3PC8C

X-ray crystal structure of the heterodimeric complex of xrcc1 and dna ligase iii-alpha brct domains.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
VLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis for partitioning of the XRCC1/DNA ligase III-{alpha} BRCT-mediated dimer complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/ligase
molecule keywords DNA repair protein XRCC1
total genus 16
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16759 LIG3_BRCT DNA ligase 3 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pc8C00
3OLCX 3L40A 2L42A 3JVEA 1WF6A 4Y18A 3PC8A 1T29A 1IMOA 2D8MA 4N40A 3UENA 4BMDA 1GZHB 3SHTA 3SQDA 3PXAA 2ADOA 3AL2A 4IFIA 2AZMA 3PXEA 4BU1A 2NTEA 3PXCX 1Z56C 2DUNA 2LE0A 1JNXX 3I0MA 3K05A 3PD7A 3L41A 3SZMA 1Y98A 2HTFA 2EBUA 2COUA 4IGKA 3K0KA 2ETXA 3QVGB 4XPZA 3PXBA 1KZYC 2EBWA 1OQAA 2K7FA 3I0NA 3UEOA 3PC7A 3U3ZA 3PA6A 3COJA 3T7IA 3EF0A 4XQ0A 3HUEA 1CDZA 3PXDA 3T1NA 2K6GA 4OFBA 2JW5A 1T2VA 3L46A 2COKA 3FA2A 2E2WA 3T7JA 3SHVA 1T2UA 3PC8C 4ID3A 4BMCA 3PC6A 1L0BA 4U4AA 2WT8A 2VXBA 3T7KA 2XNKA 2R1ZA 4JLUA 2COEA 3EF1A 2INGX 4Y2GA 3QVGA 3K15A 1T15A 3K0HA 5ECGC 2EP8A 3HUFA 3AL3A 1IN1A 2XNHA 1L7BA 3II6X 1N5OX 3K16A 4BU0A 2M2IA 2VXCA 3KTFA
chains in the Genus database with same CATH superfamily
5CB4A 3BRSA 5IDWA 2N0SA 1Z5NA 2ZYAA 3DAFA 2Z09A 1AS0A 1R0SA 3H9QA 3B1WA 4Q7LA 3T7SA 2DPYA 1LDYA 5HPYB 1U6JA 4XM0A 1KK1A 3MGGA 4E5DA 2OHGA 1M0TA 1USIA 2JGNA 4HNAB 4R8RA 3X1YA 5KU1A 1A71A 3L8GA 2F55A 1RWQA 3WOVA 1WAMA 3HFGA 1U7XA 1JEYB 1UXKA 3ADCA 3GIWA 2AEMA 1LBTA 3MIIA 1FNSA 5BO5A 4ENRA 4TSFD 1JALA 4NBSA 3HFSA 4WKNA 1H4TA 2P9QA 3EFBA 3TOSA 2C2MA 3UBTA 1E7SA 1PDOA 3AJAA 3PTAA 1Q7TA 2GKGA 3OI7A 5TF4A 1QYDA 2JL1A 1IWPB 1EFRD 2GEJA 1UEXC 3AR4A 3KEFA 4J1SA 4QA9A 4TQUS 3B1JA 2O7QA 2VDWA 1BZYA 3HN7A 4CQJA 2OY0A 2UZAA 5G02A 3D6AA 1LBQA 2YJZA 4QGAA 4RVUA 4JL5A 1WBDA 4B0OA 2WFMA 1Q1ZA 2AEEA 3O8OB 5EKDA 4J0JA 4BDTA 5BN3A 1ST3A 1YA6A 1ADFA 2WU8A 4IUDS 1Z56C 3JZFA 3KX2A 1JEEA 1TCCA 1ORVA 1B8OA 4O2LA 4Z99A 3SYMA 3L7CA 3D1LA 5KVQA 2WSYB 4BN5A 2RGAA 3K6KA 5DYIA 1WW2A 5IDVA 1PT6A 2QRPA 3MRTA 3W9SA 4KR9A 4DW8A 3T3MB 2OV8A 3DZJA 4MKFA 5AW6A 1OT3A 3K0AA 4YA6A 1UXIA 1YB4A 2C9MA 2RGCA 4N5LA 4OP1A 1XRRA 3TQTA 2I7TA 3ESQA 4O59O 5L3VA 5BOSA 1W0KD 2BFBA 4AJKA 4C6RA 4HAXA 1XCJA 3DZGA 2CMGA 1M6HA 2NLOA 4WASA 1U2GA 4O6VA 1QIIA 1YBMA 1OGYA 4MRAA 1M8KA 1WY7A 2DBZA 4FJ2A 1JG4A 3QWAA 1I0LA 2QX7A 3QY9A 3FX2A 4I4IA 4NBKA 3ZDQA 1RACA 2FWNA 5KNDD 4JBGA 3W78A 3BMOA 4B6FA 2WTMA 4YP1A 2UAGA 3MW8A 4CKZA 3X43A 1EP2B 1NQOA 2ONCA 3L7DA 5KYXA 4MB0A 4PAQA 4JLOA 4CLOB 2LKCA 4TMZA 3NHZA 3STTA 2CB0A 2FHPA 5FOTA 3S1SA 2HJ9A 1TKCA 2HWWA 1AIPA 4HWSA 5EP2A 3O8BA 3VKUA 5ADWA 5JIBA 4HH3C 3TM4A 5DTJA 2O5RA 4EB8A 3EGXA 2VHYA 2DQYA 3HKBA 3ZQ6A 4E3WA 2MSKA 5IEBA 3GLGE 3VBCA 1ECPA 3O7MA 3HKDB 1J6UA 2IZ1A 3QYPA 1M10A 1BN6A 3GG9A 6YASA 2HAEA 1RYDA 4U3JB 5KQLA 1RZUA 4K1LA 1DAOA 5KDOA 1GGMA 1TFUA 2CNKA 1YRYE 5TMEA 4WEOA 2ECQA 2GUWA 3DVAB 2JCXA 3INYA 3BD8A 2MINB 3WYGA 1Y4ZA 5IYZF 4EYKA 2UUAB 2QAGC 1DRVA 1YVEI 3KJGA 4J16C 5TX7A 2GLUA 4BWGA 2XZLA 2BGUA 3BE6A 3DE2X 3G7UA 4PSUA 3WYBA 4CMJA 2HJVA 5H5JA 4PBTA 4FD2A 2BR4A 2FYTA 5EMJA 1AN0A 1QO9A 4D5EA 2MIIA 4ZQFA 3UJ7A 3ECSA 4TZ0A 2IT1A 1L5MA 2G06A 3BKWA 1KBOA 4CG2A 1QH8B 1UBKS 1WF6A 2I29A 3AM1A 1V11A 4OGWA 1CK4A 1YR9A 1A2BA 5F76A 2FN7A 1HLDA 3JQ7A 2XMGA 4B4WA 4CDRA 1HZJA 3NV9A 4QKQA 3QUTA 1KARA 1FS5A 2E5FA 3ZIAA 2AOUB 2YNMC 4IIHA 3FUUA 3RKSA 3IEVA 5CPFA 2EKBA 1UJCA 3FYUC 3IPCA 2OTCA 2HK9A 1GUZA 1A5BB 1AQLA 2AR9A 1X74A 3CIFA 4JSYA 1EIWA 1I3OA 2GM5A 4FC7A 1V8OA 2C7PA 1L4GA 1OHHD 2VP6A 4M37A 4R5HA 4O4LB 3H04A 4GI2A 3P19A 2YVKA 4LJ7A 2QUHA 1WD7A 3HVHA 4GBED 3CF2A 1CS4C 3DHWC 3HXMA 2ZDGA 5ITZB 5EIOA 2VAWA 1R0CA 5HFNA 1E3DA 3W06A 2EYQA 5KQRA 1LV8A 3E7DA 5FOSA 4M6WA 4FGUA 1YS7A 4AJ2A 1C81A 1Z34A 2AIRA 2GBFA 3ZBUA 4F92B 3ZLJA 4IDAA 1P39A 3T7CA 2CXUA 2RI1A 3QKWA 1RWKA 2HIGA 4A5SA 1FP6A 2PRKA 3MD0A 1OIXA 2FOXA 3O1IC 3VTAA 3LDUA 4F7DA 3P4XA 2B8TA 3KZMA 3MCAA 2H1OA 3K0KA 2D5IA 3OPXA 4PF1A 2J41A 4A0SA 3JQEA 3OQPA 1GTMA 3C7CB 3ZWOA 1IAQA 2VSQA 1PBNA 4NBVA 5ECWA 2AN4A 4B32A 2BONA 4HL6A 3SC6A 3L6BA 3HO6A 5H81A 4U2EA 1CX9B 3HWSA 3AR8A 5PGMA 4WLOA 5A1TA 2VZ9A 4KK4A 4JMLA 1EDBA 1W0CA 2JLCA 3IV7A 2Y8EA 4PTYA 4FI3C 1JECA 4CV3A 1QYIA 3CRQA 2XHZA 4UNIA 1M7HA 4MSUA 1U0BB 2GZDA 3NRJA 4BUCA 3V80A 3COJA 5JLJA 4ZK2A 1RYFA 1JJFA 1O8CA 1FXWA 5G40A 1AF4A 1D2CA 3JZDA 4R8MA 2V97A 3OQIA 3QF4B 4M6WB 4NOJA 4JZYA 2XT6A 1R9GA 1HTBA 4LOIA 1MCZA 5FQOA 3PTZA 1XJ0A 2N1MA 1SXJC 4CQLA 4DCGA 2ZBGA 4N5DA 3T9DA 5TB5A 4BNZA 3LWBA 4GX5A 1NUQA 1L7VC 2A0KA 1J5PA 1I1QB 3WK5A 4N01A 3AR2A 4D56A 2PUBA 1LDMA 2C9CA 5B1SA 1RIIA 3VNVA 4DDHA 4CMEA 4RSGA 1TGVA 5H82A 4L5IA 4F2DA 1Z4JA 2OC4A 5K8IA 2IPMA 1ES9A 1G66A 2GPYA 1IPHA 3NBMA 4AK9A 2Y9PB 3RUDA 2PPVA 4XB6B 5EZYB 4TSKA 1PNQA 1JEAA 3K0AB 1MO2A 1SUFA 4IHJB 5AW7A 3CUVA 2R6JA 2KLBA 4RY2A 2GTIA 1UKBA 4BB9A 2ZR0A 3UK2A 4HP8A 4YCCA 1SY7A 2PRZA 1BCSB 3G1UA 4UVEA 4KQGA 2QTMA 2OP0A 3GLIA 1NG1A 1RZVA 1FRVA 3DKKA 3HDVA 3LCMA 3VPDA 4DSNA 1DIGA 2HT6A 3O73A 5AK0A 1E2FA 1PK7A 4ZHQA 4KPEC 4HAWA 4DPMA 3GAZA 1E79A 1DOZA 2I3GA 1MOPA 4RHFA 2FZLA 3PWZA 4ZCQA 3TOVA 4B6EA 1VLLA 3NXKA 1GUAA 2FSIA 3R74A 4BRZA 2P1RA 3WB9A 3K8ZA 2P30A 1NUPA 4BFZA 3EC2A 4IDBA 5ALIA 4YP7A 3GR6A 1L4LA 3UUGA 5J5VA 3IQHX 2WUFA 3F6PA 2CLMB 2NPOA 3QLUA 2BFDA 4IIJF 4RZSA 2OB1A 2Z4RA 1A7AA 4H4DA 1PCXA 4LRQA 2AG0A 3IMKA 3VNAA 1BW9A 4ZI2A 1F48A 3EMVA 1QFJA 1AQ6A 2C92A 4GS5A 2VA9A 2QA5A 5REQA 3ZZ1A 1KMNA 2I1QA 4P31A 4LDJA 5COQA 2FVYA 1R4MB 2WTEA 1XLWA 3ZQJA 3BF7A 1F8FA 2JFUA 1W59A 4ND6A 1YAHA 1U4NA 1WCWA 4QWWA 1KEPA 1JIJA 2QRVB 2SKEA 3OTHA 4L50A 2R6FA 4Q7JB 4RTLA 2J32A 1ZK0A 2CXOA 1A88A 4Q4DA 1GFWA 5E8JA 3UJ9A 1GCAA 4AS1A 1QK3A 3IKLA 4CE6A 3DAGA 3T3EA 3HADA 2IV2X 2GUGA 3WB2A 3HFJA 3NETA 1H0HA 3QUCA 4GR5A 4YP6A 2AXNA 3AF2A 3BFXA 4ZDWA 4FIDA 2FZKA 2YIDA 2EL9A 2V74B 1OE0A 1P73A 3Q6MA 4HD8A 4JSTA 1RXUA 3LK7A 2DFTA 3QE0A 3T7RA 5M04A 5C1OA 4W7HA 2XQGA 3A6GA 1PNVA 5CYPA 5L8VA 1C29B 3FD8A 3I4CA 4ON9A 2X8BA 2WQ7A 1JYEA 2XMZA 4B46A 1SEVA 1SXHA 2A9PA 4ZWNA 1KERA 4NI5A 3AUSA 1I9GA 5AKEA 1T6XA 5KYUA 4G23A 2C95A 3DEAA 4I66A 1ZGJA 3SC2A 5E9WA 4PW0A 5JATA 1AV6A 1SXJB 2X6TA 1IWOA 3I73A 1VLHA 5LVAA 2V4ZA 1HRDA 4EP1A 1MV8A 5I7FA 1SU6A 3A14A 4BFLA 1FPMA 2C42A 4I8IA 4RH1A 1NBOA 1WEHA 1HEUA 2PH5A 2VNSA 3TSCA 3VV3A 3IEXA 1HSZA 1I33A 3PWKA 4A0GA 1V4VA 4HQKA 3QI7A 4YUAA 3GUYA 5LD2C 4IQ0A 1RXCA 5KVSA 3K72B 4IVQA 4TRRA 1LVHA 3P96A 5B37A 1I2CA 4MCAA 5I7VA 5FULA 3JATA 5YASA 4BVEA 1SELA 2VNIA 2XXAB 2Q3CA 2WT8A 2F67A 3HGTA 2H00A 4CIXA 4BE7B 4EK9A 2Q0SA 5HF5A 5CBPA 1UOQA 1HZZC 2O54A 2PBFA 1OU0A 1X8LA 4O1HA 1TVCA 3DD1A 2HUPA 2GJ4A 3MXTA 3OFKA 4JA2A 4R2KA 1TMYA 2FSVC 2ZXEA 4ARZB 4WCFC 3NIWA 4JXXA 1E9BA 3TW6A 1JKFA 2QVZX 3WWPA 3PHIA 1GQ2A 3DV2A 4X61A 5ICMA 3GWGA 3CRRA 3MS7A 1AK2A 1O3YA 2J3KA 4RQBA 3DMFA 3LM8A 4I9GA 3T1VA 5AW4A 1D9XA 2PKCA 1U80A 3EEBA 1XMOB 3P52A 3H0CA 3UJ8A 1QIFA 1IU9A 4UU0A 1AN9A 4GZ3A 3ZCRA 3HJFA 1S2OA 5LA6A 2NMVA 1RI2A 1E2QA 3BHIA 4XGRA 3GFQA 3E7PA 1H2XA 3SOZA 2GHQA 1T0JB 5JV5A 2FPIA 1QFSA 2JJMA 4COKA 2IIBA 4BZQA 1SVMA 5CDTA 4LFAB 1AM4D 3QTTA 3KKEA 3WRVA 5KTNA 3SVLA 1DKMA 1R27A 3KJQA 4FGLA 1SUAA 2DX7A 3ZH9B 3G0IA 3M4ZA 3PHLA 5A7FA 1DJOA 3EQ9A 4JLBA 4UAGA 3H9GA 2HOQA 1KE1A 2J4CA 4ARCA 1PL0A 1RJDA 5FYDA 3DE5X 2OXFA 2X58A 2QN9A 1JA9A 3FI0A 3FTQA 3IAS1 3LQYA 3C70A 4ZAFA 5LBUA 4ZHSA 1D8AA 4ES6A 5KSPA 1J1IA 1MJGM 3UB3A 5AR1A 1PI3A 3WR5A 3MSXA 4HVCA 4Y1GA 3GBPA 1VJ1A 4RBNA 3ZE6A 2FGKA 2AE1A 4CDGA 1EDDA 4I0WB 3D7RA 1P6XA 3DV9A 4RGBA 1F9EA 5J2TF 4B6RA 4Y98A 1I80A 2OGWA 1CR1A 4MITA 2D59A 3O2JA 2H2WA 4KAFA 5E6UB 4DUPA 1SQ6A 1J07A 2BGMA 2LWIA 3ONVA 4X6LA 4YQZA 1K5DA 3CEJA 5ALGA 5F9HA 1ADCA 1XTTA 3ML1A 4ALNA 1WA5A 2V0NA 1PJ2A 4M88A 5K3EA 4YR9A 4MR9A 3SZMA 2JLZA 3UM9A 4GEGA 2LBPA 1DJLA 1G17A 5KOJA 3L3BA 1NXWA 2Z5GA 1TE2A 4K86A 5DCUA 4TLBA 5HNKA 5EUCA 1VSTA 2OEPA 3LDFA 5CXSA 3MCVA 4EF6A 4D80A 3N2GA 4Q6BA 3R7DA 3QI2A 4P7JA 1IZ7A 3LJKA 3M34A 2WMOB 3FZQA 4J4TA 5P8WA 3VH4A 1A2QA 3AERA 1ECGA 4NENB 4YMVA 3R5KA 4TYNA 3DGFC 1KI9A 5AVYA 1T8WA 4MO2A 4ZYTA 1IUOA 2ZSKA 2DCMA 3KOUA 4BEJA 3KR9A 3DE6X 1NFFA 1XAJA 3OLWA 4PE5B 2NUPB 4KLRA 4KIFA 3SD7A 1CUIA 3K9QO 3R1IA 2O7VA 5KVVA 1H8ED 2J6BA 4KH0A 4QUAA 4IO1A 2FWIA 2IGBA 2QX6A 4KVGA 1T9KA 3BGIA 3U56A 1YL5A 3RYHB 4E1VA 3DEKA 3KVNA 3UHFA 4WBNB 1YDWA 1YS6A 3FUWA 3GJQA 5B3LA 4HDQB 3SHVA 4REQA 1JDBB 2MSWA 2VNHA 3GIDA 1OMOA 1DG9A 1OTXA 1T5HX 1QF7A 4R1UA 5JQGA 4N41A 3IJPA 1WZNA 4O4IB 4EFLA 1DWUA 1U2QA 2VJLA 3NAQA 4HKTA 1HWYA 2O06A 2C5SA 3LF2A 1LLDA 4W7SA 1JBQA 3S2GA 1M6WA 2QUAA 2VHVA 4F9GA 4OJKA 5AUPB 2HLHA 5JNWA 1CJUC 3FOCA 3HB0A 1CZLA 3M6IA 3OT4A 2QTNA 1Q7BA 4Q15A 1C4XA 4WZ6A 3OPNA 1CBUA 3VKGA 2HZBA 4BLUA 4MUYA 7AT1A 3M3HA 2XNHA 4P81A 4D0NA 2C77A 1LSOA 4GP6A 1QSGA 1YVPA 4G9EA 2Q3MA 5IHPA 4AMVA 4PLYA 4IJVA 3TZHA 4JXKA 4BVFA 1QCDA 2CMKA 3FKSA 4RYLA 1XDWA 3FNQA 5JTTA 1DO8A 2BCGY 4MNTA 1ZJYA 3C3JA 3MRXA 3OP1A 4JKYA 4BIIA 1W0JA 4QT0A 4P2GA 4Y6OA 5IT9A 2PKWA 5IMSA 4LRXA 4UTNA 2GCOA 4WOBA 3FPHA 1JEOA 4HAUA 4K9NA 5KJFA 3VNUA 3AINA 3IP3A 1TQDA 1KI8A 2MYNA 3I23A 1DQYA 2CCJA 3QYFA 4EI7A 5MN4A 1YA4A 4IXWA 3HXLA 1IBRA 1EINA 1XTSA 2PWZA 1YS9A 2EKLA 3JQRA 4E5VA 4WK6A 1N1DA 1H1TA 3DC2A 3D9QX 4G1FA 3REOA 1VHQA 2BE9A 3PJGA 3GJ4A 1KMQA 3OIUA 4HSGA 4DR3B 1Z35A 3PRJA 1J2RA 4ARBA 2OLKA 4PAGA 2IPXA 3MUEA 3WL5A 4UU1A 221PA 1FSPA 1SG9A 2E82A 2RK6A 4G4IA 1BDJA 3ANLA 2XUPA 4GOLD 1PLKA 1YC5A 2GPJA 2Q2WA 4R8VA 4GP7A 4NULA 5ILQA 3BJIC 1ZI8A 3FJ1A 4FUTA 4KO3S 3MJTA 4L4UA 4WY8A 3MVEA 3FRJA 2JGLA 2A9QA 2FQQA 5IAJA 2I2CA 4N3CA 3CX6A 2VBFA 3ZYCA 4DSZA 3KQNA 1CUCA 1NXVA 1USWA 4G86A 4ZI7A 2ZRHA 2R44A 4TT3D 3D8BA 1U4OA 4N5IX 2C3UA 3A8TA 5FL7A 2F48A 1ADYA 1KEEB 2R8ZA 2W83A 1P1JA 5JALA 3LT0A 1QRDA 2J9FA 2XAAA 2GN8A 2QY6A 5BRJA 3R75A 1GRVA 3ENZA 4MS1B 4IZOA 5KJ1A 3EPKA 1W8IA 2AG8A 1Z08A 3N2IA 2Q9UA 1MIHA 1L5RA 3QVXA 4X9XA 1ZSYA 3IUNA 2B4RO 2GD1O 1LUAA 4EW1A 1CZUA 4L5CA 4RW0A 3NDBB 1RLUA 2W6MA 3SLGA 1I51A 4AY2A 4D8TA 4U7GA 4JI6B 4EZIA 3NTOA 4OQEA 4X20A 1A97A 3QKUA 5EJIA 3K2EA 3N0XA 4KBYA 2EWWA 5I8WA 1A9XA 1NPYA 4PRZA 2PIAA 1PV2A 3GJ8A 4JJ8A 5FWXB 1JLLA 2WWVD 3JD4A 1E4EA 4CM9A 1SIBE 3PIDA 2HMYB 3FSJX 1OXTA 3T61A 2FEXA 1N0HA 1RMYA 4R9SA 2IYAA 4MW1A 4FE7A 1KGDA 1U7HA 5C8YF 1XZEA 4QO7A 3C3AA 1L8OA 4JLMA 3R3JA 4GL4A 1LKZA 1UWVA 2FR0A 2K2QB 3LYLA 4GYKA 4O63O 5FPQA 2GCNA 4C43A 3KSDO 4E4YA 1NY6A 1A8UA 1AF7A 2Q3DA 2XQFA 4I3GA 2GSWA 4RIEA 1QHGA 5GWXA 4PYJA 1UIRA 2H3HA 4BNTA 4KXMA 5E7QA 1CQIB 3WLIA 5HIKA 2B8NA 4F12A 3E27A 3RYIA 3SKYA 3BD6A 3FMVA 3VSEA 4JJFA 5K03A 1MB4A 2YVLA 1PKEA 4M36A 3LUBA 2AW5A 2NUBA 3A7DA 4BX8A 2YXPX 1YDGA 1JHDA 1Z8NA 3HV2A 3LUAA 4HR7A 4FM9A 2C5FA 2QTRA 1V3VA 2X2FA 3STWA 4WVLA 4L0CA 4MWGA 4FEAA 1EVEA 3RSQA 3KG2A 4EI9A 3L1JA 4GOXA 3WQQA 4HNHA 3ZVLA 5MGBA 5EJFA 5COAA 2P9ZA 2XAUA 3OLXA 4NS1A 2B69A 2PLFA 3RS5A 2WJ3A 3ZBQA 4E5KA 2YMMA 1ZYUA 1KYIA 3RF7A 1DO2A 5BW8A 1I3CA 3I3OA 1P5HA 5D00A 2HQRA 5FB3A 2WF7A 2LGJA 2OXEA 5FTNA 2C9ZA 4Y2TA 3DTTA 3LO8A 1K6MA 5CDHA 3D0QA 4QELA 3TXYA 2WAXA 3VR4H 4EMUA 2P7IA 1Y3AA 3EWAA 4I6JA 4JJ6A 2OXTA 3N1UA 3VUFA 5LKAA 3OM9A 3P9CA 4TYMA 4OA5A 4WZBB 1I7NA 4LJYA 1CUWA 2P4SA 1WUHS 2WM9B 1TTPB 4V2IA 3OWOA 4Z86A 5JT1A 4Z8YA 2IY9A 2AXEA 4K6KA 4RLSA 5UKDA 5LNK6 3A4IA 3RJ9A 2W2NA 1ONSA 3H13A 4ND7A 1KJWA 1KC3A 5AESA 3MWKA 2PZEA 3IDSA 4RVDA 2HU5A 4YRBA 2CNLA 2X7JA 1V1JA 2OUIA 1LW7A 5EA2A 3DLCA 3J81k 1I8TA 1EFVA 5EMKA 1P61B 3F8WA 2UXDB 3ZW9A 4RE5A 2LD4A 4RFSB 1M1YE 2W9XA 1P5ZB 1RRVA 1T36A 4V03A 5ENVA 4PYQA 4ZAXA 1B3RA 1C7JA 4H7HA 4IL5A 3S44A 1ZUHA 2Z8XA 1C7ZA 1W4ZA 1FNCA 1O87A 2P4UA 1J4AA 3C2QA 3MLBA 1QYRA 2WVGA 1E0AA 4V38A 2QSJA 4PC1A 3WRWA 1F8UA 2Q6OA 4YRTA 3QNMA 5ALPA 5TPZA 3ZG6A 3AVXA 4PFQA 3WKCA 1IDN1 3BIJA 5FFMA 5JOQA 2R11A 3L6OO 2OFFA 1GV1A 2X8AA 2ZI6A 3JD3A 3JVIA 3LKZA 1YAJA 2OCDA 1XQ1A 2O05A 3EA5A 5B5SA 4BNKA 1PWHA 5KX5F 3TGWA 4PLVA 3BFKA 1MJHA 1SZCA 2HQBA 1EFLA 5EE9A 2IU6A 1RE1A 1T4BA 1KTVA 1HQYE 4KDEA 5TQJA 2BFNA 2QE6A 4ZT7A 2XCLA 1CLEA 3ZQ4A 2UUBB 1T0BA 4DA9A 3Q9SA 2PTGA 5G0TA 1QZUA 1LDEA 2H16A 1NNI1 2XB9A 2ZQ5A 3ZUGA 3BZBA 2ZIXB 4NH4A 3MTEA 2VHJA 3JTEA 4KVFA 3Q88A 4ZI7B 2DUUA 2R4TA 4TWJA 1QORA 3OUTA 2GHRA 3KQWA 1LNQA 2X7XA 4TTTS 1YUMA 2A2ZA 4XPIA 2P5YA 4MWEA 3HEAA 1SB8A 1YQEA 4QARA 3IJ5A 3AM4A 3C8DA 4DLVA 5TT0A 5F7XA 3OPYB 3LS2A 4PPQA 5ECGC 3OG9A 2FNAA 1QK5A 1K6JA 3A4VA 3JAKB 1BE6A 1G4AE 1BQ4A 2G0NA 1GG9A 4PZ0A 1G8HA 3ULKA 2C7RA 3BIFA 4WK2B 1J8QA 2WWRA 3PUJA 5JYBA 5CUQA 4K6FA 5EMHA 3Q3GE 5DBOA 1S2NA 3LYUA 4YAWA 5DYTA 5FLEX 4C4TA 3D3NA 5AVTA 1PR6A 4QNRA 2DF8A 5TLSA 3AKDA 4ROTA 4EEZA 1N7IA 4JJEA 4YFVA 3KWMA 3OZXA 1DV1A 5DV9A 4TWAA 3ZW7A 5JCZA 4F6LA 1T10A 2RH9B 4LF6B 2EIHA 2BBOA 1JDVA 3O47A 5HFAA 2PT5A 3TG2A 2P9HA 1M7GA 2VDUE 2CB9A 1KEZA 4NJEB 4HNTA 3A27A 3IDAA 3IT3A 4GLBA 1N1EA 1TW2A 5EZ6B 1S4QA 4NBUA 3UCEA 1JQKA 3E2MA 4X66B 3G2NA 1KU0A 3B60A 2DR0A 5DN6A 4AG3A 3R9XA 1NMQA 4X1KB 2QBYB 1Z3CA 2WJPA 4DMKA 1CQIA 3QLUC 1X1AA 2Q1UA 3QFCA 4F0JA 1Q7EA 5LR6A 4G0MA 2OCYC 2G4VA 2PS3A 4M8LA 3KYDA 3QJGA 2C00A 3V6MA 2E4UA 3GFGA 3RSHA 3GLGB 3SMQA 1OFUX 5ALSA 1E3WB 3A9VA 4JSRA 1E7YA 2OAEA 4FEEA 1YI0A 4L6AA 3NAMA 4OI0A 5ALYA 1U2SA 1U5BA 2Z2JA 1GCGA 4PO9A 4JAVC 4OQYA 3TFWA 5BUQA 2ZBPA 1GUFA 3KKQA 1E9DA 2Y6UA 3T3OA 1O57A 4F9EA 1B26A 4CEHB 1YZTA 2QRQA 1T3GA 5KCZA 1IBMB 3FY4A 5IJ0A 5JJBA 5KQPA 4UKDA 4XFJA 3FYUA 4QTZA 1KS9A 2VDNB 5A9RA 1BH2A 2C54A 2OV1A 4XJVA 3TQSA 4AD8A 1E6UA 4M7RA 4EQ6B 2VYFA 1ISMA 3TLZA 1OBOA 1AV7A 1HRKA 2BKVA 2HRBA 3PQ3A 3Q7PA 2ISSD 4F04A 1KK2A 2IBSA 1G8KA 1Y5IA 1WXEA 5FX2A 2X40A 1JHAA 3HPRA 2QRZA 3UJAA 1PN3A 3B36A 3U0VA 1QQBA 3PT5A 1O96B 1YZLA 3U3RA 3I37X 3QPUA 1SCQA 3JWPA 1JZQA 1WSAA 3C87A 2BEWA 3J7TA 3TXAA 2JFYA 1XZAA 3BH0A 1X80A 1GPWB 3GVXA 4X8HA 3S2SA 5C7IO 1BDMA 2UUPA 4UM8B 4AO6A 1OJ7A 5IKXA 1OYYA 5EXPA 5DH9A 1YH3A 2JCYA 2VYND 5HJ2A 4NX2A 4BO3A 5CCEA 3W5AA 3QFTA 1E8NA 1P72A 2QYTA 2I67A 2A5LA 4KN9S 1E8MA 1FUEA 1K9SA 2H5IA 3FB1A 4UU7A 5JS7A 5BOSB 2YJNA 5KO2A 1HUQA 3QMWA 4MQ4A 2HSGA 4BJ6A 1VLJA 4H1HA 1QVAA 1L5GB 1NN5A 3RW9A 3A9TA 3C3CA 5FFFA 1PUIA 2PVSA 3GWZA 2KJQA 3IO5A 2QUBA 2AMYA 1VL6A 3KU4A 4HO1X 1Y7HA 2GKSA 1M2HA 2QGFA 4XOUA 3T1QA 5JXIA 1E5TA 4MR9B 4QDOA 3MTIA 1T1JA 4GYWA 2OPBA 4AS3A 5LWHA 2RGRA 4BGUA 4J4BA 1HI9A 5J2TA 1MQAA 1JFVA 3EJ6A 3G7SA 1W73A 3MWLA 2QZ4A 2FMFA 2AZDA 1CPYA 1VJ5A 3VAZA 1BG6A 1ZC4A 5EE5B 1NWCA 4IF6A 4OF4A 1NVVQ 4U02A 3HY6A 3I45A 2QRNA 3O75A 4HADA 1XNJA 3I2YX 3KTOA 1JMVA 1RRMA 1S01A 1O9GA 1SPXA 4M0UA 4Y6RA 1D7OA 5D3ZA 1H65A 1L3BA 2H1IA 4B31A 3V7YA 1PW5A 4EUEA 1UK7A 2VH2A 3AF4A 3L43A 4EKIA 3KTDA 3EVAA 3GLIE 3KKZA 4KMRA 1ZNXA 1E69A 1OUMA 1I3KA 2PEZA 3BC1A 3SWWA 5KYNA 3VO9A 2WJZB 1RRFA 2PR2A 4ENWA 4F06A 4FBLA 2I3AA 1A8QA 3ONWA 4ND8A 1PD0A 3UXYA 4WMLA 1H69A 3EZ7A 2CJXA 3PR1A 3ZCXA 5JW6A 5JS8A 1AB5A 2WKPA 3WK8A 3S1AB 4BO8A 2HI0A 3V46A 4CMBA 3DF9A 4XGKA 2QEQA 4TWRA 3UJHA 3IBGA 2YYAA 1Z5PA 3L8EA 4EGQA 3PL1A 4JUDX 2DKNA 1WCIA 3OKFA 4K40A 5KNBA 5JNUA 1DIHA 2UUOA 1N8TA 1X1EA 5FCDA 2ZYTX 4GKKB 3EARA 1WDLA 1KJIA 3EDCA 1U7ZA 1ISHA 3UGJA 4V0NA 3UN1A 3DR5A 1T3TA 3CVYA 4I9HA 3C6YA 4F46A 4KPYA 1CG6A 2ZVQX 5BMVB 1R6DA 4MVWA 3C6KA 2E89A 3EG9A 1C7RA 3BXPA 2QV7A 4PQRA 1CJBA 5DGCA 5EOVA 4ID9A 5JFOA 5BQFA 1YONA 4UDYX 3FFBA 1FNMA 5J4KA 4NY1A 3WGMA 5E6SA 1Z18A 2C4WA 3JATB 4MW2A 3WKDA 4NV1A 3AP1A 1Z6XA 2MMCA 2C9OA 2D5CA 3FCCA 4AY3A 1KORA 4HX2A 1O6ZA 1ONOA 1XHFA 4UHDA 3X44A 2E4VA 3PFNA 3ZE7A 2ZI7A 1YI1A 1E32A 2YH2A 3QLJA 4G37A 4JB2A 3UH0A 4JLDA 1IOVA 3RS2A 3IERA 1WOYA 4ZV4A 4JYBA 5T3YA 1D3AA 4Z3OA 2CD7A 3GP5A 1IPFA 4H0FA 3ZBTA 1A50B 2QNBA 3LLVA 3FDIA 3UMBA 4X84A 3L79A 5FWYB 1A82A 1RPTA 4Q4CA 4OLBA 3HVIA 4TYPA 3HCFA 5I9BA 3T15A 3CXRA 3OEEA 2D2VA 2EAUA 5TGDA 2ZUVA 1PK8A 5H4GA 1KFCB 2EX1A 4UARA 2ZRPA 4XD7A 1X38A 1YHZA 3QKRA 1H0KA 1X87A 3K31A 4XPIB 3TRHA 3HCEA 3OC0A 2RBEA 2VJNA 2QL9A 4J6EA 3TEMA 3TOXA 3NRCA 3SE7A 1ABEA 3LBAA 1MN6A 1QLWA 3WGJA 4I8DA 3JQBC 3M7IA 3NATA 1H5UA 1VM6A 4DV6B 5IVKA 1EFDN 2Q28A 3GFRA 3KYDB 3MPUA 2QAGB 3OPYI 3S29A 4KGZA 4ARIA 1V8BA 2HF9A 3CZ9A 1J06A 5IK2A 3EMBA 3WLHA 1XLTA 2YWFA 4Z8XA 3UCFA 3UJPA 2BCJQ 1XZJA 4Z3KA 3A1EA 5K3DA 4N7RA 4P35A 1UBRS 1FL9A 2DHQA 3ZDDA 1R4NA 1JX6A 5U1PA 2DWOA 3M4JA 1KJQA 3BE8A 3HKCA 1M74A 1C8BA 2XE6A 2ZYSA 2HSDA 1ZVJA 2HCJB 3BGSA 3CURA 1EFPA 1VE3A 4FSHA 4GLLA 4ZC8A 3UMYA 5JPIA 1EIZA 1UPUA 3HCCA 3HWRA 3ZH2A 4HN4B 4JNKA 4BNGA 4BB0A 2IF0A 3DA8A 3TR6A 1WDKA 4E14A 3GJZA 1W1UA 1U9ZA 5ARDA 2NACA 4ZCMA 1R4AA 2FSVA 2VL7A 3NOVA 3CGGA 3R40A 4C0JA 5BN5A 1MJFA 2QPLA 2GBPA 3OJEA 3UAXA 1NKVA 4A91A 5FOUA 4JV5B 2D54A 3KQTA 4HB4A 4C06A 2NU6A 5KJEA 2V9CA 5FWDA 1CUJA 3IIEA 4EHJA 4RY0A 3L4EA 1T6BY 3F7MA 4CDNA 3ISTA 2QSUA 4N40A 1FU8A 2B5VA 1BHSA 3CEAA 2Y1GA 4K6CA 3IA7A 1QO0A 4R2WA 4F71A 2BRUA 4N7BA 4XIGS 4IDFA 2PJDA 4O08A 3AV3A 2CHVA 1KP3A 3FMOB 4QAJA 3TNLA 1Z7WA 2CNBA 1NQXA 2WM8A 3BWYA 2QQ5A 1Y6QA 2B8EA 3OJ0A 4I4NA 2EFDB 4M49A 1QFYA 1XPUA 3GV0A 3KLBA 3A6LA 3LZ6A 2XYQA 3QP9A 4LF4B 1OHHA 1ODKA 1DAMA 1G64A 2ID7A 4QQFA 1ZM4A 5KWVA 5EPOA 3VPFA 3FPBA 2O8DA 4JGGA 3ZX5A 2AMJA 2XNSA 3ZW8A 1Y42X 3FOFC 3HMQA 3VXKA 2IYPA 2YFHA 2A57A 3H1TA 3NTUA 2X3FA 4J7UA 4BFYA 1SKMA 1N4AA 1THZA 1EUCA 1EX1A 3ILVA 4X54A 3EIWA 4KB5A 3WIUA 1Y8AA 1CY1A 2WKQA 1G3QA 4J7CA 4W8HA 1MFPA 4YYZA 2C4MA 4F21A 2MYTA 4KGVA 4Q16A 5ICEA 1G9SA 1ZGHA 5DM2A 1P0QA 2EBWA 2MYPA 1QH1B 3FETA 3LDHA 3B9QA 1E2DA 2B36A 2H1CA 4H3KB 3BXGA 5FO0A 4EECA 4YB8A 1XTJA 1U3FA 1AKVA 4N6NA 4C78A 2PUVA 1ZVMA 4FYWA 2RIRA 1SIOA 1XWFA 1ZCAA 4OGFA 1D6SA 3NQ41 1YWGO 4CM3A 3WHKA 4V0SA 4YT4A 3PRKE 4CQNA 1BD4A 4IFEA 4C4SA 5ER6A 2AFHB 2PLNA 1Z6GA 4LVUA 4PLCA 3SIRA 3M5WA 1CDZA 4G0OA 4RVNA 3AHHA 5ETJA 4EPRA 4I50A 1XRLA 2I4IA 4ALJA 4B2IA 1ZH6A 3ITKA 2O57A 1K8QA 1PR0A 1Z4MA 3ROZA 3FR8A 3HLTA 3ITEA 2XRFA 5T4BA 2QR5A 3L01A 1P4GA 4EY8A 3HJTA 1G6KA 3V1LA 4DLRA 3MHTA 3IUMA 2GJKA 4ER7A 4ZVQA 1UBOS 1S3IA 2Z2YA 5I7WA 5CM8B 5CVUA 2ODTX 4L5YA 1R8SA 3LGAA 2WF5A 5DHFA 2XUKA 4EEKA 4EGAA 2PZMA 1CZOA 1JUDA 2EQAA 1B2LA 1TW3A 3Q5DA 3KQLA 4KL8S 1VLQA 4NESA 1OI2A 3PPWA 3DZKA 3C3DA 3UYKA 3DBRA 1R0WA 4EVQA 5C5DA 5KMGB 3HNRA 4JIMA 3V9AA 1R0KA 1KJ9A 5EZSA 4FFBA 5EE3A 3J7AC 2W6PA 3JVVA 5JLAA 4ZYZA 3ILHA 3OC6A 4Q1BA 1QCZA 2O7SA 4DWWA 3IKJA 5ITZA 5BQ5A 4F9FA 1UMDA 1UM9A 2V1UA 9MHTA 3OCJA 5TGZA 3OJWA 2H18A 2G04A 2ZIEA 3QVKA 4INJA 4HDMA 4LYJA 1QB8A 1G8YA 2VP2A 4JVNA 4N6GA 4OM7A 4XQ9A 1MDBA 4I4TF 3TSZA 1SK8A 2NVBA 3JVUA 3LUFA 2A78A 2WBLC 3EA0A 1ZCJA 3G2JA 1KJJA 3TCXB 3BE4A 4WECA 1J0DA 2BDTA 1Q1BA 4B4DA 1V6AA 4NHEA 1FYVA 1UBGA 4CV2A 3BSYA 2A1TS 4BLQA 3WE7A 2OSBA 4L0MA 2FOIA 2VXOA 1KQPA 4WY2A 2JIZD 2PT9A 4HB2A 4M9QA 5KTTA 2WP0A 5EIBD 3VR4A 4JYCA 4PINA 2WJHA 2F9FA 3KETA 1TYDE 2VHZA 3RUEA 3VC7A 3KXPA 1TKAA 1U8CB 2CUZA 4QTTB 3VU1A 1GZ6A 4MKIA 3UAZA 3E7WA 4I5EA 3TSYA 1XAIA 3KK0A 5K0CA 1WIWA 2DUMA 4S2EA 2I3BA 2NTEA 3TECE 1E2BA 3MAJA 4J43A 3OSUA 1A2OA 1NQUA 4OYLA 4BLSA 1V16B 3NOOA 3KZCA 1TA4A 1O94D 5AHKA 3PP8A 1N9GB 1UAYA 4R5MA 1HDXA 3RLFA 4YJHA 3SN6A 2H31A 3JV7A 1SQFA 2DTXA 4HWOA 3L92A 3AF6A 3RSSA 1BHO1 3VPHA 1DJPA 4IICA 3BILA 4ZOLB 5IXYA 2EJUA 2Q4TA 3IPLA 1YJ5A 5DHUA 3HKBB 1O77A 2YZKA 3O82A 2FEOA 3ACBA 3LCRA 4X20B 3DEFA 3NGMA 1OCEA 2PT7A 1CQJB 1K27A 2ZJFA 3P2KA 4DBLE 1AXEA 5FUVA 4QDZA 3V1NA 2XCUA 1FNNA 1ZUIA 2QOEA 5BYAA 4DR5B 5LDHA 4YV0A 4QSHA 3JQ8A 4G8CA 4KQCA 3FBWA 5BW5A 2QJWA 3ESZA 3IILA 4RADA 4J0CA 4RCZA 5TJHA 1XD8A 1FK8A 1V7CA 3QUSA 1BA2A 1PZMA 2JIZA 2ZRMA 1N9GA 4KIJA 4R7ZA 3L05A 4RELA 3F3SA 3BMOB 5ALKA 2EZ8A 2H9AA 2CXNA 3KKKA 3NEJA 3KE8A 1BHJA 5JXHA 3M1LA 5A03A 4WKPA 2DBRA 2HHAA 1B43A 5AHXA 3ZWPA 3Q3CA 4RTKA 4UEWA 5LKRA 3ENNA 1E1QA 3N8IA 1Q57A 3H65A 3G3EA 3HZRA 1GADO 1SZDA 5FL7D 1C0LA 2RGDA 2ZUSA 3E8XA 3SVTA 1SVIA 1QKJA 4R84A 5ED0A 5DTMA 2VOEA 3ZK7A 1IZ0A 1XP5A 2F4NA 2FE4A 1G21B 1FLNA 2YZNA 2BKUA 3KT3A 3QX9A 5AMXA 1G7CA 2EOAA 1CS0A 1J7JA 4C4PA 2YWJA 3GAFA 1NVXQ 4JASB 1LQUA 1XL1A 3I04A 3PNLA 1NMZA 1ZWLA 2QTWB 1KO8A 1XOIA 4TV8A 3PGLA 4B75A 3QFSA 3KZXA 2Q7XA 3WO1A 3ZGLA 4H17A 1LD3A 2Q2NA 2V7XA 3NCTA 3LI2A 3VZRA 5D3QA 4OBWA 1LSJA 4O4JB 5AW5A 3H2BA 1ZVVA 2HMTA 5BPHA 3STHA 2YY5A 3ZWDA 2OBXA 1WABA 1XWWA 4YAOA 4HPXB 5G3ZA 4MB2A 5LB4A 4QDKA 4HLUC 2IPNA 3EGEA 5ESRA 2DP4E 1UMDB 3AIIA 5GGXA 2O1XA 2AKAB 4JLSA 1F2TA 4KNWA 1M2KA 5B1DA 4FW8A 3EH2A 2BGGA 1FUYB 1ODLA 4F1WA 5KMGA 1FVXA 2O8FA 3F2VA 5IZ4A 4WLNA 1JYFA 1ADJA 1LDBA 5D6OA 4A82A 4DTCA 2V7WA 1UBTS 4JUAA 1NAIA 3E18A 4EG7A 4DDWA 3BXXA 1JAYA 2P3SA 4PZYA 1OVMA 4Q7EA 4UBJA 2GN0A 3GFPA 2CDNA 3M9XA 1I4WA 2CK3D 1P2TA 1V2GA 1PSDA 2R8XA 3A3YA 2ZT7A 1TT5A 3ITNA 4JY7A 4FKBA 1K7CA 3WMWA 3ZV3A 3DMRA 4QTXA 4O3MA 2QG9A 3CBGA 4TS9A 1JF8A 1V8FA 1PW7A 2CXQA 1JHYA 4YC7A 3AG5A 4BAZA 3VO2A 3GXOA 1WL8A 3RRFA 3RVMA 3IBTA 1GYPA 4OM8A 3PGKA 5THQA 2CHQA 2GT1A 1F14A 1BEUB 3PNOA 4AJNA 2JH8A 1SRRA 1YIDA 1XLTC 3GNQA 3L6EA 1LVUA 2G25A 5DPMA 3U80A 3URMA 5C34B 2OAQ1 2VA8A 1AHNA 3Q10A 4JVLA 3I5XA 3AJDA 5E0KB 2CN1A 5HCIA 3TNYA 2Q9BA 3IAM6 5IT0A 2HSZA 3ND7A 1NOJA 2I3ZA 5NLLA 5ADHA 4HNSA 2HTFA 3LE8A 3JYLA 3F67A 5DW0A 4ZYWA 2H0AA 3B6IA 2UXBB 2H07A 1C9EA 1N77A 3NWJA 2JI4A 3P8ZA 1URPA 4Z9XA 3KAKA 4J91A 4AIRA 1UFOA 1W75A 3H9CA 3TRFA 4CKCB 1PJZA 2BH2A 1CUZA 1U2PA 2HNBA 3WRXC 4IKOA 3REFA 3ZTYA 4IQ4A 3R09A 4U39A 3U4GA 4YCBA 3W4JA 5LP6F 4S1NA 1GQYA 1JWBB 3UAWA 4QXMA 3GZNB 5EPEA 1J2JA 3EJWA 4MYHA 10MHA 5HJEA 2BFBB 2VF4X 1U31A 3KPWA 3DBOB 4YDSA 4PQGA 4EKEA 1WRBA 1H5NA 3P2EA 4TKUA 3HRKA 1BFUA 4G4SO 4QUHA 4RABA 3M89A 1VE7A 1G59A 2V0GA 4X63A 1KAEA 3ANYB 4UXHA 4XVRA 2FSUA 3IAHA 4RYDA 4BNYA 5M29A 2Q8QA 3NM6B 3WMXA 5IUNC 4PLZA 1JEQB 1NU6A 1ZK4A 1EUQA 2XZPA 3AX6A 3PNYA 4R2HA 3T7JA 4EG3A 3MS4A 2H54A 3LUDA 1NQAO 4J16A 5BSEA 4MV7A 3N76A 4QYIA 1L0BA 4KFRA 4DCJA 3MMZA 4FS8A 4YCNA 2Z1MA 1KOJA 1S2LA 2J7PD 3HHPA 4YJFB 3T41A 4W5WA 4ZVVA 3VR6H 5AVSA 2J9GA 4PIVA 3WA6A 1ZZEA 2VPWA 2XNKA 2ETVA 1OIVA 3LMKA 5K0ZA 5KWJA 4D9KA 4FOSA 1G16A 4YYEA 3T1OA 1SUSA 2EBHX 4IOMA 1NVMB 1IY2A 5KKAA 2BJVA 2E18A 4GZ5A 4KIWA 1DKUA 2GPSA 2ZYGA 5BYBA 1DIRA 1IE3A 2WWTA 3KSAC 1MUUA 5E38A 3I6MA 2P2NA 2Z4SA 3JQGB 3K8YA 5LQAA 4BQQA 3EG9B 4KQ6A 2IZ5A 2XGMA 4PSDA 3W1WA 4B71A 1EK0A 5DGDA 1JS1X 5LZ7A 3HA7A 2VKTA 4B3TB 4O2AA 2D5BA 2PFGA 3TLGA 4K2HA 2CDRA 4MAAA 3Q7TA 3BGVA 1PZFA 4Z0PA 5CA1B 2A3RA 4I6GA 2Y2UA 4C7BA 3HU1A 5A3SA 1JVSA 1JMYA 3HYNA 3N3AC 4I50F 4I2NA 4JGIA 4KN8A 1LCIA 5HRUA 1IVSA 4CM7A 4BNLA 1EBBA 1UZMA 1P2BA 4LF7B 5HILA 4PYLA 4O4HA 3MJEA 1KHHA 4CQMA 1XCGB 1VA5A 4MAMA 1NXXA 1KJNA 2BUCA 2PGNA 4U63A 5F51A 3W3AD 3N9IA 4F3RA 1J0EA 1DEOA 4D9FA 3F46A 1V4NA 1XZNA 5KYWA 3WGIA 1DADA 3KUKA 3QE9Y 1E7WA 1XD2A 3MC1A 4ND3A 1LSUA 1NZDA 2WUEA 2ZYRA 4CLRB 2WLTA 1NOKA 5IDXA 4OU5A 3LIPA 3QXHA 4FZ3A 2EWVA 5BRAA 2H08A 2YR0A 1DIBA 3V2IA 1CERA 4XEHA 4QOHA 4YUZA 1LLFA 2FHSA 3D3KA 1DGQA 4OYYA 2XMSA 1WXGA 5GJBA 3ZGOA 2A1UA 4M76B 1LBEA 3EXFB 3LGSA 4MRMB 4AB1A 1ZEJA 4CCAA 1OX4B 1B0ZA 1GQOA 2FZCA 1C8LA 3DZ8A 3Q5GA 4P4TA 4CODB 5LJIA 5TXGA 2ZJ4A 3Q8KA 1EG2A 3NGLA 1Z45A 3NPMA 3I8XA 3FAZA 4E2YA 3LG2A 3WSVA 2JZNA 2Q07A 4LDQA 1U04A 2BTOA 5IAEA 3ZEIA 3U7FB 1HQKA 5TGTA 3KZNA 2C8KA 3W90A 5KB3A 4NFHA 2QXUA 5CFLA 1GVNB 2GO1A 3TGPA 4WSOA 3W5VA 5DFAA 1RJGA 2XR1A 5BWLA 1F6WA 1BWQA 2D1QA 4U8GA 2IXTA 3JR7A 1IVYA 4JEIA 3I6YA 3NYRA 3EXHB 5K0TA 3ESRA 4WOKA 4AXBA 5LQUA 1RYNA 2R8YA 2WTAA 1FTWA 2NSLA 4WDRA 4IWXA 2P0YA 3L77A 2XMQA 3GHHA 3Q7RA 2Q7OE 3FVVA 3WBBA 5FIUA 1E5DA 2I6FA 2Z2IA 3DF7A 3DTVB 4KQKA 1YZHA 2OD2A 2RHRA 3EFOA 4MV9A 5JMTA 1NX9A 2QPTA 2VEDA 4EKDA 5FNVA 2FN4A 3RIXA 5E4FA 2QX9A 5JRJA 5GOTA 4KE7A 4UTOA 4CKXA 4CCYA 4IMJB 3LC7O 4C6TA 2DXIA 3NP9A 1EK2A 2JLWA 2WJ6A 5KNCH 1E3SA 1YKSA 2QRVA 4Z3DA 5ICCA 1A98A 1PS8A 3M33A 3GVHA 2EBFX 5A5DA 1NUUA 1HSOA 2VTVA 1N5KA 1U0GA 2VJAA 4EWLA 4LVOA 2IQ5A 2QNRA 2RGXA 1VHJA 4K87A 4HH1A 1I6KA 1KRWA 3F49S 3WLNA 1HA3A 4GG1A 1J99A 2GEVA 1S9HA 3FKQA 4Q6WA 2HWKA 2SKDA 3H2KA 4Z9FA 2YHUA 3U81A 2IW3A 4DL9A 4KACA 4KWHA 5CEFA 2F4VB 3QQPA 4QLAA 4TLCA 3LQQA 3QIAA 3P2OA 2FCRA 3A04A 1D0VA 5LLTA 2XKBA 2KW5A 2NO5A 1HF3A 3FTDA 1JQ5A 3H2IA 1J21A 2PH3A 3KZKA 5EUBA 4ZVUA 3WQRA 5T41A 3AVPA 4OOEA 4GPEA 1V16A 1A2KC 2B82A 2WWWA 2FXVA 4J6FA 2BMEA 3QG5A 4M1MA 1L5NA 3H0EA 4Q3NA 3TZBA 1NLUA 1XD2B 1I6LA 1U1CA 3O38A 4ZVSA 3S0JA 3OOHA 1JQDA 3TLXA 1U7OA 4MWZA 4N47A 5K7SA 3NTVA 3UMSA 1DJMA 1F2UA 3K7EA 4Q7KA 2BMJA 4UCQA 1C1YA 4BO2A 1ACLA 3D4IA 4X1KA 1QBKC 5AM0A 3AHEA 2FA9A 3D1VA 3GLHB 1KMHB 4EHIA 3Q3HA 4DBZA 5JANA 5J23A 1ZLYA 4NJEA 5JPCA 1CY7A 3I6ZA 2IE0A 3O8CA 2GBGA 4KHZA 4J75A 2ZTLA 5EE0A 5IUJC 2V7QD 2AB0A 4FTWA 1KAOA 1H8HD 4I55A 1ESNA 4O2AF 1A8HA 2XTJA 4DRZA 1KZ1A 4BMOB 1YZGA 3NO4A 2CHEA 1AGXA 2A30A 4KPGA 1G6Q1 2H4JA 3UGKA 5LWQA 3KXLA 4TL6A 4DDUA 2JBHA 1AHPA 2AXQA 5AVVA 4B7XA 2NVUB 1GTZA 4XYEA 3IEMA 3UNXA 4XW2A 1BGWA 4FMCB 2W93A 4Q1CA 4RVOA 5IABA 1Y1QA 3WC4A 2G71A 1BO6A 1YZKA 4G5QA 4RXMA 2ZS9A 4EKGA 4L8WB 5BR7A 4IH1A 5LXTF 5K8VA 1SRQA 5CFNA 3HB9A 4DJTA 5AW1A 3GMSA 5B3JA 5ITVA 3GH1A 4UFPA 1J42A 3F2IA 1EE9A 1HFEL 2HPAA 1N92A 5JNRA 1GZUA 2C88A 2YVAA 2NGRA 4B3GA 4RK1A 4EQ6A 3GARA 3SS9X 2PH7A 1RYBA 3A32A 2XDAA 3IEUA 1TNDA 2ET6A 3JARA 1QPBA 3T8YA 5K99A 3LA6A 3H9JA 2GN9A 3ETEA 4PYKA 3D4NA 4UQOA 3WJ2A 3RODA 4IXMA 3T06B 4NBTA 2V45A 4NG4A 4B3CA 1RXEA 4XWKA 1Q7GA 1CR2A 2HWXA 2PXXA 5EFOA 1EJBA 1U5BB 4BRWA 4WI1A 4B73A 4PSAA 4DDKA 4R81A 3H5NA 1TIPA 2BCEA 4R1OA 4RK5A 3STYA 1X14A 3A25A 3UMVA 1I2ZA 1XZLA 3O4VA 4YRZA 5B6PA 1HY3A 1VP3A 4CF3A 3EDQA 4A2WA 2C78A 2XYPA 4XFDA 2C3YA 2VPZA 2YDXA 4LJ9A 3RQIA 4DRXB 1S2DA 1V0JA 4MVJH 3NALA 2JKVA 2G5CA 3R6WA 4D3YA 2OBBA 3IOBA 3ZI7A 3PEEA 1Y5RA 4UE6A 1GKKA 3IVCA 4A5OA 4M7WA 4RD3A 3UMGA 1B8VA 2INGX 1DHRA 1HYEA 2HGZA 4D41A 1B6SA 2AOUA 3T9BA 3L7IA 1RMTA 3TRKA 3ZOZA 4RH3A 5CVTA 1JA1A 5CRIA 2P2DA 2ZJ6A 1G20A 2LCIA 3HYSA 4X92A 4ALMA 3OU6A 4WN3A 3WGVA 4HX5A 1P2DA 2PSHA 4BU0A 4EHDA 1XU9A 4FQ5A 1NN0A 5DASA 3ZPXA 3GLKA 1ZVKA 1WLSA 2ZI3A 3KVRA 4XDZA 3ZY2A 2GYYA 1M6EX 4PICA 1UZAA 1HGXA 1OV6A 2I55A 3AESA 1K68A 3CW9A 4Z1OA 3EAGA 2QXYA 3I0ZA 4Q0MA 5JJ5A 4KR2A 2HF8A 1XZIA 9GPBA 2HCTA 1AQIA 1R6BX 2PX3A 1BAPA 3RC1A 3QWFA 2BDUA 5KHLB 4EPTA 1ORDA 5TQ2A 2D5LA 1ZBDA 4LDRA 1ZD5A 3NKLA 4P5DA 4D6YA 1ESCA 4WA7A 1MRNA 1WMDA 1VTKA 1ZXLA 5CBPB 3PC3A 1Q83A 3L7BA 4OHPA 3P1JA 5DCYA 3EE6A 2A0UA 2CFSA 3C14C 4PZCA 5IBQA 1O6GA 4EABA 1YRLA 4HPJB 3DOOA 4UASA 1RLOA 3E84A 5G0VA 2NV2B 2I54A 3U9TA 3WTCA 1Z29A 5IH7A 2PUEA 5C8DA 2E1PA 4G0VA 3F9RA 2UVPA 1A7JA 2O6LA 2B4KA 4FYMA 3Q72A 4G1UC 1JIKA 1S7GA 1QMPA 1WVGA 2GK3A 1J0BA 3C1UA 2FR8C 3CRNA 2Y99A 4HV4A 3FKJA 4OAQA 5JISA 5C5CA 2IK8A 3KEGA 1NLMA 4KVZA 3WIEA 1CIJA 4AIIA 4GO1A 4JENA 1CS0B 2QTLA 4XQEA 1B2RA 4WDQA 2J87A 4FFMA 3VH3A 1AQUA 4H18A 3ZU5A 3OAAD 1F20A 1P5JA 4YMUA 5KOIA 1A1VA 1QF6A 5L4NA 4KTTE 1ECBA 2FPMA 1DPFA 4B8WA 3AT1A 5H68A 3ZCTA 2CVQA 3BF8A 5K8UA 5EKUA 3QEMA 1GCOA 1Q1AA 3PV0A 3NR2A 2TECE 3OLQA 3OP4A 3TG8A 4P3OA 1G2PA 4FYIA 4Z9BA 4MUIA 1K1EA 1Q1QA 1EA5A 2XMRA 3VMMA 3OU2A 4NMLA 4URUR 4ZYLA 2HJRA 5AJTA 4HLDA 5EIHA 1H6AA 1K5PA 4EH1A 4A0FA 3NAGA 4XARA 1E4EB 1SGWA 1U8FO 1ZN2A 3A1CA 3U7GA 1VFNA 1ZCZA 3VZPA 4F9TA 4UUPA 3LBNA 5AH0A 1YCHA 4K6MA 3A9SA 3H1FA 1MJ5A 2AVNA 2LRHA 2NPFA 3MIZA 4F11A 1U5AA 1YF3A 3HHEA 2ONZA 2PGAA 3H42B 1Y80A 4TMYA 2FGJA 4P2BA 4RV5A 4UUAA 1PRYA 3S99A 3WQSB 4YMTA 1DIAA 1MTZA 2WINI 1K6XA 3PCRB 1S0UA 2PYZA 1HKUA 4Q00A 2VTEA 3HJBA 4L1KA 1B00A 1HEIA 4NKRA 1EE2A 3E22B 3ENWA 3IESA 3LP6A 4L4RA 3IP7A 3R0IA 4MWOA 1TZBA 3JQ6A 4RD6A 1W9HA 4X7BA 5EUMA 3I42A 1JPUA 2WHEA 4QLBA 1NVWQ 2PTHA 2XWJI 5IUKC 1OPXA 4NEQA 4C7VA 2VDWB 1HTWA 3UT0A 2I8AA 4JJ7A 2YFYA 4FZ5A 4ZVLA 4FJ0A 4XVCA 2V6MA 1SWVA 3MJ4A 4KQHA 1KZ4A 4ND5A 4BMSA 3NVKI 1MPTA 1REQA 2EL7A 2P5TB 1ZI6A 4M4SA 4NOLA 5CCBA 2B30A 3N74A 4JDPA 4MDEA 4NMXB 3F3KA 4FS3A 4P4NA 5A3JA 1K08A 2R25B 1WHSB 2JFFA 3KPVA 3OEYA 4KSCA 5JCOA 3TKYA 2W8BB 3R4VA 3S8YA 3R3UA 2H4ZA 3PUZA 4ZRNA 1C4OA 1M6VA 3NNDA 4J0HA 4CV1A 1IRIA 5FTMA 1VMKA 2YMLA 2FUEA 3HBAA 2JEZA 2VYQA 5I9MA 5K4HA 4ALLA 4LE1A 1HC7A 1YFZA 5BUZA 3AEXA 1DAEA 5KOHA 2LIVA 4ITVA 3PJFA 1GT91 4MKZA 1FDWA 1BFKA 3EFHA 1ZSVA 4JFAA 3DMDA 4Y2VA 4DDTA 5CURA 1ZI9A 3TL6A 2QD2A 4BX9A 1GTSA 2WE8A 2FUNB 1JBEA 3I34X 4PXYA 2V7EA 5JD5A 1PFYA 4DMUB 1E1MA 1XK7A 3PXAA 4LFBB 6ADHA 2H1RA 3X2EA 3HK2A 2E9SA 4WVFA 1PQYA 3JTMA 3SX0A 2AG5A 4RHYA 3CVUA 2AZMA 3KT0A 4PX9A 3IUQA 2DECA 2Y0PA 4DM3A 3PC2A 1E2HA 1U5CA 2ZSJA 3AZOA 4HK4A 2D13A 1JKMA 1O54A 1Y81A 1XDDA 5DOVA 2XBLA 1EQAA 2Y76A 4Y2PA 4NECA 4AMZA 4ZTZB 3JSXA 4MWCA 1G1AA 1UPBA 4FHGA 4GI3A 1TUBA 4J0IA 4P34A 3AEUA 5JC1A 2XQKA 2ECPA 4HTFB 4M0MA 5KX5A 3CLSC 1QRSA 5LUBA 3D8UA 3PNBA 4W63A 4EB0A 4YT5A 2I4LA 1L6IA 2ZSDA 5BSWA 4OJQA 5B4VA 3LLCA 2D4HA 2FLKA 1MAHA 3DAYA 3JS5A 1C3OB 1ZNWA 4IGAA 4RIHA 2I2DA 3AB8A 3DGEC 4MS1A 1YFJA 5IU6A 1R5BA 4B8YA 1I0IA 4XWOA 5CW2A 2IEYA 1A9YA 3ER6A 3R3WA 3KDPA 4RKFA 3R9KA 2WWIA 1JFFA 1IZYA 1GOTA 1RWNA 3E9YA 4BLWA 4ZJZA 1L4BA 2CJFA 2XHEA 4L28A 1E1RA 2BHTA 5JJCA 1CUDA 1VBMA 3AONB 2O2GA 4J1QA 3IBCA 4NYJR 3W8NA 1K75A 5F5NA 4ZGWA 1UDXA 1OWMA 2ZAOA 1YHYA 3RVQA 4NSNA 3EW9A 2WD7A 1T35A 3OLYA 4ETWA 4XX0A 2PE5A 5JZVA 1CY4A 2QN1A 4EHLA 1TADA 3I5YA 4X95A 2WJWA 3S8MA 4BXOB 1BX0A 1KAGA 3CS3A 4I9NA 2HJWA 2I78A 3SJZA 4AZ0B 1SKUA 1COZA 3RWBA 3GJ6A 1THMA 4LHYA 3F4LA 2P9CA 4LRSB 1I4EB 1E1LA 2W2LA 4E1AA 4R71A 2VCEA 2CC2A 3T9CA 3L4SO 1ZD2P 3GJ3A 4NNOA 1SC1A 4Z7OB 3ADDA 4LMAA 1ZOOA 1E1YA 1V9CA 2XE4A 5JR3A 1TLLA 2HFJA 2A9VA 2I0FA 4LYYA 2AV6A 4NBNA 2H1SA 3B5EA 3VDNB 3WHLA 2DFKB 1X77A 3N2GB 2J3DA 4ZVRA 3TPZA 4DABA 1Z36A 4MQEA 2B6NA 4A6PA 5KREA 1OH7A 4N8SA 2OVFA 3EBPA 1QHEA 4C3ZA 3D81A 4H27A 2VHXA 2A59A 1V4BA 4G84A 4C21A 4GR4A 5HOQA 4K3UA 3U1BA 1TAHA 2C7OA 4IS2A 2C5GA 3U9LA 3ZD8A 1BN7A 3V4VB 3NCHA 4JUBA 2YJ4A 4HGQA 3WGHA 3HZOA 1U3DA 2CLSA 3B12A 4PSVA 5ALTA 5ALQA 1TF7A 4D6PA 1O5OA 4BKQA 1KZGB 4NHOA 5IAOA 3BMNB 3GPCA 5ES4B 3UPTA 1Q22A 2Q1YA 1RM4A 3BK7A 3OFVA 4BVJA 4GNRA 3FW1A 4KODA 2VWHA 1NRXA 4CQMB 4RC9A 2D7DA 1J8VA 4LXXA 2P27A 5B57C 3KV3O 2G82A 3NWBA 2H2GA 1DQPA 1EM8A 3A9WA 4UVHA 4H1TA 3P9IA 4N1AA 3PFCA 4J0QA 4YP9A 1PK9A 4ZIRB 4MQEB 2A1IA 2ZJ8A 5A3QA 3WGUA 3DLPX 2BKAA 2CDBA 3AF3A 3PXUA 1DQNA 2WHYA 4GC9A 3GPBA 4RA9B 2J9XB 2FPKA 3EUFA 5L51A 1NDHA 1FPQA 3Q3JB 1WF3A 4KE8A 2B98A 4FFDA 2XW6A 3Q3EA 2JLRA 5CX1A 4QG3A 4PLPA 1BMQA 2LE0A 2FPRA 3IQFA 1NJ2A 5ALZA 2I99A 3MQ4A 2I9KA 3RTCA 4CUKA 5IASA 3ZHUA 3RUAA 1ZN7A 1N4DA 3IPAA 1DNPA 2IJGX 4LY0A 4OQPA 5FPPA 2YQ4A 1QH0A 3LNCA 2CJWB 4ANFA 1Q0SA 1VFPA 4Y7CA 4XOIA 4YV2A 1CULC 5A04A 3I1YA 1I1OA 1LC3A 3OPYA 4HFNA 4ASUD 5L53A 5CDSA 5I9IA 1ZA1A 3B1YA 4LCJA 2JCVA 3AYZB 1K4YA 4E0BA 1JKXA 1PX2A 4KH1A 4F4FA 3I92A 5HRCA 1DC8A 1CDDA 4CLDA 1CFZA 1ZWKA 3RT9A 1GZ3A 2F3QA 4F97A 1H3NA 2WRZA 3RVDA 3ZWMA 2AJ8A 3FYTA 4FW9A 2Y0DA 3V33A 4G01B 4J03A 4ZOLF 4B17A 2OAP1 1I01A 3QNWA 4FYXA 3NDIA 2JCGA 2B7LA 1B6GA 1A7KA 4YFYA 5ALVA 2HSEA 2X8JB 4R8LA 4XX1A 3BA1A 4ZOAA 3HJRA 5BNIA 1A8SA 1RVV1 1D4FA 1OD6A 1SC6A 2VJOA 2X19A 1G38A 2IZ7A 2XT0A 4JMPA 1G21E 3RBXA 2D00A 3FNFA 1N75A 1M5TA 1JHZA 2B2CA 3WP1B 4PZ9A 3WYCA 1GN9A 3PENA 4G5OA 3QV1A 2VPIA 4G5YA 1D2AA 1S7CA 4HVTA 3UMCA 5KWIA 4F1KA 2XLBA 4P86A 4EVRA 1GVHA 4YY3B 4MPDA 5DLDA 3VPSA 4XVUA 1VGVA 1UJ2A 1RI5A 5K5EA 3A4TA 5EI5A 5A0VA 1ECCA 1IJFA 2ON6A 1EJ6A 1UWLA 2H1LA 3CKMA 1UBSB 2C98A 2WKSA 3KJZA 3FZNA 1W88A 3LL4A 1G0NA 1FBTA 1Z6TA 3QIVA 4N3GA 1RXSA 4PYOA 4UM5A 3W2HA 3U5TA 3HCDA 1RP1A 3EIHA 3A2NA 3IXMA 4F8EA 3ZGYA 4L73A 1JTFA 4YRRA 1JEYA 1XDGA 3W8FA 3N6XA 5EERA 5C52B 1NLZA 1HMYA 1QONA 2QXTA 3CN9A 2QY9A 3GPDG 1X1TA 1RLIA 2Q4DA 3QUBA 1SXIA 2AWNA 3USES 1GFIA 3CX3A 1YIOA 4G5FA 1S4MA 1CP2A 3GFOA 3H75A 3A6FA 5TSDA 3NLLA 1F9AA 1OY1A 4PVDA 2ZSFA 1ZIDA 2HZ7A 3F6CA 2VXCA 3IALA 4O4HB 2PQ2A 2PYDA 5CB4B 1GPDG 4O02B 3QYAA 1D6JA 1G19A 4PZAA 3QG1A 3AMVA 4ZN6A 2Y92A 5HJ5A 2IA5A 3BFJA 4LZAA 1YVRA 5EQDA 4MRVA 2L42A 1ZCBA 4TL8A 2CV2A 2PIDA 1EH5A 2Y1FA 3TW4A 4D9NA 2ERXA 2AA3A 2QMZA 4EHHA 5AUQA 4MTCA 2RHWA 3RIMA 3ZK8A 1Y8QA 3D7SA 3MJDA 3K0FA 3ANXA 4IDCA 1HBJA 1LLQA 1KSJA 5HGJA 2JJQA 4ZT3A 1JR2A 2VLIA 3O83A 4CEHA 2IEDA 1I4LD 4NCJA 1UFQA 4P3KA 4NQZA 4YRLA 1K7SN 4NNPA 3VYTB 2WFLA 1N32B 4J7XA 3FTPA 2EJCA 5B3KA 2WF9A 1KWKA 3Q87B 4CEIA 1MZPA 1BMTA 2FUCA 5IBPA 3SC4A 1X8KA 5AKYA 2FMKA 1ZP6A 3G23A 2AKEA 5TC4A 2B0JA 4OIMA 1E94E 3E81A 2IHUA 1SHLA 3V8PA 4B9AA 2HMUA 1QOZA 3GRCA 4OFXA 5GMOA 1J70A 2IFTA 2A67A 3SBOA 3T54A 2KWIA 1F7VA 3DE7X 3IQEA 2P79A 4EAQA 3RC9A 2ATXA 2ZSHA 1U81A 2BLNA 1HTTA 1M34E 2BUBA 1C41A 1OLUA 1XTVA 1DPGA 3IQZA 1VI2A 1T8UA 3TINA 2P68A 4GOKA 4RA6B 4RMJA 1EP1B 3RSGA 3D3EA 2W6OA 3FFTA 5CDFE 1KU6A 2YFKA 4BP3A 1LDNA 1LU9A 4AZTA 4QXRA 3AHGA 1L5WA 2BL4A 2EARA 3GT0A 5EKSA 1TRKA 3V4OA 1UBMS 2O5EA 4N39A 3AY0A 3A3PA 4FIZA 8OHMA 5IAAA 2R87A 2GEBA 3KPJA 1ZM3A 3NHSA 4YONB 3GHYA 3WLEA 2Q45A 3U3OA 3R20A 3MTBA 4NCBA 5JJLA 5E3JA 3X1JA 4DTIA 2O8NA 4UNRA 1TLTA 4AJOA 3BJZA 3EMDA 2M6SA 4MW4A 4AZ3A 1K89A 1N3BA 4TUYF 1TUIA 2FF7A 3EN0A 2BEWB 1SHKA 3UWDA 3H2JA 3P9ZA 5CK4A 4Z4QA 1SZPA 3G17A 3K6SA 1CIVA 2ZR7A 4PRKA 2UU9B 3A2KA 3KDSE 5LUAA 1K7FB 3NWPA 1UQTA 3W8RA 1ZL0A 3OUUA 3QV2A 5BORA 4KR6A 1MX5A 1HT1E 4FYJA 1OBCA 2Z30A 5CT5A 5AKGA 3UO8B 7GPBA 4WGFA 2E5LB 1S3SA 1JHVA 4OHYA 4U00A 4BYMA 4C0LA 1PUJA 5BP7A 1KA9H 5JO9A 2JGDB 3WLRA 2P35A 1H1DA 1ULHA 3EGDA 2FWAA 5JEDA 2PZBA 4FYPA 2A0FA 4XEUA 1SPBS 2IYVA 3ANTA 4A8JC 4G1CA 2KQUA 5HW0A 3ETDA 4U5QA 2PMFA 1KF0A 5LLSA 3FPSA 3Q3IA 3B78A 3U3MA 3KL4A 3AFGA 2Y1XA 3FGPA 3JAMA 1HXHA 1E98A 1IG0A 1B6TA 2ECKA 1FC0A 3QW4B 5TV2A 3LW8A 4S0ZA 4BASA 2P11A 3KVVA 2YZMA 5JBNA 1LRLA 3CTMA 3N87A 3D5TA 1QG4A 9LDBA 3GGSA 5FWNA 2VP9A 1GAJA 1JR3E 2XGGA 3VGPA 3PF8A 1WEKA 1SVWA 2VG8A 4YDHB 2QUIA 1GJRA 4LRTB 4OQDA 3TE6A 1L5YA 4UATA 4PNEA 3AJEA 3FTNA 3PS9A 1YOVA 3AF1A 1CT9A 2FG7C 3IQWA 1I5RA 2HX1A 4KXQA 4LOLA 3TSOA 5CT6A 4D92A 3FCXA 5AIBA 5IM4F 1ZIXA 3T0GA 1MAWA 2HXYA 2QMEA 3ONEA 2IOYA 1RHKA 3FROA 1EVKA 3BGWA 3M81A 1MO6A 3EGCA 3H86A 3KB8A 4IHJA 1DC5A 2NTYC 1CZKA 2HNAA 2HIMA 2NZWA 3F98A 1QHHA 4Q3LA 5K3OA 3HABA 2I65A 3DG9A 2OGUA 1E5LA 1E3QA 2GWRA 2XTMA 4ZQGA 1WQ1R 4JX9A 1GPLA 3HN2A 3C24A 4UCWA 4EW6A 1R3UA 1DBVO 2JEOA 2O2ZA 1Y4AE 1YI8A 2WEKA 4OJMX 3QVMA 3SZLA 2BI8A 2QVCA 5CYFA 5BN4B 3SHTA 4E13A 1N2GA 3G5TA 3MLEA 4HDMB 4D99A 4OKIA 3K9HA 1ZUNA 1NP3A 2PU5A 2P1DA 2PQ6A 1QK4A 2OLJA 3LHIA 5F3WB 1G60A 4U7FA 3JASB 1YL6A 3G13A 3FYSA 3P97A 1A8IA 2VPTA 2CL5A 1G4UR 3PQ6A 4LOAA 5U4QA 3TX2A 4MMYB 1SOAA 1T3SA 2V7VA 3BEDA 3C6MA 3U4MA 2C0PA 3CKKA 2ZJ3A 3SZUA 2GNAA 4DY4A 1AG9A 2I33A 1CEQA 2GPWA 4LK2A 4I1SA 4R8SA 1LRJA 5E0OA 2YJ5A 1GUBA 4OP3A 2QK4A 3IV6A 1Y98A 3NBZC 4XIYA 1HDZA 1FNBA 3SSMA 2Z8YA 4W5TA 3G9XA 5L7WA 2RH5A 3GBSA 3NHMA 1CYDA 1YL7A 4OP2A 4BE4A 2CDAA 1BS1A 1GEEA 3KKNA 3E0XA 3BIWA 1IG3A 5LQDA 5BT8A 4BGDA 3C1AA 1C3OA 2HC9A 3ASZA 3BIOA 1HT2E 2EJWA 4FVTA 5HFJA 3WRYC 5IKMA 1GCUA 2PMWB 5FF9A 1IHXA 4G56A 5HTKA 1FX1A 3UC5A 5I7SA 3R6GA 4LKOA 5JCXA 4JT2A 5IFKA 2W22A 3H5OA 1ATIA 2C61A 2AFHA 3EZYA 4UQPA 4UNNA 1W36B 2OFWA 4NTZA 2HBQA 3UJ3X 4IIVA 3VDMA 5GVRA 2XCSB 4MYTA 3T1TA 3UMMA 4HH0A 4JKIA 1TO1E 1WW8A 3BIXA 1BJTA 1HLGA 3U3JA 1IXYA 3QENA 2PQ0A 3MRVA 3AF0A 3G1WA 3LPDA 4HFJA 3I2IA 3NASA 1PD1A 1TM7E 5D5PA 3HXOA 4K9LA 4RM3A 1KI4A 1F8GA 4DCNA 3V4FA 1D04A 4LF9B 4HYEA 3VR6D 4JT9A 1RKVA 3K1TA 4G09A 4C07A 1U1GA 3QWHA 5HM6A 3I3SR 4K0RA 2VXBA 3L82B 4GYJA 2VP5A 5EWJA 1SUDA 3REQA 2RI6A 1U2GC 4WFJA 4E5UA 4A1OA 1VIVA 3SYRA 1A04A 5AKKA 1TJPB 1AMNA 3QHAA 3DFKA 4XQGA 1EWRA 4GGOA 2ZPAA 1FVOA 4ONEA 3K9GA 1DU4A 2JB9A 3C3YA 4MZDA 1ILWA 1DELA 1V1RB 2C2KA 2V54A 2C96A 4M8IA 4MS3A 3DXZA 4INOA 4UHFA 2GEKA 4QYXA 5E6RB 3HNOA 3HDYA 5ERGB 4DCCA 1OLUB 2XRYA 3K16A 3JYPA 2IDMA 3NHJA 1IUNA 2GAOA 2ECOA 2WICA 5HKKA 5CFRA 2BRUC 1Y9AA 2YTZA 3ID6C 3ZE2B 4AT1A 3D0KA 4PAMA 1CVIA 4HSEA 1Z2AA 3RR2A 2ZWMA 1NI5A 3LQ1A 4PC2A 2EKZA 3ZV5A 4MYCA 2W2XA 4D81A 4KI7A 1O4VA 5JSUA 1V47A 1NBHA 4KR7A 4R2MA 1YQTA 3LW7A 2HA5A 1CUYA 2XECA 1MJNA 2AFIA 3KLMX 4C4AA 1W52X 4OMUA 5TQ0B 2GXQA 2Q6TA 2GSDA 3I4FA 4CHGA 5BUCA 5LNK1 1RQLA 1T5LA 1F3LA 1O08A 2VAXA 1T2AA 3U4DA 4TLAA 4XVHA 1R0XA 4AF7A 3FWYA 3V3TA 1GL6A 2OV3A 4FGKA 2QQEA 5LQCA 2ACEA 2YW2A 1NYQA 2GYWA 4NYMR 4X6XA 3JALB 1FP7A 1DBQA 1CNMA 1ICEA 1Y9EA 4HNAA 4NCIA 3BMCB 3UGTA 2G7MC 3GUCA 4HUQA 4EI2A 3N2EA 2AZ4A 1VPLA 3DKRA 4NYJQ 2HT1A 2JGAA 3PHCA 1R74A 2HLDD 5A2QA 1K5HA 1NBEA 3KD2A 3MJCA 2UVDA 4M86A 2PKXA 4I6EA 5CVCA 2VHEA 4QDXA 4NF2A 4KRFA 2IUYA 2YRFA 1QE5A 1LNSA 3GT3A 3SQOA 1XZFA 1XQ6A 3L0ZA 4PG4A 4QUBA 1NY5A 4II3A 4QBGB 4AUEA 1Y8ZA 3GDGA 1BMFA 3C3WA 4AVYA 3GGPA 4M53A 3WAKA 2DH6A 2DR3A 2VQ3A 2O52A 3E05A 5D01A 1EZ1A 3TLJA 3WTBA 1MPXA 4BNHA 1W44A 4D74A 4DDMA 1NGSA 1EWVA 3ZDAA 1I4TD 2X0RA 2ZBUA 3GZJA 4RPHA 4XYBA 5JXJA 4DR2B 4A36A 1F4VA 1AS3A 1SB9A 2GF0A 4C3UA 2DY0A 3I1IA 1Z2OX 4ZO8A 1ENZA 2JVKA 2EW2A 3EZ2A 2Q1TA 4OHOA 4GGPA 4MA4A 1CU1A 2BFFA 3GRYA 4O4IF 1VI6A 2NU9A 2WT9A 2P8JA 1QH1A 1XIVA 1WDWB 1NSYA 4QUDA 3SQLA 2M6KA 2HDWA 1ZD3A 2ASVA 2R8OA 4TXHA 4BJ1A 4LMRA 4DWJA 5HMLA 1KRHA 2ZWOA 3BAZA 4MUKA 5C51B 4NRDA 1AGYA 2BFOA 4B83A 2BKXA 2ZSIA 3FCUB 4YDRA 4XCVA 1VKNA 5DRTA 3NONA 5FA5A 3P2IA 4IOLA 4RLFA 4XUCA 3W5HA 4QGSA 1R8QA 5KNCD 4DIUA 2AEFA 1QM5A 3C3MA 3JQCA 4ID3A 3GU3A 3WXMA 3E5RA 2HM7A 3W2EA 5EJ7A 2BBTA 2HU8A 2F3UA 4M0PA 4WUVA 1QAOA 1T0UA 2X2EA 4O1IA 4U4AA 3T7KA 5EJEA 3BZUA 3T0FA 5KKCA 1OFVA 1L4MA 2FUG1 4IX1A 4LBYA 5DX1A 4CLRA 1M0WA 2J59A 1WMAA 2P8SA 5TQ2B 5KTPA 2AWOA 3I72A 4LUCA 1HT0A 1F8XA 1WPXA 2QJTA 2JKZA 4BV8A 1AMOA 3HUFA 4M8KA 1N3IA 9LDTA 1FIUA 2IS4A 3N7TA 4ZJPA 5ELXA 3JZIA 1R10A 2I6SA 3DQZA 3O8LA 3CUKA 1F51E 1N5RA 2E4ZA 2GR9A 4UAVA 3KTFA 3DLIA 4ESHA 1N3LA 4G1EB 4BAGA 2P6RA 2NV0A 4IDPA 4TTAA 5GM1A 3ROPA 2Q0QA 1BXKA 3KD3A 3LFUA 3MF4A 5B1IA 3MWDB 1E3IA 3WIVA 5AVOA 3RGWS 3GJSA 1IY0A 5IRCD 3NIGB 1EWKA 1AA9A 3F6SA 1Y1SA 1VIMA 3PTLA 1SD2A 2QMQA 4ZCLA 2IVZA 4XXHA 1CD5A 4JCOA 3EIFA 4ML3A 3N70A 5AM3A 3HY4A 3ICOA 4D0SA 2C5AA 2QTTA 3CNEA 1QV6A 2ICAA 5EWMB 3ZKWA 3WSWA 2GA8A 3OQHA 1BMDA 3OWHA 2BM0A 1SNYA 2AG6A 2WWXA 3BERA 3GRPA 3IMCA 3JQGA 3L8YA 3Q0IA 2BFDB 3LDAA 4L4XA 5EQTA 2AN1A 4R0VA 3TZCA 3GA5A 1MGOA 2PBRA 1GAEO 1JDPA 4HJXA 4NG5A 2AFIB 1EM6A 5DK6A 2Q5EA 1CYEA 4RXUA 4FYKA 4B6JA 3VAAA 3UQZA 1ZC3A 1JA0A 4XGIA 1S8FA 5FTKA 1T91A 3IMEA 4A6EA 4B4VA 4DT1A 2QRKA 1LWOA 1P1KA 2B9VA 2NVOA 4JP3A 4MARA 4YWHA 5EP1A 5KJCA 4L3OA 1CSEE 1NZJA 2G9UA 2XLCA 3GG2A 2X8JA 5JZMA 1FDRA 4QQNA 4C4XA 5J59A 3ET5A 2XQJA 2ODBA 4UUBA 3EQZA 4AZVA 1UBHS 1UZLA 3G6KA 1NQ5A 2MDTA 3P4YA 1LNZA 3PD1A 4L85A 2OOKA 2A5YB 3UHPA 3UUFA 4I7EA 5HG0A 1S2MA 2BF4A 5CB0A 1E8DA 1POWA 1L7QA 5LDGA 3C5EA 4REQB 4ETIA 2GVDC 2W2MA 3W77A 3IAFA 3MTJA 3R23A 2G36A 4HAVA 2GN6A 1RWWA 3PHBE 4IVNA 1OYOA 3ZHCA 2CD9A 3QXSA 3BA6A 3TIXB 3HKEA 1XQ9A 1HFJA 3GGCA 3R5HA 3ND5A 1GFZA 4E07A 4WLVA 4EHFA 1CNFA 5FA8A 2H4WA 3AHJA 3WYNA 2R0QC 2ID9A 4C22A 1H2EA 1XU4A 4EJ2A 4TZKA 2C2WA 5F52A 4DWVA 2FVXA 4RHEA 1W30A 5IJAA 2IXFA 5K51A 1NULA 2GAAA 4IX9A 3TBKA 3VPAA 3RPEA 1G55A 3ZQKA 1RDFA 2XNDD 2Y1LA 3FGZA 1NNUA 2EEPA 4QYMA 3ZE1B 1IY8A 3UV7A 4FHCA 4FC6A 2OYCA 1E3LA 4G0QA 3U6KA 2I4NA 4L6IA 3NHFA 1QLJA 2QMYA 3VFDA 3B53X 3NX4A 4ZZIA 1KMHA 3GJTA 2J6HA 4IJWA 2IPAB 1TMGE 1MOZA 2V4UA 2GS9A 4U7TB 1AKRA 2MU1A 1EXMA 1T34A 1NW8A 1MA0A 1R7RA 4CG1A 1GP2A 5AI6A 5GJVC 3EQ7A 5CTJA 4DT1B 1O4WA 3B7PA 4QC2A 4BVAA 2DPMA 2A0YA 1FDVA 5DWQA 5ES3A 1M0SA 1NRWA 3MNFA 3V7UA 1JJIA 3ZE8A 3N6RA 2R68A 3BL6A 1IWBB 5CW1A 1RHMA 1NLYA 5KTOA 2I71A 2NO9A 3B85A 3E4CA 2ZUUA 4MI9A 1DTWA 4BZZA 1T5SA 1D2NA 3WGOA 3MAGA 1CWUA 4F96A 3AILA 3CTPA 1ZUNB 3V8RA 2I1LA 2G5TA 5IZCA 3M49A 5D1HA 3OFJA 4TZ6A 2PJUA 5DHTA 1WUYA 4MV8A 1F2VA 1OAOC 3EVGA 4TSRA 4NJMB 4QM6A 5K8LA 5F1YA 1K2WA 1R16A 4GPTA 4QYSA 2J7KA 2FKNA 1G8FA 3OFNA 1XC7A 2PKQP 2CW5A 5FR2A 4ZEWA 3DZBA 4K6HA 2DOKA 2ZB7A 4CN9A 1X7XB 4QUKA 4ZQBA 2FEPA 4MMZB 3WNZA 1FRNA 1XEFA 2C83A 3MWDA 4UMEA 1TYZA 1QU2A 3JWGA 5H02A 2H5LA 4IZIA 1EDZA 1RKUA 3VR2A 1MGPA 1N2BA 3A6EA 5TS2A 4FB4A 4JBIA 3RI3A 2A9KA 2WABA 2XEDA 3ORHA 4IUCS 1S8NA 2AJDA 4PNHA 5DWDA 3GPLA 4MV4A 2JD2A 2GXAA 4L27A 5FUQA 2O2CA 5LP1A 2PZJA 2WD7B 1TIBA 3CCBA 3DTVA 2R8BA 3PUWA 1CEEA 3RFFA 2Q8PA 4QL3A 1G0OA 2RAVA 3KQUA 3CLKA 2G6BA 1T8YA 4FKMA 5G4LA 1HOTA 2CBXA 3R9IA 2J3QA 1Z25A 1H85A 2UDPA 3H9UA 5CMLA 4ZKDA 5KNCA 2HXGA 3L4BC 4UM7A 1P7CA 1UQUA 1FF9A 1MFZA 1R0BA 2FUG6 1U7PA 1JLRA 2GB4A 2PGDA 1J8YF 2IPOA 2ZK7A 3CZMA 3M1YA 3MEQA 2W6IA 3F6RA 3QLEA 3Q8WA 3GGJA 3CE9A 1RXIA 4HDKA 4JJ4A 4JNCA 3U3XA 3WO0A 2QHXA 1RQNA 2PGXA 2VJMB 1VC2A 2I6XA 2RARA 1YQ9A 1S89A 2LPMA 4ED9A 4F4JA 4DV1B 1NDUA 4A6DA 4WKGA 4OXYA 1O6FA 1TIKA 3TI9A 3EGDB 1Z0JA 1YZYA 3TVDA 1A9QA 1P77A 4D97A 4DC1A 5HTOA 4BQRA 1G2IA 3LPNA 3L0BA 3OF3A 4KTVE 5JS2A 3ICCA 4JN6B 4UUNA 5I8ZA 4BHTA 4GVXA 1J0XO 2WI8A 2R97A 2NSDA 1LPPA 3DTYA 3WBFA 2BFCB 3BTVA 4LZZA 1H66A 1J8MF 4NLLA 3Q9NA 5F9FA 4YRJA 3U26A 1OV4A 3DHYA 1AUQA 1PHPA 1TUGA 3BXZA 1U0FA 4D0RA 3K3PA 2DFLA 2BM9A 4P0QB 2OGSA 1RM0A 3HM2A 5H3LA 1Q3HA 2HA4A 4HMQA 4EFNA 3T5PA 2XMBA 3LAWA 1HDGO 1SD1A 1P4AA 2AC7A 5F5LA 5IMBA 6Q21A 3W0LB 3QF7A 3WP0A 4AY4A 2HPVA 2D1TA 1FQOA 2R1TB 4LV5B 3KYJB 3T4EA 3H18A 5EJGA 3NEPX 1PFGA 4K7JA 3ISJA 5EXXA 2HH9A 3CLRD 2HLDA