3PC7A

X-ray crystal structure of the dna ligase iii-alpha brct domain.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
b'SQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 3
molecule tags Ligase
source organism Homo sapiens
publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
total genus 17
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16759 LIG3_BRCT DNA ligase 3 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pc7A00
1L7BA 3SHVA 2XNHA 2K7FA 3K0KA 3II6X 4Y18A 3PXCX 4BMCA 3UEOA 1CDZA 2D8MA 1T29A 4BU0A 1JNXX 4XQ0A 2COKA 3UENA 1OQAA 3FA2A 2JW5A 3EF1A 2LE0A 4ID3A 3I0NA 3JVEA 1N5OX 3PA6A 1WF6A 2INGX 3K16A 4BU1A 3SZMA 1Y98A 2EBWA 3L41A 1T2VA 2COUA 3I0MA 4XPZA 3PC7A 1L0BA 4N40A 1IMOA 2EBUA 3T7KA 2K6GA 2EP8A 3T7JA 1GZHB 3PXAA 3PD7A 3PXBA 3SHTA 3HUEA 1KZYC 4OFBA 3PC8A 3OLCX 3PXDA 1IN1A 3T1NA 2ETXA 3KTFA 3K15A 1T2UA 2HTFA 3PXEA 4BMDA 4U4AA 5ECGC 3EF0A 2ADOA 3HUFA 3AL2A 1Z56C 2L42A 1T15A 3QVGA 3QVGB 4IFIA 2AZMA 2XNKA 3K05A 2VXCA 2E2WA 3PC6A 2DUNA 4JLUA 3U3ZA 3L46A 2R1ZA 2WT8A 3L40A 3K0HA 2NTEA 4Y2GA 3AL3A 3COJA 2COEA 3T7IA 3PC8C 3SQDA 2M2IA 4IGKA 2VXBA
chains in the Genus database with same CATH superfamily
1Y4AE 3KV3O 4G1CA 4ZOAA 1FVXA 2F43A 2HCJB 3H5IA 3RAFC 3ROTA 2VT3A 5AM3A 3OTGA 2WYOA 1KA9H 4QJIA 3DTVB 2GWRA 3F4KA 1DTEA 1AGPA 3A1UA 3HV0A 4DW8A 2ZDGA 1USWA 4YRMA 3E9EA 1PJBA 3Q9SA 3F46A 5LIPA 1C1XA 3R6TA 5EQTA 1J07A 1JQDA 1XZNA 2V6JA 4NCAA 2QRVB 2EQAA 3PI6A 4GMFA 1NOKA 2CXRA 4O1HA 3CE9A 2IYZA 4RIIA 2OCIA 3LXMA 3EPPA 4P3KA 2H5EA 4ZP1A 3ITEA 2X8BA 4RQAA 2ZYWX 4JJ8A 4ZRDA 3ZLVA 3SC3A 3E7PA 5DEIA 5IU6A 1NI3A 3LECA 3A1SA 5DSZA 3IL2A 2JFXA 4EUSA 4YLEA 1M6VA 4BZPA 1B0UA 1PR1A 2EIXA 1BS9A 2BKUA 4HVAA 4OA5A 2PZEA 1M75A 4JC5A 5JHHB 1RPNA 3FI0A 4C07A 4E1VA 3E15A 3GBVA 2XVAA 5DH9A 4EPXA 4ETMA 3JTMA 2PK3A 2O8CB 2H00A 4OD0A 1SK9A 3KPVA 1FNNA 5HUHA 3QEMB 1E0AA 3BSSA 2X86A 1R18A 4J6FA 2C0CA 1QR2A 3R7AA 1MW9X 3QEKA 2DLDA 2R47A 2Y99A 1IBCA 1PNVA 1G55A 2V6BA 4DLSA 2EL7A 5LBIA 4WMLA 3PL1A 3TIGA 3KETA 4UQPA 1P7VA 1XHEA 3S1LA 1VPWA 4BS9A 4YC7A 1DBVO 5JI3E 1UJ4A 2IIBA 3A70A 4GG1A 3T0IA 2V6IA 2BGWA 2WZDA 2R2AA 4W7IA 4S05A 2AQIA 2CNOA 3IKLA 5EERA 1HTWA 2FPGB 4URFA 4CMJA 1X1AA 1ZONA 4YAIA 3W4KA 3UAGA 1C80A 2KE5A 3KL4A 2RC5A 5JH7A 3W5UA 2YVKA 3I9OA 3COWA 4CM4A 5TF0A 3EIQA 1S6YA 4MWGA 5EFZA 2PVCA 1NWHA 3EA0A 3GXBA 1UQTA 2CZCA 3FCCA 5K9ZA 2ZZKA 3IJPA 4U8HA 4ERXA 1R4ZA 4B7UA 4K2HA 4K9LA 3HWRA 3FMOB 1ZBDA 3D4OA 3NKLA 5ALUA 4ROTA 1BHO1 5DK6A 1JPJA 1EHIA 1V3QE 3MIIA 2AG8A 4JBXA 1QG4A 3KOXA 4NZMA 3AT1A 1NBHA 4MV4A 2OILA 3VO9A 3ZE6A 4QODA 4H4DA 3T99A 5K6RA 6ABPA 3ST7A 1KFCB 4ZT5A 1JQLB 5SY9A 3DOUA 2LBPA 2H7YA 3P45A 1Z5ZA 4MQEB 2Z4TA 1OLOA 1Q7CA 5F52A 2FOXA 1IZ7A 4HGYA 3HB7A 2M6LA 1YZNA 4RHUA 4F60A 4WE3A 4W1PA 4OHWA 1L5LA 3MTBA 3KR2A 2I67A 4BNZA 2W00A 1UZUA 2NOAA 2XIJA 1U8CB 3HKCB 1W47A 3NBKA 4OO3A 5KTRA 3FUWA 1YQEA 3ZW9A 3WWYA 5AOVA 3GOHA 4HKTA 4HNAA 3HNPA 2ZIAA 4IJUA 1IWOA 1N2EA 3C7KA 1XNRB 4RO0A 1ODFA 2YJ3A 3R7DA 1ISGA 2A3NA 3VHRA 4NFSA 3TUZC 5HNKA 3HM2A 3WYDA 4DUPA 1VMIA 5LQAA 2ZSEA 3DBRA 3AEZA 3NHMA 1XF1A 3KUXA 3SIPA 1G3MA 4P3YA 4ZTZB 3X0DA 5ALIA 2ATCA 2W6OA 4YS6A 5LB2A 3ZZ0A 2EKPA 3STHA 2XB9A 1Z6ZA 3REOA 1JILA 1S9HA 3CJRA 3HJHA 3QXHA 4I81A 4L3WA 4YH1A 4BU1A 1IM2A 5BN4A 4AJEA 1CY2A 4Y98A 2BE9A 4Q4HA 2V3VA 2Q7OE 5GZ6A 4CKBB 5HR5A 4M9XA 4YMWA 2Y1CA 4PU0A 3VO8A 3B5EA 5AYVA 1Y8ZA 2JBAB 1YR1A 5ECYA 2WI8A 3QXSA 2NZWA 4BDSA 3A31A 1A8HA 3ACDA 2A59A 4X45A 1VL1A 4KFTA 2F1HA 2NSDA 2PT7A 4QICA 3H4TA 1YTUA 5JFOA 3KK0A 2Z4RA 1SZDA 3ANMA 1I1QB 4FGLA 4TMVA 3UMGA 1R5BA 1YBHA 2ZE7A 4ZANA 2RH5A 4R1LA 1RRCA 3PQFA 3GFSA 1WEKA 2NZUG 2DQZA 3VDMA 5A9TA 2B1JA 1J00A 4R7ZA 2MHCA 1W49A 2DUJA 3LCJA 1V48A 1TA9A 1SVLA 4MV0A 2D5CA 2IH2A 5JAPA 4ZU1X 3QMPA 1WOMA 4O4HA 1EFPA 2J33A 4P58A 2XCQA 2TSYB 3D4IA 3FNGA 1VKJA 3AHIA 1DFGA 3VFDA 2WHQA 1CF4A 1XYGA 5KX5A 3QLEA 3OQ1A 4IQ4A 4TWIA 4QBTA 1H6AA 4E22A 1T91A 1E94E 4XFDA 4NAHA 2D54A 3ND9A 1GITA 4A3SA 5JFTA 1LEHA 1N0UA 5JZSA 3LLUA 1G7TA 5JYEA 2Q4RA 3KXKA 5F2OA 4OUKX 3J80A 2ZYSA 3N6XA 4TM7A 3ZNPA 3VKHA 1F1JA 4V0ME 3F3KA 2CB9A 2BTOA 3KX2A 1U1CA 3DEIA 4OK3A 5I7HA 1CQXA 3AB7A 4O3MA 1DKQA 2WIFA 1PDVA 1Q15A 4JH0A 1ZVQA 4GXNA 4KO1S 3MLEA 3C43A 4AF6A 5HZHA 5EIBC 1P9LA 3A1CA 4QOEA 4FOSA 3OOJA 1ONOA 4OHXA 1SCNE 3C6KA 2XMPA 4TYNA 1PNRA 3WL4A 2QS9A 4TXMA 1B0AA 1RNLA 3CXUA 2CFRA 4BFZA 3INTA 4LXGA 3ZE9A 3TJRA 1U98A 4OJNA 4R1TA 5DHPA 5FLKA 2CBXA 1J2JA 3FZEA 4PYMA 4TLDA 1K68A 3TRJA 1A8IA 4A5OA 1C8BA 2AYYA 4UU7A 1GPNA 2GCGA 1P61B 3UGTA 4JLWA 4TV8F 2OE2A 4BXOB 3TLMA 4QGBA 4Q5IA 1FPMA 4EG8A 1UOOA 1TT5B 1QCZA 1P8JA 2D2IA 2WSYB 4KFSA 3FYDA 2PUJA 4RD0A 5TQ2A 1EI9A 5I7EA 1I3KA 2D1TA 5FHRA 4HTAA 3K0AA 3PFIA 2HBYA 1NUQA 5HBGA 3VYSB 5IVPA 2WWYA 2V6MA 1Q95A 1S7GA 1FB5A 2VZLA 2BFBB 2CJXA 2X9VA 1XTPA 1KHTA 1Y1RA 3EVAA 4RK0A 2B4YA 2FZKA 3FOAA 1A7JA 4NHOA 3AY6A 1NXTA 2DP4E 5BWMA 3ZVNA 4HXGA 3RI3A 2XYQA 1P9NA 2ZI7A 1O94C 3KLOA 5KKNB 1A7KA 1G1AA 3WMXA 1QIKA 2CVOA 3NP7A 4TZ0A 3VC7A 4AMGA 4KDRA 3RK0A 3K2EA 1S89A 2BJHA 4QE3A 4Z1MD 2AWOA 2P78A 4P36A 3O4FA 1U3DA 1ZD8A 1DMSA 2QRQA 2YY5A 2EF1A 4GSLA 2AEFA 1A27A 5H3HA 3Q3VA 4BP1A 5ICEA 4UKDA 1VB5A 4L6CA 3MHTA 5EAIA 1HXHA 1B4DA 3WIUA 2WKPA 3B1KA 1O6ZA 4N7RA 3RFFA 4B4VA 1BA3A 2IZ5A 1E5DA 4OQYA 3LG2A 1OBOA 2O59A 1C0EA 2PR2A 3L7MA 2BGTA 2BM1A 5J5VA 3UMJA 4QJ4A 4BAZA 4DCGA 2G04A 4U9IS 5DW0A 3GNQA 2QR2A 1F14A 2NXWA 4CM1A 3TW4A 3HA7A 1QHEA 1YFZA 2XITA 4KYUA 2JD2A 5H83A 2WY2D 3KKLA 3Q5DA 3QVTA 2A6PA 4Y9TA 4V0LA 4EG4A 3EUFA 3I3SR 5KKAA 2DBYA 3HGTA 4NYMR 2L19A 2GK6A 4EH1A 3M82A 1RPAA 1HWYA 1U0NA 2O2DA 3U0VA 4A26A 1FTWA 5L3ZA 3H17A 3VOTA 3PX2A 4YROA 2CKMA 3IPLA 2GHTA 3PYLA 4LVNA 2X6RA 4N0PA 4CI9A 3JAKB 2JH8A 2XHEA 4M49A 4YBRA 5FI1B 3NRBA 1KDYA 3M34A 3ZGOA 4EJ2A 3L8GA 2YR0A 1E9SA 2V7QD 3E8MA 3RD5A 3L9WA 4ACBA 4ZCIA 5IXYA 3FVWA 4K6GA 2IDZA 3R74A 2C1XA 4J4HA 2OBNA 4BX0A 3PXEA 1BDMA 4AXBA 2QMQA 1X1EA 1AMOA 4FYVA 2H9IA 4JJGA 1UKZA 3EXIA 4KNWA 1Y7LA 2N42A 4NK5A 5C51B 4HQLA 1PT7A 1TO6A 2BFDA 2WF8A 4KO8A 1IAVA 4FGJA 1W2HA 1J2RA 5BV7A 2O0MA 3O82A 4QM7A 2JGEA 1MOPA 2R00A 3K5PA 4GOXA 2C9OA 2ZP1A 3L79A 4OCZA 3WYEA 3ZZMA 2FJ0A 3RF7A 1Y1QA 1NNI1 5AJHA 4QUBA 1R8YA 3UOAB 2ACVA 2NO6A 1RQXA 1OX6A 4GT1A 1ML3A 4YJ3B 4HHEA 3O73A 1I4DD 3O4GA 3A2KA 2ZG6A 4BRZA 1HYEA 4N5IX 3RIXA 3EVFA 1PGJA 1BE6A 4EARA 2WU1A 3OFSA 5HMMA 2E21A 4KI7A 4JI6B 3WOVA 4DRZA 5JFGA 1ECGA 4YRJA 1CT9A 5FWNA 1OZ0A 2GAAA 3Q7EA 5E6UB 1THTA 1NZFA 2BOVA 4G5QA 4L16A 4RA9A 4PN3A 1M6HA 4DHWA 3CR3C 3PKZA 2JCXA 1QONA 3H2BA 3TAXA 2IZ6A 2WTMA 3E27A 1EG7A 1LPAB 2AMFA 4XA8A 2VQEB 3GDOA 3UFXA 2FXVA 5KAMA 4CEIA 1I9CA 2HSDA 3I37X 4JXJA 3RWBA 3ZS8A 1S9DA 2EJBA 3C8MA 5IAOA 3C1AA 2XTNA 1T6NA 1LQUA 3KP1A 3LA6A 5IBQA 1MABA 4LRWA 2CGEA 2H1FA 4EHAA 4F38A 3HMKA 4DM4A 2FPPB 4G89A 1NXQA 3BWEA 2PWYA 3Q88A 2VYCA 2UUCB 4AT1A 4DHEA 3QBJA 3GRRA 1O0CA 1IYZA 1RYEA 1Z4QA 3LP8A 1RI2A 1USKA 3PUYA 2I5PO 2FEXA 1T6BY 1TADA 2I2BA 3DBLA 4DG5A 5GVRA 4Z7OB 5ALGA 3GLGB 1RKXA 4H7DA 3HQ4O 4LJSA 2PYIA 3KT0A 4LVUA 4EABA 4FLEA 4KIGA 3L7IA 3STYA 4C0JA 3P9PA 5CX1A 2LE0A 4IZIA 1DHTA 4KV7A 2OAP1 5FWXB 1L3CA 1WZCA 1JDBC 1QGUB 2D5BA 4ZOLA 3FM9A 1NZJA 3BD7A 5KWSA 4RY9A 3NCHA 4RHXA 1WPXA 3E3LA 3IEVA 3ASZA 5ALOA 1XI2A 4ARZB 4B8YA 3E5MA 1E5VA 5JY6A 1KI1A 1JPVA 1X92A 4S1VA 4UUPA 4PLPA 2QUHA 1ZD9A 3ZDZB 4YFYA 4EW3A 1FRQA 5AI4A 3KJHA 4R5MA 2QYTA 5HE8A 4J94A 1UDCA 4N9WA 4UMDA 3AFHA 1YD7A 3LX6A 1GD1O 3L4EA 4DWJA 3E1GA 3H0EA 4QDXA 2W93A 2ZUEA 4J1QA 3NOQA 2J87A 3G82C 3QQ5A 3RJMA 4QPNA 5JJ5A 2A67A 4EGCB 5AKHA 2ZEJA 2D74A 4S3MA 3GPCA 4JLBA 2HGSA 5B64A 2AN5A 4D81A 2H65A 4CEHA 2FR1A 2OOSA 1FMCA 2EEZA 1UBEA 3WFJA 3B3JA 3JQFA 2QX4A 2JGJA 3KKNA 4R1QA 3KL2A 5IYZB 1PEAA 1YACA 3GEGA 3IR5A 3S81A 3IV9A 2VFAA 4ITVA 4MV6A 2UZ1A 3OZ7A 4L07A 4XYMA 3VHXA 1OV6A 3A0RB 2BY4A 1PK9A 1ZIOA 2FQXA 1YS4A 2FMTA 3TRHA 3I62A 1RQPA 4E5DA 3SQMA 4J0IA 4ZDKA 3TN7A 2ZI9A 2BUAA 2ADFA 2W2QA 1QOQB 2H2FA 5CVJA 4KIJA 2JJ1D 4ZA2A 5F4BA 3JQ8B 3FPHA 4I1IA 1ENYA 4JB2A 4KRXA 5G4LA 1XLTA 1HFWA 2G06A 2Q6LA 3LV8A 3V34A 3G2PA 1UPUA 1YULA 3V3TA 3F2VA 1R8QA 2E48A 4P5PA 2FG6C 4TL7A 3HN6A 3KKPA 3RF6A 2ZTHA 3SS8A 4D4JA 3MMXA 4ICIA 4B3TB 1G8PA 3ZC3A 3K73O 2AD1A 3B6IA 3QW4B 4URUR 3MILA 3PEWA 3EPKA 5BRJA 3I6ZA 4PLCA 3STVA 1EX7A 3SZ3A 4F5WA 5DTIA 5DNCA 2PY6A 4WW0A 3RJZA 4EW1A 4J43A 5D3QA 4CIXA 3TR0A 2RHDA 2PRYA 1NBWB 3OU7A 5AWFC 3FRIA 2IYEA 5ESXA 1LBHA 1LK5A 5DHSA 5LP1A 4GYYA 1QLWA 1Z47A 4WAUA 3EHEA 2UUPA 1MO5A 3GWGA 3QFHA 2HIHA 1Z8HA 3UXYA 1EWQA 3EXIB 4G56A 2HW8A 1FDTA 3HH8A 1Z29A 3W5BA 2W6NA 1UOEA 2O50A 5K51A 1KDPA 1PZGA 2JLYA 1JUDA 2QZZA 3EXG2 2QTNA 1MZVA 1ZNWA 1TGYA 4AJLA 2HF2A 3VSEA 4G0NA 1P2FA 5F2NA 1FP7A 1QZTA 2AL7A 3HWSA 2OGSA 4FCTA 3CTPA 1F6BA 5C8VA 1I7PA 4OQ4A 3A1DA 1MD9A 2RGAA 2VA9A 4MOWA 1L9XA 4TZKA 3PGMA 3D3QA 1M0EA 1II9A 4GQBA 4QUKA 1I7NA 1ZX1A 5EJFA 3WLOA 1Q83A 3Q6IA 1H22A 1Y6QA 2EKZA 3KQWA 1SEVA 4H1TA 4A8HA 3HVJA 3ZI7A 1SG9A 4PWYA 1JYEA 1J1UA 4CM4B 1C7RA 2HPAA 1WUJS 1GPBA 1XZMA 1O7JA 3GLHE 4DPLA 1SQSA 2AUNA 3K9LA 1S8OA 1QRTA 4LF9B 1P1CA 1T8WA 2AMVA 1FEZA 1ZUIA 3EXFB 3OZSA 1W0JD 4JA2A 3ZKAA 4IHAA 3D3JA 5CM9C 2IQIA 3IYLW 2J67A 3NC4A 1WHSA 5IDYA 3B1XA 2GBCA 3ROXA 3EDYA 3EQ8A 3VI3B 1GV0A 4H1HA 2DH6A 4GXQA 1TUGA 1RFGE 1M8JA 4OAOA 3C0KA 3UUFA 4WLOA 1PWEA 3ANLA 1IH8A 2VYND 3BWXA 4MRSA 4JBIA 4PANA 1DEOA 1NVBA 4C1BA 4POOA 1I3MA 5H7XA 9LDTA 1HTTA 1NU8A 5JAUA 1RZ3A 1QGUA 4L0CA 2GXQA 4NE9A 2O8CA 3ED5A 4IIHA 16PKA 4ZTUB 4JUIA 3VRHA 3JYQA 2B21A 1J0CA 2I3ZA 2LIVA 1B6GA 2NQ2C 3CT4A 5FV7A 1ND6A 3U3RA 5CVCA 1XPJA 2OV3A 3FHJA 3L7KA 3R3ZA 4YAKA 2ZE5A 3CFYA 3MBOA 3HKEA 3QU7A 2AKEA 3QE9Y 2C04A 4UJ5A 1KRWA 3D6JA 3HBMA 4PZDA 1MV8A 1UOPA 3DAGA 3TIIA 3PQ8A 4KXVA 1J97A 1RP1A 3DVAA 2R7KA 3T5MA 3FOEC 4W5JA 2RGWA 3SVLA 2JDIA 1VHLA 4UM9D 3S2ZA 4A5SA 1C3LA 2VKTA 1QM5A 2A4KA 2WG1A 1ULSA 5KYGA 2DJ5A 2FPWA 1X7ZA 4G5HA 4I4TA 4LV5B 5HOQA 1UL1X 1MO2A 2C4MA 3OFKA 3OP4A 4OIFA 1GCIA 1RHMA 4ZK2A 5K7SA 1GTL1 5TIIA 4FXPA 4FKMA 2PJDA 4MEJA 2CNLA 5E6UA 2XVYA 3C6XA 2QNIA 5T4EA 3EAQA 2FTKE 1CUIA 1E6KA 3O1LA 2NYVA 3QI2A 4JROA 2FGJA 3MWDA 3WA7A 2Q6OA 1YE8A 2GJKA 1U7UA 1U2GC 1MTZA 3FKSD 1RJFA 4Z9FA 3B8EA 4PQYA 2EL9A 4LRUA 1YAHA 2YBEA 4OP1A 2BD0A 2P1DA 3RAEC 1YWGO 2IH5A 2B7BA 1V47A 2IS1A 4QLBA 2R8EA 5EZYB 3FBTA 1J42A 2PLAA 4UEKA 3IP3A 1QU3A 2G09A 4P35A 1QH9A 1RC1A 1YUBA 4MZDA 4KLAA 3RVBA 4RYDA 2C92A 1FJ2A 2XYRA 1AN0A 4TQAA 1XQ1A 1XF9A 1L1EA 3CA8A 3TSWA 3NC1C 3ZG6A 4X66B 3QTLA 4PC2A 2YXNA 5SZJA 3SZOA 5JNLA 1Y1KE 4JBNA 3SF8A 2ZSUA 4DBZA 4K9KA 1NV8A 1T29A 3CNOA 1FP1D 2YJTD 3ABZA 3LVBA 3OOWA 3SS9X 4EG5A 4D42A 3C7DB 2QSUA 1YMUA 3MJCA 1NXPA 4MQLA 1R6TA 5T41A 4HLDA 2GPTA 4R8KA 4DNQA 5I5EA 1WHTA 3QMMA 3X1DA 1R6AA 2QJOA 3RT9A 4BMNA 1Y6ZA 5DYWA 1DTSA 1NJSA 1FLDA 2WICA 3ONEA 3RRMA 3TTYA 4LTNA 3FE2A 3IRVA 3EW7A 1OLUB 4RQUA 5DXFA 2W2VA 3PUHA 4GXTA 4RLFA 5AW9A 1KO8A 4AW9A 3VNUA 2PXCA 4S2EA 4AYWA 4GD3Q 3BDAA 1HG0A 1P6XA 3SVTA 5EHIA 3OQ6A 5AM4A 3KALA 2FR8C 2G3YA 3WZLA 4RTLA 3N2EA 4OI2A 1G2IA 2KMLA 3F6CA 2BI4A 1N2XA 3ICVA 4GOLD 4O4LB 3T3HA 4OHYA 1Z6YA 1G9TA 3OIFA 4NAVA 4H60A 4C7BA 3ZS9A 3H11B 2BFNA 4GMKA 2BMDA 3IIKA 3BXZA 4YFVA 3U3OA 4W5QA 3H1PA 4WXEA 1MZPA 3K1AB 3IVXA 4JU8A 1Q0UA 5JJLA 4N3GA 4POAA 1SUCA 5AVZA 4QYIB 1JIQA 4QUIA 1XD2A 1XCOA 1UBNA 2EJCA 2J9GA 4MYUA 5AJZA 3GJSA 1VE9A 3B3FA 3SR0A 5KNBH 1EBBA 1D2GA 4PLYA 3FGNA 3PGXA 5KSZA 1TKBA 4GS5A 1EG2A 3KHTA 5TQ0B 2J5KA 2VPWA 4K6KA 3CUEF 3KR1A 4Y1RB 4BO4A 4W5TA 3LC1O 3HDGA 5KYKA 1LBTA 1TTHA 2IIVA 4ZZ1A 1A7UA 1KBQA 3AF3A 3EGOA 4IYJA 2GHIA 5DM2A 2VN8A 2JLAA 3GYGA 4U6SA 5HG0A 3AUSA 3UK6A 2R5FA 1J99A 3ZTTA 1EBFA 4GOND 1AO0A 1NA5A 4XWGA 2O3RA 5JQGA 2O1SA 2QL9A 1PZFA 2HGZA 1GA6A 2X2OA 4YV0A 2PWAA 4N5LA 1NW8A 1PLKA 1UOQA 1H2ZA 1ZK2A 4TUYB 1M6NA 1QF7A 3S40A 5K2OA 3M5CA 4B4OA 4FSXA 4E1AA 1J8FA 1NHWA 3AL2A 3SJZA 4BPRA 2AQKA 4IDAA 4XR9A 3GPIA 1C2TA 5LM3A 2AEEA 1CUXA 4NBNA 1WIWA 3I04M 3F6PA 5JDCA 1DKLA 2B78A 4KR9A 5BSUA 2Q9UA 2O3TA 1CUEA 4AULA 3CX8A 2CEKA 2MYTA 4H31A 3SX0A 3AVYA 4P83A 3VYRB 3GT0A 1O95D 4BN0A 1F06A 3MT8A 5JSYA 5CYPA 3PQ4A 1MENA 3L46A 3OESA 4N03A 1EB8A 3DFZA 5DGIA 2JRLA 1JV2B 3QM1A 4TTPA 3TPZA 1KKMA 4BVHA 2C4NA 1ZD2P 4GH5A 1VL6A 3PEUA 2B5WA 3PDWA 4L9AA 4AP5A 2D6FA 5AH0A 4JSYA 1KAMA 1NXVA 5G2OA 2O8NA 1LK7A 4RENA 4D9CA 4YXFA 3RUAA 3ORQA 2B35A 1P0PA 3H8JA 4MR8A 3D1VA 2JGIA 1GT91 2ON6A 3VNSA 4PF1A 2YIVX 3FZNA 3CO0S 1JJIA 5A06A 5JJKA 4DXAA 1AUPA 2VF5X 3TLBA 2HH9A 3RABA 3PTLA 2CUNA 3Q5GA 3DT9A 2E89A 2GM3A 3SLKA 2Q2OA 2BI7A 4DDTA 4NOKA 3U7QB 3AMVA 2NG1A 4MQFA 1DKRA 1GGKA 4LJAA 1GTG1 5HMLA 4ZVKA 4MRMA 4EY5A 2ZUTA 4M76B 4PAWA 3NHFA 2QX6A 3NHRA 4L2IA 1XNJA 1EDDA 4R4JA 4RJLA 4LC1A 4OHFA 3MTQA 1M1XB 4H1UA 2XDYA 4MPJA 4RD4A 3V1MA 2X3UA 3ZXSA 3AY3A 1JEOA 4NFHA 2JIZD 4B6RA 1Q2XA 4M98A 1YZYA 2AN1A 3KAQA 4XI9A 3FZYA 3FWYA 3BJZA 4WIAA 1YASA 3GPBA 2OECA 1M2GA 1QOPB 2IHUA 4AO7A 1XAHA 7MHTA 1T5DX 4EDHA 2VJKA 1M2OB 1QAOA 3N2KA 5CFRA 3OFNA 4AJOA 1D1PA 4UHHA 1BS2A 3MCUA 2W6IA 1M6WA 2BM8A 3VO1A 4EB6B 3IE1A 2IZZA 1NUTA 4FZVA 4XM1A 3JQ9A 4J76A 4WRRA 3MELA 1KP2A 1YZVA 1RRGA 2BELA 3AP2A 3BRWA 1LTKA 5GP1A 4G1VA 1GKKA 2VUSA 3IHKA 1KI4A 3C70A 3PXBA 1I6KA 1OXKB 3G2OA 4HQ0A 3MAGA 3LPCA 4J91A 5CXSA 5DISB 1HT1E 1TTPB 1UQRA 2C4VA 4BX2A 2BLNA 2BSQA 1POWA 3LZ6A 2QTWB 3LL4A 4TQGA 3G0BA 5D3MA 2R8OA 3VKGA 3GFQA 5CH8A 4DWWA 4ARSA 3GPLA 3C3DA 3WLLA 5JCOA 5EJ9A 3AV0B 2GO1A 3BJEA 4YCMA 1R74A 4IVNA 3THSA 3M6VA 4RZUA 3PFGA 1OYOA 1C3XA 4EHLA 2D7JA 1AK1A 1I4TD 1E3EA 1YVEI 4RD3A 5U4QA 2RE8A 2BFAA 1I6WA 2YWEA 4MDHA 1FJGB 3T8YA 3U4AA 3W8NA 1WM1A 3K5HA 3DMFA 3A9UA 3ZBUA 1TE2A 1QKJA 4HUQA 1QFJA 1FU4A 2IPAB 5H82A 1UAYA 1EX1A 2AHRA 5I7RA 4RIGA 4WD3A 4BVAA 1KEUA 4TT3A 1FSPA 4HP8A 1LY1A 2H06A 3IQHX 5FL7D 5C9ZA 1QQTA 1BMFD 1TM7E 2QM8A 1JAYA 1XJWA 4UHDA 1Z12A 5B1HA 1PV1A 1LGYA 2XMCA 2ZRAA 2ZT6A 1P0MA 4LV8B 2ZRJA 3NDJA 1DWPA 3EK2A 1G8JA 3I6IA 4JBLA 4QATA 1WXFA 1PR4A 1G4AE 1PIWA 3TNDA 1ZUNA 2VDWA 3JASB 3N2LA 4CLDA 4AAYA 2J4CA 2WYUA 4HZUA 4OKNA 4QUJA 4E03A 3WWOA 2WKQA 1VE1A 3CNBA 6YASA 1SJ9A 2QPTA 4FFMA 2WQ6A 3PI7A 3NBUA 1X1RA 4NE7A 5AJTA 5JD3A 3DZBA 2JK1A 4MA4A 2XB8A 1Q1AA 1C41A 1F2UB 1V35A 4BEVA 2AK2A 4V03A 5M5BA 1JIKA 1NDUA 1L7BA 1N8NA 4LE1A 4MDYA 4MIOA 4BB9A 1WETA 4ARCA 4BNFA 3K0KA 5DGTA 2IFTA 4XPIB 3LRTA 1O96A 4KK4A 4MUAA 1CY6A 1E3JA 1V4NA 2AJ8A 2HN9A 2NU6B 1X9IA 2YFKA 2Q0QA 3BEOA 3OEEA 4GC9A 1UFVA 4OBWA 5K4AA 1NVTA 1ZSYA 4UU8A 3E3MA 3N70A 2PKRA 1KJYA 5A4KA 2FMKA 4KIFA 4AD8A 3HVKA 1OXBB 4K1XA 4P82A 4DV7B 2VLBA 1EKXA 1TM2A 1UMBB 3I4LA 3JAWA 3KB6A 3INGA 2GHQA 5JXJA 1IM8A 1E79A 4OLHA 4EAQA 5BV8A 4OSEA 5KDOA 2CJWA 5CG2A 1NW5A 4ZO7A 3QJ5A 3MVEA 3EPLA 2P75A 9MHTA 4GMGA 2Y1LA 4AJIA 4JBHA 4YP1A 1ZRHA 4BLOA 4B46A 1GRQA 4I1YA 1LTQA 4M7PA 4Y7DA 2VEOA 3N8GA 5LFAA 1EXVA 1CS4C 4EECA 4CM9A 1ST2A 4YT4A 4DA0A 2CLKB 5A3QA 1GYRA 1DIHA 4LW8A 3TRFA 1UKBA 4B34A 3WYFA 3LWZA 4BNNA 4GIBA 3IPYA 5I4KA 1T4CB 5AQEA 2B99A 4YCSA 1P5HA 2GZ3A 5K3DA 3C16C 3DJFA 2H11A 4BNUA 5ITWA 1H93A 1TPYA 3R20A 2O8FA 3ZZNA 2K6GA 5IVIA 5LB4A 1QZUA 4J7CA 2R4QA 3DHVA 4ZQBA 5A5DA 3G0IA 4C3ZA 1NP3A 2ZUCA 1WW3A 5INTA 5BV1A 4ND2A 5CVDA 1C4XA 4DT1A 5EE1A 2F2TA 2ZRCA 2JBWA 1KNXA 3IDFA 2PZLA 4EJMA 1SB8A 3HU2A 1R4MB 5EHQA 2Z3ZA 4PLZA 4LBYA 1JSRA 4QDOA 3OZGA 4DCPA 1MX5A 1R15A 3MB5A 4ZQHA 3WS7A 2GCNA 1MC8A 5ITZB 3ED1A 1CUVA 1X9HA 1ZMTA 3L43A 2CXSA 2SICE 4RGBA 3R3JA 5IPFA 2FG7C 3ZWBA 3N7TA 1IY2A 3DKRA 1BG6A 3VPCA 3NWBA 4WBNB 2I55A 1KO5A 2V7EA 1KDRA 1U4SA 3AZQA 3MPUA 4A0RA 5D84A 4YRSA 3U6KA 1CUAA 1AY0A 3B6ZA 1K5DA 4O4JA 2ZXFA 2RBEA 4JWTA 5BMVB 5CDHA 5FL7A 2HNKA 1C3JA 1A8PA 4CQMB 1XDWA 4WKPA 5HJEA 1HX7A 1MQ8B 4W99A 2AJBA 4BKOA 7GPBA 5JCXA 1U8XX 2H1IA 3PWTA 5C8YB 2QJWA 1MT3A 4M9CA 2HRDA 2P65A 3E3NA 3CRQA 2OO5A 2PKWA 4YAJA 2Q5EA 3L7OA 5B4VA 4DKXA 3ADOA 4Z9YA 1RRMA 1LVGA 3K71B 1LB1B 1M1YE 1XFDA 1Z35A 2X0IA 4EEXA 2V0CA 2O7SA 4R54A 1L4LA 4ECAA 2BBSA 5I5GA 3RYCB 1UBGA 1BCRA 1SKAA 4TRNA 1H2FA 3OCZA 4BVEA 2I4NA 4L5IA 4S1WA 4F6RA 4AKGA 4YA6A 5E9JA 3K9FC 2UU9B 4YIHA 1MC1A 2P2NA 2Q3EA 2ADMA 3AU9A 3OA0A 3R5SA 4Y2GA 5HA5A 1YQTA 4JLAA 4IM7A 4PFQA 3SC4A 1X15A 5EXTA 3ODPA 4DLYA 3FMPB 4AKIA 3DCYA 5JDCC 2AQ8A 5JT1A 3RSLA 3NTQA 1R1DA 2BONA 2JFYA 1BVYF 2WLSA 3WA6A 1CR6A 1RP7A 2K7ZA 2PZJA 1Y81A 3HC7A 4WNAA 5I7OA 3IVCA 3L4JA 3TNJA 4HUJA 4PZYA 5I3ZA 3AY0A 4HYTA 1CY4A 2YFQA 3CNNA 4HWSA 1ORRA 4L57A 1D1TA 4B17A 3NASA 4F71A 4UFPA 2BHNA 3BJMA 2ZAMA 1DWQA 4M89A 5EP1A 5LU9A 1TT7A 4D25A 1JE0A 3ANXA 3THYA 3R0QA 1L9KA 2X23A 2HB6A 1ND5A 2GYUA 3D3KA 3FPBA 5ESDA 8LDHA 3EXHC 4YCCA 4U2BA 3HU1A 4DPMA 2BF7A 2WJAA 1KAOA 1N5LA 3F1LA 1JXOA 3RV4A 5GIOE 5E38A 1IHOA 1ZJWA 3VV3A 3K1ZA 2INGX 5KTSA 4U7PB 1AKTA 4OY3A 3ZHTA 3MTDA 1H5QA 1C2YA 5I9MA 1XYVA 1ZCBA 2WM8A 5DHUA 5CFPA 2BEWB 2W70A 1M1ZA 2PUHA 1I0IA 1SC1A 1SRRA 2ZR9A 4HDSA 4OYRA 1XGKA 3BIOA 4M1SA 3PTZA 4KAFA 1DC3A 1LSJA 2IGBA 2JHPA 3F90A 1KU0A 3MYRA 3NAMA 4I08A 5HIMA 1A72A 1KI6A 4F06A 4Q7QA 1U6IA 1P7PA 3EA4A 4Q24A 5M2QA 3U3KA 1IJBA 3BIXA 3T34A 3K6SA 4GVLA 1HEIA 4JJZA 3USZA 3LUHA 3DPUA 1UJ2A 1ZGJA 4MGZR 1VG8A 2GAFA 1F5SA 3SYNA 4JI3B 4AKEA 3KWLA 4GKKB 5CT8A 3IDAA 5AI8A 3KWFA 2BGLA 1GZDA 2B4QA 5K09A 1P1KA 2R68A 1Y9EA 1N1GA 1MGPA 4Z49A 3FR8A 3GQBB 3FNHA 1JLMA 2XMGA 3HCNA 2UVPA 2ETXA 3I9FA 3JYPA 3MSXA 5CTJA 4J3NA 3WE7A 2XDWA 1KH1A 1SC3A 4R3WA 1GN9A 1SVNA 3JAKA 3MZ0A 4C0KA 3KLMX 2ZI3A 3LQRA 5FOUA 5FWAA 3TMYA 4HR7A 5BWOA 3NRCA 1QWOA 2OHFA 5DLQC 1GPAA 5EP3A 4HQRA 4HWGA 3V32A 3U6BA 3ON5A 3EWAA 2IDKA 2PH5A 1QHYA 2NT4A 1EVLA 1RI4A 1NR7A 3HY4A 3HZZA 3CSSA 2X8JB 3H9JA 4MAMA 4NVRA 5HIIA 5ALZA 5IJXA 2N47A 3GNLA 5E0OA 1C7IA 1ZESA 3DE5X 3E81A 2V58A 2ZSIA 2V65A 4R81A 4E4TA 1G7RA 1SZPA 1NUPA 1XVTA 2GHRA 3SMVA 1JQ5A 2EP7A 4KJXA 1XMXA 4DCNA 3FPSA 3OKAA 1A8UA 2E5LB 2P3LA 2HHHB 4NYJR 1VHQA 4WCFB 1N4AA 3LWNA 4NXNB 1QHIA 2W11A 1ADYA 1KVQA 1NMXA 3NEJA 4EFMA 3QKWA 4MWDA 1UDWA 2MR5A 1U2GA 3Q1LA 3X1XA 4QTYA 1P45A 4KCGA 4BNLA 5M04A 4MV1A 4JT9A 1N8KA 2PKQP 1UFQA 4Q3NA 4BO7A 1MO4A 1OPRA 2C4WA 2YHIB 2BGKA 3TNFA 4X61A 1XLVA 3EXHA 1HLPA 1MJNA 1PLJA 3FDIA 3VR4A 2ONJA 3FHCB 3KPJA 2EARA 3RAPR 2QVLA 2FKNA 2H07A 5G0VA 4EEKA 2PUWA 1XNHA 1ACLA 1SKYB 4HF7A 2XUFA 3S2SA 4G5FA 3J7AC 1GKUB 3AZOA 1O2DA 4K6HA 2ZR0A 1W88A 1E6MA 3WB1A 4M6WA 1IEWA 3K0AB 1XZ8A 1F12A 3PC3A 3PX7A 2Z8XA 1GZ5A 2CLMB 2Q07A 1YCFA 3WDLA 4GOKA 4DAOA 4X1OA 5KCZA 3QFTA 1GGEA 2PTGA 1W75A 1ID1A 3GGCA 1HE2A 3CF6R 3QOFA 4LOKA 4E46A 2XQIA 5K3SA 3AR9A 4L4SA 5FV4A 3COVA 2OLKA 2HJSA 1Z4PX 1DBIA 3H5RA 3PJGA 2G6TA 4TTSA 4EKYA 2CFSA 1H0RA 1KI2A 1W96A 1N5JA 5CT4A 3O5AA 4PCLA 1TYBE 1UT5A 3PJFA 2J3MA 1JEQA 4XSGA 2LGJA 2ECPA 3QH4A 2OV8A 3AHJA 3NH9A 4CR6A 4ZYXA 1JHMA 1WHSB 2AE1A 3WK8A 1XZFA 5REQB 5E3JA 1LX6A 1DQYA 1RZUA 3V1LA 4FM9A 1WXDA 4RTMA 2V1XA 1RBQA 3T3EA 3CF4G 3JRXA 1TZKA 5AW2A 1V8DA 3MAAC 3GLFB 2I76A 1XWWA 3EOAI 1MRSA 3AW8A 3GBSA 2XZDA 4KH0A 5K4GA 2WA2A 4QLAA 3ZIUA 2XUPA 3QXGA 3WIOA 4HN2A 3G0DA 4F3TA 3HYCA 4FYXA 2FV8A 2KPOA 4ZPXA 2YCLA 1SD2A 3ASYA 1QHSA 3TVDA 4HI0E 1B8NA 1FU7A 3F9IA 4O2AF 3QPVA 4JJFA 4MI3A 5DWDA 2Q28A 2X22A 2JCBA 4BBPA 5A6VA 3STWA 1GHTA 4JV5B 1EXWA 3OUTA 5C8ZA 2PU7A 1RHQA 1PJ2A 3R2JA 1TOAA 3EUWA 2IU4A 2JVJA 5LMUB 4FMDB 2ZIXA 4K8RB 2CF6A 2W2TA 5KOHA 1DVRA 1TJ5A 6LDHA 3T3MB 1N3LA 4IBOA 1R7RA 4C4OA 1E3SA 5KBYA 4CKEB 2ZDQA 4TYWA 3KBBA 4G26A 4NZYA 1YJ5A 4I8IA 3FCSB 1YK1A 2A5JA 1CYEA 2WYIA 1J20A 2ZBPA 4X85A 2C29D 1AO3A 4MB6A 5EUMA 4L02A 3RVJA 1NLUA 2ISSD 5JCPA 3AF2A 5E1OA 4B87A 2QVGA 3DE4X 3T7DA 3DTYA 1LVHA 2AG5A 3EIWA 4GYKA 4HEQA 2PRIA 3T0GA 4DL9A 3D7KA 1ZWKA 1GUBA 2OZEA 2WAOA 3OU2A 4ZVVA 1BKYA 3JARA 4A6XA 1WMEA 1VYHA 1Z73A 4ZT6A 4HLCA 1NBMA 2ZWPA 3M0EA 2WFLA 4W7HA 2PS0A 2PSJA 5CGQB 1DC5A 4BOYA 2RGXA 2Q2WA 4KN6A 1EUCB 4RPJA 4ZV9A 4F6CA 1W8IA 3GVPA 2EFCB 2PANA 1WEHA 3K53A 5H4GA 2OM6A 2HBQA 2XE7A 3FTEA 3DMNA 2AKAB 2XWJI 2X6QA 4ZO4A 5GWXA 2JLSA 2JZOA 4YJ2A 5EJ6A 3DZDA 1ZUHA 2GYYA 2YYZA 1WD7A 3LYLA 4G85A 4DGQA 1K7SN 5KYXB 3LIIA 4M0CA 4RKRA 4O2LA 3FTFA 2F00A 2I1QA 4RM3A 2ZUUA 3NEYA 5H70A 4BZZA 4BE7B 4DY6A 3NC0C 5ALDA 3W2IA 4BEWA 5L4SA 1E2PA 5C53B 1ODKA 4E11A 1WXEA 4HNAB 3EXHB 1TKCA 4H0CA 3U4IA 4Q93A 1JWAB 4W4TA 4RIHA 4CG2A 5DMXA 3CVJA 5AK6A 1W0CA 4L4RA 3KXLA 5HQ3B 3PYXA 3VMMA 1CSEE 1VSQA 4R98A 2IUSA 4PPFA 5EIHA 4TSFD 4QG7A 3RYHA 3IDQA 3W5VA 3QKUA 4JYAB 2XMBA 3MLAA 4L4YA 3KR9A 1IWPB 3GUZA 5EY5B 1DO2A 2P68A 5C1IA 5BSVA 3C15C 1S2GA 1EP1B 2KX7A 3N07A 1JWLA 1E69A 4MR9A 3GFRA 4X94A 3AJRA 3AL0C 2BPOA 4AZ0A 2R5WA 1YHZA 2RG7A 3HHEA 1ZCZA 3C6ZA 3O0TA 2H5IA 1JB9A 2D0IA 3DBIA 4K88A 4C21A 3V8PA 5BOVA 1P7ZA 2NQTA 3H84A 3I0ZA 1USUA 2VQSA 3CLTC 3LHSA 1P17A 3LPAA 3HCAA 2H4HA 3IT2A 1K06A 4I9NA 2RJNA 5I6DA 4KVGA 4B5KA 3LLSA 2IOFA 2WJWA 4NEQA 5JAIA 3AFIA 2PUBA 1N5KA 1TL7C 3GVCA 4NEGA 3KZKA 4MICA 3HLKA 2DR3A 1Y7HA 3ACCA 2OHOA 3GJ8A 3IQDB 4O4IA 2X1MA 4AX4A 5JUWA 5LCXA 1VLQA 2NUAB 1H0KA 3A1NA 3E9RA 2X5OA 4C3OB 2JJ1A 1ZHOA 3A28A 3HKBB 1IRIA 1N6PA 1RRVA 2ZS9A 2CE2X 4YMHA 3EX7C 2C2XA 1OGJA 1YV9A 2GYWA 1XRRA 1U2RA 4JJIA 1QC5B 3S5UA 4QKQA 1C8VB 4QYSA 3LKZA 3TWOA 4CQMD 1EFDN 1L5ZA 2JFGA 1GAEO 2NXEA 3FPFA 4YBZA 2PRJA 2LDXA 2QX7A 4Q4JA 5LDGA 3OQBA 2XQVA 1FBTA 1QYWA 1IBSA 3U31A 4D9IA 1TGVA 2NQ8A 1GNVA 4O2BA 4GOJA 2HV9A 4JU9A 2PUTA 2W6ZA 1W87A 1RD4A 3IA2A 5TR9A 3VGPA 3VYVA 3D1LA 1JFLA 4HAUA 3I2HA 5DSXA 1EFAA 5ALKA 4GL2A 1GNLA 1M34A 1AQ6A 2PBFA 3D8UA 4F6LA 1L4FA 1PE0A 4OYYA 1FNSA 3VR3A 2HPVA 4IFBA 1UIMA 3ETLA 3DA8A 3FYUA 5B5SA 1RSZA 2AZMA 3DV2A 2QKYA 3HR4A 5DCUA 4BVJA 5BV2P 3TFOA 1QQ5A 1NIJA 1NFRA 3PR3A 4R7GA 3NQ41 3A0UA 4QUEA 1W9HA 2QP9X 4FDMA 4E33A 1Q6ZA 2GZMA 1NTRA 3F7MA 2YV2A 3QNWA 3PGLA 2GJ4A 1EH5A 5TT0A 4QXRA 4DNXA 5IUNC 5HXAA 1I3OA 4GI2A 3WK7A 5K8VA 3O9MA 1MBZA 1I5OA 3SR4A 4KUGA 3UXHA 5JRZA 1QYDA 2FKAA 3TR5A 4MWZA 3L93A 3KJIA 2WWTA 1W7AA 2I6SA 3JAMA 3ZCUA 1I6LA 2VPXA 1ATIA 5EZQA 4ANFA 1PL0A 1KJ9A 3KAJA 4LGCA 1CUFA 4DJAA 1KGDA 2XOXA 1HORA 3GRKA 5CDYA 2AFIB 4IGKA 1WUKS 1F6WA 1A4UA 1ODIA 1SVIA 2IIPA 2XQKA 3EH2A 3L4SO 4BB0A 5B2EA 2I03A 4TSFA 3SZUA 3T4UA 4QT4A 1DWUA 1P31A 1JDVA 4ZGWA 4FBGA 4HS4A 4RF2A 2J08A 1VYVA 4GX5A 3V4RA 1HDZA 4UVEA 1X1BA 1I30A 1X42A 5J58A 2JGRA 2Q2NA 3OAAA 4FZ3A 4QSHA 1KMQA 1A96A 4HAOA 3MSCA 5BWNA 3EWSA 5JR3A 2GBLA 3QPUA 1YZQA 1V11B 4IJVA 3AVPA 5E4FA 2BEVA 1L5HA 3FPKA 1W5FA 1JZTA 3B7WA 3R6LA 2GAOA 4EFLA 5BN5A 3ZHXA 1AQIA 1F8UA 3OCJA 3QW2A 4OLAA 2QNRA 4M1TA 4Z0NA 4IIJB 2EZ4A 2PN1A 3D6VA 3W78A 1AIPA 4EPTA 2J0UB 5KWIA 2RH9B 2YUTA 2D8AA 3WHKA 3IXLA 1N36B 2DAPA 1GKLA 4BUJA 3T3OA 2XCUA 2VP3A 3C98A 3M6XA 3DE1X 1PWXA 2EBWA 5JDIA 1K8YB 4EUHA 4IJQA 4C20A 1CQIB 5DHQA 4ZYZA 2DBVO 3EPRA 4XVCA 1JR2A 4IG4A 3KKEA 4PGMA 3WSTA 4MK4A 1F2VA 3EIXA 1P6UA 3WGKA 2V3CC 1XTSA 1E0JA 2E37A 1E2KA 2NPOA 3R23A 2JFBA 2PL3A 4K6OA 2O0JA 4TUYF 4TXLA 3W05A 1X8KA 1Y3HA 1NF8A 2Y1OA 2NO1A 3MT0A 5TPWB 4BNVA 5K3BA 3WDMA 4AQDA 5F1YA 1EVKA 1Z3IX 4YPOA 1P1HA 2X58A 5JS1A 5JS2A 1KTVA 3KB2A 5CIYA 1C50A 1MU0A 2FZ4A 1RJGA 1VE7A 3BULA 3PD7A 2NV2B 4AB1A 1XDGA 3G2LA 2BC9A 2UYQA 4WJKB 4PHGA 5LNK6 1KSJA 1X1TA 2H1LA 1EFLA 4W8GA 4I0WB 1UXOA 3GAAA 4RSGA 3NM4A 1T43A 3DLCA 2WLTA 1GGVA 4YRPA 1EQUA 1IK4A 5FR2A 1RR6A 1XVAA 3N2IA 3K9CA 1ZEMA 3OJCA 1YZ3A 3AHFA 2P90A 1AQLA 4BY9E 2GDZA 3CZRA 2C98A 2M32A 3VUFA 1QQ7A 2XMRA 3OU6A 4CFYA 3S28A 1YA6A 5L45A 3U2QA 1Z0AA 2MOKA 3UY4A 4M86A 4P31A 1S1MA 1IHPA 4IXNA 2J59A 4PG4A 4E7PA 4CLEA 2DSTA 2FU5C 2QY9A 3A9CA 3HUFA 4M0DA 4OH7A 4RY8A 3WGHA 1PWYE 4I36A 2VQ3A 3E9ZA 4N4AA 3KB1A 2OR3A 1SULA 1XC7A 2GPJA 1Q74A 2HF9A 3MXOA 3HWX1 4JGIA 4OXQA 4WGGA 5ESWA 4ZEXA 5CH5A 3V48A 4DLKA 4F5ZA 3PC2A 1QO0A 3V55A 1T9GS 4L3OA 5AKKA 1O6FA 1VPTA 3R9KA 4B4UA 1DXOA 3SDBA 3K7EA 4H2DA 1ZW1A 2ONCA 3JZIA 4EWLA 4JLUA 2HO5A 1PKEA 1ZIYA 3UKJA 5HJ5A 1DJMA 3N0TA 4MI6A 3P19A 4AXXA 1VG0B 1HTBA 7REQB 1JTEA 1YA8A 2IPMA 1HYHA 3MW8A 1X2EA 5H81A 1R4AA 3FPLA 3A05A 4IDGA 4WCFC 3NBQA 3WWDA 4MARA 3PJEA 3H6HA 2X9GA 3AI7A 1BE8A 1E2EA 1QNLA 1W2GA 2HK8A 2VAWA 3DLTA 3L7AA 4GPIB 4P3XA 2VDRB 5LUBA 1J49A 3WRVA 3R9XA 3M4JA 3TYXA 1PJ4A 1DDIA 5F5NA 5ALXA 1TEVA 1QHNA 3K5IA 2RBKA 4GLOA 4Q18A 2RK3A 4TLCA 1MXFA 1H1DA 2ZJ4A 3GT3A 3U44B 4M9UA 4GWKA 2I8CA 1E2QA 3TEMA 1JAXA 1G21B 1FFHA 4BQQA 4YV7A 1UXIA 1EFTA 3G7NA 1UBLS 2V8OA 3BGWA 1YI0A 2PMKA 3FBWA 4K9QA 1SVMA 1XDBA 2OT3B 3DFUA 4ZAYA 1VFNA 4FPXA 1BFUA 1PG5A 1Q2UA 3KVYA 1BZYA 4X8HA 3FYUC 4OF4A 3UOGA 1KYZA 2QQEA 3FYHA 5JPCA 2DQSA 1IDOA 1I2AA 1MAVA 1NVKA 4P98A 2ISQA 3CVYA 2VWHA 1NVGA 1BMFA 2GI4A 1E0SA 4I55F 3HXOA 1LCIA 3GARA 4K9RA 1RWMA 3DZJA 4E0BA 3VU3A 3JQCA 3LAWA 5DI9A 4IIGA 3OZXA 1RLUA 3IV6A 4H59A 4N40A 5HJ2A 1THZA 2BH9A 3UPDA 4DBLC 4MEAA 4TTRA 3ABSB 3ZH2A 2B8NA 5TPWA 4D26A 3L6DA 5T6MA 2Z1DA 2ZJ3A 3WBKA 1W6RA 2H1SA 1FU8A 2QDXA 1EFVA 1P3Y1 3L0SA 5EIWA 5C1OA 1KEWA 1SIOA 1ZH2A 2BEVB 4KPYA 2XYHA 3AJAA 3KT8A 4G63A 4Z6KA 5GTDA 4U9UA 2JHAA 3OOSA 5TC4A 2G1KA 2IT1A 5CITA 4CMGA 3OLCX 2NAPA 1OWLA 4Z3OA 1OWOA 2HT6A 3T1NA 2MYUA 3D3WB 4LDJA 2QENA 4QDUA 1C4KA 2HHCA 1T2CA 3LPNA 3WQBA 4QHTA 4TMYA 4EX7A 5C2JB 1MH1A 1X3SA 2PU5A 5EP4A 5LLSA 4A8JC 4XUEA 4FFDA 4D6XA 1R6BX 1VMKA 1QS0A 4OBEA 5T3YA 3TJZA 9ABPA 2Q9CA 1MEOA 3DEAA 3UA4A 2OFFA 1X74A 2F64A 2GCOA 1ADBA 4XRRA 4L4ZA 1TKAA 2YXDA 3ADPA 3G9QA 3HO6A 5LZ5A 2E4VA 1UBTS 4QTZA 3FB1A 1JDTA 1GILA 1NQUA 4KEAA 4RA6B 3PFBA 4B6JA 2GF0A 4O2RA 3BTUA 2PH7A 4L95C 4EJ0A 5AW3A 1U0EA 1ZN7A 4I9HA 2GEFA 2CD9A 2ODQA 3N8DA 4QECA 5AW4A 1NG9A 1Z16A 3ROKA 4LZPA 1NE2A 1DEHA 1P74A 3QEAZ 1EIZA 1S7CA 2XAAA 1YQDA 1V96A 4B76A 2G08A 2WUEA 2DFPA 5G1OA 2Y1WA 3B48A 1Y82A 3HYTA 3LBAA 4JUCA 1A71A 4W6QA 3RVDA 4D8YA 4QVIA 2J31A 2ZUDA 3LRXA 3OTIA 4ODIA 3JSAA 2VHWA 1EE1A 4UAVA 2PT9A 3LUAA 3ONDA 1Y6RA 5ARDA 3Q40A 3BTVA 3ML1A 4RPGA 2FF7A 4EO9A 3HGQA 1AKEA 3O8BA 1JQKA 3MOGA 3EGIA 1U0JA 4K40A 1ZPDA 1FF9A 3PQEA 1PUXA 4PIMA 4X1IA 3W9SA 4D43A 3E3OA 3ZY3A 5A4DA 1NNSA 3IH5A 4JP8A 3T1QA 3QLTA 4OLJA 2X1LA 3SC2B 1PBNA 5JXHA 2NPIA 1ZKMA 4AJPA 4ZZ0A 3PQ2A 1UMCB 3BQMB 2VBIA 4JGBA 2GK4A 4ZAGA 4A0SA 3ETNA 3EA5A 4V1CA 1JJBA 2F9MA 5ITSA 3UMCA 1OW3B 5DI3A 3F8TA 5KKCA 2ZRLA 2DLNA 4AUEA 3AFOA 3HCBA 4WKOA 5BUQA 1TMKA 1CR1A 1C3OB 1XTBA 2I2CA 3RS8A 4F72A 1PFUA 3RVNA 4RANA 5IKPA 1LLDA 3L0OA 1XZDA 5F4ZA 4PSAA 4A2CA 4ZOBA 3K0BA 3SJ7A 5KWVA 1UJ6A 1QAQA 2OGTA 5FI5A 4C5AA 2YV1A 3ADCA 4FYYA 3JU3A 4R9UC 3D8SA 1QKIA 2VOEA 3KZVA 4ZVOA 2W58A 4ES6A 3NAZA 2BISA 1CPYA 3I0MA 1WA5A 5ULLA 3RIEA 9ATCA 2VEDA 4E2ZA 1CU1A 5JMWA 2WP0A 2FWRA 2EKBA 4E5SA 2RSLA 5PNTA 4YCNA 2YN2A 3DTVD 2P3SA 4KQWA 2I9KA 4B09A 1NE7A 2TMGA 3SSNA 4X91A 2OFWA 4IJ5A 1T1RA 1DO0A 2YY7A 4PINA 2W8BB 2OV1A 3P27A 3OLYA 2FMIA 3RS9A 4RY2A 2IQ5A 5HDBB 3SHTA 3D5TA 3UAOA 2DKOA 3MJHA 1CEXA 3OHSX 2AKYA 1CYDA 2C5FA 1PSDA 5GONF 2FF5A 3DBHB 3NS7A 2X8WA 3T7RA 1XD2B 3L0DA 4XASA 3R3YA 4NR0A 4QAJA 4ZU3A 4ZJYA 1CRPA 1G5RA 3UVEA 1V7QA 2H3EA 3UGKA 1JVNA 1ANKA 1RWBA 4V0KA 3NDRA 3T4XA 1QHFA 3GFTA 4NZOA 1R0WA 1SBHA 1SO8A 2VYVD 3WGNA 3TPFA 3GLHA 3W5CA 3KDPA 2HREA 1KWGA 4I4TF 2DHCA 1TZCA 2H52A 2POQX 2G67A 3EODA 2IEZA 3MTIA 3TW8B 3V9PA 4XOIA 5EZSA 4C76A 2N9UA 4MW9A 3WSVA 4TT3D 2R8ZA 2PGDA 3WGUA 2OBMA 3GCXA 1BSVA 5KPDA 5FF9A 4ZCLA 3U3XA 4Z1MA 4OHZA 1UBCA 3OZEA 4UHKA 2Q3DA 2JFFA 2V3WA 5BQFA 1COWA 1TM4E 2X40A 1RZVA 4WXPA 2AN3A 2AOUA 2IHVA 4RXUA 3NM6B 2D4AA 2VQFB 3AINA 3QPAA 1FDRA 5FA5A 1MX9A 1UKYA 2HHLA 4J4TA 5EPUA 5CBPB 1GOTA 2GFIA 3DWGA 4D3XA 4OGWA 5A2GA 3WK5A 2QUBA 3ZHZA 4A1OA 1VLMA 5IHPA 1EWVA 4NWIA 1UWVA 1JLRA 2B8EA 2R6AA 3BPSA 3EY9A 1URPA 4KUHA 1TM3E 4R1MA 1U2EA 5ILGA 3L40A 3M2PA 1DAOA 1FSFA 2ONZA 1B0ZA 3C3EA 1I4LD 2QQGA 2RC6A 2K4MA 4F9EA 4CKEA 3GD7A 4D9EA 2RKBA 3RJ5A 4DE5A 1P81A 1T1JA 5BVGA 1QZXA 1NKVA 2WVHA 1AQYA 1P0IA 2RMKA 2X76A 4PX2A 5H16A 3SDSA 3GP8A 1MB3A 4WOKA 3WBBA 3H97A 3ZWVA 4ACAA 1DB3A 1BYIA 2PGXA 3ZE0B 2W37A 3BMNB 2Q6TA 1DQRA 2QK4A 4YP7A 3RUCA 3WAJA 6GPBA 3LSTA 5EUBA 2IYOA 5AXBA 1UWKA 4M8LA 1ECBA 1C30A 4O3FA 3F74A 1XTIA 2JFVA 3OA2A 4FUQA 4FXOA 4R3UC 5CLLA 5IM5A 5FAXA 3RR2A 3TRIA 5HJ7A 1NMYA 5TS2A 1P1IA 1JQEA 3F97A 4G0OA 2YVQA 1JG1A 3BOSA 3N7UA 4KQHA 4MR7A 4OHOA 1GWNA 5DN9A 1R0CA 5LP6C 1T3LA 3CWCA 1QPGA 3NBYC 1SELA 1NI5A 1Z36A 4RL4A 5LXTA 1RYMA 1CY0A 4QU0A 1MCZA 2RH8A 3SE7A 3DKVA 3RYFA 4DQDA 5J43A 1I2ZA 3FYUB 1PJLA 4Q21A 1H3EA 5LXTB 2FSVC 1JH8A 4PNEA 3DOEA 1FVHA 4Q34A 1WWKA 3TZLA 2QM7A 1JKJA 2AW5A 2O0HA 2G5TA 1Z0KA 1UIRA 3K30A 3NV9A 2IPLA 1K3TA 2H59A 2VH2A 5JJIA 2XV1A 5I7WA 3D5EA 1FFEA 3CLRD 2PUEA 4BVFA 2IF2A 2VJMB 5KWEA 5LZ7A 4Q02A 3RS0A 2QD3A 1SQ5A 4OB7A 5ALWA 1YCGA 2L82A 2VF7A 3MCAA 3CRW1 4HLUC 4ZHQA 3D8RA 2X4GA 1XK6A 3LL7A 5DASA 3SOPA 2HPHA 4X60A 3DLBA 2GN9A 4IS3A 3SAJA 4C5BA 3LS2A 4CYMA 4QPDA 1RPZA 4B6QA 5C7IO 2WMYA 4L5AA 4Y0AA 4H7KA 3WKEA 1AQJA 5JHGB 2BDUA 4NBVA 3AEQA 3R0VA 5BWCA 1YR8A 1IWBB 2JARA 4LDPA 4TOIA 2Q0XA 4TXHA 2NUAA 4WZBE 1SHJA 1OB2A 2WD7B 1YQQA 2VWQA 4HH3C 2WKSA 1EUQA 1G38A 3IA7A 2ID4A 3L7JA 2NZ2A 3D43A 2YJNA 4Q19A 2DECA 3QEBZ 2YYSA 4IGAA 3T5PA 3OIVA 4UATA 3OQJA 4P4SA 4OHMA 3FSEA 3VKFA 3PDIA 5AVSA 2IP4A 1Y4DE 4MKIA 2BBOA 1S01A 2GB4A 1IBRA 3EMVA 4NK4A 3RNLA 1GGMA 1TUIA 2ZT8A 3UYKA 3V5NA 1C0IA 4RM2A 2QNBA 1RXWA 3ZN2A 2JKVA 4FS8A 1F60A 4LDAA 1N7HA 1ONSA 2W6JA 1JF8A 2W7TA 4JYCA 2P9HA 1YDGA 1W5EA 4KPUA 1WR8A 2E4XA 1XRPA 3OCYA 2XZTA 3O2NA 2XE8A 3PA8A 4FMCF 4MUXA 3UW1A 3IOEA 4IINA 1TI7A 2Z5GA 3C39A 2R6DA 4DNFA 4ISBA 1TLFA 3F8SA 3PX3A 4KIWA 4D0GA 1K8RA 4ND5A 3TX2A 2CDAA 5FHQA 5ARCA 1V45E 3AZPA 3W5DA 1UM9B 1PL7A 2FX2A 3O3CA 4JZKA 2Y76A 3Q8LA 4BC0A 4LYAA 1TZJA 1G59A 4UVHA 2B69A 1T6XA 4GQAA 3GGOA 1T8SA 4ZHQF 4MPPA 1LNZA 3OCXA 3DXYA 2PUVA 1NY6A 5CGZA 3DC2A 1NJGA 1VIMA 4FHDA 4G0MA 4K9SA 2XCOA 4HATA 1LF5A 4RPLA 1CUWA 4KI0A 4PFJA 2DC1A 1R9NA 2IXDA 1XJQA 4NS1A 3WLTA 1SAYA 4F2DA 4J07A 3JX9A 2D0PB 3L7LA 1UH5A 3BXGA 3O95A 1NULA 4JLKA 4O2AA 3FKQA 1TQ6A 1KBZA 1O9GA 1C1DA 3LI2A 1BKDR 4Y18A 4S04A 1RRKA 2IVZA 3OZRA 2WFMA 2FVYA 1OBCA 4YTEA 2G40A 2AGVA 2Z83A 1EGQA 1ECLA 4L78A 3NYQA 4HWRA 2WFLB 4CUZA 4RX1A 4XQEA 1ZXLA 4X7RA 3ZYCA 3KTDA 3A6HA 4X95A 4GOOD 2FEWB 3ZZ1A 3ORRA 3PDIB 2JGKA 1DCKA 2GPSA 4JR1A 1N3YA 4NMWA 1V0JA 4QYXA 2IXAA 3GB9A 4I1SA 3W8EA 1HNZB 3BREA 2C7OA 2JPDA 3L0ZA 3QFCA 1GAXA 4WVLA 2F8MA 3IP8A 3WLHA 3GT4A 5IEBA 4D0RA 4UNRA 3O8CA 1J9ZA 1HNXB 2FQ1A 2QX8A 3D0KA 3F7NA 3GT7A 4EY8A 4YRQA 1OR8A 2O1WA 1DKUA 2H2AA 4LC0A 2VAXA 4NENB 3QJGA 4QYWA 3HP7A 4HDQB 3TCNA 2WWGA 3IQZA 3DXXA 3JD0A 3LDHA 1M2VA 4MRNA 1RJDA 4X97A 5AW7A 2QTBA 1ZINA 1PD1A 4C7VA 1TF7A 1E60A 1RM4A 1X19A 2PMCA 2ZVDA 4MJXA 5JS7A 4UHEA 2FEAA 1VTKA 3TW6A 2Q4EA 3ZY6A 2A0WA 1AURA 4MNTA 4XR4A 4FT4A 1UAGA 3CE6A 5JCJA 3R44A 1SUWA 3CMCO 3ROQA 1RWPA 1OFHA 2EP8A 2MSEB 2Q99A 4B2IA 5CCXA 2IHKA 1T26A 4CM6A 2KM1A 3RFCA 2QUJA 5DULA 3D4PA 1GQ2A 3G49A 4PX5A 2XXAB 2ERYA 3MHPA 3A8TA 2H1WA 5FPQA 2C7BA 4A6DA 3IUMA 2QSZA 3TQRA 1MW8X 1HH4A 3ZJ4A 4Z8YA 5G3YA 1MQSA 3UB2A 1JI0A 4DDMA 3UC5A 2ORWA 2GCPA 4HADA 2IOQA 4HFRA 4L5CA 4LK3A 3LU1A 1M1NB 2W6JD 1NVAA 5GGYA 3SK0A 3FTQA 3NMUF 3BSFA 3JWJA 2V7BA 3I58A 2DHQA 3BYZA 4L50A 2NVUB 3A4YA 1RAFA 4NMMA 3V9AA 1BA2A 1D03A 5L3QB 1SXJC 4EPRA 1MIOA 1T3SA 4G5XA 1CHDA 2QWXA 3I42A 3GLGE 2ZJ7A 2DQ4A 2DKFA 2NWQA 4RCZA 2E87A 4IYRA 1MB9A 2VJCA 4FEAA 4U5XA 1OXSC 1MF7A 5TF4A 1VBKA 3KYDA 1IHDA 3S2GA 4PM4A 3TFWA 1KVUA 1L7OA 3IAS1 2VPTA 2ZSDA 4DQVA 4E2FA 3THWA 5A5VA 1WCYA 1O5TA 1DDOA 2WDZA 1TC1A 1YRBA 2VHYA 5CLGA 2G5GX 4CKYA 4CDRA 3AESB 1IVNA 3DWFA 3EGEA 1QFSA 2YJGA 1U7DA 1XCPA 5CX1B 2DYKA 4YY3B 1OA1A 1BXZA 2OD2A 3AH8A 3ZZTA 3DL4A 2IYAA 5GV7A 3S68A 4EHFA 1HDYA 1VJGA 1H4QA 2XMSA 3EWIA 3MCWA 4F6RB 5C37A 4I14A 2MR6A 4KXXA 4PSKA 5NLLA 4EMSA 2B8WA 1FIUA 5B7GA 4M9RA 1W34A 3C3YA 1GJRA 1C7QA 1C9EA 2V5UA 3MAJA 1A82A 3RTEA 2GH1A 1ILWA 1XCLA 5DYGA 4E51A 2YYYA 2R7NA 5J5CA 1Z5VA 3COJA 3PKJA 1FZTA 1H8HD 2EWWA 3P9ZA 1Q84A 1R0BA 2A1TR 3FOCA 3VV2A 5DX1A 5A7GA 4BO6A 4D0NA 3C6MA 1PJTA 1QB7A 2A1TS 1RTTA 1H0HA 4RH3A 4A9AA 6REQA 3Q3GE 4NI5A 4WNCA 1Z3CA 3ETDA 2HWKA 4KUEA 2ASVA 1JFRA 3GFPA 1AC5A 1AV7A 2KBEA 3CKYA 1S2DA 3EZ6A 1ZBQA 1BE0A 4RHTA 4CVNA 3T3DA 4F8JA 1OFGA 1P1JA 4U3JA 4US0R 1LLUA 4XCVA 1WXQA 3R7FA 1SUBA 4G65A 1LLFA 5I45A 4LF7B 1YO6A 1AE1A 4RVGA 3W6OA 3L2OB 3UH0A 3RS7A 3R5KA 2CFTA 1R50A 2FZWA 3H18A 1R27A 4Y2RA 5FCDA 1LNSA 2HJVA 2FHSA 4X62B 4DMHA 2BM9A 1KPGA 1C14A 3IUYA 4UTNA 1XALA 3UWPA 1BWQA 1VDZA 2FPIB 1JR6A 5B1IA 1KORA 5A5FA 4WEOA 1Y34E 4FS3A 1OT5A 4PZEA 4YIKA 3A4IA 4C06A 4BCDA 4TKUB 4UDOA 3TEJA 3PQ3A 4CLHA 2WKRA 3OJXA 4ZZ2A 1O8BA 1RXSA 4RD1A 3TQTA 3LCRA 1R0KA 1P3JA 5JMPA 4N7JA 4WLFA 5KU1A 1KDVA 2RIRA 4HL6A 1CRZA 2ZI4A 4NX2A 4DDKA 4YT8A 1OZFA 4FWIB 4FSHA 4KQGA 4TWBA 1NVWQ 4ZO8A 1HOXA 2A5FA 4UVGA 1SC4A 4BMZA 3U16A 1JHQA 2AXNA 1N5MA 4DA4A 4C6SA 3NXKA 5KSOA 5A6SB 4BRWA 1XZCA 3ME5A 4W5HA 3NHLA 2JJ2A 4B40A 3NBXX 3TUIC 1ZMBA 5DI3B 4NYMQ 5BMOA 2BV3A 3Q3EA 4HNRA 1MAHA 3MYYA 5IH3A 4ZJUA 1IC6A 2BL4A 3BXPA 3A7DA 3G89A 4O6VA 1FFSA 4MV8A 4JOSA 5AVYA 3DDUA 4DYVA 4DQ0A 3AHGA 4URYR 2X7JA 2GN6A 3VNRA 2IC5A 5IZCA 3MMSA 2HBRA 2C3OA 4GOMD 5DBGA 2GM4A 5FI3A 1E1CB 5GJWC 5LWHA 1I3CA 1UC5B 3CURA 3EQZA 3FY4A 3LW8A 3MJTA 1K27A 1KI6B 3FNRA 4FK8A 4R7TA 1GQOA 2EEPA 4X1IB 1V16B 1GGFA 1VJ0A 1JTVA 2PX2A 3QLUC 4B6OA 2RGNC 4PX9A 2P7HA 2IS4A 2GX6A 3L9XA 4RSMA 4Y6LA 5CHYA 4GEKA 2VJAA 3UATA 3JYLA 4GRIA 2VLIA 1Y1PA 5IKEA 2ODBA 3WLAA 1HDCA 4FTWA 4XGIA 5JOQA 2P27A 3NDPA 1FRZA 3QHAA 1QF9A 1DOZA 1QYRA 2QZ9A 1HE3A 3L8EA 1UC8A 3DR3A 4RPKA 5CVTA 4YP6A 5AM0A 1NR1A 4JI0B 2ATVA 4D44A 3C3AA 3QX8A 2GETA 5I9TA 1GFIA 5C3UA 1ADJA 1PTJA 2HEIA 3BE8A 1W85B 5DHAA 4AKHA 1C8KA 2CZQA 2VP5A 4JP3A 5KPJA 3LDGA 2HRQA 2NW6A 1Y9ZA 2ZTUA 4DVGA 1CCWA 3DEYX 4ALNA 3K70C 2DPHA 1Z5NA 1ISFA 1J0DA 2UYYA 2YCBA 3GAFA 3NHZA 1HO3A 2GPBA 4NIMA 2PXAA 2I6UA 3U37A 3DT6A 5TXGA 3GWZA 1OFIA 4GI3A 1QTRA 5BSHA 1EQ2A 5DB4A 1K7YA 3M6MD 1KYQA 1CD5A 1LZLA 2J3DA 3GX1A 3I92A 3NJ4A 1F4VA 1SPXA 3G68A 5BOSB 1OIXA 2EF0A 3L8HA 1ICIA 1NV9A 1SUDA 3AL3A 3U9SA 1CDOA 3OTOB 3UUGA 1LDBA 2I6FA 1QIGA 3KLPX 4LDZA 5KMGB 3ZCPA 1CE8B 3FNFA 2A0YA 3T4EA 3T9FA 1RJ9B 2CVQA 3A26A 1T8YA 1SU7A 3L1JA 4L0DA 4CTNA 2SCUA 3EISA 3LYHA 1G18A 4GWGA 4L8YA 3HYNA 4XJSA 4YAOA 3VZRA 5CBKA 4HWKA 4RZ3A 4OHBA 4ZN6A 4RHYA 1PGOA 1RHUA 5H80A 4DR1B 5KVSA 3T06B 5A0TA 3P0HA 1W4LA 3F7TA 2JW5A 3LYUA 1FRFS 2ZB8A 3AETA 1BEEA 3F2IA 4FNMA 1A5BB 1NWCA 4LQLA 4MINA 3W6ZA 4K0KB 4KFRA 5MF6A 4AZSA 1YF3A 3EZGA 1G8GA 2BKLA 4G1UC 1UJMA 2GXSA 1HDIA 2BEJA 2IE8A 4GDMA 3WHLA 4C03A 4HXEB 4OM8A 3E2PA 5LP6B 2Q0HA 2WA1A 4MS3B 1VLZA 3NAQA 4F3RA 1NX9A 4IVQA 1G20B 2YMQA 2D2EA 2J5XA 2H29A 4EJSA 2XVZA 4DDWA 4FKBA 1KJNA 2WV7A 3IMKA 1QGZA 2BSXA 1L0BA 1E63A 3CX4A 4LYEA 4KWTA 2YWJA 2BGIA 3JS5A 3V80A 3QK7A 4OHVA 5T4FA 1KYVA 1JDZA 4F1JA 1NLYA 1VDMA 4A8JB 4GX2A 3H86A 4HZIA 2AFIA 4UD6A 2XA1A 5CVVA 4YQEA 1FQOA 1T9DA 1EJBA 2P2DA 4Y0NA 3U5ZB 3LUCA 3VYTB 4INPA 3FDJA 1L7MA 4YRNA 1TXGA 3ZE8A 2DWOA 1HBJA 3IAM6 3F71A 3KIPA 4DCSA 4DA6A 1QANA 1QFMA 1L5KA 1HT0A 4BAGA 1IJFA 1P19A 1Q91A 2Y6VA 1WCIA 2R87A 1E3QA 5CW1A 4CCYA 3SS7X 3B8HA 2O3UA 3HHPA 2O8EA 2WJGA 4HPJB 4RUKA 5EKUA 5FTKA 1KR5A 1GSAA 3MQFA 3O3OB 2PWZA 3K9QO 4QTUB 5JXGA 3THXA 2DERA 2C97A 4AWBA 1P3DA 3JWEA 4PC3A 1LW7A 4K9DA 4LEIA 4OAPA 4HB2A 4UE6A 3S8YA 3MWEB 1R9MA 3NW9A 4DSUA 4OMCA 1F8XA 1F9EA 4H7EA 4I2NA 4YACA 3WK9A 4IQGA 4DV5B 4M8KA 4EMBA 4EKGA 4DGSA 1I0LA 3U44A 3UWDA 2FRXA 4Z9AA 2PH3A 1VP9A 5EWJA 3ZI0A 1KY3A 5F1PA 2GNPA 1ZNYA 3B5JA 1T4MA 3HDQA 2FPXA 4WXHA 5EXEA 2OKGA 3IUSA 2CCKA 1JIIA 3PC4A 1CVRA 1HYBA 3PNLA 3QUCA 4IOMA 1DI0A 1PFGA 4N5NA 2P8SA 2Y0EA 3A36A 3EEQA 4MWCA 2GKGA 3MS7A 5AK4A 5HGJA 1T9AA 3SMQA 1SCUA 5E4JA 2MMGA 1JKMA 5C8XA 2CK3D 4F5YA 5JXWA 3KSMA 2RJOA 5EZYF 3V2IA 4D3SA 3UMYA 3RSQA 1DC7A 3GLRA 2WU8A 2C0PA 4UNNA 1ADCA 4LRQA 3U40A 1XD9A 4B84A 4OIMA 2NYUA 4UW9A 1DDGA 4Z3KA 3MG9A 2G82A 2WJIA 2R1TA 4PFSA 4AMBA 3PBKA 3NWOA 4MJLA 3W9BA 1U8TA 4PVCA 4ZQEA 1I0ZA 1M2KA 2D7DA 2HZ7A 5EHZA 5FOSA 2OWDA 2Z8YA 5AKXA 5ES3A 4MB0A 4KWIA 1ZN8A 4N01A 1GZ7A 2DF8A 2O6LA 3UCXA 1IXRC 3KFVA 1RM5A 1YSCA 2A3RA 2QVCA 2NSLA 5JECA 2YJ6A 4OM7A 3LHDA 4RMHA 1E58A 4XQCA 6ADHA 4HDMB 4BGIA 3DKPA 3K6RA 4ENTA 1I7DA 5KJ1A 3ITDA 4E5UA 1D2MA 3GG9A 1P62B 5TPZD 1GAWA 3ZVKA 4JUFA 4DQKA 4OFZA 2IYSA 3ZWAA 1ZFNA 3I09A 3NVAA 1LPOA 2COKA 4PZCA 4LF8B 1FFYA 2ZWIA 2PX0A 5HP4A 1UPTA 5KQPA 4AIRA 5L6LB 1KRXA 1WY7A 1W581 2NUBA 3CLRC 3HJNA 1Q20A 3PWSA 4ESHA 2GJSA 5FNVA 1QH1B 1M2JA 2TECE 3DCNA 4MMXB 2IPXA 1WKVA 1S0UA 1WMDA 4FI3C 4YQZA 1SG0A 3E6AA 4OQQA 5ES4B 2UUBB 1Y7TA 1H8HA 1CJUC 2HMYB 3IAAA 4V24A 9GPBA 4GRAA 2OP1A 4TS3A 1Y8CA 3M3HA 4FJ0A 5J63A 4CL0A 4YHBA 2GOYA 2BMEA 2WJJA 4GL4A 4KGDA 5E1DA 4C4TA 1R00A 5JALA 4M7RA 3N6VA 1QMGA 1DV1A 1Z28A 4F84A 1UK7A 1A0OA 3LWBA 4FLFA 1NJ8A 1TZMA 1BMTA 4INAA 3LOQA 3RYTC 1SOAA 3WWCA 1Q6YA 4W8OA 1WBBA 1AZWA 5CJ2A 2L17A 2Q50A 2OZPA 4IP0A 3L49A 1QHHB 4GR5A 1FP2A 2QUIA 5ERGB 2O3QA 2AC2A 3RWMB 5TGDA 5I4CA 4N3NA 2G1UA 4BFWA 5FWDA 3TQQA 2IA5A 1MIHA 3FGZA 2E4WA 1AF7A 1NP6A 3WGMA 3CPSA 2I1VB 1CWUA 1C0PA 3BHNA 2ZVJA 3E9QA 5ERXA 5KJCA 3ZEAA 2VTBA 4BIMA 1BX1A 4JDUA 1NQWA 2OAEA 1ZR4A 1IM5A 3A10A 4EL5A 4L73A 1BW9A 1RHRA 3IAM1 4ND4A 4PSUA 4YRKA 3X43A 2PFSA 3IVRA 3VR2D 3V42A 2WNIA 3C7AA 1YBFA 4N8EA 3RU3A 5KTNA 2R1UA 4IIJA 1P7WA 3PLNA 1MGOA 1OILA 3PU6A 3QRWA 4QIHA 1EDZA 2R6HA 5AVUA 5J4VA 1GZ3A 4TMFA 2FAXA 3IJEB 3S99A 3ZQ6A 1ZGZA 1HE1C 3KFXA 3F3MA 4F4IA 1ESDA 2VDJA 3BRSA 4RGVA 4ZIRA 2MJLA 5IJ0B 2PE5A 4XDHA 4HMQA 4NMHA 4RDIA 2X41A 1NRXA 3GLUA 2P91A 4ZQFA 5FYDA 3GA7A 4NDZA 5B37A 1F5NA 1G9SA 4NJOA 3G59A 3CWZA 2AR0A 4ZVUA 4WLUA 2Z9DA 3N74A 4UUOA 2A5DA 4FDLA 3ND6A 4ZALA 3EIOA 1KF0A 1X14A 1GO2A 1EWYA 1Q5PA 2NZVG 3E8XA 3LOUA 3MWDB 5BW8A 5C35A 2WABA 1WB9A 1V8ZA 2UDPA 4KBYA 1D6SA 3M4ZA 3F67A 5HOEA 5K4HA 3KQUA 4UTVA 3NHPA 1OF1A 1PD0A 1Q19A 2HKIA 4ZVMA 1DAHA 1QH0A 3LIPA 1CULC 3Q3IA 4WXMA 5JVDB 3WICA 4C0HA 2XBUA 3DAHA 4WA7A 1SA0A 3BXHA 1QMPA 4TT8A 2BFCA 4UC0A 5ALMA 1JG7A 5AOAA 2DPGA 3RRNA 3TJMA 4DIUA 2HRBA 1KJJA 1R16A 3DB2A 3FPEA 1OH7A 4O2BB 4TV8A 1L7EA 4XDYA 3DJYA 4WINA 1SU6A 1B8PA 4Q4JB 5EI5A 2JLQA 1NASA 1XQ9A 4HZGA 4BNJA 2YJZA 3DYBA 2C1ZA 3K4QA 2CXUA 4L5BA 2GUWA 2I4TA 3JQ7A 4U7TB 4EMTA 3LD9A 4I6EA 2W2PA 3OC6A 1UXJA 1YVPA 1B42A 4Q03A 4IO1A 3LY5A 4MYRA 4DEXA 4FC7A 3F4BA 3NU1A 5GGXA 1IUKA 4CM8B 4XWOA 3GJZA 5KIAA 2GXAA 5AI5A 1XT6A 4QYMA 4AJ2A 5D6OA 3GXOA 121PA 4MW5A 4M9QA 2XBMA 1E2MA 1O1YA 2ZCJA 4ZJZA 3ONVA 3SWWA 1S96A 3ILHA 4I55B 1RE0A 2J6BA 4G5YA 3A6FA 3K4HA 1PL8A 4X7MA 5AM1A 5M29A 3OZVA 2SECE 2H18A 3IVGA 4P2GA 5AP9A 1PQ4A 1T2VA 2JFWA 2D59A 2DWUA 3J7TA 2Q4BA 4QELA 4TVBA 2PYDA 4PPNA 3DO8A 3EARA 4RSHA 3RKSA 3P2EA 3UV7A 1II0A 1O6BA 1L7NA 4KFUA 3RM3A 2QIPA 2TS1A 5D7NA 2YZNA 2TMDA 3Q10A 4JJ4A 4EVSA 1E7WA 1XDZA 2ZUWA 3NTXA 3WNBA 2ZR8A 5CFQA 4HEHA 4CMKA 1EM8A 2VBGA 1LSOA 2YZKA 3H3XA 3MJ4A 1HLFA 4J7UA 1ZWLA 4UZSA 5IWCA 5JSQA 3DCIA 2CVPA 1TJPB 1CQJB 1VJCA 1GL3A 1V3UA 2I7TA 4C22A 2AFVA 2IXGA 3ZQUA 2QDKA 2Z43A 4U5QA 3WL3A 1OT3A 4W9MC 3CZ9A 2PFKA 1L7VC 2HCTA 4U7HA 1MB0A 3Q8WA 4UARA 5I9LA 5A9SA 4K26A 3EDOA 2EX1A 1N0VC 2O4UX 4HDKB 4JK3A 1DAEA 5AKLA 1NL3A 2A9JA 2Y1KA 1E0KA 1RRFA 4MV7A 2V96A 4XIGS 5HK9A 4HDRA 5WRFA 1L5VA 1XTKA 3SYTA 4LDRA 2RK4A 3MUOA 1O87A 1FE8A 3KEGA 1YRAA 4UUQA 5IN5A 5IFLA 4LHXA 5AJUA 5ECGC 4G9BA 3AWDA 2I87A 5JAOA 4L6IA 1MPXA 3ROGA 1YL6A 1SM4A 2VZ0A 5FA8A 4ZEVA 4DB4A 1NLFA 2QRGA 3CEPB 3P9NA 5G1NA 4MVJE 4RZQA 3A6LA 4UBMA 4KRYA 3IHTA 1ZGBA 2C42A 1E6UA 2BKVA 3V2UA 1GARA 1KJQA 2C95A 4QJBA 4Q9DA 2ZSBA 3TG2A 1NFQA 2B9VA 2NYAA 3IQFA 3OC0A 1YZHA 2XLBA 4U2GA 3D2CA 2AWNA 4WERA 1PO7A 3R40A 4GBGA 1OV4A 1EINA 5F73A 3WXBA 2XJ4A 1BX3A 2IXFA 3INRA 5K0JA 4JCCA 2JH3A 2UVPB 1AHNA 1JI3A 2VWGA 3NGMA 1J33A 4FHZA 2GGSA 3U3ZA 5BNTA 3L7NA 2PIDA 3QELA 5JW6A 5LZ9A 2P41A 2PV7A 3TBKA 2Z09A 3C14C 4OJMX 2WTNA 4IIVA 1TU3A 2DBRA 4KN9S 1EVQA 4EGQA 2PO5A 2PGNA 1LDEA 3KQHA 1VMEA 4TZTA 3GDGA 2FW6A 4GFDA 3S2EA 2ZJ1A 3ZJ5A 4NARA 2A94A 1KKLA 1EVZA 1UBMS 3H9QA 2NO5A 2P2LA 2XNHA 3A3OA 1YB7A 5DPMA 5LZ8A 4XEUA 5J59A 4LPKA 1USGA 3AUAA 3B2EA 3WB2A 3ZJYA 2F67A 5EEHA 5GY7A 3TNYA 1V1MB 2PT5A 4ZVQA 2ZRFA 3KO8A 3PDJA 5FLXA 5JNVA 1U8UA 2NSJA 3IODA 4UEJA 1OHHA 2I80A 4EA8A 2AVNA 3O8RA 1RI1A 1M8FA 4KQMA 4EKIA 1OUMA 1VHTA 2DFTA 3BXXA 3PVSA 3L77A 4D4MA 4F2PA 5B55A 1ORTA 3KCNA 1QBKC 2CMDA 2QVYX 3PIIA 2HTEA 3RVLA 4ZOLF 1D2HA 2Y0BA 3HNOA 2Q7DA 1T5IA 2XW6A 2BYTA 1KGSA 1X7XB 4J0EA 1SBZA 3WJAA 2NUTB 4KHPB 5HWSA 2Y67A 4CW7A 1E1RA 1DU4A 4BNTA 4QZVA 4EMUA 5ALRA 1Y1SA 3SKVA 3FIJA 2D2VA 3AY7A 1MAWA 1U2PA 2E4ZA 2VDVE 3FX2A 4C14A 4JQSA 1Y9AA 4CUJA 4ZVTA 3FNQA 1RI5A 5IX8A 4UFNA 2GZDA 4JI1B 1P5RA 1PQPA 1YR3A 1Q7TA 3V1NA 1JDJA 1A7AA 3X1WA 3ETJA 4DMFA 4PRYA 3BWDD 1JEYA 3AVQA 2F4NA 3OJ0A 4KIUA 2G1PA 1PP4A 1BWSA 3UHAA 5EJEA 5JISA 2QN6A 1E1DA 4REQA 2BGGA 4FGSA 5F7XA 2CXHA 4GAEA 3ZIAA 2VYVA 4NH0A 3AUFA 4B8WA 3I32A 4G4GA 2BBTA 3WNCA 4G6ZA 1E8NA 1MX1A 1RQ2A 2H08A 1Q1EA 1X6VA 2G70A 2JVKA 3QI7A 4M6WB 4QVGA 4RJ2A 5AHXA 3ZUGA 3FYTA 1ZNQO 1I7SB 3RLFA 1D4OA 3MXTA 3OWXA 4LMBA 4UBIA 3AI1A 4DG9A 1PS9A 4ZO6A 1H65A 3FKJA 1UR5A 3S44A 4E6EA 3K70D 3M1AA 4PCAA 1TYEB 2CSXA 3ER8A 4X93A 2WHEA 4HMOA 1SBTA 2PAFA 4DXDA 1Y80A 3TE7A 2J0VA 4UVIA 3ZJTA 3AM5A 1PQWA 2X5XA 3C7TA 2XCTB 4V0OA 2JJQA 2YTZA 3ZD8A 3V