3PCXA

Caspase-3 e246a, k242a double mutant
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
250
structure length
244
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDDDMHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRAVATAFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic, enzymatic and structural effects of removing a salt bridge at the base of loop 4 in (pro)caspase-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
total genus 81
structure length 244
sequence length 250
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pcxA00
1CP3A 4FEAA 4QU9A 2C2ZA 2H4WA 3R5KA 5IAKA 3V3KA 3V55A 5K20A 2H48A 4AW9A 1PYOA 2XYHA 2QL7A 2XZTA 1GFWA 3K7EA 3P45A 1QDUA 4HQRA 2HBRA 2QL5A 4FXOA 4JQYA 1RWPA 4M9RA 4QUAA 5I9TA 3PCXA 4ZVSA 2HBYA 3EDQA 2CJXA 1NMQA 2AR9A 1RHKA 1RHMA 5IAEA 2FP3A 3R7SA 3DEKA 4IEFB 4PRYA 1QX3A 1K86A 4FGUA 4QU0A 4QU8A 3DEHA 3IBFA 3V6MA 5IABA 1GQFA 4EJFA 4EHFA 4JR1A 1M72A 2QL9A 5IAJA 3UO8B 4JJEA 2QLJA 1RWKA 2QLFA 4NBLA 2J31A 3D6HA 3KJQA 2NN3C 5I9BA 3IBCA 4EHDA 1I4EB 2HBZA 4QUDA 5IBRA 1ICEA 2FUNB 4N7MA 1KMCA 2HBQA 4JB8A 4JQZA 4ZVQA 4D3XA 1PAUA 2J30A 4AWAA 1NMSA 3V4OA 2XZDA 2H5JA 4QUIA 4I1PA 2WDPA 1RHQA 4PRZA 1F1JA 3R7NA 2K7ZA 2QLBA 3GJRA 4HQ0A 4EHHA 2H65A 3H11B 4ZVRA 1SHLA 2Y0BA 3QNWA 4NOMA 2H51A 3PD0A 2XYPA 4N6OA 3SIRA 2H54A 4AWBA 4N5DA 1CVRA 4JR0A 4QUJA 5LUAA 2Y1LA 4N6NA 5IC6A 4FDLA 4QTYA 3S70A 3S8EA 5IAGA 1JXQA 3P4UA 4EHAA 1RWWA 3H11A 3OD5A 1RHRA 2XYGA 3D6FA 2CNLA 4QTXA 4EHLA 3GJQA 1RWVA 4IYRA 4DCOA 4DCPA 3E4CA 1K88A 4JJ8A 4LSZA 1RE1A 1RWXA 4ZVPA 3H13A 4QUEA 4JJ7A 1RHJA 4NOJA 5IBPA 4QUBA 3KJFA 2CNKA 4QUGA 4QULA 2H5IA 4N7JA 1RWMA 3H0EA 4JR2A 3NKFA 4NOKA 4D3YA 2CNNA 5IARA 4PS1A 4EHKA 3ITNA 4D3ZA 5IANA 5LUBA 5LU9A 3NR2A 4ZVUA 3H1PA 1F9EA 1I4OA 3V6LA 5IBCA 3GJSA 3GJTA 3PD1A 5IASA 2FQQA 3DEJA 2C2OA 2J33A 1RWNA 3R6GA 4EHNA 3KJNA 2CNOA 4HVAA 3DEIA 3NS7A 4QU5A 1BMQA 2J32A 2P2CA 5JFTA 1SC3A 4ZVOA 3R6LA 4N6GA 3UOAB 1RHUA 5IC4A 1NMEA 2H4YA 1I3OA 1IBCA 4ZVTA 4NOLA 1RWOA 4I1RA 3R7BA 4DCJA 4NBNA 5LU8A 1QTNA 3RJMA 1SC4A 2DKOA 2C1EA 1SHJA 2C2KA 3R5JA 4PS0A 4QUHA 3V4LA 1SC1A 3SIPA 1NW9B 1I51A 5H0IA 3D6MA 3BIJA 3EDRA 4NBKA 2C2MA 2CJYA 2CDRA
chains in the Genus database with same CATH superfamily
3JYPA 3O4FA 2WI8A 3OM1A 2HPAA 1IBSA 2Z8ZA 3AERB 4KO1S 1RYBA 2FNAA 2RONA 4EB3A 1OLUA 1M1NA 5LR6A 1NUUA 2HT6A 2D2VA 4X91A 5FAXA 2RBGA 1KMQA 1IUPA 3DLAA 3GRVA 2RGYA 3EN0A 3UXEA 1RHKA 2WJGA 2IXTA 4MWBA 1X3SA 3I6YA 621PA 1T6XA 4GLBA 4LPKA 4KRXA 3IBFA 3W3AD 5BSRA 4CTOA 4HDKA 2PHZA 3O21A 2HZBA 2QY9A 2VF5X 4L8LA 3MGGA 1MB4A 1U0HC 5F3RA 3SYLA 2V96A 3S6JA 2P6RA 2C20A 1I7QB 4H3VA 2LCFA 1Z74A 3NGMA 5MN5A 2WZQA 1HNNA 4HYTA 4MKXA 3I58A 4UHCA 3ZHBA 4D3DA 1M34E 1L7QA 4UDNA 2ATEA 2J3MA 2MSKA 3FKJA 4DA0A 5EWJB 4X84A 1EFPA 1E5TA 2OCBA 3MINA 3BGVA 3R40A 2D2EA 1LTKA 3EXHC 3C1TA 2VJBA 1QH9A 4LXYA 2QTHA 1P7ZA 1TPYA 2ZB3A 3FTFA 1KSGA 3W9YA 1NOKA 2YJ5A 4DAOA 3O4HA 2V58A 2IEYA 4LZNA 2QX8A 3Q88A 4TXNA 3FNEA 5FOVA 2DYKA 4JL6A 5AJWA 1I6LA 1NUPA 2IWRA 2FP4A 4X6LA 3K05A 5AM3A 1QH1B 1KYYA 1YS1X 2D13A 2DKNA 2QJOA 1LDNA 4X6YA 2D74A 3VOBA 3WWZA 4BB5A 3JWPA 4EEKA 2C0QA 3ZYCA 1P4JA 3C8DA 3U1VA 9LDBA 2W4MA 1ZXLA 2IOFA 3Q3HA 2MR6A 4I81A 4PONA 4UUAA 5AH0A 5HW0A 1ZIYA 5ITVA 3KDSE 1K75A 1E3DA 2JI8A 3AY0A 3C3JA 3I5MA 1LDEA 1IN4A 1B2RA 1JAIA 3AFOA 3GW8A 3A1WA 3GUHA 4PQYA 2OPHA 4N8EA 3FUVA 2IIQA 3HV2A 3OEHD 4TKVB 1JWAB 1SKAA 3DMGA 4UCQA 2ZPAA 1DKLA 2ZI9A 3WGIA 1UBKS 2O14A 5HP4A 5DV9A 2QR3A 4RDIA 2OV3A 4R1PA 1W44A 5BN1A 1ORDA 4FFMA 3ER8A 2AOWA 2P78A 4RCYA 1A8HA 1RRFA 3DE2X 2PX8A 4QFBA 1MT3A 3I0NA 1R1DA 3LBHA 3MS4A 4BVLA 5LP6B 4I14A 3JVIA 4C03A 5GIOE 9LDTA 1PLKA 2V97A 2YJ6A 3IRVA 1MT0A 2FF7A 4L16A 2HT1A 1K6JA 3GPDG 3GP5A 5IULC 1EWRA 1J9EA 1YBVA 1RPAA 3D3WA 2HJRA 1V8PA 5IUKC 5C46F 5AVQA 3WL6A 2Q2NA 2GVNA 2F1OA 1BXGA 2J4DA 3C74A 3CMCO 2PS9A 2Q5LA 4ZQGA 4W6ZA 2H85A 4W7HA 1RXSA 1XHEA 2JIZA 4OQFA 4WJLA 2MDTA 4AX8A 1KBQA 2B7LA 4AZTA 4CRWB 1H9BA 1TMYA 1XALA 4EQ6B 3FOCA 1M2HA 1NUQA 1QTNA 5KAPA 3TIVA 1KVTA 4O4LF 1EK1A 4P8RA 4YCMA 3MRXA 3RC3A 3PENA 3ZHRA 1RAFA 1TZKA 3UJPA 3WLEA 2GCGA 3JQRA 4GF5A 5AKJA 5CVTA 3M9LA 3VPHA 1U0NA 2AVDA 3PQDA 1XTSA 3FKSA 4F9TA 4UZFA 5E1BA 3SF0A 2DKFA 4N49A 5IAKA 5JLJA 2OM6A 4HB4A 3FVTA 4B6JA 4B32A 4DW8A 2GA9A 1ORIA 2N1BA 5E2BA 1HRKA 1KDVA 2YS6A 3AYXB 4UEQA 3TSYA 4N54A 1NQXA 2RHWA 2OG1A 3JD3A 3L0PA 1C3OA 5CIWA 2H2GA 2R79A 5EC8A 2A14A 2YV3A 5LXTF 4RZUA 3RI3A 3CJTA 3ZDYB 3RM3A 4KVZA 4QD3A 4Y2PA 3RFFA 1S3GA 2IP1A 4MGYR 2VF7A 4IIJF 1TJ5A 1XU4A 3EY9A 1EQAA 4GX5A 5KWJA 4NSNA 3HCNA 5FTKA 4PPFA 3WLHA 3F78A 8AT1A 3PLRA 4L6IA 3BH0A 4WNAA 3DJFA 1YTLA 3WOHA 1M6VA 3N53A 3UCFA 2VAXA 4FNOA 2Q49A 5FL7D 1Z0UA 2YOHA 4NZOA 4N5HX 3GH1A 1HDIA 3HJTA 2EARA 2FSVA 3H5VA 2IYYA 4KZPA 1HM5A 2BKEA 4WADA 3P9YA 4JELA 2ZRDA 3AHHA 1VYUA 2IKSA 3D7MA 1OWOA 4MW7A 3RE1A 2FHSA 3HCRA 3HJHA 5HG0A 1QB8A 3WFZA 1EK2A 1NJGA 3FXAA 1SOVA 2WSIA 3CE9A 5AXAA 1G38A 1WHTA 2YDYA 1KHTA 3EBLA 2GRUA 3G2PA 1E8NA 4U6NA 4EKYA 1NUHA 2H51A 2YQZA 2OXEA 3K2IA 3HO8A 2HHLA 5C80A 1CF4A 4K9KA 4E07A 2O1WA 2A0KA 1W0CA 2DQYA 4AS1A 4N6NA 3EOZA 2PANA 2UZ3A 3BDIA 3QKUA 4OLJA 2UYHA 3NAMA 4RK5A 5HVNA 1RWWA 5B1EA 4G9BA 1W36B 4TRMA 3S2ZA 1SPBS 1WKVA 4IUCS 1S8FA 1EP1B 1UBOS 3QVMA 4ZI3A 5GJBA 3GT3A 1NTOA 3S68A 2GD6A 2D7CA 1Y37A 3K92A 1WOYA 1FDRA 3MCTA 5IMBA 3CM0A 4D0LB 3FTQA 4QRIA 5DHFA 4KH0A 3VR3A 3WZLA 5KYYB 4AY4A 1LB1B 2JL1A 2Q3LA 2VAVA 2H5IA 2Z30A 4LF4B 4TVSA 2VNAA 2WJAA 3I9OA 2JB9A 4W82A 2OSVA 4B3MB 1XQXA 4MYUA 1UT5A 3AINA 2Q6IA 5GADl 4XJVA 5C37A 1XRMA 2V4MA 4BQOA 4RMGA 2ZETA 1BE6A 1W30A 2GM5A 4UUQA 4XGNA 1DIBA 2IYEA 1C1XB 2Z5LA 4RABA 1GIAA 4QOFA 1NVMB 1JHRA 1RBQA 1UC5B 1R27A 2CNOA 4K9DA 2QMZA 2HMUA 3SPXA 2BLNA 2JAXA 2LDXA 3LY9A 1H8HD 2UV8A 3R7LA 3AL3A 4P4GA 1SIOA 2AKAB 2Q41A 3VZBA 4QLAA 4YDHB 1AZSC 1N3LA 1P6UA 4FFPA 1RAGA 2ZYIA 2C4TA 4LDJA 3HLTA 4YAOA 4ZKEA 3A2NA 1L9XA 3L06A 3VR6H 3V8EA 2ID8A 4ZCMA 4ARIA 3HKCB 4M9CA 4QTUB 2ZI6A 1S02A 3AP3A 5JD4A 1CTQA 4PAWA 4Q24A 4TYPA 1ITZA 2PJZA 5LOVF 1ZY2A 5A5FA 1Z0SA 2W93A 3ED1A 4XPIA 3L6BA 2VUTA 2HM7A 1GSOA 2GXQA 3FIUA 1MJ5A 4R2JA 1QWSA 3HDJA 3MQFA 5IZCA 2IDJA 1P1BA 3DMTC 3JSAA 1GL6A 3T9EA 1SN7A 3WL4A 2Z2YA 3LUPA 2P1ZA 4P3KA 3IBSA 5E6SB 2PH7A 4V0QA 1OFGA 2ORWA 5AOVA 4YRZA 4KITB 2JD0A 3K5IA 4YPVA 2XWSA 1G64A 5AOCA 1S3FA 2ATCA 3HVJA 5EAIA 5P21A 3RU9A 4LVUA 4F4IA 1E9CA 1C3LA 2KM1A 2H1LA 2ZAOA 3R7SA 3FSEA 1FFEA 5JAHA 5JAZA 2DZDA 4X92A 5KTMA 3PXUA 3B12A 3QU7A 4H35A 4AJLA 3BA1A 1DWQA 2J7PA 2JI7A 2XWPA 5JXIA 4B2IA 5BWOA 4HDNB 4RTMA 3E22A 4FLFA 3AH8A 5F51A 3RUIA 4K9NA 1GR0A 4JEHA 2Q0XA 4BNTA 3STXA 4DLZA 2VPYA 3PNQA 3J7TA 1WMFA 1B43A 1P62B 2NYUA 3MUOA 3L40A 2ACVA 3RVLA 1Y89A 4WOCA 4MEAA 3E3OA 4PYRA 5AVZA 5KHOC 3V48A 2P9GA 3EXIA 4FBGA 1BDIA 1TJYA 5BXQC 3FR8A 4KSBA 2YWDA 2ES4A 5L3ZA 4X6XA 3QPAA 1VIVA 3KZMA 5J4HA 3S5JA 1N36B 4MVYA 3HBFA 1Z8DA 5K3AA 3I01A 1XXHB 1RQXA 2ID9A 3MTBA 1NF8A 5A4IS 1J1ZA 1KOFA 2YHSA 2JFZA 4EKNB 5C3UA 4R8KA 1AN0A 4ETNA 1MX3A 1XFDA 2GGSA 3GJ4A 3JVUA 2OFOA 3CX7A 1JA9A 2VQEB 1F4PA 3DOOA 3UK7A 4UASA 2HLNA 2CLOB 2GNAA 1XTZA 4EVSA 5GZ3A 3GGCA 2R7MA 4WRRA 3PC6A 2R4UA 4FU0A 2IYXA 2VCYA 3L8FA 4FYMA 3A9CA 5FI5A 5JI2E 5U9CA 1E3MA 1YDFA 5G1PA 3RVRA 1AG9A 1V1JA 3GEMA 1N0UA 4AQ7A 3BK7A 1NLUA 3PDHA 4FIZA 2FZLA 3O1LA 3ZJYA 3VNSA 2JGEA 4TWZA 1HL3A 3WGVA 1ISSA 1BYUA 5HTKA 1TYAE 1L7EA 3X2FA 3LNTA 3QXCA 3PYLA 4MKZA 4RS4A 1N2CA 2H8GA 4YWJA 3SJAA 3UMVA 1KL7A 3VOTA 3ZCUA 4F0JA 4RHXA 3WLIA 3UTCA 2EFGA 5B55A 1E2UA 3OZWA 3Q1KA 3UT6A 1MAWA 4PPGA 1L5FA 1DEHA 2GM9A 1JAYA 5LPNA 2Q1SA 3UA4A 2GZ3A 3WDKA 2B3TA 4ARZA 1BTOA 1PKXA 5IJ9B 1H23A 3HZRA 1QRUA 2BSQA 1VL6A 2IELA 3BEDA 2FW1A 2DLCX 3V2GA 4C6TA 2EX0A 1KIMA 3PC4A 4LHVA 5IJ0B 1P44A 4YK7A 1N33B 1QGZA 3PKIA 5KHAA 3WYGA 3A58B 1U1DA 1RYHA 5IK2D 3HG7A 1ZM2A 3MERA 3O8QA 4TUYF 3ZLVA 4D79A 5HKBA 3S1SA 1JSCA 2IUEA 4ALLA 4YT2A 4QBKA 1U3FA 3L04A 2Y9PB 1XDGA 1KGDA 5HFAA 2OHVA 3GBPA 3QVKA 4RKQA 3GNLA 4A2PA 5CXQA 2NSLA 3SG0A 1KDPA 2LR0A 5DPMA 5KNCH 1T5OA 2ZTMA 2IPMA 4MXDA 3MB5A 1Y6FA 1L4HA 4XJTA 3GHYA 3ASZA 1AV7A 2YINC 3HA2A 3NHRA 3HNOA 4W99A 3RR2A 4UAUA 1U04A 4XEUA 3WBJA 4B0OA 4EEZA 4TLBA 1H8EA 2HJ9A 3M9WA 4GM4A 4QEKA 1KMMA 4TL7A 3NGXA 3F7NA 4PSKA 2Q5QA 4AO6A 3HL4A 4ATNA 1GCOA 3T4XA 1PT8A 1NG1A 2CF6A 2W6PA 1UC9A 4KQ9A 4FS3A 2A0FA 1ZD9A 1OWMA 2PGJA 2PKQP 3MYYA 1MJNA 5CFMA 1E6LA 5K2OA 2VN8A 3LD9A 1ZD3A 1HURA 1UFQA 2C8VA 4EHDA 1V5IA 2FMUA 3G49A 4JL8A 1F48A 1USVA 3AETA 3F6BX 4FJ0A 4ZARA 3VPGA 3FWZA 5GVRA 2F9LA 1V8DA 1OXXK 2CBXA 4ALJA 3UWMA 3G9ZA 3GHHA 1GT91 1Z0DA 4RD2A 1SHZA 3OIWA 1CB0A 1RQGA 1KGSA 4FCTA 1F51E 2JVJA 4FWIB 4LDAA 4OXKA 4GPAA 3IAS6 4FEYA 4ZCQA 2A33A 2HL6A 1TCCA 2WZBA 2BHLA 5DCYA 5TPZA 1L4YA 1CZHA 1NW6A 2CD9A 2Q1XA 2R6AA 3CYFA 4OBEA 3WWEA 5EPEA 1SC6A 5H3CA 2PMCA 4YUYA 1VPVA 1IVNA 1ZW6A 2JFFA 3EYWA 4PFQA 3R5TA 2HA7A 3V1TC 3ACBA 1DAPA 4OP1A 2FN3A 4ZAWA 3K1ZA 4ZZ3A 1GZ7A 1D2NA 3GB9A 3OC6A 1D5CA 2YZ2A 1OHHD 1T0BA 3LPDA 2AI2A 5BW5A 1X77A 1F8XA 3EC7A 2QD5A 5JJBA 2PLRA 1YMUA 3U17A 3HA7A 3VNQA 1NVWQ 2ZXEA 4B1FA 2I3AA 4FQ5A 1XA4A 4G5YA 4KIWA 3G89A 4WI1A 3TLAA 5A0TA 4WZAE 4I4LA 1IQUA 4JCCA 3DOCA 1DT5A 1VG9B 3NBXX 3ABZA 5GONF 4C0HA 3JQDA 2VHEA 5ISMA 4HNSA 1IB6A 1K8XB 2L0XA 4RBNA 3KAJA 1QHYA 3CV3A 3UCEA 5JSZB 4N3BA 3L5OA 1P5FA 3B1VA 3I8SA 1XQVA 2I3BA 3SYNA 3ZLBA 3C15C 1WP9A 5JANA 1L4GA 2DSTA 1BVUA 2XB4A 4UNIA 1VA4A 1ZGCA 2X41A 4D45A 1P73A 1AKMA 3ACCA 4ZAVA 5TJHA 1SVLA 2WYVA 4BGIA 1T3ZA 3DCNA 4C14A 4EI9A 2BDEA 4KNVA 5IBCA 1R9NA 4URXR 5JZ9A 1P75A 2PZJA 2K6GA 5I7FA 1GPJA 4HNVA 1Y5MA 4A10A 3RYIB 5CD9A 1FDVA 5CH3A 1V43A 3W8EA 3TE6A 5DJ5A 4UVDA 3VNRA 2AYZA 1FYEA 1BU8A 3JCZA 2BFBB 2D2FA 1LC3A 2VDKB 4GBMA 1GHTA 2BHSA 4N6GA 3GGOA 3WADA 2CCKA 1U28A 1M3SA 1PDVA 1U0GA 3EISA 4OH7A 3O95A 5EWMB 4UHHA 1BW9B 1Q0RA 1V71A 2RHJA 3LT5A 3NX4A 4JLBA 1SG0A 4RK7A 4OI2A 3K6KA 2ZIUB 1SCDA 4QBIA 5LIRA 2UZ1A 1VCMA 1WPQA 2NG1A 2A3RA 2BM0A 3H2GA 1J2JA 1H69A 1PU2A 1RS0A 4FMCF 3M89A 2WIJA 2E4VA 3CURA 2JAHA 3W7AA 4DGQA 4JJKA 1QFZA 1DKRA 4CL0A 4Q4AB 4Q3DA 1Y1TA 3M1IA 2X1LA 4WN9B 1A9XA 3WHLA 3L1UA 4D56A 1GZ6A 4ECAA 2GETA 1G16A 2H7CA 2X3YA 1T9ZA 2XKJE 3G3EA 4EGFA 4YMHA 1UPBA 5KS2A 2XR1A 3EWIA 3R6DA 1DKNA 5EKXA 2B7BA 2H7VA 3H6HA 4E4YA 1Y7TA 4PXYA 4GDMA 2AJLI 2OV6A 4KXWA 4WY2A 3T7EA 3VHXA 4XVRA 4W1QA 1NULA 1RQRA 4R9NA 4URVR 4NC9A 2C5LA 5EJGA 1I8TA 3IEMA 4JXKA 3TLGB 4CQNA 2R00A 3I9LA 3A04A 5G4LA 3N3BC 4UQLA 3KDPA 3S44A 5TVKA 3BKWA 2AZ4A 4H7JA 1K92A 1W4AA 4J2OA 2PZEA 1MAHA 3OE1A 1O1YA 3B60A 2QAJA 1EFLA 1OI2A 1SUFA 4H2DA 4BNNA 1D6SA 1ADGA 1E7YA 1RQ7A 3OU6A 1NM5C 3LGXA 4XSHA 1HT1E 2BTQB 2YZMA 4JY7A 1POWA 2LE0A 3OPQA 3QELA 4F9EA 2X76A 3KUXA 3LF1A 5A7HA 3RYFB 1XZ8A 2V7UA 2NVOA 4WLEA 4GP7A 1A9QA 1NIPA 1SKYB 1RC8A 1J06A 1GDHA 4IINA 5KQSA 5LLDA 2G77B 3WWDA 3ZHOA 4ND3A 4GI5A 2W58A 4Z4CA 4JT8A 4DR4B 4Q7KA 2E89A 2J46A 1C0KA 2QD1A 4WH0A 3SJUA 2PSSA 2HC9A 2A1UA 1O6CA 5A6SB 4AN4A 4R6WA 1L5MA 3QFRA 4NFLA 3S40A 3H5RA 3BWCA 1OGJA 2BBTA 1LK0A 3GDOA 4EYQA 1L4MA 5C5CA 4Q5IA 1OZ0A 2EW8A 2M6RA 3K1TA 2RHCA 3N59A 5DTRA 3WNBA 2B1JA 3RSLA 1B6RA 3FFWA 5CYGA 1AA9A 2H59A 3SS9X 1TU3A 3KD3A 3BORA 1VE7A 3DT6A 4QDXA 1QO7A 3RS7A 3ABOB 3IT2A 4I55B 5AHOA 1UXIA 4LE1A 1GG9A 3VVLA 1LSUA 1TA9A 1UMKA 4II3A 1MJGA 1G1AA 4RHEA 1Z4LA 4P32A 2QENA 2ZJAA 3C8MA 5H82A 2P4QA 2ZVQX 1ZINA 5BNIA 3BBLA 4LBYA 1GRVA 1AF4A 1DQSA 2JIRA 5CB4F 2VL7A 2WSLA 1RSZA 3KJNA 3OCJA 2AMVA 1JTVA 1XCMA 4JGGA 4RH0A 2H4ZA 5C4GB 4LUCA 4E15A 4XIYA 3W5VA 5DNEA 4XSGA 4NBVA 3AVPA 4B3BA 2ZI7A 1I5EA 5AICA 4ACBA 4WFQA 1QDEA 2ZRGA 5CT6A 4OQMA 4C9BA 4WGGA 3OZIA 4PSVA 3I5AA 4TV9F 4DQXA 1RWOA 1J1UA 4HYQA 2I6TA 3WIVA 2M1XA 4C6HA 4MINA 5E4TA 1RVDA 2YW2A 1KZ4A 2QRPA 3GAZA 1YMQA 2GTPA 4UUBA 3VFDA 4BQSA 3EHEA 3SX4A 1AHPA 3R4VA 4DA7A 2ZVDA 1DXYA 1UBGA 4Y30A 1E0JA 5JVDA 2GR9A 3UC5A 2JA1A 4JNKA 4K8OA 3R3YA 5HCIA 3OQOA 1XD2A 2B5OA 3EDRA 3WFJA 5CB0A 4CU2A 3NBQA 1VJ5A 3MA0A 2QJTA 4E5NA 2IL1A 3LGSA 5LJIA 4ADSG 1OXUA 5LQRA 5B5SA 4AUNA 4H9GA 2TS1A 2OCLA 1B6SA 1UAYA 2R62A 4GMKA 3T3PB 3TTWA 3ZDXB 6LDHA 4NAHA 5EQTA 3RTEA 1K9VF 3GMIA 4N12A 4S1TA 2QQFA 1NC3A 5G2OA 3T0IA 3IERA 4D9GA 1UBRS 1VLLA 3EF1A 2VEOA 5IAEA 3ANXA 4L9RA 3DEHA 3GNTA 1W93A 5SYMA 4DSUA 3U3ZA 1F4LA 2FFQA 1Q77A 3AJ8A 2QDXA 3ELDA 2BTEA 1UKVY 2EHJA 5EG5A 1ZNQO 4OXRA 1TYEB 1YBHA 4OXXA 5SICE 4H7IA 2A1IA 1ICEA 1KY3A 5J5AA 1JZSA 1A5SB 3CLRD 2FAXA 2C94A 3SE0A 1A5BB 3IO5A 3AI2A 1GPNA 1R4AA 2G1PA 2KWIA 3Q7TA 4BLQA 1B16A 1P4GA 5AM1A 4PEVA 2IW1A 4Q1FA 2IXDA 3B36A 2LVBA 3FN4A 1DKOA 3PHLA 3Q0TA 4HKTA 3JQFC 3P0RA 1JA1A 2OO5C 1VYHA 1F1BA 1V1RB 3IC5A 2WJYA 4FDTA 5EJFA 5EWLA 3GP8A 2QG4A 1OI4A 1CIJA 1YB2A 5F52A 4NOMA 4OMUA 2D59A 1TLTA 2Q3JA 4G0ZA 3UJAA 3VUFA 1W36D 5HJ5A 1J0EA 1BE1A 1Q0HA 2OLKA 3UJHA 1E2PA 4QUJA 2BF7A 4B9EA 3NC1C 1XZAA 2I7VA 1IVSA 3DGFC 2OB1A 1CS4C 3O91A 4G09A 1PDWA 3URKA 4EHAA 3QEOA 1DQZA 1MABA 4J0IA 3FNQA 5CT8A 2AN1A 3U7GA 3GDFA 4CQMD 3DXXA 2IXFA 2WTMA 1SVNA 3VPCA 1KVUA 3S1AA 1R8YA 2C84A 3QX7A 4YRPA 2GCOA 3FB1A 3ZJTA 4KXYA 2PXHA 1IZ9A 1C7FA 3C3DA 4EUEA 3EPJA 5IDWA 3V1NA 1T6YA 2PKCA 1JW9B 2HMWA 2HRCA 5DM2A 1E6EA 3GQBB 2FZGA 3P9IA 10MHA 3E2MA 1YU9A 3U9SA 1DOZA 3QX9A 2VAMA 4EKIA 3M4NA 3EQZA 3LT2A 1Q84A 1OJLA 2WHYA 4MS1B 4RQTA 3E9YA 4WACA 5GY7A 5KKAA 4B76A 1P18A 2GF9A 3VOAA 2EEZA 4F84A 3CLTC 2HA2A 2FPPA 3EQ2A 5DTMA 2F59A 1EFHA 1FP7A 3DTTA 4DNQA 2HLDA 5CX1A 4L4UA 4RH3A 3IYLW 4QGBA 3K9LA 4X45A 4I8IA 3L79A 4PZYA 4CMBA 1XLTC 2ERCA 2W6MA 1DXQA 2GK4A 4IZOA 1AO3A 4ARVA 4EY7A 3QV2A 5HF6A 2VRCA 3ENQA 4LV8B 1PT6A 3D8SA 2V8BA 2EHDA 4QTTB 3CPEA 2IFTA 1G60A 5IYZB 5JFTA 1XIVA 2OD9A 3OQPA 4GEKA 4WOKA 2QK4A 4EEXA 2HF2A 1N9GB 3C1UA 1KMHA 1UKAA 2DY1A 3MAJA 4GLOA 1WDMA 3AUKA 5JD3A 1JT9A 4XM2A 1GSIA 3TF5A 2P79A 5I47A 3CC8A 4WLFA 4HDQB 4PS0A 1PLLA 1ZQ1A 4FKBA 4ESHA 2V3CC 2W8BB 4MDEA 3TG8A 1I2BA 1UFRA 5C1BA 3RJZA 1VECA 3H1GA 4EA8A 5IH3A 3QY0A 3RU2A 3TD2A 5A04A 4MIEA 1KO1A 1O58A 1G18A 4QNNA 1FUEA 4OFBA 4L5AA 2BFEA 1OF1A 2XT0A 1JQKA 5F3WB 3HU1A 3OTHA 3CQ9A 1PR2A 2Y1DA 2Q6TA 4D81A 4TZ0A 4U2BA 1V11B 5LQSA 4DCSA 1M0EA 2F6RA 2XBUA 3GWGA 3ONWA 3WQRA 4B46A 4OA8A 1UMDB 2A0UA 2ACWA 5HQ3B 1Z0ZA 1EGQA 4FGUA 2CW5A 3C3CA 5CVJA 1PD0A 2Q0QA 1KYQA 5HIAA 2B21A 4GPEA 4INOA 1GUZA 3VZPA 3ORQA 1TAQA 1U3VA 4M83A 4ESOA 1OZGA 1YDMA 2VQ6A 2BFFB 5EYPA 4KBYA 4EOGA 1MW9X 1SELA 4PX3A 3FSGA 2QYTA 4X8HA 3E7DA 4L7QA 2I62A 2CUZA 4BV9A 2JVIA 1KJNA 1S89A 5EQFA 2EERA 3BXOA 4WXEA 3QQ5A 1JFFB 4R8VA 3ZK8A 1KI3A 4D9IA 1JLLA 2NQ2C 1X7WA 4LN1A 2YRFA 3MPOA 1XX6A 2BFCB 4YJFA 1H6BA 2PSDA 2UZ0A 3AF3A 3PVSA 5EUBA 3TIFA 5L3SB 2DLDA 4FUQA 4KQGA 4ZIRA 1QXSA 4OK6A 4O2AB 1Q91A 1XLUA 3HWSA 4MQEA 1WB6A 4ALNA 2XDYA 4PCAA 1BS2A 3D6AA 3KD2A 4QE3A 4ZQHA 1KZGB 1LZKA 3OCYA 4YR7A 5JHGB 3C70A 1QGAA 3EIQA 2ENWA 3FUXA 1PN3A 2C7QA 4HF7A 2WQ7A 4X61A 1EUQA 3HACA 1AQLA 3H4MA 1V8FA 3G6WA 3H87A 5ILQA 3UJ9A 1KAMA 4LOAA 4MVJG 4WDQA 5LP1A 5EJ5A 2NT4A 5EZ5A 1LA2A 2PWAA 4J29A 2PT6A 4C30A 2XIQA 5FWXA 1NR5A 1XTRA 1X7YB 4U6QA 4IDNA 2Z6UA 3SF8A 1KFCB 3KJEA 4XA8A 4OJTA 3CZQA 1DIRA 4KI0A 2A7QA 3DW1X 2PZLA 1T2VA 1DEOA 1WHSA 1M6EX 5E3JA 2B1RA 4WKPA 4KTTE 1H5QA 1KQ3A 3JWJA 2R1ZA 1FS6A 3JQQA 3NP9A 3AU8A 3T9FA 1NWCA 3Q2KA 2NO7A 4XJXA 1LQ2A 3NALA 4F7DA 5LKRA 2WLTA 3ZOZA 2DU8A 4E7OA 1VSVA 1TM3E 2NUTB 3QXXA 2JGNA 3UWDA 3FOZA 3K70D 3HKEA 1I7PA 2NQTA 1E1KA 3SSMA 3ZCXA 1UM8A 1ZIOA 3FDZB 4TTJA 1NX6A 4RLFA 3A2MA 2FWPA 1Z2NX 4MR8A 3R5SA 4PLFA 2O8VA 3LECA 3A1SA 1H3NA 1C29B 4E3WA 9GPBA 4AQYB 4G4SO 3SKXA 5AW3A 1AKTA 1GA6A 3IMKA 1JR3A 3OX4A 4H1HA 4QOGA 2Q99A 1GTVA 5AW2A 1TW3A 3H9QA 1PV2A 3GA5A 5FHRA 1OFHA 1UCFA 3F1KA 4CIXA 1N3BA 2QT1A 2WMOB 1OC2A 4A0GA 2F4VB 1NZFA 1D4AA 1YVRA 1PUIA 1EA7A 2CXHA 4Q48A 5JXHA 3HXQA 1ZH6A 3G2LA 2WM9B 1UZUA 2X5XA 2VSFA 4D9MA 4IKOA 5WRFA 2IH4A 1PNQA 3IURA 2XOKA 1NT2A 5AUQA 3QOXA 5BR7A 3T8YA 2WEKA 3DO8A 4G5XA 5FUVA 1JJAA 1R0SA 1XYVA 2EJTA 1JXAA 4P9NA 2PMBA 3WB1A 4BX9A 4KQFA 4F72A 3EGVA 4TTRA 4MHOA 1CRLA 2FEPA 3NVMB 3OCVA 3N74A 2COKA 2P5UA 2V65A 4BLSA 3C3XA 1WXWA 3GGGA 3IQZA 1JKIA 1UDCA 3CNQS 3VHRA 4PZAA 3IUMA 3O5AA 5ALVA 1O54A 5DBEX 2AA3A 3ND8A 5AP9A 1NRXA 3O7WA 3VV3A 2C97A 3RG2A 1ZA1A 3V1YA 4EJFA 2O8CB 3UH0A 1J2EA 3NTRA 4IH4A 4JJEA 2P4UA 4O2BB 1NSYA 5DHQA 2V6BA 1CUVA 3G8BA 3IBCA 4KRGA 3OZSA 5ENZA 3V42A 2EGHA 3PE6A 2RGUA 3H9EO 4A23A 3THXB 1WZUA 3CZ4A 2H1WA 5C8ZA 1GTRA 4AX4A 4WPGA 1EAYA 4JJFA 1PE0A 4Y2YA 2X2FA 1ZGBA 3ZY2A 3KQMA 2X8BA 5DYIA 1VLJA 3EFBA 3KT3A 5DM60 4B75A 4DY6A 3BJIC 1U9CA 2WAOA 1SUCA 1UP7A 3AR3A 4IGFA 4PWZA 1B6GA 3ISVA 4Y2GA 1CDOA 5BORA 1HY3A 4DTIA 3H11B 3FBWA 4AJ1A 4F12A 4EB6B 2IWHA 3A4VA 4BMYA 1CS0A 1SXJA 3QF4B 5JLAA 3NJ4A 4KUEA 1XZFA 4JKYA 4LHEA 1RQNA 4FCVA 4RDHA 5BNTA 4HLQB 1NMYA 2WD7A 4CF7A 1ZVMA 4BRWA 2AI3A 2J8ZA 2Y77A 4M1MA 3TVDA 3DHWC 3IB6A 2CLFB 5AYVA 1EVLA 4OREX 3EGWA 4HAXA 1E4VA 2QV7A 2XMGA 4YMVA 2P35A 4BTLA 1M8GA 4LSZA 1V3QE 1WOMA 1Z2EA 1H05A 3IV9A 3UPUA 2FMTA 3VPAA 1Q44A 2OZEA 4FW8A 1KFBB 2UKDA 4FFLA 5BSUA 3VJKA 1U1IA 4Q9NA 3J80A 1ABEA 4JJ7A 2WJJA 3RVJA 2Z2IA 5KYNA 1L8LA 4IMRA 4HH4A 2QPAA 5E6RA 3SJCA 4BMZA 3HKEB 3F7OA 2E4AA 5J5CA 2Q7OE 1N2ZA 5FRDA 1EWVA 2O2ZA 3GL9A 5CCDA 4NI5A 4KNYA 2ZUDA 2BISA 2EL7A 2O8EA 2JFOA 2PKEA 5AVYA 1LQTA 5BR8B 1RXCA 1QF6A 4HOYA 5IVIA 4N5NA 2OXTA 5H83A 4WKNA 3HN2A 5T3UA 1BVRA 3U80A 2XKKA 1USKA 2A9JA 1T29A 1P0PA 1PS8A 3LUCA 4U6SA 3RHFA 1BOOA 3BRCA 3WXBA 2QRUA 3K20A 1MEEA 5JATA 1GZHB 3RC1A 1YE3A 5BV0A 4AXXA 1RMQA 3BVPA 4DV5B 1XRLA 2QW0X 5T5QA 5JU6A 4AMYA 3OKPA 2VP3A 2DC1A 2E6UX 1K3UB 3AYZB 3FUWA 3IUPA 3SM3A 1U6KA 4NMHA 3T5MA 4Z1OA 2OGZA 2F62A 1T9DA 4QNRA 5ALHA 3G8DA 4DLWA 1TQHA 5TQJA 3CRZA 3GJYA 1KOLA 2H0AA 3UQZA 1UQUA 1XHFA 2P75A 4Q4JB 1NKVA 1QSGA 5FUXA 5FPYA 4MLCA 5G0SA 5KNCA 4F5YA 1S2GA 1F4VA 3BWYA 3IMFA 3Q85A 1OUMA 2ORED 1YK0A 4EG6A 5J2TF 3X0DA 3ZWXA 2BEUA 2JGAA 2H1FA 4U7HA 1NE7A 2XZTA 4HH0A 1DV2A 4L72A 4OHRA 5I5GA 5JBIA 1TUIA 4RPLA 2VWPA 4IMPA 5I9TA 1NP6A 4ZALA 1PBNA 1GG2A 5HGJA 1NMQA 1J21A 1ZWLA 5HE8A 2FQ1A 2JJQA 1O8CA 4DRXB 1O96B 2V7GA 4LKRA 2WQZA 4KJZA 2IZ5A 3DOJA 2B61A 3NEAA 1FVFA 3RQIA 5FT9A 3DG9A 3GPCA 1X86B 3E9ZA 3KL4A 4EAQA 5EHQA 1RJFA 5SY6A 1J97A 5BYJA 4TUYA 4MVCA 4FYJA 2Y1WA 4BVGA 4H0CA 1H2FA 3CZRA 4JVSB 2IS2A 1W5SA 1BVHA 3EXAA 2FQXA 1Y8CA 4HNAB 1JDZA 1XROA 3L0IB 1XG5A 3LKBA 4Y6PA 4YUAA 1JXOA 1G8MA 2QMHA 2O19A 5JBNA 3JQAA 4ZQFA 2VKTA 4JH0A 1AA6A 4BLUA 2TSYB 2PBFA 1E9EA 1EX1A 3BGIA 4RVUA 1PO7A 4XDZA 1RPZA 4AY2A 4B7AA 5TR9A 1L4UA 1QC5A 4K9RA 4UFNA 3B8HA 2BP7B 2VQFB 1EVZA 2EFDB 3M6XA 4PC6A 4PLVA 2W8BA 2EVWX 2XNKA 5JC8A 4MWZA 4XE5A 2AKYA 2RHMA 3C6KA 4EGQA 2FQYA 5KTTA 4LJRA 1DLIA 1FMLA 2FWIA 4MVJP 3SLGA 3ZGXA 1OV4A 5A3JA 2FJPA 4G5OA 5D5HA 2BGGA 5J3JA 3LO8A 2OP0A 1WE2A 4H60A 5CNMA 2W5UA 4RVOA 3ZI0A 1TQ2A 4PHGA 5KNCD 4S3MA 3GA7A 4CUKA 2Q7XA 1R5JA 3ZKWB 2P41A 4HHEA 2XADA 1V9CA 3NBUA 2IZ6A 2N0SA 5FF9A 4C04A 4FHDA 4LEIA 1C3JA 3PPIA 2IOYA 4QUGA 2YBDA 3NATA 3D7LA 2WSYB 2I0FA 4QGGA 1TTPB 4PSDA 4RGQA 4XX0B 1FZTA 5DMHA 5TT1A 3SSOA 8ABPA 1BDJA 5H02A 1XTQA 4Q03A 1O87A 3K0FB 2OSBA 2BFDB 2WAXA 1F2DA 2ZYRA 4KXVA 3RUFA 3TSCA 2WD9A 1U2DC 3D8UA 5E3HA 2NXNA 4B3GA 5SYAA 4BLWA 2DVMA 4GVPA 1O96A 3SOZA 5EXTA 4A1FA 3CGGA 3RJ5A 1K7XB 1KO4A 4GICA 4PINA 3PPYA 2N46A 1ZR4A 3DMDA 2MWMA 3MWDB 1TJNA 4HGRA 1YC2A 2HX1A 3TMYA 5F4BA 2C7RA 3H1EA 4FMBB 1WXXA 4P5DA 3A31A 3QFCA 4HDSA 3RNLA 3TTXA 4DSZA 3JS5A 4MNTA 4C20A 2KPOA 2LGJA 1IYZA 2WOJA 4KGVA 2Z6VA 3DVAA 4M22A 2ECQA 1NQTA 1XR3A 3CUUA 4O4IF 2VQ3A 3G17A 4HGQA 4GNKA 1WSAA 4M1OA 1HOTA 1U0RA 4PYOA 4BNHA 1J0CA 3FCUB 1W88B 4J0DA 2FZVA 1W2GA 3OH8A 5CU7A 3SQMA 4BP1A 1YZQA 3BCRA 3ENKA 2CNWD 3IT1A 1JX6A 2VOEA 3QTBA 3T7SA 1RFGE 1G21A 3KL2A 2IHTA 4D25A 4X66B 4CUJA 1EXDA 4F8YA 3PNOA 5KJ6A 1JG4A 2BWJA 1AB6A 4KLAA 3K6SB 5BW6B 2NZVG 4IDGA 3I39X 6REQB 5JQGB 2JHCA 2B9EA 3BS4A 5ALUA 1XFAA 3IEXA 4DF3A 4PRYA 2O8EB 4U9UA 3VJLA 3WO1A 4NK5A 2GXAA 2ZSBA 1X39A 2Z9DA 3INYA 1ZRMA 4FFOA 2ODBA 3SZUA 5GAJA 5LLSA 1X87A 1P5JA 5H16A 5KWVA 2QGNA 4W5QA 2WIDA 3FYUB 4MQFB 3GEBA 4HWSA 1TRKA 4BZWA 4MHTA 3F4LA 4JSTA 5H81A 2AOUB 1IK4A 3HABA 3KALA 1T9KA 4QPPA 1CUFA 1ENZA 2H2DA 1V16A 3HBNA 4JNCA 3BWVA 3NYQA 5F3DA 3WRVA 5FLXA 2W2OA 5LZ4A 3IE1A 1PNVA 3UW3A 3KT8A 4C01A 2PX2A 2NO5A 3F2IA 4LFBB 4NMMA 1QV7A 1R6TA 1ISHA 3MN1A 2O52A 1CEXA 3WP1B 1U9ZA 4X62B 2Y6UA 1NDHA 4FINA 4D3SA 3CVVA 5ALFA 2P7HA 1NX9A 2EJCA 3QXSA 4LOLA 4XWTA 4TM7A 4B6EA 3HWX1 3GLIB 2ALJA 3SR4A 4ZEVA 3DZFA 5LD2C 1MW8X 3CUYA 3I9V1 4HPXB 2V9CA 4PVCA 1Z12A 4P86A 4RF5A 2M1ZA 4UUPA 3OQNA 2A0YA 4QASA 3H11A 3VPXA 1MMFB 1JDBC 5AJUA 2VDWB 2I4MA 2UXCB 1TYZA 3LYLA 4MV7A 1XZKA 4M0DA 2GX6A 4BMCA 1D6NA 4TYNA 4RTSA 4I5FA 3R76A 2H07A 4U4AA 3WLNA 4BMPB 3U61B 3KYCA 3PJGA 4COKA 1N2EA 1YQDA 4JA0A 2R7AA 1ZL2A 2CLIB 2DTDA 1QC5B 3CLUC 5ECDA 4YVFA 4YP9A 4R68A 5A02A 4KVFA 5G53C 1C7EA 1PJAA 2ZSUA 2BDUA 4DIDA 4TKLA 1BD4A 1R0LA 2BF4A 5EIHA 2AOVA 2XDQA 2D0DA 2YMLA 3SBDA 1U9JA 2CNNA 3KV3O 1RBMA 5DT2A 4ZHQA 1EB8A 4KFUA 1VCIA 1BCRA 1RYNA 1QRDA 3K0EA 5I7WA 4GBJA 5THKA 4YECA 2YVLA 2E85A 3SMVA 2XWJI 3AJDA 4OLAA 4GKAA 1GXSB 3RGGA 4JOQA 4M36A 4H4DA 2ZJ7A 1W9HA 3LOPA 5A5GA 1Y8QA 3FYSA 1RXIA 2E3JA 4IV8A 4RFVA 4X1YA 1P19A 5TEVA 1HG0A 1W85A 4KDEA 5B3KA 1XZDA 1WD5A 2HIAA 2P2YA 3Q7RA 5H7XA 3SQLA 1L3BA 1R0YA 2Z1DA 1HWYA 3BHMA 4OV6B 4RW0A 3RVQA 1ZQ9A 4OHBA 3BD9A 1XDZA 4K3VA 4WN3A 4NCKA 2JRCA 1II0A 1SXIA 3QLTA 1U02A 4MUKA 4O1IA 4P33A 3IUQA 3E1KA 4UDXX 3TR0A 3V4ZA 2DKOA 5BPFA 3HJFA 4WA8A 1JG1A 1OLXB 4MB6A 3TQSA 2W6JA 5HF5A 3X3HA 1DZIA 2IHBA 3W90A 1XTUA 4C2AA 2FOIA 2XNJA 3RC9A 3NHWA 3K0KA 3NHBA 1GVNB 3BG5A 1QYDA 1V37A 2SCUA 2YN0A 3H5IA 4MARA 2YX1A 3G8YA 2BEJA 2IH5A 3O2QB 3QA9A 1BX1A 1KQGA 2C8LA 3IPLA 4C7VA 4ZJZA 1PJSA 1UT8A 4F2HA 1DKUA 2H11A 5DFAA 1W75A 3BGDA 3GCDA 4HEA6 2ZM6B 1ZCZA 1D6MA 1DX9A 1WXQA 4EJ0A 5ELLA 1QUEA 1NM5A 4F4UA 5H9VA 3BD8A 5BPHA 2OKCA 2BE9A 4MRSA 4YCLA 2J0UB 1ILWA 2AG8A 5DYYA 1GL7A 1YB6A 2NUTA 2YXDA 3UXHA 3KWJA 4UU7A 4BB0A 4KQMA 4M4SA 3OLCX 4EW3A 4DMFA 1SUAA 1Q0ZA 2DPMA 4NL4H 3UT5A 1IOVA 2Q07A 2F55A 4TV9A 1CIVA 4JMLA 4EENA 1JIUA 1CUXA 1HK7A 3CLUD 3ZZ0A 1AK9A 3M1LA 4EYKA 3OQIA 1AOXA 5IM4F 1EVKA 2D0IA 3IXLA 4XQCA 3U48A 3QEKA 2ON6A 1MB0A 1XF1A 2V7EA 3I0ZA 1GL3A 3SAJA 5CFPA 2BOVA 4QXQA 3FETA 4IGAA 5DGXA 5FH9A 1CJVC 4P0QB 5EQJB 2APJA 3R24A 4I1PA 1HKUA 4CFSA 3ISTA 4IUBS 1O5IA 5LBTA 1Q0TA 4OHFA 4NYIR 1DO0A 1GTZA 1DG3A 5D87A 3BILA 4QBTA 1I80A 3T3NA 2D1RA 2F9MA 2H17A 1WEKA 3M5CA 1CZLA 1LFDB 1D1SA 4INJA 4K9LA 1G7CA 2VNSA 4UBJA 4A2CA 1UMCB 2YIJA 3DHYA 5YASA 5BQ5A 4DLLA 2PGOA 4GR4A 4R16A 2X4GA 2DH6A 3DLIA 5IDVA 3LTEA 1QPBA 1Y63A 1RYFA 4W5JA 4C4AA 4ZI7F 2NXCA 4MVJD 2HCBA 3L6CA 3PTAA 5TX7A 1G41A 3BIXA 5BN5A 3QG5A 3QE3A 5JBQA 1L5NA 5E4FA 1LBTA 5ALJA 1G8YA 3HR4A 1JMYA 3WYFA 2G76A 3OIGA 1O0CA 3I37X 2OO7A 4AICA 1E2BA 1KJJA 1NVVQ 1FPQA 4FGZA 4P7FA 1NI4A 2ZJFA 3D6VA 2E49A 4OBWA 1JG7A 2AN5A 3AVWA 2HDOA 1ZGGA 1N3YA 3KUDA 4IIGA 2O1EA 2J0QA 1JN0A 1FE8A 1H66A 4NULA 1QYXA 4X97A 3FPFA 3AU9A 3HFGA 2GOYA 2HSWA 4AN0A 2VP6A 2IEIA 2B78A 2XCTB 4QIHA 3VR6A 3QVSA 3WVNA 3T5PA 4M8SA 4NICA 2FRXA 4A91A 2GFHA 2WT4A 4G25A 4DY4A 2C4MA 1F8GA 2HSGA 3KTFA 4HVTA 4V0RA 3TPZA 2J6HA 4F6RB 2G5CA 3ICOA 5JSZA 3F7MA 3W05A 4JBYA 1F5SA 1VGQA 3FHOA 4DAEA 1IH8A 1UJMA 3RJ9A 3ZWPA 3GCXA 2P67A 2JFPA 4PG5A 2XMPA 5H4GA 3HDTA 4DM3A 4IX1A 2VTKA 4G5RA 4HMPA 4LSGA 2VSQA 1Q6YA 2PCJA 1DPFA 3GLSA 4G67A 3EPKA 3EZFA 4TGLA 1BVYF 3MTJA 4ALKA 3L0ZA 3QPBA 4NBNA 4EPVA 5E0KB 1ADBA 1DBRA 2X4LA 3S5UA 2CYBA 1JEDA 4N7BA 5CIQA 3RVNA 4V1CB 3MRSA 1KMHB 1MRNA 2JFHA 2PFGA 1CF9A 4I7EA 4Q1CA 4Q93A 3ZHCA 2MTBA 4HUTA 2PLNA 1JR6A 1FFAA 2VSYA 3P9RA 3TMAA 1T3GA 5D7NA 1OTHA 2HW8A 3WLFA 2C5FA 1LRKA 2FUEA 2O3JA 3H8VA 4KE7A 4RVFA 1FQOA 4YJ2F 2HBRA 3IR5A 3EUWA 1TLFA 4XDYA 1JWLA 2AQKA 4DT1A 3BSWA 4YV2A 3CEAA 2LNDA 3OUUA 3KHSA 1NJ6A 2QLNA 5JISA 4F04A 3TRJA 1KXJA 1R64A 1SQGA 1WQ4A 3JYLA 3AVQA 4FS8A 3KYIB 2A9QA 5A7GA 1ZXBA 1N1GA 1N6IA 1NXSA 2OAEA 4ZQCB 3MCWA 1B76A 3PEUA 5LB4A 5K0TA 1HFKA 3A1NA 5BN4B 4WE3A 4PBSA 4A36A 1USGA 1DU4A 5HK9A 3P96A 5IFLA 3R3WA 2H4HA 2WFMA 2WTNA 2HO4A 4NJOA 4R8SA 1TVMA 3RUDA 3SVLA 1PZGA 4DR2B 3SKVA 1ZCJA 5CLQA 1X7XB 1QBKC 3PXDA 1OBOA 1A9SA 4TX1A 5FLKA 5L53A 2CLLB 3QFSA 1TAHA 4P1ZA 4WK6A 1JH8A 1ODCA 3IAFA 4KACA 1KO8A 5FNVA 2X40A 2C5BA 1ULSA 1E4OA 2FFAA 3E53A 3AY6A 4BKRA 2OFFA 3G79A 2ST1A 4AF8A 2WUDA 1ATZA 1Z5WA 3SBXA 2Z3VA 5CYPA 1E1DA 4DJAA 3TNDA 2DMRA 5A06A 2BLLA 4MP6A 1ZD4A 4OHPA 3UJNA 1PG0A 1VBFA 1KAOA 3TLEA 4DCPA 1PQ4A 4EPYA 3FFBA 5D5PA 4EF5A 2JRLA 2Y0CA 1L0BA 3AB8A 4CCAA 1K4MA 4LBVA 4J75A 1BX3A 1RWXA 4MHSA 2IYZA 4C2BA 3DTYA 1DV1A 1WABA 3ILYA 3PGJA 4OB7A 4PCUA 4XCQA 1MIOA 2J45A 4I3HA 3P9QA 4KGZA 1WG8A 3FZNA 1KC1A 3W5UA 1PVOA 2JAUA 1IY9A 5JCJA 2WK1A 5ALSA 1P61B 1E9RA 2EBUA 5DYNA 1VG1A 3H2ZA 1X7HA 2A58A 1ZNZA 2W98A 5DF1A 3H3FA 2OBLA 1PKEA 2P4SA 3IUEA 4DNPA 3NFRA 1PJ2A 4E30A 5E38A 2QRGA 3AFHA 2BT4A 4N18A 4UQPA 3AESB 4WZZA 5D1NA 1NPYA 1Y1SA 2QVBA 1BCSA 3Q40A 3OM8A 7REQA 3HSYA 1KQNA 1RWQA 1IUNA 1K08A 3FOFC 1XMJA 2O2EA 1ZISA 2CNWA 1VHDA 2KB0A 3OFSA 3U4MA 3FZYA 1GGFA 1Y9ZA 4WERA 2WP8J 1MRSA 4LSMA 3BIWA 4MR7A 4QAQA 1RHUA 1MV8A 3QENA 1AX9A 1JU9A 3NIWA 1R9JA 1ZJ6A 2DUUA 1HEYA 2Y4OA 3P2OA 2OO5A 2J0UA 1FK8A 4HQKA 1UJ2A 2GYWA 3AVXA 4G23A 4JB0A 1L5SA 1H6AA 2PTHA 2ZYTX 3I2FA 3PF9A 4IDDA 5F76A 4MTCA 4URZR 2MT9A 4ER7A 3SX0A 1TQ6A 1WY7A 3COPA 4J3NA 4EJSB 3A2KA 3P0EA 2EG5A 1N0IA 1JLRA 5JNWA 1IFXA 2Z8YA 3DC2A 1QRSA 3G88A 2AH5A 4XYBA 1C0EA 1LK5A 4HAOA 3IVAA 1QTQA 2BKLA 1D07A 1WXIA 3O0DA 4I6JA 2EOAA 4K0KB 1ZVJA 3EXIB 1YS4A 2CDBA 4LDQA 4B5KA 3KZCA 2YYSA 1WD7A 2FUG6 4U2EA 5KNLA 4I4TA 4FX5A 1XCBA 1U7TA 2RKOA 4BFCA 3L3BA 1INLA 1Z8NA 3DD1A 3TS1A 3DB2A 1GQ2A 2QJWA 2ONZA 3DH0A 2YY5A 1XK6A 2JGRA 3KSZO 3OCCA 4HWOA 5CG2A 3VA7A 2OAQ1 3PJEA 1F0NA 3IP6A 2QJFA 4YJGB 1S9DA 2IV3A 3BYZA 3KEFA 1ZCBA 3JQCA 2XOEA 1OZFA 3NTVA 2FU5C 2A78A 3L92A 2BHTA 5CH5A 5GJCA 4DQUA 3G23A 2NO6A 3ECCA 5FQNA 3KUCA 4ND4A 1Q7RA 5A4FS 1WF3A 4U5QA 3UT0A 1YBAA 4Z4QA 1PFGA 1QH0A 1X92A 3F3MA 2V7WA 4D4HA 3CIFA 1QIKA 3D6JA 2PQ6A 4LY3A 4NARA 4ZANA 3WGQA 2P2NA 5K0GA 1Z63A 5EE9A 5DBOA 3R5FA 4KMOA 1XVTA 4NE9A 2P9FA 4GG1A 1E9VA 1XDDA 5KX5A 2REQB 5C8YA 2Q2VA 4OATA 4CQMB 3VNVA 3VYWA 2FG5A 1UBCA 2VPTA 3GRPA 3EOBI 3K2EA 4U0JA 1NFQA 3MMPA 5LXTA 1XPOA 2Z56A 1P9LA 4RLQA 3OX1A 3TZCA 3KFXA 1N5MA 1WLYA 3GJ5A 3KZ1E 3IKJA 1DWOA 1SQSA 4IJKA 1MABB 2FOLA 3DMPA 3NHLA 2VYFA 2V7VA 2IBTA 2CWWA 2Z9CA 3C8UA 2CD7A 3RWBA 1FL9A 1RE1A 3GX1A 1E62A 5FX2A 3OFVA 3ZWWA 1F9AA 3K35A 2GVDC 3N05A 1B41A 2YWHA 1GGKA 5KUTA 3EDCA 5JSYA 1JIJA 4M8IA 3VGPA 3LCRA 3A70A 4LF6B 1KVQA 1XCJA 1USIA 3TW8B 2JFNA 3RGWS 1UP6A 4IXTA 3WKDA 2ZB4A 2MYTA 3TLGA 4ISBA 1K3FA 1ZD8A 3P8ZA 3KQLA 2BGUA 4C4RA 5KREA 4B85A 1H4QA 1A82A 4FYVA 4BBPA 1N5OX 2NZUG 3L1IA 4I19A 4RPKA 4X44A 2WWIA 5AVTA 1DAHA 1OIVA 1T5HX 3H5OA 2XSZA 4LVCA 1C9JA 4DXHA 1ZYUA 3OFKA 4QU5A 3U19A 3HXMA 4HG2A 3ITEA 2V74B 3QLUA 4M0UA 4LZJA 5BY2A 5FEUA 4AAYA 1OKKA 4DJTA 1ZBDA 4BAGA 5FA8A 1UC8A 3NTQA 3VYRB 1E69A 1DRUA 1G5IA 2GI4A 2WWHA 3KKNA 1SHKA 4ZZ1A 1SU8A 5BUCA 4D1YA 4H77A 4A7PA 4YV1A 5AUOB 1R37A 4FZ3A 4ITUA 2PD6A 3IE0A 3SJ7A 3SZLA 4EBBA 1KI1A 3LBAA 3LP6A 1VRCA 3FHLA 5FNVF 4IO1A 3RSQA 4CKWB 5KMGB 1E98A 3IKVA 1E2MA 3NJ8A 4C29A 1WPRA 5E7JA 2CHVA 1FUKA 1O5TA 3VR4D 1JHVA 3WS7A 3BXHA 1JQLB 2PKYX 1K7YA 3OQ1A 6ADHA 3RH0A 4GS5A 4H3HB 3BXEA 3KAKA 5KVAA 3VJRA 1I4DD 2BV3A 1YJ5A 1O6ZA 2WRZA 4NYJR 5K0SA 4NCHA 3EDMA 4I1YA 1THMA 2JLYA 3VPDA 4Y8VA 4KX3A 1RI4A 2QUBA 4L6AA 3AQIA 4TXMA 1VE1A 3VU1A 4G36A 3A3NA 1H6DA 4Y6SA 3GXOA 3N6XA 1G9XA 1A7UA 1M6WA 2C5SA 4OFZA 3SK0A 2ZWAA 3LBYA 2BI7A 4KFSA 1PV4A 4B6OA 1ULTA 4KV7A 4ZP1A 4FMPA 2POQX 1HT3A 2HXGA 3OPVA 4HGYA 4B43A 2COEA 4CL2A 1A8IA 2NU9B 5L3RA 4FHZA 1C4OA 2PUCA 4N7MA 4RH1A 3L1VA 4BO3A 1J5PA 4HRYA 4EAAA 2Z0MA 2VK1A 3PHGA 5B3LA 3S8YA 2CXPA 1O95D 4PCLA 1KKMA 4H31A 2QM0A 4E03A 2DLNA 3SLKA 3U56A 4ARUA 2Z2ZA 3R41A 4ZI5A 3RSCA 2WAYA 4AJ9A 1UIMA 2BELA 1QZZA 5ELMA 3RKSA 5EJMA 1UZAA 2JJMA 3R09A 4XEHA 3QU4A 5DI3A 3W3AA 1SHLA 1U1FA 3TCXB 3FNIA 2CUKA 1UKCA 1FFXB 2QVGA 2RK4A 4H6XA 4ANFA 1B93A 1O97D 3BF7A 3ORHA 1Q6ZA 1SUSA 4DCVA 4EPWA 4HVLA 2IYAA 4ZAFA 5CPBA 3WDMA 3U3JA 1Q0UA 1SOWA 4DCGA 1U9IA 4IG4A 4M1QA 1LSJA 3HBAA 1TM4E 4JLNA 3MJHA 2JIBA 4KE9A 1I6WA 4P5PA 2A9KA 2B4TO 3QVJA 3L6EA 1HZZA 4NDAA 4NZZA 5EESA 2VBIA 2QYOA 4FYXA 3P9SA 1ISMA 3O4GA 4DOMA 1EGHA 1XSEA 4P83A 1QORA 4XQ9A 4HWPA 3ELYA 1EFTA 3BJZA 3H13A 1Q50A 4KO8A 3JX9A 3D3WB 3AI7A 3I3OA 3WLAA 1BKDR 1EM8A 1FF9A 1L1QA 5JXGA 4CT4B 1OXSC 4LV6A 2RC6A 3SNKA 1TF5A 2ASVA 3P9XA 1IN5A 4HXGA 4OP2A 4C0WA 1CJBA 1VL0A 2OCAA 3HBMA 3TOXA 1LW6E 2FXVA 4GYJA 1HL7A 1KK1A 2FK7A 5GV8A 1LVUA 5KCMA 4DMLA 2VT2A 2W6OA 5FWNA 3ADKA 5ESRA 4O29A 4GI3A 5SY4A 1SVMA 3GT0A 3DMRA 4DS3A 4LWQA 2IHYA 5BNWA 2YNMA 2G25A 1ZD5A 4WVLA 1Q83A 2XOKD 2XUAA 3HYNA 3ZUGA 5KTOA 4G56A 2HO5A 4EX6A 2I33A 3F3YA 4DNXA 3KEGA 3EQ6A 1BFDA 1F7VA 2W6JD 2YFQA 5J4LA 1YQEA 3V7YA 2C58A 4RENA 4J2HA 4UTRA 4WBNF 2PMFA 1LLUA 3COYA 4NFSA 3VYVA 3BFJA 2H7XA 1AGNA 4LVOA 3WV4A 4ME6A 3OLZA 3DVLA 3BTUA 1PFKA 1X7YA 1FNNA 5DYWA 4ZT2A 3RYHB 2I4IA 1AMUA 1Z75A 1MOQA 1YZHA 4CIYA 2UUBB 1Y1KE 2NYRA 4G0YA 2VDJA 1IM8A 4RULA 3AFNA 2FPGB 3H9UA 2V4ZA 2PJRA 3DBOB 2J9YB 4NR0A 4C6TB 1KPHA 2ZIWB 3PI6A 4QT0A 4I9UA 2Y68A 3MMZA 3K2BA 1N2CE 1P4AA 5M5BA 2XUDA 1XCOA 2AEFA 5J23A 1OH5A 3W04A 1JHXA 1RI2A 1Y7LA 2VCEA 4ARZB 4D4JA 3B1FA 4WFKA 2AUMA 4L0QA 1KJ9A 1ACMA 2AR9A 3QIAA 4X7MA 5K4AA 3UB4A 1J42A 4MVJF 3STVA 4H15A 1VGRA 4OHKA 3ZWNA 3WG9A 2YVQA 5L3SA 1N8NA 3WLLA 2O8DB 1ISFA 2O2DA 2BCGY 4OL9A 3HBLA 2PVSA 1DJOA 4M0LA 3ZWAA 1DP4A 5FI3A 4EBFA 1XBTA 2F43B 3AC0A 4O1MA 4WNCA 4YRCA 3OIVA 2GHQA 5HBGA 4EW1A 2BEWA 2UZ4A 1KMCA 3D02A 3H4TA 4N65A 3HB9A 3KOWA 1PGOA 2A3NA 2UZAA 4Q3NA 2O7QA 4GECA 4RQBA 4A26A 4PG7A 5K4GA 2OXIA 3GD7A 3U7QB 5EYPB 3ZWYA 4IMIB 4MAMA 1BA3A 1NVBA 1L7BA 3R0ZA 1FJHA 1HQYE 1RKBA 4LFCB 1QZTA 4BQRA 4QDZA 4RIGA 2UYOA 1NXVA 1M2GA 1Y6JA 4AWBA 2O2SA 1TFRA 3D59A 2PYDA 5H80A 5ALIA 1F5NA 3UG6A 2X5KO 4BNDA 1GRNA 2IHZA 2SCUB 2X5NA 1P72A 3C6MA 3H0CA 3LCMA 3P0JA 3BM5A 1BHJA 3NT5A 4TLLB 4DZZA 1XXHE 1K2VN 3AUFA 1O77A 5ICFA 2I4TA 2QA5A 2VUHB 3C2QA 3QITA 5EY5B 3I8XA 3T3MB 1IN1A 2Z2KA 1C30B 3PUJA 5E9WA 3WHPA 4GC5A 3PGVA 4ROSA 3GJXC 1H0SA 4ENRA 1ODKA 1QHEA 2JH3A 1N6NA 4MVJI 7GPBA 4RVSA 5LYYA 5GJVC 1MKYA 2IVFA 2B2NA 2VG8A 3GFRA 5CW2A 4WA7A 1W5TA 5TT0A 4W5HA 4E70A 4KOAA 1Z4JA 5FHQA 2DWQA 1ECJA 5IANA 1EUYA 2W0SA 5KYTA 2X13A 3BMXA 4YGXB 2VDRB 5EEHA 4BASA 4YHBA 3MGKA 1H8HA 5LSAA 2H1IA 1YJQA 3AETB 3GFTA 4IY1A 4BWGA 5ECYA 2Q9BA 2AN9A 4L95C 5HCUA 3EVTA 1BCRB 3PNLA 4LZPA 4DWJA 3AHJA 4ETIA 4CPDA 1BMQA 3WLMA 5I7VA 3GN2A 5GGXA 2RHBA 3ROZA 4CEIB 1RI3A 3FMVA 4HAUA 5E6SA 2PUJA 1IMJA 1Q1BA 3L6RA 4JYCA 5L4SA 4HAWA 4NOLA 1XKTA 2VPPA 1MA3A 2OWEA 4HXYA 3H4VA 3ZQ4A 1V0JA 4XB2A 2CF5A 3INRA 3AY7A 2AQ8A 2H2AA 3C5VA 3F5SA 3GJ0A 4AP6A 3UB2A 1DEKA 2HQOA 1TYDE 1OFVA 2VFAA 4XPIB 4ZO4A 3PRJA 4ZJPA 3UMYA 2JFXA 3TUIC 3VR1A 3EODA 1JBKA 2P91A 2AC4A 3KVNA 3WA7A 1NP3A 1PTKA 2DHCA 3EZ7A 2A57A 1X1DA 2H4WA 3N8NA 4KR7A 4TVOA 4GBGA 5HIMA 2HV8A 3DAFA 3FG9A 3L8DA 3ZDAA 3ICCA 2XMZA 1ZCAA 1P2GA 3AIIA 4L27A 2VO1A 3PB3A 3H5LA 5E1MA 3WYDA 4DNFA 1TC2A 5K0EA 3PUWA 5L40A 4BTEA 4YPOA 3U44B 2YXEA 3UK1A 3NPAA 1XJQA 1CPYA 3P26A 2P9BA 3U0BA 2JGDB 5A5DA 5FYDA 2MJLA 4G4JA 4GRDA 5A3SA 1WSWA 4D92A 1KEZA 4EHFA 5KOHB 2F1RA 3HK2A 3SQXA 4I4CA 5B3AA 2YWEA 1NR7A 2WTBA 3H8SA 3A6FA 3MUNA 4QVGA 3U81A 5BP7A 4RZXA 1QTIA 4UREA 5AR1A 2RI0A 4U7GA 3B51X 3IHTA 1G8JA 2ILTA 3MFYA 4O2RA 2ODEA 2WYOA 4JX9A 3ZE0B 1GUDA 3MC1A 1CJSA 4BWYA 1LDGA 1Z9BA 3E7PA 5DBHX 3JWHA 5G1NA 4DSOA 1ONSA 4AMBA 1M5UA 4KBGA 2IHUA 1U5BB 5UKDA 3KUKA 3MGAA 1JR4A 3DDNA 2EP5A 3EF3A 1T3SA 4WBNA 3ZQ6A 4FD2A 1BW9A 2P65A 2BPOA 3EBPA 1YGPA 5COAA 2IYFA 3EZYA 1G291 1TQ8A 1N8KA 2GDZA 3N5CA 5EWLB 1BRTA 5IXSA 5D2CA 1T13A 1B8UA 4X6UA 1KTVA 2Q6KA 4ISCA 1YR8A 1Z39A 3LQRA 4IFEA 3RVDA 4Y67A 2MR5A 4Z7QB 2Y2UA 2JJYA 1JQBA 2GFIA 5AM5A 5A2QA 1OYVA 3D8RA 2IPNA 4LCBA 4NYJQ 5H4HA 4J49A 5AJVB 1J8VA 5D86A 1YIDA 4NONA 2D5AA 4DEVA 1UK9A 4E31A 3H2IA 1LSOA 2PQ2A 2YQ5A 4FMDF 1NXQA 4PGHA 1AB5A 4LC9A 3P2YA 3GMTA 3LQ2A 3P2IA 4PAQA 4G0OA 1P74A 1FVHA 4Y7CA 1BFKA 1YE8A 2PXAA 3OQJA 1Z6QA 4LF7B 2VYCA 4E5YA 1TX4B 4G0QA 2ODQA 3QH4A 1MG0A 1SVWA 2JF0A 3HSKA 1TKCA 1T3LA 5HMLA 4K2AA 3EVNA 4LHXA 1NI3A 3A3PA 3HB1A 1EGAA 3G0IA 4HN2A 4CKXA 1DCTA 2NVBA 5JMPA 3QJ5A 1LNZA 1BXRB 3AUJB 4M7OA 4AT1A 3N2KB 2OA0A 1O7JA 2VKQA 3JAWA 3M6AA 1ZIDA 3KB2A 2YIVX 4WZBB 4HQOA 4IOKA 4NRDA 3JV7A 3VBCA 5JOQA 2Q1TA 4CR8A 1VL5A 4Q9IA 5CXSA 1RRCA 2CL5A 5EP4A 2XA2A 4UEWA 1Z0JA 2I2CA 3DBLA 2EIXA 3P9PA 4EY3A 3UV3A 2O8FA 1IVYA 2A92A 2AK2A 4F2WA 3I6MA 2DE0X 4PXSA 4LY6A 1U8AA 4MS4B 4ZICA 3M6FA 4BLRA 2XJ4A 3BGOS 2FG6C 4A9AA 1IOZA 1U9IC 3WBFA 2AD5A 1VZ2A 1T1EA 2XYQA 3CH4B 3F96A 1E94E 5AWFC 3STTA 2X0IA 4ZZ0A 2E21A 2H48A 3OZTA 5AKLA 5B1IA 3K16A 4Q39A 2RFLA 3TLCA 4N5MA 1J33A 4HP8A 4UNSA 5EXEA 2RD2A 3FMGA 3E9NA 2LBPA 4MRMA 4X60A 1E2KA 1KY2A 3JQBC 4NU8X 3QEJA 4HNAA 1P9WA 1SU7A 1V9LA 3OCZA 2YOFA 1CY2A 3JD2A 3PICA 2GTHA 3WK9A 4D41A 4F6LA 3MLEA 2CC2A 3U13A 4C7XA 3QUTA 2I3DA 3UAWA 2I4OA 2WHEA 3U3KA 2AG1A 2PO5A 2I6SA 3Q9LA 3VAZA 4D96A 1I4EB 1Q21A 4ZD6A 1ZJJA 1Z7YA 2A94A 4LFAB 3IP8A 1QNFA 2CK3A 2R6GA 2QMEA 4KH1A 4AZ3A 1DBVO 3E3MA 1A1VA 3DJYA 1NMSA 1XCLA 2CK3D 2YASA 4MW0A 5FTNA 4D9HA 3KELA 3MT8A 4NK4A 5AUPB 1CLUA 1K7EB 3GRCA 3H05A 4D4GA 2ROQA 4ZCRA 4Y7DA 5ADUS 4G0UA 1TADA 2QORA 3AO0B 3L4JA 2IXBA 3QW2A 1J07A 5TXGA 2BGNA 3BHNA 1QNLA 4MQMA 3ZGLA 1ZK4A 3C43A 1SXJD 1UJNA 1JKJA 1Y8AA 1E1RA 3FSJX 1I2ZA 5IMSA 2ADMA 3BH6A 1W4CA 3LDUA 3S55A 1IL0A 1U7HA 2CVPA 3HLYA 3M9XA 4ARBA 4EO9A 4CG1A 4V0NA 5D00A 1ECBA 1M1XB 2R751 4LMAA 5KX5B 1UP4A 4E2ZA 1DZ3A 3L8ZA 3HL0A 1Y3AA 2LZ0A 4HD8A 5TPWA 2W6ID 4CLEA 3Q8KA 3CF4A 1EFPB 2FW7A 2HDWA 4NE2A 3TINA 1DJQA 1C3XA 1Z16A 1RJ9B 4JT4A 4EGSA 3M6VA 4EITA 1DT3A 1EEHA 3TI9A 3LUGA 1A9YA 4MV1A 1RHJA 1U4SA 4K2HA 2YZ7A 3DO6A 4QX6A 4G2TA 1DNPA 5IBPA 1QVZA 1Y8RA 4S04A 3ET5A 3H8JA 1CY8A 1L3CA 2D5IA 4JVOA 1OBFO 4OOFA 5CHEA 3B5JA 3SSAA 1FDTA 1TU0A 3R0QA 2YRXA 4FE7A 4M0PA 2R8OA 4GOXA 3PGKA 5AFSA 1KEKA 1BWSA 1ZK0A 3Q3IA 2CB9A 4XRRA 2EGGA 3CGWA 4OK5A 3OA0A 3UB3A 3N0TA 4QO7A 1IATA 3R0VA 2QUIA 3DP9A 3INTA 4B4UA 2VXBA 3NC0C 5DCUA 5KSZA 2QD4A 3B2NA 4K6OA 2P40A 2HRBA 2OCKA 4I46A 5G1OA 3UAZA 2QRVB 1CYEA 4PC3A 4AQDA 2XSZD 3FZGA 5A9SA 3ZDDA 2WBLC 3R44A 4BKPA 4ACAA 3PLAE 1Z4QA 1THTA 2QAGA 1JVSA 4QXRA 3DKKA 3F6YA 3LHDA 4IMJB 2H9YA 3WIDA 4G89A 4C05A 1YDGA 2FDRA 3IQIX 3BB1A 3TX6A 5JR3A 3O75A 1I2DA 4JGBA 2P90A 3HDQA 1RPTA 4UNQA 4J16C 1L3IA 4P4UA 4WUTA 1WY5A 4B4WA 2G07A 1BMFA 1FFSA 1X94A 2Q3BA 3MJFA 4MJ7A 2XE6A 3FZEA 4BO5A 2QNIA 3BF8A 5ANRB 2NVUB 4A6DA 4COOA 4NYMQ 1U1GA 4LF5B 2GEJA 4NZNA 1JSLA 1T8SA 4FFWA 5FBHA 2HNAA 1DARA 2ADOA 4KHPB 4UATA 5F21A 2EZTA 1GTJ1 4BWFB 1A2QA 3B6JA 3PPWA 3VH3A 1BS1A 1UBNA 1P9OA 2XCLA 2PXXA 3AHDA 5K6RA 1M2OB 1T3HA 2WFLA 1XP5A 3DVRX 4KE8A 5SZJA 3VH4A 4C5BA 1J2UA 1NXPA 1WVGA 1Z82A 4GWGA 5DLPA 3FOEC 3I9KA 5LDHA 1U1EA 3ROPA 4F3RA 1SVKA 4P4NA 3D8BA 4KL8S 3TECE 1T2DA 1NF3A 2JVKA 4M9ZA 1KJQA 1YCFA 3PC8A 5JS2A 4ZYWA 1I1NA 4KX5A 3UK0A 4YYEA 2XRZA 5AHRA 5CX4A 3G6KA 4MIOA 4B35A 1FXUA 2OHHA 1I2AA 1KJYA 2R8PA 2ZB2A 2B6HA 2PLFA 4G01B 1KMNA 2J30A 2MYUA 3L77A 3NVAA 2I2DA 4PYIA 4YP1A 1PFWA 4MJLA 3VVMA 2D3TA 3MJTA 2DETA 4DIEA 4PHTA 3KVRA 4JU9A 3HR7A 1V35A 2XOXA 4V0LA 4PRLA 5DEOA 1D7AA 2HEIA 5GV7A 4ZVVA 1YU6A 2PCLA 4GE0A 3LC0A 3BFXA 2DAPA 1V3TA 3G0CA 4Q19A 2C9YA 4G0NA 5BRAA 3JQEA 3FWHA 3OFJA 2NPOA 5I7RA 3KB8A 1TQDA 2VF4X 2JLSA 3LW8A 4QOEA 2VR1A 2ZVJA 3REOA 2Q5OA 3ZQKA 5KWSA 2X3FA 2JBAA 2YXLA 3GVIA 1NONA 5F9MA 4A6PA 1DQRA 3CWCA 4DCMA 1ZJZA 3ROQA 3P4UA 1F2UA 4D4IA 1CUAA 1R9MA 2AT1A 3ABIA 4INAA 4JLUA 4X41A 3PXEA 1S4QA 4LYDA 1XEXB 1ZHHA 1I3LA 3GV0A 2QN6A 4F06A 4B6QA 2GKGA 5JC1A 4Z4GA 3GLKA 4KAAA 4RJIA 2O8BA 5FA6A 1AO0A 1XC7A 4YRBA 3NHYA 3K09A 4TRJA 4A73A 3UAYA 5JRJA 2QPOA 3SM9A 5E3IA 5ADVA 4PPNA 2J85A 3KC2A 3DL4A 4MCJA 1JKMA 1VHQA 4OCZA 1GFIA 2JHAA 4OYLA 4WK0B 1H1LB 2UVPB 5BO5A 1XQWA 3D0QA 1ZH2A 3NUGA 5C35A 1AUXA 5EWJA 4I66A 5CP8A 1QP7A 3CF4G 3EARA 1RWNA 1MLDA 4EM6A 4YAGA 4YRIA 4A8PA 2JK0A 3K72B 1GGVA 2PS0A 2O8BB 2R1TA 2Q8PA 2E37A 4RO0A 2YYYA 3RBVA 4AF6A 5BXYA 2G1KA 2HPHA 1G3QA 4WKGA 3GFOA 3T5GA 3UATA 3KLNA 1NPDA 2BR3A 1SKQA 4ZVOA 4HDKB 3L4BA 1E3IA 4TXHA 1ULUA 1COWA 3EXEB 3C39A 4DMGA 1Z5VA 4M86A 3MIZA 4V0SA 3T5TA 4ZAYA 1KY5A 5ECGC 3NBFA 4KI7A 1UBHS 4GR5A 1E9FA 4O0MA 5IP5A 1M7HA 4H3KB 5JCJD 1NHWA 1O57A 2B94A 1ARZA 1CZKA 2YC2C 5HM8A 2ZRNA 5I8WA 3O8QB 5DXJA 1NBMD 4Q37A 3SWWA 3WLJA 2ZDHA 1V4BA 2BMVA 2GO1A 3ECAA 5H0IA 2GESA 2QVCA 4OSPA 2B37A 1ORRA 2X8AA 2C2MA 2FZ5A 4QJ5A 4BFWA 4DWVA 3FKQA 2CXOA 4PGFA 1T4BA 2ECFA 3AP2A 2R8RA 3N2LA 3O2JA 5CXXA 3VPBA 4EZIA 1FXWF 5EN4A 2Q8QA 1E2IA 2IHVA 5KSWB 5DNVA 1D0SA 1T8TA 3A4MA 3JZDA 3OJEA 5A1JA 4TYWA 2Q5JA 4LCJA 3THRA 3PQFA 1EXWA 3O82A 2IZ1A 1I0LA 4O2AA 1CQJB 3HNRA 4M55A 2W6ZA 4XD7A 3RJTA 1O6FA 2FJUA 4K9QA 3OE5A 3EC1A 1FQWA 3B9QA 1Z35A 3LFHA 4X1KB 4CNQA 4YB8A 4BYGA 3BSYA 3F9IA 4Y6GB 3U3OA 2FWNA 1QV6A 1XRSB 4MO9A 4BKOA 5FFMA 1ZI9A 4C0LA 3JD4A 2PGNA 2IOQA 2HHCA 4X85A 2IQ5A 1UJCA 3QWHA 4IUYA 1PGJA 2I6UA 3L0CA 2Y4NA 2B4KA 3Q3VA 4G4SP 4IIYA 4YJHB 1R6AA 3ROFA 3W5HA 3EW9A 3WICA 4AYXA 4E2FA 4WQMA 1MG5A 1G2OA 2G9RA 1G8AA 1VLHA 3QUSA 3B6EA 1R66A 5CR9A 2CFIA 2P2SA 4NZMA 4ZKDA 1JMVA 3C3PA 5BN5B 3HB0A 4GP6A 5T67A 3VSBA 2AB0A 3AX6A 4RSGA 3D1VA 2Y0BA 5JNVA 3E9DA 1D1QA 1MC4A 1P77A 3FLAA 4PNZA 4C4OA 3NDRA 2RJOA 2XNCA 2ZIZA 3B38A 5F64A 1WVIA 3EPHA 2QTVA 3IBTA 3PUXA 4KBFA 3CVOA 4QECA 1KZ7B 2ZULA 3OEWA 3DT9A 5ALXA 1V8ZA 3ZJUA 2IYRA 1IRXA 2YW9A 1BE0A 3AIMA 1CLEA 4GR9A 4L73A 5AM0A 4EUNA 1OZHA 1RIFA 1U6JA 1XNHA 3IAUA 1GP2A 5FPQA 3DZDA 4UU8A 2WC1A 4M60A 3UXMA 2XTZA 3K71B 1T2AA 3GUZA 3A25A 1SRQA 5EIBD 3UJ3X 4EATA 4YQFA 4LJYA 1NGSA 2F3QA 4QYXA 1EKXA 1FUYB 4ZVPA 1E99A 3K2QA 1RYDA 4D9CA 2HGZA 3TM4A 4N8DA 3K0CC 3DWFA 5L8VA 3QYPA 1JB1A 2GNOA 4S1PA 5IYZA 5FPPA 2WW8A 3H99A 2CYAA 2GHRA 1YUNA 3L02A 3IP9A 3PS9A 4FGLA 4JOBA 4CV3A 4E5SA 3PHCA 4BNFA 1XMOB 4OI1A 3AKZA 5MHTA 4MPPA 3JQ8B 4CQJA 2WUWE 2P3SA 3ICWA 2IS4A 3NEYA 5JDCA 3QOFA 2IU4A 1GGNA 1X80B 1U5CA 1K63A 4RHYA 2XUQA 2C7GA 1IPEA 4HH3C 3WKAA 3C1OA 4XWOA 1N7HA 2QN3A 3LL7A 2XUZA 2YJTD 3KKZA 1EYZA 2JAQA 3AR4A 3WXMA 5ADHA 1W5FA 3K8OE 3OIYA 4HNRA 4UEOA 3RCBA 3RIEA 5ITZB 3VMFA 3WLQA 3A6ZA 2FPGA 1OTYA 2WT9A 3HE3A 3LX5A 2P2ZA 2RSLA 3ZXXA 1I3OA 1VKZA 4MCIA 1P0MA 2XXAB 4EY5A 3AEUB 2GXUA 2A1TS 3KSRA 3KKQA 3P0HA 2WP0A 1XKXA 4E08A 4GBED 3EUAA 2F48A 2Q7DA 2Q2WA 4W9RA 2WIAA 1VLZA 2C4WA 2ZJ6A 4M7RA 4J4TA 1OR8A 2ZR7A 4GOLD 5NLLA 4BB9A 4EJ2A 4FR2A 2GBGA 2AI1A 2OM2A 2R3SA 1TVCA 4KN8A 1CFZA 1E8DA 3OCXA 4MDFA 2H1VA 1FP1D 2Q29A 3TNJA 2VDNB 5CB4A 1F17A 3PYMA 3UYLA 5DP2A 1OROA 4CWAA 4BJ1A 3FYDA 2ZRAA 3DNFA 4FZJA 2WF8A 1GQSA 1UAGA 4RF3A 4IQ4A 3T1OA 4YBRA 2VH2A 2EJVA 3OESA 3OSZA 3WHKA 3T1VA 3RKUA 3CVJA 1DG9A 2PZKA 4QYTA 1EXMA 4ZFNA 3PRKE 5AKGA 5IF3A 3COJA 1V6AA 3PFKA 2HQSA 3FCYA 2WNSA 1JE0A 3ZG6A 3IOMA 4DDUA 2XAAA 4DPMA 2PUFA 1MF7A 5CUQA 4XCVA 4KMSA 1DC7A 4D0RA 1EIZA 2VDOB 4EB0A 2WG2A 3OEED 1G7SA 5BSGA 4Z5XA 1DWUA 4AS2A 1UXHA 1KHHA 2V3VA 1TZCA 2HDNB 3G2HA 1AHNA 3E61A 4XARA 1B1CA 2YVAA 3MTQA 4YTEA 2AKEA 2EBHX 5ESXA 1VC2A 3CCBA 4DQ0A 4REOA 4UHJA 3GI1A 4RK6A 2CY0A 1UZMA 4ILKA 2DWCA 2AC2A 1ODTC 4QATA 5HRCA 1M54A 1SBTA 3ZE2B 5EHGA 2W7TA 2R6FA 1C50A 1JLMA 3D3QA 3QUQA 1OREA 1Z17A 2BFPA 2WNHA 1ST3A 4BO0A 2JGLA 1C3OB 1NC1A 2HFKA 3USZA 4CMJA 3KYJB 3WRXC 1EFRD 4N5DA 2X7HA 3W6PA 3LHKA 4P84A 4AY6A 2WLSA 1G4UR 3ELBA 5DI3B 4GL2A 1YRAA 3PQ5A 2HK7A 1UADA 2XGGA 3CT6A 4ND8A 4XYGA 3D3KA 2ZTUA 4EPTA 1Z2OX 3PR2B 5AK5A 3B1XA 4LRUA 3MILA 1JGTA 5JVDB 1YL6A 1FTWA 3QBVA 4D6XA 2DFDA 4MITA 4OEHA 1AXGA 2DFTA 1WCV1 4Z51A 4TS3A 2GAJA 5AKIA 2ZRLA 4N7RA 1UF9A 1WZIA 1DIAA 2E4WA 3BE6A 3II6X 4P3OA 4BNDB 1BCSB 1YFJA 2PX4A 3GLTA 3EJWA 4H0NA 3LLUA 4NU6A 4OM7A 4CG2A 1TMGE 1UQRA 2RJNA 4U7PB 3WRXA 4ZK6A 2EQBA 4ZI7A 3AOEA 3JYNA 3KFLA 3UAGA 5ALRA 4E1VA 5HR5A 2WF5A 5CITA 2R87A 1M9NA 2GMWA 3EA4A 1KEPA 1Y4DE 1UKEA 5JAUA 1OKKD 2EGUA 3I72A 3P5BA 3V00A 4BWVA 1MVNA 3L0YA 4WKOA 1UR5A 5ESDA 5EUMA 5BMVA 5LFAA 1JQJC 2DR0A 1OD6A 2EWWA 3N7TA 4LMBA 1AKUA 1JJFA 1VL2A 2X14A 3E9MA 3U60B 3TMKA 2UYGA 2ARKA 3C3MA 4DSTA 1GNRA 4YAWA 3I9NA 2VIIA 4R69A 2IITA 1MO3A 4FHCA 3BXGA 4RFSA 3RWOA 1PWEA 4EELA 1G21B 5B7GA 5JZBA 3VSCA 4LRQA 3DBVO 2JKZA 4YAUA 4LMRA 5EPUA 3V2UA 4I5GA 1OU4A 1R6XA 2QPLA 3OJWA 1LXCA 1U80A 1UBSB 2W2LD 3DAPA 3QI2A 4PBRA 4ND6A 2ZTVA 1W88A 1DKMA 2JIZD 2Y6VA 2ZWIA 1SMKA 3A1CA 3LT4A 4RWZA 1JBQA 1L1EA 3L41A 4N0DA 4DLVA 3IMCA 4LDPA 3EIEA 3DBIA 3FCOA 4IJMA 2PJUA 1BJTA 4NJMB 5IUJC 3PC7A 5CM9C 3T41A 4AVYA 1T0IA 1AIPA 5TPWB 2BMDA 4MRNA 3JQ7B 2XA1A 3FAZA 3UJCA 4S35A 1E89A 1ULZA 2P0EA 2K4MA 4K9SA 1K0FA 4OJNA 3ME5A 4UXHA 1N2IA 4WY8A 4BMNA 1UC4B 4RQAA 5C5EA 2FP4B 5GZ6A 3WLPA 2PRJA 4OO3A 4DYVA 5KYVA 3ZHVA 2FP3A 4YDRA 4GLFA 4ALMA 2DQKA 3SC2B 1MAAA 1RXUA 1RD4A 1SKMA 1PG5A 2CSUA 4MW4A 3UGQA 3CUSA 1BH6A 3O4IA 3PSAA 2OMKA 2RH8A 4BNMA 1QFJA 2EKPA 1CG6A 2ZSEA 1QHIA 3AUTA 1PYDA 2X0KA 4O4JF 2J0SA 4JB8A 4XSVA 2ZQ5A 1FSFA