWA 1UOQA 2FWMX 4TKUB 1YQWA 2DG2A 2G04A 4RIIA 4EJSB 4IY4A 4ZOLA 4D4MA 4EZEA 1UAAA 3R5FA 2BLLA 4US0R 4MQFA 3G5UA 4DREA 3L0PA 3WLRA 2YWRA 1KJZA 5F2EA 1DLJA 1QE0A 2FEOA 4BRUA 4QOHA 4WLFA 1BCRA 4QFCA 4WK6A 5FBZA 3L0YA 3QG1A 4IOKA 4C2AA 2FR0A 4N3GA 1ISGA 1XTIA 1SQ0A 2AG0A 2G09A 1LUAA 2AOTA 1OH8A 1J9ZA 2A94A 2C82A 1PV4A 3U60B 1YB1A 4WNAB 3GVCA 3K7EA 2VJDA 2WIAA 2IS6A 1FTNA 1KWKA 1BEUB 2CFRA 2NZWA 3SC2B 3G0GA 4NU0A 3CLKA 5ALFA 4V0LA 5BRJA 3EIUA 1EXMA 1E0JA 3SNHA 3S5UA 1W76A 4MW0A 1VSTA 1L7EA 3B20A 4FCCA 4TMWA 5DH9A 1L7MA 3IVCA 4S0ZA 3SYMA 1G42A 3A6DA 3H8WA 3U4GA 4IXMA 5AM1A 2AFHB 4N0EA 4I4IA 3RAJA 2JKVA 4EA7A 3RC3A 1E4EB 3B1WA 3V6MA 2YXLA 3WYFA 4S04A 3TBHA 4I5EA 2EZ8A 3E3MA 4RM2A 1K5HA 4EPVA 4F84A 2AN5A 1BOFA 1I4WA 1U2DA 4OLAA 2P4EA 3F5SA 3RRZA 1X8LA 1HE3A 1NR5A 4EVQA 1B1CA 2BOVA 4NDAA 1CHDA 4G85A 4I55A 4OXIA 2OXRA 4CDNA 3A1NA 3BGSA 4J94A 1GG8A 4JLAA 1L4BA 3HUTA 3NHUA 4MV6A 1YQXA 1YUNA 4NSNA 1PQUA 4B3DA 1T0JB 4BLQA 4E94A 3CFYA 3U3ZA 3X3HA 4BBPA 3H6HA 3S2SA 2ONKA 4OHRA 1N3YA 4YUWA 1XF1A 4GHWA 5K8IA 4MRMB 2VP6A 3S27A 2Z30A 4H0CA 1DEXA 1XVTA 2VPPA 3FJ1A 2PVCA 1T29A 3PUXA 2COKA 3H1PA 4NECA 4ZZ3A 5F2OA 4JI8B 3DR5A 1I01A 3CF2A 1T3TA 2EBFX 2ZJ0A 5AVYA 2HXGA 4P7GA 1P7PA 4H35A 1IBMB 1XXHB 4L8YA 2HW8A 2IZ1A 4WFIA 4Y30A 4ESHA 1ZGHA 4I6GA 3HUDA 4D9EA 1LPOA 3LP5A 4OO3A 2VDPB 1NULA 3R7DA 1ODKA 3K70C 3OZFA 4Z9AA 1YR3A 2Y77A 4TRNA 4Z2YA 3RTCA 3RG2A 4WTOA 3CZ4A 3VOSA 1G0OA 1Z4OA 2DX7A 4PQGA 3OSUA 4AAYA 4EMTA 5JJCA 2QUZA 4E5YA 4UUUA 1ZISA 4KQXA 4JC5A 4DSAA 2QR3A 3ZWYA 2ODWA 3LX4A 2YZKA 5A4IS 1A9RA 2HM7A 3IAS6 3TL2A 2BFDB 3U0BA 3K0BA 2HQRA 3ST7A 1K7EB 3K6SA 1II9A 4IV5A 2HU2A 2MWMA 1X1SA 1KGSA 3LQ1A 2JARA 3WLQA 2P4QA 3L1KA 1I7DA 3MCTA 5LKRA 3GVXA 5CVDA 3TN7A 3KQQA 1CP2A 3DE3X 1ZYUA 2PZMA 4F2GA 3IIJA 3OOEA 4YRAA 3D7NA 5LQCA 4M0EA 1Q7CA 4LY9A 2DPGA 3UA3A 1U7DA 4RADA 4YUVA 1O0CA 3WIEA 1XTTA 3GUCA 4JEUA 5IJXA 3L4BA 3SAJA 3ZWKA 1U2ZA 1OT5A 4XR9A 2GZ2A 4FMBB 2DAPA 1U3TA 2ZU0C 4HUQA 3ANNA 1Z5WA 3ND8A 3UFXA 1BD4A 2QL9A 3OF3A 4GEKA 4PVDA 4FCTA 4RQUA 1NVFA 2QW1A 2TMKA 3UT0A 3ZD7A 3WYBA 4BZPA 5DCUA 4IHAA 1WY7A 4BYGA 4G0UA 1A4RA 1EJ2A 1RHMA 2CXOA 3VMMA 1R0YA 3G9XA 3V8RA 3K8ZA 4G2TA 3QVMA 3CRNA 1AKVA 2HNKA 5E3JA 1KAEA 4Y6SA 4H7IA 3WB1A 1ZICA 3FMVA 4P81A 4I1RA 1DLIA 1BJTA 2X0JA 4XDHA 4O8ZA 2F8LA 1Z75A 1IONA 2VQDA 3KB6A 3ZU3A 3GLIE 4TPKA 3IQZA 5JATA 4I50F 1GFIA 2F59A 3ZDAA 5IHPA 5I7HA 4JFRA 3WLTA 2I7XA 2HCJB 2H57A 1NI3A 3HY6A 3PDIB 1CY0A 1KJIA 2QX7A 4HB4A 2V7BA 4K7JA 4RVCA 5FBVB 1X1QA 3AH8A 5I7EA 3W6UA 5ALNA 3HCWA 1ECLA 1H85A 2VXBA 1WMDA 1U3DA 3GG9A 5KI6A 3TNFA 5I7VA 5JASA 1GM5A 1N78A 1DC4A 2ZBRA 3EFHA 4KQ9A 1T24A 1E6KA 2YNMD 3OZGA 4A2QA 3V7YA 1FUYB 3N8DA 2J3LA 2WJ4A 4Q4JB 5K0GA 1PNQA 1ZESA 3BVPA 3HYRA 4V3CA 5IAOA 1CCWA 3S28A 1OFVA 4O63O 4EPXA 5EHXA 5EP2A 4B3SB 5AIBA 5JAUA 1VYHA 5E2AA 5A3VA 3UGTA 2OG2A 4F7WA 4CFZA 3AKEA 2HQOA 1S2NA 4OSEA 4ZVOA 5B4UA 2ZTUA 3AF1A 3II6X 1JQ5A 3QVOA 5H9VA 4QUDA 5KBYA 2X4IA 3GEMA 2C4HA 3RREA 3DE4X 5J5AA 3FTEA 4MYCA 3C6ZA 5F7OA 2GXAA 1K2WA 4C08A 1QYRA 2AXQA 3VH4A 1NAIA 3WNCA 3QVJA 3EXHC 1IY0A 2JCXA 2B0JA 2PTHA 4H77A 2KHZA 3A32A 1NG9A 1ID8A 3O74A 2AIRA 3T5CA 1NKVA 2A5GA 2ZE7A 3VR6D 4RH1A 4PZPA 3GEPA 1AQNA 2IOFK 3OMXA 4K6OA 2Z6VA 4L4SA 4RDIA 1EA5A 3H18A 1OYWA 2GK4A 3I6ZA 3QE4A 3TL3A 5B7GA 4NMMA 3U61B 3SDBA 4U1RA 1KMHA 2OESA 2BDEA 2QUJA 1XDDA 2VG8A 3PUWA 3S99A 1QC5B 4HS4A 3EBLA 4IR7A 3T95A 3RYCB 3AGPA 4UU8A 1Q0ZA 2FHSA 3KRTA 3KAKA 2VUIB 3GDOA 5CB6A 4GI1A 1ZVJA 3P9PA 3R76A 4AJ1A 3IPAA 1NYTA 1RRPA 2LUOA 2W8BA 2P8SA 4BKQA 4YRZA 2NQ2C 3C41J 2BY4A 2WSYB 3L06A 3R3WA 2J0EA 5FL7A 2WB4A 3PA6A 5C8DA 5I5GA 3NMUF 1R0BA 2PYIA 4H1UA 1V7ZA 2QVGA 5EZQA 4B17A 4EI7A 1EQ2A 3T9BA 1SVNA 2BGLA 3FNEA 3BICA 3GUUA 4HPXB 5DGDA 5FLKA 1WVMA 1Z6QA 4ZKDA 3HBFA 2PA0A 4I19A 1G1MA 4PZLA 2I91A 1PT5A 3KDAA 5E7MA 4BN0A 1XZEA 3QY9A 2FQYA 3OG9A 4M0DA 4EG8A 2BMVA 3SYNA 4AKSA 4OHWA 5EXSA 2PT5A 4GIBA 5IBCA 4OHMA 3LD9A 2AA3A 3A9VA 1Z4MA 1Q1BA 5KYUB 3RK1A 3I9V6 1JHXA 1CRZA 1U5CA 4CDRA 4X8LA 1R6UA 3K4HA 4E3ZA 3OD5A 1XL1A 3T9FA 2YKGA 4XDYA 4HVCA 1LVHA 3P9SA 4QEKA 2HRRA 2NV0A 3LPLA 1RXVA 5LB4A 1BHQ1 1MOSA 3Q1KA 3RAFC 1U65A 2F43B 3G5AA 4FGZA 1OBVA 1AS0A 2Q50A 5JVDA 2CJWB 1LF5A 3M83A 5DRTA 3ZWVA 1SKMA 1QMGA 1YSCA 4DJAA 4YIHA 2HA2A 3HJUA 4PZEA 1G64A 2ZWPA 1RVV1 1UIRA 1BA3A 3SU8A 1K9SA 4H1VA 4OJTA 1BMTA 1IQ0A 4KN6A 3KPBA 3ER6A 4JLBA 3QUSA 4Y2QA 1M2OA 5COAA 2YOHA 3DLPX 1E0DA 2G40A 3AY3A 2RGYA 1JTEA 3JVIA 3T5BA 1S3FA 3C7TA 4RKFA 1G41A 2K5UA 3FPFA 5BSMA 3GLFB 5A7HA 2CVPA 2XXBA 4UD6A 3VNUA 4FTWA 2NP6A 3ITDA 3JAWA 1Z25A 1FNCA 1GPAA 2ZU6A 3LY5A 2E89A 5G53C 4FN4A 5AVVA 1DAHA 3BJEA 3ZV3A 2I4NA 3PEVA 4HXYA 4IXTA 1PO7A 2OOXE 3EW9A 5IXJA 2VC2B 2XJ9A 2JLBA 3GN2A 4Z1MD 3MRTA 2FF5A 2O0MA 4Q3NA 4MROA 3NDPA 1NV8A 1A9XB 2NOAA 2JHCA 1OWNA 2F6RA 1XQ1A 4JSTA 1E7RA 2DUJA 4A1FA 4BP8A 4PXSA 5ES3A 1PYDA 3FDZB 3S2UA 2G5TA 3D31A 3RIHA 2W2VA 1PT8A 4GOXA 2VDVE 2REQB 3EJWA 1QU2A 4MVJE 1M7GA 4WOPA 1P19A 5CVTA 3VOAA 2VDMB 4RPKA 3IQGX 1NJGA 2BFCA 3BXEA 5K2MA 4QBGB 2PZAA 1BS1A 2KQUA 2XYVA 3HXKA 1X70A 4J7AA 3V2HA 1WKCA 2B8EA 4YAGA 3JTMA 3BXZA 2XOKD 4D9KA 3FVRA 2MYUA 4WOBA 3JQFC 2A86A 4W5QA 1OGYA 1ZUNA 1Q2XA 3GT4A 1K7XB 4K6HA 2CVFA 2PUHA 5F51A 5IJAA 1UJMA 3HLKA 4LGYA 1YCDA 1CEQA 2NPOA 3NI2A 2XGMA 4RKEA 3WL6A 1R37A 1U0HC 2BGUA 4FVTA 4DG5A 3F3YA 3DTTA 2DWPA 1UQRA 3QEJA 4RFSA 4NZYA 1D6JA 3T41A 4DARA 1UDBA 5TSDA 1XALA 2BZ1A 2GWHA 4WACA 3TQRA 3D8NA 1U2QA 3V55A 3T9EA 3W1EA 3D7RA 1EFKA 3PPXA 2OE2A 4Y0AA 1G7CA 3CIOA 4P4NA 4ZAFA 1GPNA 4QXAA 4AQDA 3HA2A 3IVGA 3M49A 3IAUA 4MVYA 4U0JA 3STUA 3HC7A 1KDZA 2IPAB 5CT6A 3STYA 1AH2A 3HFRA 2YNMC 5AW0A 4X1KA 5KU1A 1TZJA 1O4VA 4P3PA 1ZNQO 1Y8CA 3HH8A 1UMKA 4ISCA 4NOJA 3I9NA 4PCLA 3TPFA 2IK8A 3UNXA 1LI4A 3PGXA 5KTPA 1G4AE 1K3FA 3KEMA 4Z7JA 1EVLA 2FOIA 1T9BA 3H5VA 1UBUS 3EA0A 4PO9A 3RSHA 3TQFA 4QYWA 4OX9Y 2WW8A 5FPSA 4FRYA 1GU1A 2ET6A 3HB5X 4LRSB 4MVJG 5F2NA 4RK1A 2YIMA 2ZRIA 3I0NA 4D98A 1Q3KA 1F8GA 5EMMA 3AVOA 2Q3BA 4BUCA 2RHHA 4X1IB 1WVIA 2YWCA 3HJCA 1XJ5A 2AT1A 4R3WA 1BROA 5LXTF 3IUMA 3NCHA 1CR4A 4BL5A 3QEKA 5JFOA 4ZXPA 2C04A 4D45A 1ABEA 4EHDA 1SWVA 4HQ6A 4RHEA 4E5NA 1HA3A 5CFNA 3BRWD 4WZ6A 3ROMA 4GC9A 3VU9A 4L27A 5FTNA 4IJ6A 4XD7A 2ZRQA 4DCGA 5JPCA 3W7AA 4EHAA 2F1JA 4LOHA 1T3SA 3Q4GA 1P5RA 4UNRA 1OX6A 3UJDA 2YYYA 2ZJAA 4ITRC 4CQLB 2AQHA 1YR9A 3EMVA 3HPQA 2KYRA 4N5LA 3QBVA 1XRMA 4GYJA 3KXRA 2R65A 4JL8A 3DV0A 2G4LA 2G4VA 4L6IA 5DBOA 4ND4A 4BBJA 1YJAA 3RLIA 4MW1A 3SWWA 2C4VA 4E1AA 3I37X 4ALJA 5DMXA 1YE8A 4Q01A 2OCDA 3OQJA 4XWTA 1HKUA 2YZNA 1MBZA 3NASA 4ENUA 3STVA 4Q7EA 3CRW1 2W2MA 4RKWA 3KDPA 4GWKA 2GYVA 3EC1A 2IA5A 4KNWA 2QUAA 5EMLA 1XF9A 5T6MA 3EJ6A 5CFRA 3RSQA 1E1DA 1L4KA 1HDCA 1RZVA 3HLTA 4PXAA 5EINA 2O5RA 2OVBA 4ZT4A 3UT6A 4DLXA 4MDFA 1N5RA 4CIXA 2W6ZA 1WB4A 1V16B 2WUFA 2ZUVA 3CNNA 4YH1A 2FMFA 3WWZA 2QH1A 2FW8A 2FFAA 2G9VA 5K4AA 1Y1PA 3HCCA 4BMPB 3I1FA 1C50A 1DIAA 1EK6A 1Q84A 4NZZA 5B6IA 4ONEA 4BNJA 1V3TA 2EJWA 3NBQA 4P6VF 3GJTA 2E7ZA 2H8KA 1YS4A 1ACJA 4LNAA 1RXCA 2WBLC 4B3BA 2P3SA 4LIPD 4COKA 3ANXA 1OTYA 4GM1A 1P9WA 2EFJA 4DZRA 2GEFA 3KV1A 2FP3A 2ZUBA 2W70A 2E82A 3NUZA 5IYZA 4TT3A 2D7DA 3OEHA 1KY3A 3VQTA 4BV8A 4HADA 2MINA 1Y1TA 1YQEA 4IDAA 2VSOA 2WSMA 3OCYA 2Z8XA 4XJTA 3B7WA 1SU8A 1J0DA 1US8B 3R7WB 2NZ8A 4RVOA 2YWHA 4PYIA 2J0SA 2GMWA 1IU9A 2MCFA 1NQXA 1JP7A 1TO2E 1R00A 1HQDA 4MITA 1RP7A 4RF4A 2G5CA 3GXOA 2P2YA 2WUVA 3JTEA 4V0ME 3WHIA 3TF5A 3KSBC 1L8AA 1SBIA 3KELA 1TM4E 2E4UA 3HYCA 1PEKE 3I04A 3EWAA 3KR0A 1JV2B 3CG0A 1H69A 3ORQA 3QELB 3QOYA 3AZQA 1YIDA 1I6WA 4LYEA 4X61A 4KU4A 3Q12A 5FA6A 2RGUA 1XRRA 2VSYA 4WECA 2O52A 2G63A 1Z15A 1QYDA 3MSCA 1OT3A 2WVGA 3BMQA 4JIMA 3MXOA 1QBGA 2OC4A 4NX2A 4JUCA 2JJ2A 2PIDA 4TLDA 2H1RA 5A6SA 5AW9A 5LZ8A 2C2HA 4M1WA 2I22A 4EJ6A 4FE4A 3KWJA 1P0IA 2CY0A 2ZK7A 1MO3A 4RGYA 3CUWA 3ZXYA 1XHFA 4KNVA 1OI7A 2LPMA 5F52A 2GGSA 3BOSA 1NU6A 2HRQA 3L7LA 5KTRA 1WUYA 1DFIA 3LUHA 3OU7A 3E23A 1GP2A 2W7TA 2ZJ7A 1AGPA 2BFMA 3EQ8A 1NGSA 4QJ4A 4QYSA 2HIGA 1IN6A 1DAMA 1M1NA 3NBYC 3LVBA 3LZ6A 4IVNA 1GKIA 2Z3VA 1T0IA 3TZCA 2DUWA 3GRFA 2C7OA 4BNTA 2GEBA 1H5QA 4CTKA 3D64A 4L7QA 2FN7A 2J0VA 1VLJA 2CWWA 3HWX1 2X8AA 3O4HA 4O59O 4QUIA 3HCFA 4HNSA 1UXGA 1Z56C 2BBWA 3OZCA 4MV8A 1JAHA 1HQCA 1RHUA 4NFSA 4WQMA 3UJCA 7GPBA 1CFJA 2O6LA 3MD0A 2IPLA 3OZXA 2F00A 4NJMA 5A4KA 1PJCA 3L6RA 5F73A 1SVUA 2P30A 4DWJA 5MFZA 1JR4A 3AF3A 1T1SA 3OY7A 4I99A 1M74A 4YJ2A 5JBNA 3W6OA 3MMSA 1K08A 4LCEA 3GZJA 1Z18A 1Z5UA 1U6JA 5IFLA 3A3PA 4OGKA 4S3MA 2J6BA 2QNBA 3GRCA 2B20A 5DV9A 2PT9A 4JLVA 4NE9A 4UOEA 1C3OA 3GRUA 3L7MA 2MYTA 1M2FA 1J8VA 5HQ3A 1K68A 5DLYA 1F48A 3S4YA 1BWSA 1FP2A 1U99A 3H6KA 1XVAA 1HT0A 2HJWA 3GCWA 3OFJA 2QN6A 2J87A 2Z4RA 2O2YA 4JZKA 3AR7A 2QWXA 5I45A 2M6KA 4P2GA 4YMTA 2PT7A 2X2OA 2FPSA 5JZMA 1NLUA 1XHLA 4Q3AA 2F1IA 3TAXA 4C06A 3LHIA 4ZHQB 1IBKB 4DR2B 1E7QA 2Q49A 2RARA 3M4ZA 5TQVA 1JKXA 2HWYA 1KI4A 5CYPA 1YUBA 2ISQA 4Y2YA 4V0KA 4BWGA 3GDGA 1CKEA 3D2BA 4TRJA 3UFBA 2XF2A 3X1JA 3D3KA 1D03A 1C9YA 3FI0A 4P36A 5LWHA 5EP3A 1RC0A 1ESNA 1FPQA 1MNQA 2XCQA 3G1UA 4MRPA 5GP1A 4L5AA 1W46A 3B12A 4AXBA 4E15A 1U2SA 4X20A 1L5KA 3QQPA 3WK7A 2G3YA 2NXWA 3KG2A 4Z49A 2NU8A 5FWNA 4FHDA 4ZVKA 4DEVA 1H65A 1IVSA 3ZK8A 4EY5A 2PD6A 3EOBI 3OSZA 5LP6F 5BWMA 1JBKA 3W6NA 2OQIA 2V6GA 1PQWA 2ZYUX 4FMCB 1S0UA 4LXXA 4M1QA 4CMBA 4HB0A 2XDWA 3MMXA 4M9XA 5ESXA 2EIXA 5EJ6A 3MMZA 3QXGA 4LQ4A 3CBQA 5FFNA 1WCXA 3H75A 5LDHA 1TTTA 3RQIA 2V7QD 3DWGA 1TM1E 2H17A 1GCOA 4GLJA 1GUAA 4L57A 4E46A 4JJGA 2OBLA 5D3KA 4MIOA 1C29B 4TRMA 3F6YA 1N2ZA 4HTFA 1AGYA 2VBGA 3F9IA 3FDIA 2PJUA 1EK5A 1I1HA 3GQBB 4QICA 4AMYA 3WV4A 2ZIEA 3KNZA 5AW6A 5JT1A 2DERA 4YV0A 1H0RA 2FK8A 4TN1A 1LZKA 3RUDA 4JCOA 4A9AA 4Q4DA 2AQIA 3H1BA 1K7YA 1WXGA 4YAWA 3SF8A 3DV2A 4MLZA 1G20E 2EX4A 1DIBA 2JFXA 2QIOA 1LBHA 2VAMA 2VYVA 1DMSA 1ODTC 3NC4A 2PGIA 4U6SA 2BTOA 2C8LA 2Q0SA 3M1YA 1TD9A 1KEPA 3ZDZB 3ZV7A 4LWZA 4MYUA 4FZRA 2BFOA 2BW0A 3BH6A 3Q7RA 3HWSA 2M9MA 1Y82A 5FO0A 3TOXA 3DFIA 4PBRA 4OAPA 1YVPA 4LJYA 1Z36A 4YAEA 2Y1DA 4X24A 2HK6A 2C95A 2DTXA 2Q41A 3TNDA 2NMVA 2ZSIA 4TVKA 2ENWA 2ZVDA 2B35A 1H1TA 2WJ3A 1T36B 3H4IA 4IDHA 4IGKA 4JLDA 1ZONA 3MJEA 1BGWA 1NBEA 3WI7A 2VAWA 4A23A 3F0TA 3UCXA 3FPLA 3R5HA 3BD8A 5JPIA 2YZIA 1HDIA 1GKKA 3MTDA 2WE7A 1OF1A 4WESB 4Y1EA 1XO1A 4G4SO 1RKBA 4CWAA 4V39A 2WKPA 2PQMA 4BZZA 3WY9A 3R2JA 2ZAIA 1FNNA 1QLWA 1IM8A 3UWDA 4A5SA 3QTBA 3VO1A 2R44A 1KK3A 1RM5A 3CEJA 1H94A 1Z83A 4TOIA 1MT0A 3WGIA 3VA7A 1UQUA 3R1IA 2FP4B 3DL4A 4EAQA 4QDXA 2OBFA 2YWEA 3GEDA 4KPUB 2GF2A 2YVAA 3EODA 2PX4A 4KIUA 3AERB 3KLPX 4HH4A 1JG4A 3HNOA 4DGQA 2Q8QA 1ND5A 1TIPA 1RYBA 3IOYA 3K92A 4E08A 1XEAA 4F4IA 1J6UA 2FLVA 3MGKA 3F3KA 3CVOA 1RHRA 4FDLA 4L08A 3RCBA 1PFKA 2W6IA 2VRBA 4J4TA 4JFAA 4HV4A 1Q50A 2RGWA 4PGHA 4LXTA 4Y6RA 4JUDX 2O2JA 2WJWA 3A8TA 4V03A 3K20A 3ICQB 1LLFA 3RSSA 2YMMA 1XD2A 2WJAA 1ECJA 3IQFA 1KFCB 1SCAA 1GNPA 4M9QA 3F8TA 3N2IA 2ZCJA 3H5IA 4PXYA 1VG9B 3ZGOA 3QQ5A 3H5WA 3QFSA 4QUKA 2OPHA 3YASA 4E70A 1DWUA 1RIFA 4M8IA 4D3FA 2HK8A 3HYTA 1GXSA 3BXGA 1OXVA 3OOWA 3VPHA 2XMZA 2VWQA 4N7MA 4HBGA 5AHWA 4L72A 4C7KA 2R751 5IUJC 4OD0A 4LX0A 4DEYA 1JG1A 2Q0HA 2Z57A 2OZVA 3BD7A 2VYNA 3EXHA 5EWJA 2BM0A 1HDXA 3NKLA 1OLUB 4MB0A 2R5NA 5GOTA 3MJCA 2EOAA 3DDHA 1OTXA 4G3XA 5ETJA 2CFSA 3TDKA 4BLUA 3KSMA 3TXXA 3AUUA 4PN3A 3FDFA 5CLFA 1KI6A 2VYQA 3RWBA 2YMPA 1E7YA 2QG4A 3MOIA 3PFHA 3ZQ4A 5K8TA 3ETLA 1D2GA 2IE8A 4IGFA 4F5EA 4F3TA 1O77A 4G0YA 1YFJA 2H9IA 1G5FA 3ZW8A 4L76A 4G0XA 3OF2A 5E4TA 2WZCA 2Y68A 4GW3A 3THXA 1H8HD 1N0HA 3ZDQA 3LHHA 1Q0QA 2BI4A 2JCVA 3CKMA 2OG1A 3CUSA 5CK5A 4KMRA 5MN5A 1RBMA 3DH0A 5E6UB 3LTNC 4ZKEA 1P6QA 2EP8A 4B31A 1JG7A 4FT2A 4J7XA 3DXFA 1EXWA 1A2OA 4C4YA 1MJHA 1E2PA 2VDQB 4KUGA 2Q07A 3PNKA 4P7FA 4NK4A 4D6YA 4DY4A 1FS4A 2NT4A 4JEIA 4FNGA 1KS9A 5JAMA 4UEQA 4D4IA 4MNTA 5DYTA 3GCGA 4PYKA 3BHNA 1IDOA 2OKGA 3NPAA 2FW1A 2Y6VA 4UEJA 3T9DA 1U90A 1KERA 1KOFA 1OPRA 4FZVA 4NENB 3LBAA 4FK8A 4M76B 5ALJA 4ZV7A 3DVQX 4JIGA 4H4DA 5DK6A 2P6MA 4ZC8A 2XZOA 1E8MA 5IC6A 3Q72A 2CGEA 3IAHA 3CUTA 3KM0A 3BE4A 3GLHA 1M10A 3D4LA 3RRFA 1GQFA 3QLEA 1YOVA 2D7JA 4WCDA 4MQ4A 1MJ5A 4X1YA 5CDTA 1FQKA 4KXYA 3AUSA 2G08A 1I2ZA 1FFDA 3OZBA 1YR6A 1RI5A 2GNPA 2NYAA 2Z04A 3OZ7A 4GOOD 4KXUA 1GZSA 2Q3CA 3K0CA 5CLGA 5H16A 2YHIA 1ENZA 2MYPA 4K1XA 1OHHD 1T2DA 4XX0A 4YXWA 2PE5A 3VR4H 1HZJA 1GQ2A 1IRXA 3HVKA 3O03A 5EKDA 5LP1A 1AKQA 3FVQA 5KTOA 4D0NA 2AFVA 1CQJB 1L4HA 2IYWA 1I4DD 1QX4A 3AHEA 4ID3A 2RGDA 3ANTA 1QIJA 1XJ0A 4IKOA 1YA6A 3IP6A 3G2NA 4G5SA 2JAWA 4L73A 2GETA 3IIMA 3VSCA 2FFRA 3DE5X 3J80A 4Q48A 3X1YA 2G9NA 4E4RA 3C3DA 4K9DA 5K4GA 4HNGA 4MJXA 3KPUA 1HFJA 1YVDA 3MM4A 2RB4A 4RQBA 3PG5A 2XZLA 3KJEA 5E1MA 3OE5A 4TTPA 2Q5OA 1RPTA 2XA1A 4UQPA 1TPZA 4YY3B 3RAEC 4NEQA 2J6IA 1XLWA 1SN7A 3ND9A 4F9FA 4OGLA 1DS6A 1EVQA 1ZRSA 4D79A 1T8UA 3CG4A 2GCOA 3NOVA 3LM8A 5FEUA 3WOHA 3PNQA 4MKIA 4TXMA 3TTXA 1KYYA 2OHJA 3TVDA 1Y9EA 3BQ9A 1DOHA 5J40A 4P92A 1BDIA 3L84A 3LLUA 1JYSA 2AJ8A 4N3CA 2FX5A 1BJRE 1FYWA 3EUWA 4IHJF 4K05A 3ZIDA 4CG3A 4EFDA 2HHCA 2AVNA 2ZYTX 1XDSA 4K1LA 4LHWA 4ZYWA 2JZNA 3C85A 4KYVA 3IXLA 4S1VA 1WW8A 4L0MA 1NQUA 2AMFA 4D57A 4OA8A 4B46A 1MOZA 4AJHA 4EPTA 4LRXA 4NJEA 2Y1OA 3EEYA 5DYIA 3GBPA 3GBSA 2Q28A 4L8VA 3RVQA 4A27A 5KQMA 3W5HA 1L1QA 2FHPA 2I78A 5M2QA 2FSUA 5KO2A 2ZWAA 4KFUA 1OASA 2OCPA 3JZMA 2OKCA 4FCVA 3KZKA 4DRXA 4JWKA 4OREX 2P9GA 1E4YA 1KC3A 2PZBA 1JRLA 3FHCB 2OXIA 1JJBA 4DUGD 5FWDA 4XVRA 3C3MA 4YRPA 3WKDA 2EHDA 5AJZA 5KS2A 2X9QA 3PTAA 3I9LA 1SB8A 3ZEIA 5KQLA 4I3HA 1DB3A 3RAGA 2YNMA 1XTUA 1DKOA 2AOVA 1CZRA 5IULC 4OY3A 4W7SA 3WIVA 4A8JC 2D3TA 4J49A 4U7WA 1ACLA 3F3SA 1VL2A 2P4SA 2R79A 3IYLW 5KTTA 2R8ZA 3PNYA 1VI2A 1TPYA 3ETJA 4Y7DA 3N8HA 1AK9A 1CT9A 4CF4A 2EIHA 2JI9A 2ZCUA 4RF3A 4U7FA 1QG2A 1Z74A 3RKRA 4XWOA 1TQ4A 1WXQA 1HXHA 5BUSA 4IWNA 5KB3A 1K88A 3JALB 4DQLA 5IJ0B 2GD0A 4G2NA 2J0UA 3P9RA 2HBQA 4XGNA 1XQ9A 4BP3A 3MJVA 3KJHA 5EZ6B 5LP6C 1W88B 4NCAA 2V7PA 1B43A 2GR9A 1T26A 3DTNA 4RFLA 3RT1A 1OXXK 1SM4A 2H1IA 1ES9A 1U1CA 1XEXA 1J07A 3FIUA 1OZAA 1XXHE 3N6RA 4GR4A 4JOQA 3VR6A 1NV9A 4M6WB 2LNDA 3ENKA 2C5GA 2XUFA 2M32A 3GFSA 4ZO4A 1A8PA 2LR0A 3FDJA 1CUIA 4RVHA 4EUFA 4TTQA 1U7WA 1IVNA 2PANA 3CJTA 3OECA 1C1DB 1LCIA 2CLMB 3HEBA 1KZGB 3H4TA 3OFSA 4JELA 1P9LA 3RS3A 8OHMA 5HJ5A 5KYXB 2PJRA 3EGEA 2IW1A 3EAGA 4YP7A 1RLIA 3CLVA 4G8JA 2WWVD 2F1HA 2COEA 2YZQA 1VJ1A 1KBOA 4LN1A 3RVPA 2QJWA 3LPDA 3OETA 4Y6GB 3PT5A 4B3RB 1RWQA 3BMOA 3U26A 3JARA 5DN6D 2EFCB 3CVWA 1Q1GA 5FBQB 5C7IO 1LNSA 5J1SB 5CD9A 2HD4A 4BLWA 3ML1A 4PGAA 4YRMA 2YIDA 5ICGA 2B2CA 1EEXB 3P7MA 2GD2A 4XWGA 5JJIA 5E2BA 2BFAA 5KWEA 2O1EA 4JI6B 1JVSA 1F2VA 2B37A 3AQ4A 1WV0A 3KXLA 1C30A 5BR1A 1ZK3A 4P3YA 3SXPA 1V7QA 4WA7A 5CCDA 4E7OA 4KQEA 1W4LA 4EHJA 4AMBA 2W2LD 1M34E 2X86A 5EXTA 2QDXA 3HPRA 4MWZA 4X8MA 1TEVA 1W6UA 4ZVNA 5SY6A 3V1KA 3LAWA 1TU3A 5CCBA 1F9AA 5EJGA 1VHQA 2R1VB 5M5BA 4XQEA 1L8OA 1BDBA 2WFLA 1F0YA 2WWHA 4H1TA 5U4QA 4C07A 1U04A 1L8QA 2ZRCA 2CD9A 3K35A 2REXB 4F5YA 2J59A 3NALA 1ZIDA 1HLGA 1G5TA 4EATA 1QYCA 5UKDA 4DNOA 2R6GA 1S3GA 2FA9A 2ZR8A 1NVDA 3C5WP 1GPMA 1H8ED 2GI4A 4D82A 3KT0A 1C3LA 4EF4A 3JU3A 1RP1A 4YECA 1KPIA 2P41A 3QUQA 3B89A 3NWEA 2CMDA 4PG7A 3WGMA 3TX6A 4LJAA 5EPOA 2EFHB 3I2GA 5HR5A 3CN7A 1YB5A 4KKXB 2BGWA 3TZHA 3R9IA 2UU9B 1XAHA 1BFDA 3ACBA 4H7EA 3O7MA 1N7JA 3PXCX 2RAVA 1MJNA 1UP7A 2R6AA 2R96A 4GXRA 2NYUA 5FTMA 4HVLA 5LQNA 1RJFA 4JXXA 1R8XA 5CUQA 4ZOEA 1ZCAA 5DTJA 5LR6A 1DO0A 4Z1MA 4Z3DA 5JHGB 1SC9A 1JDVA 4U2CA 3C3BA 3RYIB 5HGXA 3HCRA 4AZSA 4F3YA 1AKEA 1SBTA 1CDEA 1L7BA 2VRWA 4ZOAA 2OLKA 1N3IA 3DZGA 5A1TA 1K63A 4M53A 1YB6A 3E22A 4Y6QA 5FADA 5FPHA 1OYVA 3Q5EA 2FPGA 3TLAA 1IEXA 2WP0A 5AJVB 4B5LA 4JA0A 4C0SA 2GBIA 5KCZA 1PNOA 2H2HA 2I2FA 4DDHA 1QYVA 2OFWA 1E63A 3MCWA 5AOBA 2QN7A 1NXTA 1R0RE 4YJ3F 4JB2A 4MQMA 5DVZA 2LD4A 3MC1A 3ZKAA 3MLEA 2E9SA 3J7TA 4N3BA 1ORRA 2EMQA 2GO1A 1XNGA 2WILA 4M1EA 1Y3CE 3OE7D 5KWJA 1I3KA 4ZA2A 5C7OO 3C4VA 2ZI3A 1JDNA 3DBRA 1OW3B 1YRAA 4IOLA 3THRA 1GRNA 3LKDA 5AD1A 3RWMB 3ZJYA 5L3ZA 4ZYVA 2O07A 3EY4A 3ZCSA 5K20A 1WU8A 3T3GA 2H4ZA 2HNAA 3IAXA 2D2VA 4Q39A 2GFHA 1YU9A 1TYAE 5C46F 3L40A 2UXBB 1U3FA 1OLOA 2ZOSA 4MKRA 4BECA 4AY4A 5EJ5A 4CCYB 3L49A 4IG9A 3W7VA 1WDMA 4QUJA 4CN8A 3PZBA 4D3SA 4FYIA 3TKLA 3TW6A 4XI9A 4ZK6A 2ON6A 1SZJG 2C77A 3CH7A 1IDN1 3LIPA 3IR6A 2CNWD 3KWMA 3MUOA 4C05A 3G8YA 3LCRA 2X0KA 1XTRA 5DYGA 3B2EA 3T7SA 5AW3A 3ENVA 2X0IA 3IAFA 1EXNA 2Z43A 2YV1A 1EM8B 2A92A 4FR5A 4YJDA 1QRTA 1IUPA 1L5RA 2EW1A 1U9CA 2XKKA 5JU6A 4YHHB 4MWDA 2HRZA 3RANA 2GD6A 1RC1A 2PHZA 5CYOA 2FJ0A 3SZMA 1T1JA 4D8YA 2QXYA 3IODA 3Q8LA 3NATA 3UJ9A 2OBNA 3F74A 1IQPA 1MX5A 3N53A 4CG2A 2B21A 2H2GA 1R3DA 2RHMA 2AQKA 3O26A 3O4FA 4CKCB 2J6CA 4ZO6A 4QEZA 3R0VA 4Q19A 3ZY2A 2FX2A 3HL4A 4LWOA 1CUDA 2IU0A 3G59A 3N8NA 3ZU6A 3GOHA 1IEWA 2ZCVA 3JW8A 3K8OE 5FAKA 3QF4A 5EESA 1NDHA 3DDOA 3LQQA 4RPLA 1DEKA 3T5DA 3D5TA 3I76A 4NOMA 1M2EA 1G21E 2DPXA 2CL0X 2LKDA 3C16C 1F6WA 1TMYA 4KG7A 2XNJA 3Q11A 4D8TA 4L6CA 1U3GA 2UZ1A 2EP5A 3U4AA 1RU3A 4JD5A 3BGOS 1EFTA 4H3SA 2RG1A 4I1PA 4O9KA 2P2SA 4QVKA 3U44B 3U4MA 2D00A 4V38A 4BIMA 2HWUA 3DOCA 3MINA 3IP7A 1RLMA 5HBRA 3WMFA 2RH5A 1HYHA 2X1VA 2ZSKA 2KBEA 3GLFE 3DZKA 3C3EA 3PK0A 3JWIA 3R6TA 4X00A 5JTUA 3B53X 3TOSA 2IVFA 1Y8RB 1SOMA 4GPZA 2XUDA 2OXFA 4U2KA 1QP4A 2TRSB 1Q19A 1YZUA 2FPIA 3I42A 1I5OA 2AEEA 1K06A 1YTLA 1YC5A 1VSQA 2GEUA 4NATA 2WNIA 4JLNA 5AXAA 4AG5A 3TSYA 4AYXA 2QTFA 1SHLA 2ERYA 1QONA 5DI3A 1WNFA 2O7VA 3HCNA 4RA9B 4UPEA 1SUDA 1JXAA 3B82A 2YFHA 2VSFA 4IRMA 4RL6A 1WMBA 2Y4NA 2Q1UA 4K26A 2I71A 4BE7B 4M21A 3RSGA 1J70A 1GAJA 1UP6A 1V8ZA 2DWUA 2F2TA 2LVBA 3LLCA 1J0BA 4Y2GA 1SVSA 4NS4A 3SOPA 3ZE6A 2F17A 1LX6A 1UKCA 4Q93A 1E5DA 2J31A 1CETA 5F4BA 1PUIA 3EA5A 5HCUA 2AF4C 1FP1D 2Y0BA 1BXRB 1K97A 2CFOA 1Z26A 2JFZA 2ZE5A 3KU4A 3Q15C 1TK2A 4KXNA 4EGQA 2OMEA 2CLOB 5I8ZA 3QMWA 3GGPA 3MZ0A 3NJ8A 5FEMA 4PFSA 2QT9A 5GGYA 3TNYA 2QRNA 1L3CA 5TC4A 1LNZA 4N48A 1WUIS 2OP0A 4GSLA 1QZXA 1OV4A 4LC0A 4O4IB 3U6KA 3DO8A 1EBBA 4L5BA 4EBBA 4ZOCA 1NBWB 2GN0A 1PT6A 4KWIA 5EZYB 3DFKA 4I4CA 1M2HA 1ZOOA 5FWXB 1SQFA 2IZ0A 3A2KA 3VR6H 3UOAB 3V8MA 4E32A 4QWWA 1AGRA 1JNXX 4GFDA 1X14A 3WICA 1SO8A 1C9JA 3L7BA 4UM5A 3GVIA 5EEGA 2IOYA 2I2CA 2XTNA 4EW3A 1O5TA 2BM1A 1YRYE 2CLDX 1GPYA 2VTDA 2QY6A 3COZA 3H1EA 4WMLA 1U3WA 3GJXC 4FWBA 3RC9A 5GVSA 1R1DA 1TFRA 3H0EA 5J5CA 3ZU2A 5AKHA 5K8JB 5JFGA 4CM4B 3R7AA 3ZLBA 5GIOE 2O7QA 1GUYA 2IXFA 3QHAA 1LRLA 2PZJA 4UVEA 2GNOA 1PR5A 3DONA 2AJBA 3WS7A 5ESWA 4U6NA 1BVYF 1QXSA 4M1TA 2IUUA 3P9QA 4ZFNA 2I8LA 3B3FA 1AUPA 1H2RS 4NCKA 4K9OA 4ZAYA 4CF5A 3AM1A 5EPEA 2ZAMA 4IF6A 1GPWB 4RACA 1S2MA 4C76A 1NF2A 3HRHA 2CF5A 1JQ3A 2BCEA 3EIFA 2FPLA 3LNCA 5FXMA 4JP3A 4X6UA 2DSTA 2HLDD 5TQJA 4GICA 4YQZA 3OKCA 2B8NA 3FJYA 1QO9A 1FFXB 2PKEA 2VI5A 4O5OA 1K8XB 5AESA 1UM9B 4KK4A 3X1WA 4G37A 1JR3D 3MA0A 4H6XA 2B98A 3H9CA 3IDQA 5T57A 2HSDA 3A58B 4M8SA 3LFHA 2AL7A 3CTMA 2RB5A 4EHHA 3F9RA 4IH1A 1NY5A 4F8JA 3HNPA 2A0WA 1E61A 4HQFA 2NYEA 3I04M 3RH0A 5AP9A 3IPRA 4PIMA 1B2LA 1M6VB 1K89A 4CI0B 3HV2A 4X6YA 1G4HA 3I4FA 3AVQA 3T35A 4ED9A 2HGSA 4BVGA 1Q17A 4ZI7F 1A1SA 5KPJA 4MUXA 1NVXQ 1EVJA 4U3JB 4IDFA 1N5KA 4U2GA 4LDJA 5FOWA 3GFGA 1KMMA 3KB2A 4Y8VA 1VG1A 7ADHA 5KDDA 3KFLA 2Y2UA 1FBNA 1S5PA 3R3XA 3I61A 1XR3A 3NG1A 4BQFA 4TWAA 2NTYC 2UZ0A 3GRYA 4Y2SA 3QV1A 3VPFA 3A25A 2RGXA 2ZSHA 2BL4A 3LVQE 3IUNA 1IY9A 1QPZA 3IESA 3P0EA 3HB9A 4JOBA 3W6ZA 1LKZA 2QVZX 1J0CA 4ZRDA 4TM8A 1WHSA 4M87A 4R16A 1RI4A 1AKTA 1GPDG 2JGAA 3ZCTA 4JT8A 4BQQA 5AQ1A 1N32B 4L0DA 1ZK4A 1H2AS 2NWQA 2YZ7A 4K9PA 4V02A 3WP1B 1CQPA 3DT9A 1UOEA 3OT1B 4ZHSA 1QHEA 1FS5A 2DE0X 4M9SA 4JWTA 1E2QA 3V4FA 1E69A 1N9ZA 3FNHA 3KPVA 5JNLA 5K3EA 3PCRB 4LJRA 1YTUA 2P62A 4YQEA 4DZTA 3EXEA 3PC8A 2CCGA 3OTHA 4PRKA 4MMYB 5F1KA 1YU6A 1JZTA 1MD9A 2BMAA 3FTFA 2A4KA 1Q5PA 2HO5A 2PWBA 1JEQB 1KVTA 2X1HA 3MJDA 4GF5A 1EAMA 2V7QA 4GX2A 4EW2A 1NN0A 5C3MA 3FETA 5BPHA 4X65B 1GZ5A 3G2QA 4Q82A 3WHKA 2M1ZA 3DNMA 3IHTA 3ND5A 4JHLA 5GAJA 2GHTA 5DXAA 2QLJA 4MW9A 3AETA 2XVYA 1TYZA 2ZYSA 4WCFB 3ORRA 1ZK1A 4XGKA 3SBXA 5J58A 1F2UB 4TS1A 3WZ2A 4N01A 1SUWA 4L8WB 5CHYA 4D96A 1ZY2A 4RXUA 2O14A 4P3OA 4N3NA 4AS3A 4HS9A 2VTVA 4WV3A 3USZA 2Z2XA 3QSYA 2CHUA 3M6MD 1NVAA 3IALA 2PEYA 1JKMA 2I5PO 2PNFA 2VSXA 3O4GA 1M2NA 5F5LA 3PUHA 1PV1A 2GCPA 3L82B 2RHBA 1BMFA 4KEAA 8AT1A 4TMFA 1CIPA 3HKDA 1A9QA 4PF1A 5E1BA 2QRQA 2C9MA 2IEIA 2SKCA 2OECA 3EGXA 3O73A 3ZWWA 4XM2A 2H5EA 1G3UA 3SZ3A 1XU4A 4U63A 1ADJA 3GJ5A 3RYFB 2RAUA 3BILA 1VLZA 2BELA 3HU3A 1TM2A 2IHKA 4MQEA 4MYTA 1EUCB 5I7FA 1CF2O 1FB5A 2VBIA 4KJXA 2FW9A 3QU2A 2H2IA 2IIBA 1USVA 4B87A 1LLDA 2ATCA 2MMGA 3FNBA 3JV7A 2ZUEA 5HJ2A 1XKXA 5ARDA 5KJFA 4G56A 1M83A 2B1JA 2H07A 2Y05A 4BVBA 4EA6A 3NOQA 3T5MA 1DADA 1JMVA 4NH4A 3U39A 3DS8A 1GGFA 2FZEA 3NT2A 4OA5A 4BEVA 5B12A 2R6FA 3I9KA 4UVHA 1PGQA 1DAPA 2PEZA 5T6BA 5GJCA 4Y9RA 1OV6A 1ZSNA 2BM9A 2VFAA 1R0SA 4JITA 4LK3A 2HOQA 3GMSA 1I4OA 3I52A 4FFBA 4U02A 4D6XA 1RJEA 4QYXA 1IXRC 2OWDA 2ZB3A 1DOZA 4P1ZA 3AF2A 4X97A 5DHTA 3ZCRA 4TS9A 4NDNE 5I51A 2SNIE 4HGNA 1VYTA 1DFHA 3A1FA 2E0IA 4UE6A 5FPQA 5JV5A 3JAKA 4MRSA 4YT2A 3Q0TA 5T4BA 4WBXC 4RLHA 2ATEA 3RJZA 4KMOA 1DC3A 3D8HA 1NR7A 4LSMA 4NIMA 4O3MA 3B52X 4R1LA 4TV9F 4Q12A 5AWFC 1XZGA 4MXDA 3W7BA 1UQTA 2P27A 3L92A 3UAGA 2IBSA 1G8GA 2RBEA 1C8LA 2PLWA 3FF4A 2C5SA 3KZXA 2BGJA 5AJHA 5DHFA 3TIGA 2VA8A 2PAAA 4AU1A 4CR7A 2O8FA 2V3WA 1F8XA 1VJ5A 1YCFA 2FE1A 3MJ4A 4Q3LA 4RXTA 5JSFA 3DL2A 3KE9A 2RI1A 2EGGA 4JX9A 3SHTA 5DNVA 3ELUA 4MX8A 3BTVA 5GONB 2VXYA 2IXBA 3I53A 4KRFA 4GWGA 1M7BA 1VG8A 2JJ8A 4FOTA 3ESYA 2IV2X 4DT1B 1P45A 1TJ5A 2QEQA 2SECE 2WP8J 4KLRA 4M86A 1DELA 3IXMA 3PC7A 5JD3A 3EXG2 1XBTA 3ZDCA 1P62B 1IB0A 1NZDA 3S3TA 4WOJA 2OZKA 1NT4A 1Q21A 2ZATA 4GPAA 4ZVPA 4C03A 2GB4A 1QORA 2O0LA 4AJOA 1M2VA 1H2HA 2NX2A 2W00A 2ZJ6A 3Q9UA 3NV9A 3N0VA 1E1LA 4YONB 1YQ9A 3KJGA 3HN2A 1CQIA 4NBNA 3SN6A 3SX2A 2OY0A 1T35A 4BAUA 5C1OA 4ZD6A 5JC1A 4MUYA 3KQUA 2IS2A 3K0FA 3M6WA 4IYSA 1LDBA 1XU9A 2BKVA 3F3MA 5AKGA 1L7XA 3GFTA 2NPIA 1VE3A 2O3QA 1BMQA 3H04A 4QPNA 5FHRA 3MS4A 4KDRA 4GPIB 4U6QA 5A02A 3IS3A 1NTOA 2E4YA 2QB5A 1P80A 4TUYB 1ZNXA 1MXFA 1GAXA 4IHQA 2LBPA 3W2FA 5JROA 5KC8A 4UDXX 5ALYA 4I1YA 5BQXA 2OHXA 1FCJA 1UBLS 2QIPA 2PGXA 1X92A 3HR7A 4AIIA 1E2LA 4MDHA 4B81A 2PQ6A 3OUTA 1UPCA 2CJPA 4YRBA 5FR1A 2OYRA 4PNHA 1WB5A 1JHRA 2VNHA 3TX2A 1BHO1 4AFNA 3B36A 2EU8A 5AVXA 5HYVA 2JG3A 1BW9A 2O6HA 5FHQA 4I5FA 3WVNA 4C4XA 4TS4A 2DWCA 1RADA 2EL7A 2EYQA 1U81A 2QJRA 2RC6A 3BMNB 4W9NC 2QBYA 1TK9A 1KAMA 4N54A 1DKLA 4DCNA 3GGSA 4DR4B 1X94A 2VDNB 4MVJF 3WYDA 1ZZEA 1H4VB 2I66A 2HB6A 2UYQA 3JPYA 1QWOA 3AUYA 3LQRA 4LZWA 1XPRA 3L1HA 2QVBA 1B6RA 3OWXA 1WD5A 4QM6A 4JJKA 3PIIA 4P4GA 1A5ZA 3C7CB 1Q0RA 1U2GC 3IAM6 2G8NA 2VBCA 2XDQA 4H7PA 5CJ2A 3ZU4A 3WRYC 3O4VA 3HVJA 4HLCA 1EK2A 1GCAA 1PZEA 3NPMA 1XRQA 1X0VA 4DG9A 4AURA 1H2XA 4WXEA 2PSSA 1JAIA 2WFZA 4GPBA 2ZKIA 3JYLA 3GFRA 5EGSA 2IU6A 3DDWA 3RD5A 3DBIA 2X8BA 1XTJA 3DKPA 3Q2OA 5LDGA 3GRVA 2YYZA 3EXG1 4EKIA 3LIIA 1UK8A 2ETXA 2RHWA 3LF1A 3IE0A 3LS2A 5AW1A 1PJZA 2P5YA 2PL3A 4FMPA 4DMHA 4UTRA 1AG9A 4ZQFA 1VHJA 1PW7A 1OLXA 1T2AA 2BF4A 4J7CA 1NBME 1L7NA 2OL4A 1XQVA 3ZZ0A 1CUJA 1OHHA 1ZJ5A 2HC9A 3MT8A 1PS0A 3AHFA 1JTVA 3TD9A 4OCZA 1HNNA 3DYBA 2DH5A 3T1NA 1UPBA 5KIAA 3DG9A 4X85A 1XJCA 3VZCA 2YVLA 1D4OA 4PR3A 4QTUB 2P0EA 2FZ4A 3PVSA 1DGQA 4FLMA 2ZWIA 2QRLA 4Y2XA 2R6DA 3E1KA 4PPFA 3VVLA 1MQ9A 4TKUA 4EJSA 2UVPB 1CC1S 2PBRA 1JQJC 1UF9A 2R9VA 3PQ8A 4RY0A 1BHJA 1LQUA 1P2SA 3HDHA 1PHRA 1TCBA 2OHGA 2PLRA 4P4SB 4UAVA 5IVHA 2I3AA 3AKZA 4KVAA 1DQNA 5I9NA 1XMSA 5KOJB 5BSFA 2ONCA 3LBIA 2QA5A 2APJA 1VJGA 3A05A 3VISA 2VJAA 4DAOA 2UYHA 2IH4A 1T5SA 1V39A 3MOGA 4R1OA 4X9XA 3QIVA 3BSWA 3SK0A 6ADHA 3L4SO 1KYTA 4WNAA 2Z9DA 1X13A 1UZNA 1QCYA 2RIPA 3BSYA 1DBRA 3KEOA 3VKUA 5D01A 1ETUA 4XUDA 4CUZA 1REQB 4BQIA 1N5LA 3HGMA 3KBOA 1F0NA 3OP1A 3M3HA 4DF3A 5JLJA 3PC4A 3SR4A 3SQOA 4PV7A 5DJ5A 3CLRD 2AFHA 2JDID 3D7LA 2OENG 1ADCA 1MIOA 4OP3A 1QRUA 3M7IA 3KTAB 1A50B 1IN5A 1E4EA 1JB9A 1NC1A 2JZCA 3WKBA 1Q15A 4BMDA 1I0LA 4IINA 4CLRA 2PMWB 1I24A 2J9RA 4GS5A 3KJZA 1X86B 2IUTA 3BCUA 4O2AF 2VYFA 3WLKX 2ZFUA 2AZXA 2JIZD 4K5QA 3E82A 3RU2A 5DTMA 1SC4A 3KJNA 5CP8A 1X19A 5E9AA 3HB7A 3I3SR 4QFBA 1M8JA 4MMZB 3H42B 1E9CA 1A9ZA 2GESA 4I1VA 4DUGA 4OKNA 1DUSA 1ZX1A 4RTMA 1YAJA 3EZNA 4JGGA 1YMVA 1KO4A 3WB0A 2E48A 2V7EA 2Z2ZA 1ITZA 2ECQA 1I7PA 5FO1A 3QUTA 4E6PA 3A6KA 4NPCA 1RXEA 1NXWA 2IYRA 2OO5A 1U31A 1NMSA 4WLOA 3BL6A 1DU4A 4BC0A 4INOA 5C2JB 1P6XA 4G65A 2XTZA 4ZV4A 4JSRA 5EJ4A 2ZXFA 2FSSA 2GAIA 1V0JA 1ANKA 4DDKA 5CW2A 4JJ8A 3A4VA 3SE7A 4DILA 1KKUA 3A4YA 3MGGA 3DUFB 3FNFA 4ZI5A 5BQ3A 1Z88A 1A95A 1O6FA 4JT9A 2VN8A 3FPJA 1NJ6A 4XVQA 5FF9A 2ZYGA 5IC5A 4MVJD 3O2SB 1NAHA 3ETNA 3G7SA 4HDSB 2R8RA 1XSEA 3NO4A 3QKWA 4S24A 3FH0A 4MB6A 3WLHA 4C7VA 3ZLJA 3KPCA 5K23C 3D3QA 3BXHA 4IGEA 4JK3A 4L75A 1NW8A 3Q9SA 4IEEA 5J2UF 3COWA 2VNAA 3FM9A 3IFSA 3IQEA 4FKZA 2VZLA 2VJCA 3N5KA 1VE7A 2DLCX 1QGAA 1FW8A 1VLHA 1UPTA 4ZICA 4C4AA 2ZZKA 4IUCS 2JFNA 3OPMA 2VDWB 4O4HF 3UK2A 2J5RA 3B6MA 1I9CA 3U5TA 3L4EA 1SHTX 1YNSA 2NADA 2OCXA 4JT4A 3DEHA 1PFYA 1U4SA 1XQ6A 3C70A 3OQPA 4WKPA 3U7QB 3I0MA 2ZJYA 3K09C 4KMSA 2AXPA 2RHJA 4HDQB 4QOSA 2F3QA 1BQ4A 1D3AA 2ORYA 1V41E 3WZMA 4CM9D 7YASA 1QANA 1S8OA 4K0RA 3P1JA 2ZS7A 4DLWA 3JRWA 1Z0KA 1LRJA 1W0CA 4TVOA 1Z2AA 1EVZA 4RDCA 5DN6A 3T1HB 2VHCA 4DLYA 4ZP1A 2AMJA 4D9MA 4HDRB 5CVEA 4RTNA 5BMVB 4LMBA 4S0XA 4D8WA 1SPXA 5BPFA 3ANMA 5BSVA 4B7UA 3O3OB 2J3JA 2ONJA 4IIBA 5HFAA 1WXDA 3W5UA 4EF5A 2IIVA 5GM1A 3QMMA 3NIDB 3CIFA 2BBTA 2YY5A 1NXQA 4MRRA 4B6PA 4FWTA 3VR5A 1NUPA 1KRWA 1H0KA 2IYAA 2YS6A 1GADO 1IG0A 4H4CA 5CNKA 5EHNA 1N8SA 4AZ0B 2VF5X 2C5AA 3N2GB 3IOBA 4M38A 1OWLA 4DE5A 5BOSB 1KP3A 1QX3A 1VXOA 4KI0A 4HN2A 1NONA 1AURA 4Q05A 1WZEA 3FW1A 4GKAA 4MUFA 5KAPA 4DMUB 4E33A 5BV1A 3DL0A 2OD2A 4K9NA 4M9RA 4Q9LA 1Z0JA 3KPYA 1P77A 4P4LA 2ZWOA 4Y6OA 5D3QA 2CK3D 4XFKA 2QX4A 5FRDA 4U7DA 4ABTA 3RS4A 1H8EA 4NAVA 3TMAA 3SLGA 5JRJA 1VL5A 4B85A 1N2GA 2EEZA 2QW0X 5J4VA 2QMEA 4POAA 1KY5A 5CB4B 1QOQB 3SSMA 1XCBA 3VX4A 3C4JA 1KO7A 2A0YA 2BR5A 5AW2A 3DLHA 2X41A 5CM9C 5FORA 1BSVA 5JSYA 2FMXA 3GDWA 3LKBA 4MEAA 2Z4TA 3TZKA 1T6YA 4Q4JA 3UCEA 4C0HA 4EKDA 3FE2A 3HHPA 4RPIA 1EDDA 1IJBA 3BK2A 4UTNA 1A5TA 1Y48E 1MA0A 2PS9A 5CLQA 4TWBA 2SBTA 3RVSA 1D1SA 4RMJA 1SJ9A 2V45A 3PSHA 4P53A 3PWZA 4DIBA 5T64A 3STXA 9GPBA 4GX0A 1DTSA 1EU1A 1GLNA 1QIGA 4WWHA 1HF3A 3TLGB 2BAGA 1PG2A 1GYQA 1UBCA 1CRWG 1SHKA 5SZJA 1CR1A 3TMKA 1RXWA 3OZRA 2ZXEA 3OUUA 5ALTA 2YW9A 5NLLA 4EAAA 3QKSB 3HBNA 3CINA 3QK7A 3BXXA 4Z9YA 5ER9A 3RS0A 3UAZA 4A10A 2F8TA 3RROA 3R9XA 3ZYZA 2Q2NA 4BC1A 3TSAA 3I1IA 4CUKA 1DTEA 2J3IA 1TXGA 2WU0A 2WVHA 3ADOA 3D54D 3JATB 3MHPA 4FGUA 3C15C 4NVRA 4ZAXA 4Z0HO 2Q6VA 1PSWA 4O6VA 5E4FA 5CCEA 1H4QA 5AVUA 2CHEA 1LTHR 5BQOA 5A62A 2A84A 1ODIA 4LI0A 2HREA 4Y67A 4DV2B 1AZLA 3RG8A 1QC5A 4D44A 2D1SA 5CA1A 1QVVA 3CLRC 2YXEA 4Q03A 5HS4A 3VSBA 4BATA 5BYBA 2PIAA 5K2OA 2JHGA 4B2YA 4G0OA 4REOA 4AW9A 1FUIA 4EG1A 5FI3A 3RT7A 1E0SA 1SUIA 3W04A 2PMFA 2WAMA 1IM5A 1SD2A 3AWDA 1PJSA 1WDTA 3VNBA 4MR7A 4ZO9A 2Y9PB 1FSPA 2GTHA 4RETA 3E1GA 5KYTA 1GZ4A 1UC9A 1ADGA 1NTRA 5JD6A 2G1JA 3W3ZB 1EFAA 3D2AA 1UINA 5LOVF 5E9JA 2GAAA 2JD1A 1CY7A 1MEJA 1GQYA 4QHYA 4JP8A 3TTWA 3UGQA 3PJRA 2F8SA 2AC7A 2ZSUA 2JBHA 2XCTB 4R51A 3SEZA 3OKFA 3PE6A 1JAYA 4YJGA 3GNSA 3NHLA 3KLNA 3SBOA 4FR2A 2CNWA 4V0OA 2XKBA 1XB2A 1T9ZA 2AC4A 4K40A 5KNDD 2IRWA 3BDVA 2QR1E 2EX0A 4OV6B 4IWXA 5KYUA 3PXDA 2IHJA 1XFDA 4EW6A 1X1CA 3UENA 2O2IA 3BB3A 1E5XA 4LJSA 4G5YA 2XX3A 4QOFA 2DUNA 2DQ4A 4DRYA 4BASA 3ABSB 1YMUA 3CCCA 4CKZA 5KQGA 1OIVA 1COZA 5AHRA 2F43A 4AJPA 1CZNA 2P40A 1EFRD 4M0FA 4G1MB 3OTQA 3KWLA 3LT0A 4DHEA 2CF6A 2RH4A 1L1FA 5IKPA 2CDRA 4HH1A 5LCXA 4ZOLB 2WPNA 5CDUA 2MIIA 3RW9A 1JE1A 1JHVA 3UV7A 5C51B 3JWEA 5B7QA 5JRZA 2FH5B 2JBWA 1J0AA 3OCJA 4JVMA 4UKDA 3DTVB 1E0KA 2C7RA 2EBWA 3BIOA 1BCRB 1T5DX 2FEWB 4HX9A 4U7GA 1ZHOA 4B0OA 2O2GA 1O97D 3IE2A 1M67A 1NL3A 2IPNA 2NYRA 3NHYA 4M0MA 5AM5A 5IDYA 5LLSA 2Y0CA 1NN5A 2OMKA 2VJOA 4QRDA 3DVAB 1N6OA 4KDEA 2Q5HA 1RLTA 3OEEA 3RS5A 4EGAA 4H08A 5GZ6A 3LA8A 3I8SA 1D0VA 1K27A 2B83A 3TE5C 1SCQA 1SGWA 4QLOA 1BGVA 4IJQA 3VRHA 2PUDA 1D1QA 3IB6A 2YBDA 3OQHA 4XUGB 1T1GA 1YZHA 3RTGA 1TRKA 3UJPA 2DUMA 5DTRA 4IUYA 4WHMA 1A9XA 1NSFA 2WQZA 1XZPA 4UFNA 4Y2VA 1PWYE 3PQ3A 1HE5A 2PBFA 3E9CA 1XA0A 3FDZA 3K0HA 3TE6A 1N6RA 4BCDA 1RSZA 1ZCJA 2REQA 3V34A 3ZZ1A 4C7MA 1O95D 4BP9A 4RKYA 4PQEA 1Z3IX 2WUGA 3RTAA 1C81A 3PTLA 4F3NA 2CJYA 3JQGA 1UMCB 3DAOA 2WKSA 4XQGA 5A05A 5L6MB 1KTVA 3JASA 4M22A 5B1HA 3CNEA 2EWVA 5ALSA 3R5SA 2R6HA 4I4TB 4PZDA 1GZ6A 3TRDA 2YXNA 4JV5B 2HK7A 3VGJA 5EXPA 4O3FA 1P2BA 3A06A 2CYBA 3GG2A 1E4VA 1VECA 4HLDA 3WIOA 2VHTA 2AYZA 4RGVA 4L5IA 3E05A 2I76A 3W8RA 5C80A 1I30A 2BMWA 1HLPA 2KJQA 5EIOA 2HCBA 4GQIA 4Q3EA 3G7NA 1Z6XA 1USGA 3IURA 2UUOA 1CU1A 4QJ5A 2HR1A 4TWRA 3O21A 1R6TA 2Y0EA 2XZTA 4INAA 4RL4A 4NEGA 5D1HA 3UXEA 1FMLA 3DLCA 3Q9NA 2VHVA 5T8KA 2GZRA 3K1ZA 1YR1A 1S8FA 1UUFA 1W25A 1ZH4A 2BBSA 2HRCA 3ILVA 2AC2A 1DMRA 1G4UR 2LDXA 2Q9UA 3UWPA 3FOFC 5LFAA 5LZ5A 1HLFA 3H5LA 3TBFA 4Q4CA 3TE7A 4EY8A 1PAUA 3H84A 4DVJA 1PQPA 3P4YA 4OMUA 5HRAA 3BB4A 3OCXA 2VJNA 2QF7A 1CRPA 2AOWA 3UT5A 2ZBPA 1QO0A 1NVTA 4JEHA 1F60A 5FPPA 4X91A 5JZ9A 1TEHA 3A7EA 4WUVA 1U2PA 4UQOA 3KQVA 4R1NA 4DR3B 4R83A 1L9KA 4DMMA 2WNSA 2W4IA 1MH1A 1ZSYA 2B4QA 1Z39A 2BV3A 1RPNA 3UBTA 3CLUD 3W79A 3LLMA 4O1IA 2W6PA 1FJGB 3O3MB 3KJIA 1IJFA 4M99A 4YYEA 3BDAA 3G9TA 3JWGA 4X1IA 1UKEA 4TXNA 3K6SB 4LZJA 1L0BA 5AK3A 2FZWA 5BW4A 1RBZA 2JJQA 3E81A 3JXEA 4HRVA 4QWMA 1C4KA 4ZTUB 2CLKB 3ANYB 1WLSA 2RI0A 3LUBA 4QGBA 3OQIB 1UR5A 1Y8QB 2R60A 2H4XA 1V1MA 3D3NA 4WNYA 2A9OA 4IOMA 4UOZA 5DT2A 2XUGA 5E3IA 2JCGA 3GARA 4ESOA 3PXAA 4OH7A 4CQLA 1U9YA 3ESAA 4GVLA 2W6MA 3F6SA 3IUQA 3OQ1A 5CNMA 1WBJB 2RMKA 3LWNA 3BRCA 1SKYB 4R2IA 2IZOA 5ER6A 3NV7A 3UFXB 5ADWA 3ILXA 3L7JA 2QREE 3W90A 5L3VA 4CL3A 3VR5H 1Y5HA 2HLDA 4D4JA 9ABPA 4OATA 3KQPA 3P2JA 3FOEC 2G06A 4YCDA 3ORSA 3E3NA 4LZLA 1JHUA 3KD3A 2QP3A 2VK2A 3QJ5A 4OUDB 4IH9A 2I3GA 3AOEC 3RVOA 1JR3A 4FI3F 4BOYA 5C0OE 2QM8A 5TGDA 1J8FA 1MC1A 2I54A 2RKBA 3A6JA 1ZMRA 2WJZB 5K0NA 3AVVA 5ISMA 1V16A 1KSGA 3PGLA 4S12A 4RTRA 1TLFA 2OVFA 2FRDC 3QITA 3AB7A 3EVFA 1V5WA 1IRIA 3SYRA 1BRTA 1W49A 1W85A 5BYJA 2QRZA 4UEOA 4QQFA 5DCLA 3M89A 2I80A 4P5DA 4GZ3A 2D4AA 1VBNA 4JBHA 3WGGA 1XCJA 1Z63A 1VGQA 2IVZA 3LUPA 5SV2A 3U09A 1N5IA 4M54A 4Y2UA 1VHLA 2CLIB 1SVMA 2GLXA 4CU5A 5DNAA 1RYEA 1OU0A 1SUAA 4XSVA 4DBLC 3W2IA 1QG6A 1Z0ZA 1A2BA 2GPBA 4BO7A 1BVRA 1PZFA 1C0IA 4FXPA 4WLNA 3WK4A 3LBFA 4MRNA 2JFPA 3BZWA 2P3OA 3OPVA 1EIZA 3TECE 4RYLA 1BXGB 4D26A 3DQZA 1Q0PA 3F78A 3RJ5A 2Q9AA 2PVPA 1TKAA 1YONA 3R7WA 4QHTA 4CEIB 3U2QA 3DMYA 5CDFA 2J32A 3AHCA 5B36A 2FSIA 2C9BA 3PPWA 4HAZA 5DIFA 1D2RA 1YRWA 3CONA 2GN2A 2XMBA 3GMIA 1WZNA 4A82A 2ZANA 4RPCA 1DQPA 3OC6A 4JL6A 4NZPA 4US1R 4CDGA 3IDAA 1RI3A 4M55A 5I9MA 3L01A 2BZGA 4DL9A 5C5EA 3LUJA 4KHZA 5JRDS 2V5UA 1ZVQA 3QELA 1GSIA 4CXMA 1KZYC 2YWJA 1U2GA 4DLSA 5IJ9A 3GCDA 1KQ3A 2WHYA 3E3LA 3KP1A 3OA0A 1Q22A 4BQOA 4V2UA 4L51A 4ZEXA 4ZMBA 1Q7TA 1QNFA 5LWQA 1KMHB 1CUWA 1JL3A 3COVA 3FRHA 3MRVA 2Q3LA 3QWFA 1JI0A 3WMEA 4C89A 4CNQA 4LKRA 4F93B 4H7HA 3AVXA 4IMRA 5I48A 5EHGA 1U0JA 3NM5A 3FSRA 4OQNA 4EVRA 1CEXA 3IBFA 3K5IA 1ETHA 3D0RA 3NIBA 4MA0A 4DDVA 1HLDA 2CXUA 3DMPA 1XRSB 4BFXA 3QJYA 1U7XA 3G0CA 1O95C 1Y4UA 3I6IA 2G80A 2W8BB 5JH7A 1IZZA 1K5GA 1QZZA 4M37A 3D8UA 4OGWA 2CL7X 2ZWMA 4MWTA 2FW6A 5EQTA 4IRXA 5KSWB 1EFDN 1RM0A 2GZHA 3VBCA 3CRQA 4LI3X 1CNEA 3I5XA 1E1NA 3KETA 1ZFNA 1ZVMA 3UKDA 3RUHA 2DU8A 4AO7A 2XSZD 2AI1A 3MB5A 1THMA 2JI4A 1TYEB 5LN1A 2O8VA 1IY8A 2FK7A 1JFSA 3STHA 3LK6A 2B3DA 3ZE9A 1QP0A 4KQCA 5L3QA 4Q18A 3L6CA 3OPNA 4E5UA 1WP4A 2QX9A 1H5NA 3A11A 3KALA 4JBXA 3FWRA 2XBUA 3P0HA 4C4OA 3EPKA 1VRWA 4CIVA 3SHOA 5AXDA 1NLYA 2YDYA 2Z98A 5HK8A 4RVGA 3A36A 3EVBA 3BTSA 2OHOA 3COYA 4B35A 2A88A 2F3SA 2ZRFA 5C1IA 1CUZA 5KCMA 4BHTA 4ARBA 2QTBA 4DV1B 1NFFA 4LZOA 4R6WA 2X3FA 4BO5A 1X7YA 1X2EA 3C97A 3NIGB 2IYUA 2P1DA 3DYVA 3OHSX 4PGGA 1C3JA 1UJBA 1U28A 3PX3A 3H6GA 3FVVA 3LDGA 3TGWA 3ZTTA 1R9NA 2QROA 3PR3A 1SXJE 3KYBA 3O8NA 4I81A 5K0ZA 3L18A 1GV1A 4LBVA 4PYOA 5IEBA 5C7YA 3LT4A 1PVDA 2V6JA 3CLUC 1DPGA 3CN9A 3DCIA 3UK1A 3CCFA 1Q7BA 2BEUA 4DWVA 5EUQB 4EPWA 3ADBA 4B3CA 4EIWA 3JAWB 2LGJA 3AUFA 4ZHQA 5KWSA 3IDOA 4GYKA 1XTBA 1UPXA 1SQGA 4RGBA 1QRAA 4FFLA 3EFBA 4DC9A 1QP7A 1GNLA 2GX6A 3OZAA 3BH0A 4JYMA 4MW2A 1RHJA 2FETA 4I9FA 3T4NC 4LUCA 3SSNA 4BQSA 4S05A 2BZSA 1HOXA 1ZGCA 4E21A 2EGUA 1KAOA 2J3MA 2UZIR 4BVLA 2MR6A 3F4KA 2JAXA 1A88A 4LF8B 2C54A 3EQ6A 2B9VA 4LE0A 4YI5A 1E9BA 2H7CA 1P1HA 1PR6A 4LG1A 5GV7A 3KR1A 1YB7A 3OIWA 1QK4A 1I33A 3UYKA 3DD1A 2NU6B 3TSOA 1PKXA 1VCHA 5IZCC 4RTJA 5TVGA 4H1WA 5FJIA 1NRIA 3OKAA 3H3FA 4F96A 3IKTA 4UUMA 4EARA 3EF3A 1JJ7A 2IYFA 3EZ2A 5B30A 4GECA 2PO5A 2ISSD 4Y7CA 1QS0B 2FV8A 1V6AA 1GT91 1YK0A 3KTOA 5C18A 4CYMA 2BONA 3MMPA 4C9BA 3FFWA 4E6EA 2YC4C 3DCJA 3LOUA 5HKBA 4HWGA 5LLTA 1RVDA 3OP4A 2ZYIA 1BD3A 1QUFA 3D6NB 4LXGA 2K87A 2WAYA 4XPZA 5CTAA 1COWD 1HTWA 2GAFA 2XUHA 4QLBA 1AQLA 1Z4IA 1ZOIA 2EQAA 3BXPA 4UUPA 2GK7A 2C07A 3EGWA 1XLTA 4G9EA 4KGXA 2F67A 3SJUA 4GKVA 2P9EA 3ZEAA 4UAUA 2H7XA 5JOQA 1NQTA 1L3IA 1PR3A 2PH1A 3VXKA 2DHDA 1VL0A 2JLCA 4YWHA 1N2CE 3CPEA 2ACVA 3K09A 2I6XA 4FFNA 4W63A 5IN5A 4X1KB 2HFJA 1QAMA 2GK6A 1G3RA 1F0KA 2HIMA 4NE7A 3RNOA 2CLEB 3TJMA 4PSUA 3VV2A 3ZY4A 2I2AA 1G7RA 3EOZA 4UNQA 1NVVQ 4W1QA 3E1SA 2ILTA 1HURA 1R6DA 1ZNWA 5BORA 3A6GA 1VKZA 3L04A 1ZUHA 2X0NA 3HS3A 4YXFA 1XVUA 1YB4A 2HJHA 3LE8A 4LQCA 3WK6A 4KX3A 4P4UA 3JD4A 3ZS8A 5A03A 2PTGA 2IYZA 2EW8A 3PQ7A 4I0WB 5KEIA 5AYVA 3O0DA 1UT8A 4JUIA 4RO0A 2ZYVX 5K3DA 1CNFA 2Q5FA 1H2BA 3HWWA 2IU3A 1NRXA 4OM7A 3EVNA 1YK1A 4NU8X 4UU7A 1NKSA 3F4LA 3FG9A 4WESA 3RFVA 3ICVA 3JSXA 1XIVA 4CIBA 4RW0A 3GRRA 1CVLA 5BWOA 5JZBA 4ALNA 3IJPA 1Z2EA 1AHHA 1U6IA 1GARA 4YQFA 3VU9B 3FCXA 1HQKA 1Q91A 1WCV1 4IFTA 2BR4A 1ZOLA 4ZEOA 3D4IA 3AHGA 3HUEA 3ISJA 1FY2A 2FP4A 4FE7A 4MB2A 2FN8A 2I03A 4BKPA 3PHJA 4KPUA 2OBYA 1LNQA 2FQQA 3LL7A 4B82A 2IUYA 3LX6A 4BX9A 8ABPA 1V1RA 3TDNA 2PX6A 1HDRA 5LB2A 2VWGA 5IT0A 3A6ZA 4U7JA 4W6QA 3ZHVA 1P7CA 2AKAB 1YWGO 1OFGA 4HWPA 4ML3A 4GM4A 2G72A 4RAOA 1E2UA 1YVUA 3PWSA 3K0KA 1QZTA 4E4YA 1XVIA 4DM4A 2C8KA 4AD8A 3ICOA 2ARKA 3W8EA 3WNDA 3SMVA 2GJ4A 2Q0XA 4HC4A 1DKMA 4KXWA 4YT4A 3BXFA 5FJJA 2MYNA 4P32A 4ZREA 4B6FA 1DG9A 3C8UA 4QGAA 2P78A 2UYCA 3SL7A 1G8YA 2YV2A 3GJQA 3QNUA 4QDUA 1YJ5A 5KQPA 1VGVA 2D8AA 3ZBQA 2VHWA 2H1SA 3DTYA 3ORGA 5K0TA 2EG5A 4GR5A 4OK6A 4FFPA 4BO8A 2NAPA 3S2GA 1XTKA 2DT8A 1R16A 1RR6A 4CT5A 1XYYA 4P7JA 1NN1A 1ZNZA 1BH2A 1GKYA 1DEHA 2VQSA 1T4CA 4HGOA 3ET4A 4HDAA 3DDCA 3KVOA 4FMDB 3IVMA 3HK2A 1O6ZA 5GY7A 5F3DA 4LECA 2W2XA 2XD4A 1L7PA 3EWIA 2JK1A 5DSTA 4OBWA 4HNQA 3SM9A 1FEZA 2DPLA 3MTIA 1JLMA 1OLUA 1PWXA 3WJ1A 3TKYA 4X63A 4EY7A 1W4RA 4HI0E 2ZBQA 3N76A 4GMGA 4R8VA 1UT6A 1XZFA 4HSEA 5F33A 3U13A 3X1XA 4J0EA 1YVEI 1B2RA 3ZBPA 1UDCA 2E87A 1MRZA 3NHJA 3RS9A 4P0PB 2Q4TA 3CH5A 1C4XA 2OXTA 3TLMA 4X5OA 3SXUA 1DUVG 1U7PA 1UJ6A 4FI3C 1CX9B 4N18A 4IFIA 2F3TA 3TW4A 4GVXA 4J2HA 5FOSA 3LWDA 3X1ZA 1F8YA 4IJVA 3DZIA 3LVFO 2FPPB 4YT8A 1L5NA 2YJZA 2V7UA 1Z0DA 1OJ7A 3T06B 1M1ZA 4UTVA 3TCNA 2V6IA 4GMHA 1LV7A 1YCGA 1WUJS 3C3XA 2VJLA 4FGLA