3PDJA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with 4,4-disubstituted cyclohexylbenzamide inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
272
structure length
272
Chain Sequence
QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Synthesis and Optimization of Novel 4,4-Disubstituted Cyclohexylbenzamide Derivatives as Potent 11beta-HSD1 Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 101
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pdjA00
2P68A 3AY7A 4CM8B 1TT5A 3ZWXA 1R4NA 1LRLA 5U9CA 1WP4A 1B3BA 1UXJA 1EUDA 2P9GA 2OHXA 4PG6A 3GQVA 1F8GA 1PS0A 4Y67A 1MXHA 4UVDA 5CDGA 4MVJD 4LSMA 1LLCA 1LRKA 4BS9A 3I6QA 5JFOA 1OMOA 1KY4A 1ADBA 3K2BA 3RSHA 4CMIA 1ISJA 3AM3A 3JD0A 3JQAD 3M1LA 1SAYA 4IUYA 3DHYA 2J8ZA 5HWSA 3ASUA 3WMWA 1N1GA 1GL3A 4N5LA 1IUKA 1NQ5A 3C7DB 3KZVA 1LDGA 2RHCA 2ZCVA 2W2LD 2V7PA 3WX0A 5I7SA 5CG2A 3G0OA 2YFQA 2F1KA 1HEUA 2FR0A 1GZ3A 5C7LO 3RFTA 1CWUA 2X5JO 1E1LA 2I99A 2NVWA 4EDFA 4XQ9A 3GN2A 3UFXA 1K3TA 2UAGA 5F1PA 1GQQA 4I9UA 1A7KA 1EQUA 3DBRB 1I2BA 1M67A 1C1XB 4B7XA 4FQ8A 3D4OA 1KVUA 4E31A 2NU7A 3EVTA 1R37A 4NDNE 5G0VA 1TT7A 2XF8A 4HFNA 1HT0A 3WMXA 4A0SA 4BUCA 4CQLA 4E12A 1ZJZA 2WE7A 3MJ4A 3DBHB 5KIAA 1XLTA 3WS7A 3PYMA 4CMAA 2HK9A 2X0JA 4AL4A 4XB2A 1JAXA 3H9QA 1GD1O 4ND1A 1XQ6A 1XWFA 4O63O 2X6TA 4QO7A 2GLXA 2QZ9A 3BTOA 1KETA 2R6JA 3QP9A 2X23A 2E6UX 4FFOA 3MZ0A 1ZNQO 3R3SA 3ULKA 3VHRA 9LDTA 5FWNA 3I83A 4U8GA 1LX6A 5KKAA 4BGIA 4NG5A 1SBYA 1ZFNA 3JQ9A 4IGEA 1G6KA 2ZTUA 3HQ4O 3I9KA 2XXBA 4YWJA 4B8WA 2VZ9A 4BNTA 1HRDA 4XRRA 1E6EA 1ADGA 2O4CA 3WB9A 2HMTA 1K2WA 1FXSA 2G1UA 2GN4A 1HYEA 4CLRB 4INAA 3VDRA 5HA5A 2JJYA 1H6AA 4ZD6A 3BXXA 3GDGA 5LDGA 3EVNA 3PLRA 2D5CA 3QRWA 3TDKA 3TZKA 2IXAA 3SJ7A 2VYNA 1WMAA 1BW9B 1I30A 1RM4A 1UAYA 3FNFA 4MP8A 1ZCJA 3LT1A 5L51A 1M6HA 1IZ9A 3ADOA 3ICCA 3MJTA 5JO9A 1DFHA 1E92A 1ZIDA 4ZRMA 5BSGA 2I67A 4MKZA 4XDZA 1KC3A 1F0YA 2DT5A 3PHJA 3L4SO 5F1KA 5K6AA 1YJ8A 1N9GB 2PD3A 5CEJA 1HSOA 2FSVA 4XWYA 1Y5MA 1CEQA 4MO2A 5U1PA 3PWSA 3A9WA 4EEXA 4CR7A 1PGQA 3QV1A 3DFUA 1LQUA 4R4JA 4Z0HO 2GGSA 3V8BA 2ZQYA 3H9GA 4BHTA 3OBBA 3LF2A 4ID9A 1E0DA 1Z82A 1PL7A 3CXRA 1ONNA 4CUJA 4XGNA 4FSHA 2Q4BA 4PRLA 2Y1FA 2JFFA 4NBVA 4DQVA 4Z6KA 4LK3A 3KOUA 2P9CA 3OJEA 4R5HA 1HZZA 2QG4A 4UUNA 2YHIA 3D0OA 3PQEA 4A5OA 1WDKA 1PTJA 4WOKA 1UXGA 2X22A 3GT0A 2QHXA 3JQBC 1DHTA 3DR3A 3GG2A 3D3WA 2J3HA 4FC7A 2WM3A 4L4SA 1EEHA 2GNAA 4M86A 2F00A 3ZWMA 3TZCA 2B4TO 1ZVMA 2O3TA 1IZ0A 4ALMA 4IDBA 2P2SA 3WJAA 2WD7A 3C1AA 4BL5A 3WGZA 3GZNB 1PZHA 4NIMA 1B8UA 4YJFB 1UZMA 3C85A 4D3DA 3A06A 4FGWA 2V6MA 3KEOA 3LLSA 4L74A 2OXIA 2E82A 5I7VA 2BGKA 1LJ8A 1PJQA 3JQDA 3FWZA 1LI4A 2E48A 4YJDA 5DZSA 1BRMA 1P1RA 1BWSA 1QKIA 3RUCA 2I5PO 2VUUA 4IS2A 4IJVA 2CZCA 3D64A 3NAQA 3VKVA 1ZMTA 4ND3A 3ETGA 1NAIA 2POQX 4DA9A 1F12A 1IHYA 1OC2A 2IZ1A 4XYMA 4WLNA 3ZNNA 2Q1UA 2ZB7A 5HTOA 4BB6A 1LC0A 2ZB3A 1PJCA 2C07A 3QW2A 4L4RA 1KY5A 1G0OA 2Y1DA 5EINA 3DBLB 1DOHA 4BO9A 1CERA 1UP4A 3PZBA 2B4RO 4MVJG 3STHA 2CF5A 3VPFA 4D46A 2BLLA 4YVFA 4MOWA 1XELA 2O7QA 3FHLA 3IKTA 4AICA 2X9NA 5BR7A 2E4AA 3JD3A 3JQ8B 4CL3A 1VL8A 1BXGA 3F5QA 1JU9A 1NASA 4EI2A 3BTUA 1TXGA 1NWHA 1TB4A 4PLHA 1HL3A 4AJHA 1HTBA 1CQJA 3VC7A 4D45A 4Y6RA 1X15A 4UVGA 5G4KB 3RD5A 1ARZA 1YQGA 3UW3A 1I3NA 3UKOA 4ESOA 2VT3A 4BKRA 3GRPA 4BV9A 3RBXA 1HE3A 3GVXA 1H9BA 4IDDA 1KIFA 3AOEA 1L1FA 3IJRA 3VZSA 5DULA 3U49A 1AHHA 2VNAA 3W6UA 3ZWOA 3ZHBA 3K31A 2V6GA 5TIIA 2YV3A 2EV9A 3MJSA 3Q9NA 1U28A 5I8ZA 4BMNA 4CV0A 1PJ3A 2NACA 3GH3A 4PG8A 1LSUA 4HFRA 3TZHA 3PK0A 3GGPA 2FMUA 1QRRA 2P4QA 1G1AA 1UR5A 3ZCXA 3I5MA 1JKIA 1YOVB 4XX0A 3VZPA 4IXTA 2VWPA 4RVFA 1MFPA 1EVZA 4NMHA 1E1KA 3LQFA 3UH1A 1LSJA 4CUKA 1A4UA 1T2EA 4BKQA 4K28A 2Q99A 1ID1A 1Q7CA 5G0WA 4ZICA 1P0FA 1YONA 4YRDA 2NU8A 3QIVA 5IZ4A 1LA2A 3R0IA 3PWZA 5H83A 5TNXA 4Z9YA 4QUKA 3KO8A 2FZWA 4YAKA 2DLDA 1R6DA 1E3WA 3MJEA 2NNLD 2Q2WA 4DBZA 1U1IA 2CVZA 3ONDA 5F5LA 1OOEA 3JQAB 4W7HA 1VPDA 3RAJA 1V35A 2WYUA 1EFKA 4J7XA 3ZN2A 4ZHSA 4RVUA 3UGKA 3OIFA 2P9EA 2R2GA 1T1SA 4LRSB 3DXFA 4WKGA 5TJ9A 1DB3A 5DT9A 3GAFA 3GMDA 4UAGA 2Q2QA 2PA3A 1Q0HA 4CM7A 3VOSA 4YDRA 3KSUA 3DBVO 4CQMA 4R5MA 1SNYA 3CMCO 3GNQA 1Y8QB 2FHSA 3RUIA 2RH8A 3F46A 4HFJA 1GFSA 1AGNA 1FMCA 5COBA 4RGBA 4B4UA 5KTKA 3PGXA 1CDOA 4QQRA 2Y66A 3CTMA 3K5PA 5DCUA 2E37A 1LNQA 1P45A 4GKBA 5A04A 4PG5A 2O3QA 2PZJA 2V6FA 4DC1A 5EESA 2O3SA 4LRTB 1MUUA 4YAJA 1B2LA 4XQCA 5KKCA 2XPCA 3PFWO 1FF9A 3ZWVA 3GF4A 1P1FA 4ZU3A 2GZ2A 2ZTMA 3NUGA 4IQ0A 1DXYA 4JBHA 5DNAA 4IDGA 4IJWA 4U0JA 4C7KA 4TWRA 2Q1SA 1U5AA 4MVJF 1DFIA 1UDCA 3WGIA 3HADA 2PD4A 2GZ3A 3BMCA 4X54A 3U4DA 2B36A 1GPJA 3IJPA 4CM9D 4L76A 2OP1A 1D4FA 2VZ0A 4RF2A 3BIOA 1DLIA 5FI3A 4YJGA 1WMBA 4DQXA 5FEUA 4Y8VA 3RKRA 3NYWA 4BGUA 5BNIA 5G0SA 2EWMA 4RPLA 1DRWA 9LDBA 1N5DA 1YE3A 2IRWA 1E3LA 3IS3A 3GEDA 4OIMA 2X4GA 4E0BA 3KTDA 1BGVA 2Q2VA 3HN2A 3IMFA 3OICA 3EW7A 4FCCA 3RU7A 1E7SA 3BMNB 4AJLA 3AI1A 5T64A 4ND5A 2EEZA 4JROA 4CM4B 2DAPA 4M89A 1G0NA 1KEVA 1I3LA 4BNZA 2AEJA 3K96A 4BO1A 1GTMA 2EKQA 3DONA 2VWQA 1NHGA 1MXFA 1F17A 3PHIA 4WCDA 2A4KA 5KCZA 2DTEA 2X5OA 3F6YA 1V3TA 1HYGA 3PHGA 4IZHA 2VRCA 1ISFA 2JAPA 3UCEA 3HB4X 4J4BA 3G49A 1NAHA 3S55A 3CH6A 3UAGA 2DUWA 2HMUA 3BMQB 5L9AA 3DC2A 4R1SA 2GR9A 3KEQA 1DIBA 4J0EA 4PLFA 1H9AA 3ZDFA 3ZNOA 4DL9A 1R4MB 3DZIA 4J2OA 4AG3A 1NFQA 1NNUA 4JBIA 5DCYA 3QWHA 4DMLA 1N1EA 2X5KO 4CV3A 5LDHA 4XB1A 2O3UA 4DXHA 4BO7A 4BIIA 1ADFA 4LCJA 3JYPA 1CQIA 2DQ4A 4CMCA 5DBIA 3V2GA 4OO3A 3GLQA 4J7CA 1VSVA 2Z1MA 1PIWA 3WTBA 1A9YA 2JHFA 5CHEA 3IAHA 3ZU4A 4ZJUA 1HDCA 1SO8A 1EZ4A 4JXKA 2V65A 5A05A 4ZQFA 1QV7A 3L6EA 4AJJA 3JQBA 1ZXBA 2RAFA 4J1QA 3CZRA 1D7OA 4WLFA 2C29D 4NHEA 1ISGA 2FRDA 5EN4A 5CPBA 3PWKA 3WGYA 1GUFA 4PG7A 5GZ6A 5CFZA 2OO5A 1E7YA 3CE6A 4F6LA 3FN4A 1KVQA 2BFOA 3E9MA 4U6SA 1ENYA 3UXYA 4C4OA 1QLJA 1LXCA 3M6IA 3OHSX 1E7WA 2PR2A 4HP8A 4QT0A 1P44A 1ONOA 4ND2A 4YAIA 4RJTA 3O38A 1MG0A 4BO4A 1LSOA 2FZEA 4EJ0A 3KUXA 1WW8A 3VH3A 1E1NA 4E2YA 1TT5B 1R4NB 4YT4A 1WWKA 1FDUA 4FGSA 5G0UA 5TS3A 3VH2A 3WYEA 5L40A 2HU2A 1UXIA 1X0VA 2YY7A 4TQGA 4KUEA 1UUFA 2ET6A 3PTZA 4FOSA 3CUKA 3WFIA 2Y67A 4NPCA 3AM5A 4CMIB 2PWZA 3AM4A 1QLHA 4PLTA 5JY1A 3UHAA 3DZJA 2VHVA 1ZZEA 3DMTC 3U9LA 1ZK0A 4GL4A 3E82A 1DIRA 3K6JA 4BO0A 1DJQA 1P1HA 2NUAA 5EL0A 3OH8A 4F6CA 4IGFA 4YRAA 3BTVA 3AY3A 2IE0A 5A3VA 2NU9A 1DIHA 3IP3A 4LCEA 4ALNA 3QVXA 1TA4A 3ANLA 2Z1NA 4TKMA 3A28A 4HXYA 3GDFA 1F06A 4E2XA 2J5RA 1O5IA 1SCUA 4DYDA 4CQLB 5G0TA 2H5LA 2B5WA 1XIVA 2JD0A 4GSKA 3QVTA 3C7AA 3AOGA 3GPIA 3GRKA 3F3SA 4TRRA 1TLTA 3VPSA 1E3JA 3Q2IA 1XKQA 4OXNA 5JO0A 3WBBA 1J4AA 4B3HA 4NBRA 4WCFC 4FB5A 3KLMX 3AWDA 3D3EA 2I76A 4N18A 5COQA 2AQKA 4CL8A 4FFMA 4ITUA 5A3JA 3Q6IA 5KJFA 1O94A 3AI2A 1O95A 3AJRA 2DBZA 3LF1A 2FWMX 4KTTE 2ZIZA 4K6CA 1IULA 2WD8A 1C1DA 2IZZA 2X0IA 3KSZO 1R4MA 3M2TA 4KQXA 4PZCA 4RF5A 4LMPA 4PLGA 1YQDA 4DPKA 3JYNA 1V3UA 1B3RA 1QYVA 4BNVA 4XIJA 4II3A 2GDZA 1WDMA 3GEMA 5L4LA 3Q3CA 2R00C 4OXKA 3TJRA 1ZK1A 4Z9FA 5ICMA 3D4NA 1PS8A 4RVGA 1KVRA 2Q4EA 4IDCA 4ILKA 5F21A 4G5HA 5K0ZA 5DOVA 2BELA 3PXXA 3QQPA 4HKTA 3C1OA 3PYLA 5AXBA 5JMPA 1P3DA 4HADA 4W7IA 1FDTA 2UUPA 3O8QA 3PHHA 1WAMA 4OSPA 4P38A 2I3AA 4WK6A 5JC1A 3SVTA 4WLVA 2VHZA 2CMDA 3P5SA 1VC2A 4QSMA 3SC6A 4YYZA 3AY6A 4KOAA 4D79A 2XXJA 1AN9A 4Q39A 4YXFA 5JAMA 1HSZA 5KJCA 4AJEA 3ONEA 3WLFA 4NNJA 4WGGA 1LRJA 1Z7BA 2YW9A 1NPTO 4EITA 4FFNA 4E2ZA 1JN0A 1LEHA 1Z45A 2C82A 1FJHA 5CDSA 4E33A 4UULA 4D42A 3DAGA 4GX2A 4OM8A 2YHIB 2I3GA 3CZMA 4R41A 1RKXA 1LTHR 2Q1WA 3DTYA 5BNFA 3TPCA 4GI2A 1RJWA 2HCTA 3ZWYA 4HNGA 2J5KA 2AA3A 2YJZA 4B4WA 5KOIA 3D3WB 1EDOA 4DTIA 5T5QA 4GLOA 3HB5X 1F14A 3ROQA 4I1IA 2C0CA 3S1LA 3P7MA 4ZRNA 1LDNA 1Y1PA 3IQDB 3NJ4A 3WXBA 1VL6A 4YB8A 2WD7B 4XEHA 5FYDA 3ROPA 4BMVA 5CP8A 5JPIA 3H5RA 3MOIA 2O23A 2NVUA 4JP2A 4PFJA 3GVCA 2P4HX 1DC4A 2PKRA 1PJBA 4KWIA 3KB6A 3GR6A 1YGYA 2VYVD 1QYXA 1PL6A 1ENZA 4JX8A 3NTRA 4GPD1 3Q1LA 1KS9A 1NFRA 4PIVA 3TZ6A 3W4JA 4KZPA 4FPXA 3VVCA 3KXDA 2Z95A 1BMDA 4TRJA 1ZO8A 2QIOA 2C7GA 3GMSA 3ITDA 4IINA 4MDHA 2O50A 4D7AA 4K6FA 4LMRA 1A7AA 2JL1A 3ZW8A 3RFXA 1OAAA 3WQRA 1U2GA 4BB5A 5HS4A 3L07A 3MOGA 4PZEA 2Y0CA 5IFLA 5AVOA 1KEWA 1LLUA 1XYGA 1IPFA 2DBVO 4I5DA 3W4IA 4E5YA 3DOJA 2NADA 5B4VA 1P31A 4L8VA 3D7LA 4TMFA 1A71A 4FIZA 4XDYA 4NJOA 2HLPA 5L4SA 1SZJG 1DAPA 5JW6A 4L9RA 1BXGB 4NK5A 4P4LA 4E21A 3E5RA 1EFLA 3K73O 4MVJI 1CIVA 3OQ6A 1K6IA 4JLWA 3WWZA 1ZW1A 1WPQA 1YBMA 1JLLA 1O9BA 4GGPA 4OKIA 1UZLA 4AJ4A 4D43A 2I66A 1K6JA 2HRBA 5IDYA 2HAEA 2ZB8A 2D5AA 2JD1A 4MP3A 4MJLA 1EQ2A 1HE4A 1IPEA 2W8ZA 2YYYA 4IZIA 2PH3A 4JP3A 5TC4A 3ST7A 4BNMA 4OL9A 4OAQA 4RF4A 2HMSA 5LCXA 5BSHA 2Y1OA 3L9WA 3ZHZA 4B79A 1PZFA 1HE2A 3SJUA 1KVTA 3TL2A 1IOLA 4GQAA 4GX5A 3ZGYA 3L9XA 6LDHA 4CR6A 3HJAA 1HDRA 4Q3EA 3H7AA 3KV3O 3WOHA 2Y1EA 2JCYA 4IMPA 4NZ9A 4TVBA 4A27A 1IHXA 1DDOA 1ZK2A 3OA0A 2PLAA 2A9FA 1HDXA 1X7GA 5ER6A 1KC1A 1Y81A 3KETA 4CV2A 1QYDA 3K9QO 1SOVA 2AEMA 3HFGA 4YT8A 3EHEA 1PR9A 1PR3A 1H2BA 4EBFA 5GMOA 1I2CA 8LDHA 5A4DA 3WBFA 4XR4A 3H6KA 3KYBA 4BKPA 2PFGA 5JCJD 1NQTA 3GVHA 4EUFA 4FFLA 4E30A 3F47A 2CNBA 3HN7A 1MGOA 4RQTA 3W4KA 4HBGA 2AE1A 1CETA 1MP0A 3VAZA 2CVOA 1E3WB 1TVEA 3R6DA 1VJ1A 3RUHA 4YQZA 4BGVA 4WUVA 2TMGA 4WPGA 1NWCA 3COSA 4FC6A 1T4DA 1AXGA 1I01A 3ORFA 4Y6SA 2WDZA 4CPDA 1PWZA 4IDEA 4E6PA 4R9RA 3D5QA 1PGPA 1T2CA 4YACA 1P0CA 3CIFA 3RJ9A 1EK5A 3RBVA 4M54A 3ZWWA 2C7VA 1O89A 3JD4A 1QV6A 4J3FA 1YDEA 1GZ4A 4B7UA 1UXHA 2Q3EA 3ANNA 1VSUA 3JV7A 4IS3A 2VQ3A 4CQMB 4DPLA 2D2IA 4H7PA 3BHJA 5A5FA 4PCVA 5DF1A 4S3MA 2IDZA 3AUSA 2PZKA 2CDCA 2CFCA 4P4NA 3OJFA 1XDWA 3VVBA 5JLAA 4WNCA 2IYPA 4CLXA 2GN9A 3DMTA 3OM9A 4Z0PA 1YB4A 1AE1A 3ZWAA 3WSWA 3EUWA 4D44A 3DEYX 5B37A 3C7CB 3ZW9A 4RVHA 3IOYA 3RJ5A 4DIFA 2OOSA 1AHIA 4QO8A 3S2EA 3SX2A 4F45A 5MDHA 1BSVA 2RHRA 1Q7BA 4PZDA 3U4CA 2JCXA 4W6ZA 4RDHA 5L7WA 1I10A 1YDWA 1NBOA 4CMHA 5KJ6A 4BMSA 3WG9A 4B7CA 5EERA 4HFMA 1MA0A 3L77A 2ZJ0A 4IDAA 4YTEA 3OJOA 4IJUA 5ENVA 5JCXA 3BMCB 2TMDA 3X2FA 4IDFA 4PVCA 1RWBA 3DQPA 3PQDA 1LDBA 1Q1NA 3OA2A 3KLPX 1LQTA 4WCFA 1HKUA 4WLOA 4EEZA 4KTVE 4YJGB 3WNVA 3MJCA 4OXYA 2W98A 1WLYA 2D59A 4P8RA 4L75A 5CDUA 1L7DA 4BNKA 1XQ1A 4C7JA 5L95A 3G3EA 5ITWA 1LUAA 4K9DA 2OMEA 5DBGA 3NT5A 3PJFA 3G1UA 2YQ5A 4WLEA 1X0XA 4D3SA 3GK3A 3FNGA 2WSBA 4E2WA 3HHPA 2J3JA 2ZKLA 3RU9A 4IXWA 4MVJM 4LN1A 4YQYA 4ZA2A 3JYLA 1R15A 3WIDA 4D0RA 1HETA 4RPHA 3GAZA 1CRWG 2X1HA 1JA9A 4QECA 2R00A 4O0LA 4J4TA 3S2FA 1EBUA 1SMKA 1JVSA 1PJLA 3DTTA 3K2EA 1U7HA 3KYDA 4CV1A 1YL5A 1H2HA 2WTBA 4LVUA 4E32A 2UV8A 3GFBA 3UOGA 1X7HA 3X2EA 1JKJA 2PY6A 3U5TA 2EW8A 4Q3NA 3O4RA 3OJ0A 2GN8A 5GY7A 1MB4A 1ZBQA 3K92A 3LC7O 3GA0A 5HS6A 5HM8A 1EVIA 1ISHA 2RBEA 2GPTA 4NK4A 3CPSA 3B1FA 5TX7A 3HUDA 1VLLA 3ICPA 4ALLA 1D1SA 4BNWA 3NGLA 3HNPA 3PDJA 3H5NA 1PGJA 4J4HA 4YT2A 4A7PA 3DOOA 2WYWA 3RVDA 2Y05A 4W99A 3QA9A 3ZV6A 1VI2A 3JQFC 3OEWA 2VHWA 4ND4A 1SEVA 1N7HA 3PGJA 5KVQA 2VYND 3WGQA 1R66A 4TRMA 4CJXA 4LISA 2C59A 4ZQEA 4Q3BA 1CF2O 5IDWA 3MTJA 4MIYA 3UICA 8ADHA 5EJ2A 1QYCA 1LBEA 1U8FO 1R16A 3FCOA 1NPDA 3QSGA 1LDEA 3F4LA 3PPIA 3QY9A 3TL3A 1DLJA 3VPHA 1ZSNA 4CLOA 3VTZA 1QR6A 2IODA 3I23A 4OKNA 3U0BA 1YB5A 4Q3CA 5TQVA 2QRJA 3I1JA 2YHUA 4GWGA 2BKAA 2FSSA 4E5PA 3DMYA 2AMFA 3NTOA 4IM7A 3VZRA 1NTOA 1PX0A 5DP1A 2CD9A 4KQWA 3VPGA 3HDQA 1SPXA 1P33A 5I7FA 5CDTA 5KVVA 4TZKA 2ZTLA 4HUJA 3V1UA 5C7IO 3DZHA 3GUCA 3WGOA 1MFZA 3CINA 1X1EA 2WEKA 1LC3A 1B8PA 3JD2A 5H81A 2EGGA 1CYDA 4A73A 5L45A 3INGA 5TT0A 2FR8A 2VT2A 3GFGA 3TN7A 1FDWA 1I33A 2GZ1A 3QWIA 1VRWA 4HV4A 5JS6A 2GUGA 2G5CA 3WR5A 3E5MA 4RZHA 3A1NA 1YB1A 2G76A 3BMOB 3DZGA 2YQ4A 1TI7A 4B4VA 5ADHA 2VNSA 3FBGA 2AG5A 3TRIA 4TRNA 1W6UA 3JQ6A 4DLAA 1J0XO 2PTGA 1HDGO 1ZMOA 5EIOA 1B8VA 4D3FA 4DUPA 2DU8A 3W8EA 3H9UA 4GVLA 4MP6A 3FNHA 5DBFA 3H3JA 1RYDA 4P4GA 5HBRA 2VHXA 3TNLA 1M2WA 3TF5A 1H0KA 3JYQA 3WDSA 4RCVA 5IDQA 4N54A 3OIGA 3GGGA 1JW9B 3GNTA 3L6DA 4P22A 2NTVA 4BO2A 3WQSB 5T8KC 5JBIA 4OMUA 1C0PA 5LC1A 4RLSA 3OFSA 4F46A 3H8VA 2PGJA 3N74A 5FI5A 1FDSA 1N7GA 3E03A 1GDHA 2VN8A 3AUTA 5CDYA 3QVWA 1K5HA 1BXKA 1SC6A 1LDMA 4XR9A 4LGVA 4K1LA 4B8ZA 1ZEMA 3FR7A 3U4IA 2EHDA 2BI7A 3TSCA 3ZU3A 4R16A 4LSWA 1I24A 2OUIA 5IZCC 1ZK4A 1C1DB 3CMMA 2PD6A 4KDFA 4NJMA 1U5CA 4NFSA 3ZU2A 3E18A 3KYCA 4R1NA 5JDCC 4WOJA 1T24A 1GZ6A 4M8SA 1PZGA 3LC2O 1Q2XA 1GYQA 4JCOA 3U3XA 3AU8A 4E3ZA 1VJTA 2HUNA 2OP0A 3ENNA 4A10A 5I7EA 5BSEA 3WTCA 4ZQGA 3T7CA 3V2UA 1DC5A 3O26A 2A35A 3PVZA 2H63A 3I3OA 2ZJ1A 3GDOA 2VOEA 3H65A 2HK8A 4RLHA 1M75A 2D0IA 4AJ1A 1KEUA 1C0IA 1U3UA 2ZCUA 1P1JA 1MC4A 3QE3A 4PLYA 1PJ2A 3O8QB 5B4TA 4WASA 4MVJA 1TEHA 3INTA 3H9EO 5I9MA 3FWNA 4ALJA 2YDXA 2EERA 5A1TA 1W8DA 5I9LA 3A4VA 3UCFA 3VH1A 5EMHA 2AG8A 2UDPA 5IXYA 2SCUA 2OL4A 4DIBA 4BGEA 3I9MA 1HF3A 4D41A 2W2LA 3O03A 1Y8RA 4DC0A 3E48A 1ORRA 2B83A 1YL6A 2PGDA 4IIVA 1NFFA 5JYEA 3I52A 1A27A 3JQEA 5ENDA 4YPOA 1XG5A 3H4VA 3ZWBA 2C54A 2I65A 3E9QA 2D4AA 1U9JA 2ZYAA 2X9VA 4YT5A 4ALIA 3WJ7A 4JK3A 1WZEA 1SB9A 2C2YA 1ZK3A 4GMGA 3N58A 4RORA 3LYLA 3ETEA 3SEFA 2GO1A 4J2HA 1HLDA 4NFYA 5TJHA 1Q7GA 1S7CA 4TSKA 3BMOA 2QZZA 3JCZA 1UXKA 2A94A 1DRUA 1V9LA 1RM5A 1KBZA 1VKNA 1EUZA 1EVJA 5KJ1A 1YJQA 3T4XA 4CM1A 1ML3A 3K30A 1U4SA 1ZH8A 1P74A 2NVUB 1BG6A 4O59O 4CQMD 3RASA 1YO6A 3ZV4A 3PJDA 4CMEA 2O7SA 4G2NA 1T2AA 2G0TA 4FD3A 3B20A 1WDLA 3EZYA 5BNTA 1GEGA 1PGOA 3PZRA 2EW2A 3ONFA 3PI7A 4CODB 2FR1A 2VWHA 1HDYA 3FF4A 4Z3KA 4WEOA 3ZWCA 1I32A 2OORA 3D1LA 1Y9EA 2BFAA 2DM6A 2DPGA 3WIEA 1EK6A 2X86A 1V3VA 4GMFA 5A06A 2BH9A 2PV7A 3JQGA 4TROA 6ADHA 3PP8A 2PKQP 3V1YA 3E6AA 4PG4A 2AHRA 1DRVA 2VZ8A 3OQ1A 3PEFA 4U7WA 4H16A 1OI7A 4YCAA 4EGFA 5IN4A 1YQXA 2FPGA 4Z9XA 4ZQBA 4DRYA 2FPIA 3K8ZA 4FJ1A 4G81A 4EJ6A 1M66A 2HQ1A 5ICSA 3DDNA 3JTMA 2VTDA 4AJIA 3DL2A 2FP4A 3GG9A 4XQGA 1NQAO 2W2KA 4KUHA 4GH5A 3RC9A 1GADO 1GV0A 4HX5A 1JQBA 2D8AA 1UH5A 1YL7A 3BZUA 3OIDA 3PIDA 1RM0A 1GYRA 2C2XA 4XKJA 4FJ2A 1HXHA 1RYEA 5GZ1A 2WWRA 2GF2A 2ZATA 3VKUA 3RBZA 5GZ3A 1EUCA 2CF6A 3Q2KA 3TFOA 4JIGA 1YXMA 2XOXA 1XSEA 3HDHA 2EIHA 4L0QA 1XEAA 5B4UA 5IF3A 2X0NA 1JTVA 2Q50A 3GHHA 5I9NA 2O48X 1LLDA 2UYYA 3BHIA 4FS3A 4FW8A 3C24A 2QYTA 2RH4A 3JQFA 5IDXA 1Z7EA 5C37A 4QX6A 4MVJH 4MKXA 3W8FA 5TF4A 2DC1A 4QXMA 3FRJA 2G17A 2LDXA 4BNJA 3OECA 4URFA 3QWFA 3FBTA 1I36A 1R0SA 3RUAA 2H6EA 4NU6A 5L4NA 3FR8A 4GSLA 3W6ZA 4GVXA 4IQ8A 2EJWA 1FK8A 2VRCD 3DO5A 3EGOA 3GEGA 4J49A 4MKRA 4W4TA 4ALKA 4FJ0A 4E5MA 1XCBA 4MIOA 1OBFO 4PLZA 2GN6A 4BQRA 2WE8A 3QVSA 1PQPA 4J9UE 1GYPA 3TWOA 2AQIA 4XCVA 3HWRA 3NEPX 1GU7A 1ULSA 1I8TA 1E1MA 2ZQZA 5C5IA 3QVOA 4PLPA 4XD2A 3RI3A 1T26A 5IXSA 1ZJYA 2FOIA 3FSRA 2HDHA 2JKVA 4CMJA 2DBRA 2B5VA 3S8MA 1BDBA 3GN1A 1I5RA 3PQFA 1B0AA 4UEJA 5K9ZA 3HE3A 1L7EA 3I6IA 1Z6ZA 3DZKA 5HRUA 3ZV5A 1A9ZA 2EXXA 3L4BC 4R3NA 4Z3DA 5A9SA 4LVCA 1PGNA 2O3RA 4Y98A 3NX4A 3LDHA 2UUOA 4E5NA 2I6TA 2AQ8A 2O4UX 5BQFA 3WSVA 3I9OA 3PYXA 2NQ8A 5JDIC 3MJVA 2PGLA 2Y0DA 3AK4A 1PZEA 5JYDA 1E5LA 1LLQA 4TVOA 4XQEA 4E4YA 2PZLA 3I9NA 1U3VA 5J23A 5AOVA 3ZNQA 1GCOA 2CVQA 2AE2A 2QW8A 1U3TA 3NV9A 4UVIA 5F5NA 3JQ7A 4BO6A 4JN6B 5BT9A 5B12A 2AQHA 1H6CA 3NTQA 2LDBA 1ADCA 3RQSA 5L53A 1DHRA 4NBWA 4QFDA 5JMWA 1HLPA 4BNUA 3C8MA 3RC1A 1MX3A 2JD2A 3E1KA 1NPYA 2W4QA 4J43A 1YS4A 4N7RA 1XA0A 4ROSA 2VRBA 2DPHA 4YJHA 3F1LA 3EYWA 1EE9A 2HO5A 5G4LA 4DGSA 3UCXA 1I0ZA 4BKUA 1P77A 4DVJA 1C3VA 3QWBA 1T25A 1DC6A 1SEPA 2NTNA 5T8KA 1D3AA 1U7TA 1JVBA 1DC3A 2YUTA 4UUPA 3BYZA 2V6BA 3OMLA 4OOFA 4NR0A 2DBQA 2X58A 4WCFB 4BVAA 2PK3A 4BO5A 4BV8A 3RCBA 4YBZA 1U8XX 3RFVA 2NV6A 3ZHYA 1GQYA 2OBNA 1VL0A 4B3IA 4BKOA 1WVGA 3NGXA 2Y1GA 5AXDA 4E5KA 4TZTA 4FFPA 2X0RA 2GD1O 3B1JA 4H15A 4IY1A 2BRUA 2DUUA 2AXQA 5IZCA 2OGUA 2C20A 1M6WA 5F1OA 3ZNPA 1PWXA 4O6VA 3BAZA 1NVMB 3P2YA 2CY0A 4ONEA 3HFSA 4GLLA 5JDCA 1IY8A 3TQHA 1PJTA 1V8BA 2Y0EA 3R3JA 3LT2A 4RO0A 1DO8A 1UAGA 1LSSA 4R3WA 4KP7A 5ITVA 4B3JA 3LSYA 1PJSA 1E6UA 1ULUA 3NT4A 2HJSA 3KYDB 2EP5A 1JWBB 3AI3A 1RPNA 2J3IA 2O2SA 1W0CA 1ZEJA 4JGBA 3E8XA 2HJRA 3H3FA 1W73A 3HDJA 3KBOA 5AXAA 5IN5A 3KSDO 1I3MA 3S2IA 1OC4A 5A5EA 5IG2A 1JWAB 5JY6A 2B35A 2W90A 3Q9UA 1SOWA 2FN7A 1DPGA 4NI5A 4PLVA 2GCGA 3HDYA 4CLDA 2P5UA 2BF7A 4YRBA 4MPDA 1P1IA 4DLBA 3LZ6A 5A9RA 2Y99A 3JSAA 3QHAA 4UEKA 1EVYA 2BGLA 3EMKA 4CM8A 1XR3A 4L4XA 1QP8A 1T1RA 3A14A 1NQOA 2PH5A 1NXQA 4YA6A 4XYLA 3L0DA 1GQ2A 3ASVA 3EC7A 3NRCA 2X7HA 4BO8A 4CUZA 1GUYA 4H3VA 4O5OA 1X1TA 5THKA 1QSGA 4J1SA 4J90A 3HSKA 2CDBA 2HRZA 3RUEA 3KM0A 1A4IA 4I08A 5AYVA 4CLOB 1J6UA 2WYVA 2ZB4A 3ZU5A 4CLHA 4XYBA 3EK2A 4XYEA 4NBTA 2P91A 1E3EA 3PIIA 2NLOA 4CM9A 1OFGA 4GX1A 3IUPA 2EJVA 4R9SA 3RC7A 1M76A 5KVCA 2EKLA 1X7DA 4Y6PA 3E9NA 3ABIA 5FFFA 1EE2A 2C5AA 3FI9A 3UF0A 1UP6A 2PZMA 4OOEA 3WGTA 2YDYA 2DFDA 3DBRA 2E49A 1C1XA 1HE5A 1NHWA 4CM6A 3W8DA 2YZ7A 5G2OA 2NTJA 4L73A 3AFMA 5MGBA 1PEDA 2FY8A 3FNEA 1XGKA 3DBHA 1VKOA 4CMEC 4J91A 4CR8A 4I8XA 3Q0EA 3I9LA 4K26A 1D8AA 1UDAA 4PLCA 4PVDA 1E5QA 4IIUA 4ZGWA 3PJEA 4YR9A 5C3MA 3C1TA 4U5QA 4GX0A 1E3SA 1DBVO 4RVDA 4PLWA 4KMSA 1DIAA 3F5SA 5U4QA 3C3XA 3VZQA 3V5NA 2GASA 3VH4A 3ZI0A 4W9NC 1KERA 3QJ5A 1J49A 4DLLA 2ILTA 3INRA 3WGGA 5EPOA 3VDQA 4RPJA 3RWBA 4JJFA 3GUYA 1XU7A 3LU1A 4ZVVA 1Y9AA 4OJNA 3ZWPA 3IL2A 1V6AA 4NU5A 4FDAA 4GBJA 3F4BA 4UEOA 2VCYA 4CLRA 3RKUA 4I9HA 3DFZA 1NVGA 3ON5A 4DIOA 2EP7A 1Q0QA 1YWGO 3L6OO 1BVRA 4Q9NA 4EUHA 4O1MA 1FDVA 4MIEA 3U4HA 4I5GA 4M55A 5JC8A 4OGWA 1BW9A 1HYHA 5DN9A 1MV8A 3SLGA 4I5EA 4IBOA 2YV2A 2IEBA 3CEAA 2UVDA 2Q46A 4AJKA 5EQFA 3GOHA 3D4PA 4RPGA 1YBVA 3HG7A 1NR1A 1T2DA 2BFMA 1N9GA 3G17A 4FBGA 4AJNA 4NH4A 5KWEA 3DHEA 1PL8A 4RDIA 2GRAA 2J5QA 3GGOA 4IPTA 1E3IA 3RC2A 5FF9A 3ANMA 3OQBA 2FPPA 3QLJA 4NJMB 1PJ4A 4RPKA 3ZHXA 2HMVA 1DIGA 3KYCB 3IC5A 1EBFA 1Z73A 1XU9A 1X14A 2Q1TA 1E7QA 1X13A 2D3TA 3LLVA 1NX6A 4EYEA 3WYCA 1NVTA 1BTOA 3DZFA 3OJLA 1F8FA 1T2FA 4CLEA 2B37A 3IDSA 3S2GA 4BOYA 1ONPA 3B70A 1C0LA 1E6WA 3MWDB 4PGFA 3ROMA 4WEQA 4KUGA 1NYTA 3NT2A 5JNLA 3KHUA 2P5YA 2EF1A 5IAAA 1V0JA 1EDZA 3ZWNA 4Y9DA 2J3KA 3IKVA 3P2OA 3DB2A 3NDRA 4OYRA 5CEFA 3IP1A 3PLNA 4IJKA 3JD1A 5ILOA 3GVIA 4FR5A 2C5EA 4CMGA 1UJMA 1HDZA 3ADPA 4XA8A 1N92A 3GZNA 1KYQA 3L4BA 4WLUA 4YJFA 4OQZA 1Y8RB 1GEEA 3ITKA 3LT0A 1AXEA 2A92A 4EW6A 2QQ5A 3B6ZA 4R01A 4YAEA 4R68A 4GWKA 4J7UA 2JFGA 4W82A 5JDIA 5I8WA 2CSUA 3NJ8A 1E77A 1I2ZA 3RROA 4FOOA 4YAGA 2HSDA 3W1VA 2IXBA 2VUSA 5IJZA 4J9VA 4BNIA 4CM5A 4A2CA 2GYYA 4NFHA 4U6QA 4MVJE 3ZV3A 1GV1A 3JYOA 1H94A 4QTZA 1B7GO 3CSDA 1GAEO 1GPDG 3WNQA 5JE8A 3AU9A 5CG1A 1PU2A 3PDUA 3SXPA 1SB8A 1QORA 1LDYA 3O9ZA 2X9GA 1ZSVA 2OFPA 2OBYA 4OQYA 4R69A 2O2YA 4RF3A 4WE3A 3DBLA 1T4BA 2DFVA 3ENKA 7MDHA 4J0FA 3IIEA 1J5PA 3FD8A 3ZZNA 3DWFA 4WECA 3OETA 1Q0LA 4HNHA 3TOZA 4RQUA 2YV1A 1KEPA 4EJMA 2X8LA 3GNSA 4MVJP 3JQ8A 1Y7TA 4GAEA 4OHUA 1KOLA 4EUEA 4RL6A 5THQA 1YRLA 4XZ3A 5KJEA 5L7YA 2J6IA 2ZTVA 4HY3A 3AW9A 1IL0A 1PQWA 4IQGA 1WXDA 3NKLA 4RV9A 4PN3A 3WYBA 4Z0TA 4B4OA 5G4KA 1NM5A 2VUTA 5L3ZA 4FN4A 1VE9A 3TZQA 3JQGB 3LK7A 3VPXA 3T7EA 3UN1A 1R0LA 4UUMA 1NR7A 4AJ2A 3B1KA 1A72A 4M87A 2BI8A 4XGKA 2PNFA 3PHLA 4J16A 4II2A 5AXCA 4AJOA 2Y93A 5L7TA 1B16A 5C7OO 1DFGA 1E7RA 1ENPA 3V1TC 1N2SA 5B1YA 1ZUD1 3RUFA 5A03A 4A26A 4QFCA 5TSDA 3BTSA 3JQ9C 4I9NA 2NSDA 2BGMA 2GERA 1QXSA 2RCYA 4BNFA 7ADHA 2W2KB 1YOVA 3AUAA 2QRLA 2VHYA 3WGHA 4BNHA 4OSOA 1R12A 2I9PA 4RZIA 2ZK7A 1DJNA 1EMDA 1Z74A 1ENOA 2Z5LA 5JAIA 4AFNA 4XJSA 1QYWA 3CKYA 2HKIA 3OF2A 4UVHA 4A03A 3FTPA 4I5FA 5DDIP 3AUUA 5T67A 4NQZA 3DAPA 1VM6A 2VTEA 4XYGA 3TOXA 5K6AC 2Q45A 3LVFO 2AW5A 1B26A 4XJTA 1R0KA 4U0KA 3QWAA 4CM3A 4PRKA 1AUPA 1I3KA 4BNNA 5JAZA 2IEDA 1ZXLA 4HWKA 1JKFA 4IMRA 2GSDA 3JQAA 4BNYA 4BNXA 3UVEA 1GR0A 1A5ZA 3WICA 5H82A 2BD0A 3H2ZA 3M2PA 3SBOA 3PJGA 2DKNA 4R51A 4XGIA 1BXZA 4BQPA 3F1KA 4ZQHA 2B69A 1QG6A 1PSDA 1HWYA 3MTGA 3IUSA 4EZBA 3GHYA 3GC6A 2G82A 1O8CA 1Z75A 1Y8QA 5T57A 1B15A 1C0KA 3FTNA 3F9IA 3WFJA 2VYVA 4ZN6A 2JHGA 4CMBA 1UP7A 5DP2A 3ETDA 1H6BA 4J1NA 3SLKA 4J1TA 1UDBA 4KDEA 2JCVA 1IYZA 2EKPA 5TT1A 1LU9A 1O0SA 3G1TA 2HK7A 1VJ0A 2BHLA 2Q49A 3MWEB 5EQDA 2CUKA 3GPDG 4JJIA 4S1VA 5TRTA 3Q11A 1JDJA 1C14A 5CPFA 5A9SB 1QMGA 3EY4A 1B14A 1WNTA 4G65A 2OZPA 4QEDA 5CAEA 3GZ4A 2BMAA 5JXWA 2XAAA 5TGDA 1H93A 3VTFA 4LW8A 1ISMA 4Q3DA 4DPMA 4XIYA 1W4ZA 3MEQA 3RUDA 3I9JA 1YBAA 4R54A 1H6DA 1K89A 1HZJA 1IE3A 4R1UA 5ILGA 3U62A 1NP3A 2NVBA 3JQ7B 1ZKMA 4XRGA 3EDMA 1CJCA 1RM3A 1S6YA 5JSFA 3NDJA 4DREA 4JJGA 3OSUA 5ER9A 3H5AA 5F3RA 3V2HA 3AFNA 4W9NA 1YVEI 3G79A 4CMKA 2D1YA 1N8KA 3D5TA 2IYOA 1GUZA 2H1SA 4RVSA 3BMNA 1PQUA 3R1IA 1GY8A 2BFPA 4WNIA 3N7UA 2DTXA 4YJHB 5T6BA 4CM4A 3HZZA 2IZ0A 4OH1A 1MC5A 2VWGA 1BDMA 3T4EA 4DYVA 3WLEA 4BO3A 3H9JA 3LC1O 3UUWA 4DQUA 1ZSYA 5KNLA 5AQ1A 3U09A 4MINA 1P1KA 3RIHA 3ROKA 3MCVA 3PRJA 2WJPA 2NQTA 3EZLA 5DOZA 4N5NA 1K6XA 2JFHA 3KRTA 4YEDA 5BSFA 4KWHA 2Y1CA 1UZNA 3LT4A 4NBUA 3WWYA 1YKFA 2EG9A 1E7MA 2HMWA 4JQCA 2VOJA 3KVOA 3OP4A 3PFFA 4R1TA 2AEFA 3M1AA 4AJPA 1JAYA 3DOCA 4J6FA 4WJZA 4BNLA 3SC4A 2NWQA 1Y5RA 3BMQA 3GVPA 2QX7A 3AOEC 4UVEA 1IB6A 5ES3A 1BVUA 1DSSG 3I4FA 1P9LA 5JCJA 5JAQA 4BNGA 1D1TA 2NM0A 2DTDA 2H9IA 2QYSA 4UUOA 5COAA 2DVMA 3NDIA 4GKVA 5A02A 5TLSA 2O3JA 4D0SA 4GGOA 4UREA 2QRKA 1U3WA 4M49A 3OEYA 3JQCA 3P19A 3WQQA 3DAFA 4E13A 2ZYGA 2RIRA 4JNKA 1U2DA 4Q3AA 1DAOA 1ISIA 1H5QA 2CDAA 1HDOA 2B4QA 4AVYA 3TFQA 2B0JA 2Y68A 4M1QA 1OZAA 1Y6JA 1PS9A 3DZBA 4DMMA 3BA1A 4TKLA 2ZYDA 1MLDA 1WZIA 4N5MA 4JBGA 5DCWA 3FPLA 3H2SA 3DHNA 3EAGA 1O6ZA 3BHMA 4FFRA 3I4CA 1KVSA 1U4OA 1DEHA 1GCUA 3FPCA 3GY0A 1YH3A 2NU6A 5A9TA 5CEEA 4DBVO 1K0UA 2PKQO 1MG5A 1BHSA 2YFHA 2JAHA 2WMDA 4F3YA 1XHLA 5KVSA 4DWVA 2EGHA 3ZH2A
chains in the Genus database with same CATH superfamily
4AZ0B 1X94A 1DAFA 1JQ5A 1TT5A 2ZB2A 1R4NA 1CLUA 2PU7A 1J0AA 3AJ9A 1IOVA 3CLSD 3KWLA 4I4LA 4Y1RB 3PDCA 2PIDA 1OLUA 2P9GA 1Z8NA 3C70A 1P91A 2OQRA 1WV0A 2CYCA 2CNOA 2ZJ2A 4HMPA 3V3KA 4FI3F 4L3OA 1WXWA 4MVWA 3GQVA 1NX9A 2DHDA 4PG6A 1F8GA 4YXWA 5I3CA 3AJDA 4QJIA 2ADOA 1RCTE 4MVJD 3WZLA 2GF9A 4G5FA 3AWIA 4J0JA 2OR3A 3W1EA 4P4SA 4C6TA 2B30A 2HU8A 1NG1A 3RSHA 4CMIA 3M1LA 4Z86A 3JD0A 4DB2A 4NEGA 4HAVA 2C4WA 1A04A 2HNAA 4QQNA 1OYWA 4YMTA 1L6RA 2C2GA 4QE3A 4FIDA 4M9XA 5NLLA 1NQ5A 3C7DB 3P0HA 1DZ3A 2RHCA 2ZCVA 4LDQA 4PRYA 4C1NA 4BX9A 4ER6A 4I4NA 1WVIA 3VZBA 3MT8A 2YFQA 1HEUA 2GQ0A 2FR0A 2GVNA 1N3IA 2FEMA 3RFTA 4J3JA 2X5JO 1E1LA 2I99A 4JASB 3QSYA 5C5EA 1BRTA 2ZZNA 4B2PA 2HF2A 5E6RB 1KPGA 1PKEA 5TR9A 1GQQA 2R68A 1JUDA 1XVTA 4F85A 3DT6A 4C0HA 1EQUA 3IOEA 1E60A 1I2BA 1C1XB 1M67A 2C88A 3D4OA 3K1YA 4FQ8A 3I0ZA 4JUFA 1J8YF 4P98A 4E31A 3T61A 5G0VA 4NDNE 4CQLA 1TT7A 3T95A 2GNPA 1ODSA 3V32A 5B1YA 4S0XA 1DWOA 3TK1A 4QQFA 1D2MA 1NRIA 2WE7A 3DBHB 2QUJA 4K40A 4W9RA 2HQBA 3KT3A 1HFKA 2X0JA 4MUAA 4Y2QA 1X6VA 2H4HA 3H9QA 1J2YA 3QLVC 2CFTA 1GD1O 4A2PA 4HTFB 1C4WA 3X1YA 2WV7A 2G6BA 5GOTA 4ZI3A 5AOBA 5I45A 1XWFA 3R4CA 4QDOA 2VJOA 1R6BX 2IY8A 1HTWA 4IKOA 4PYMA 3KZKA 1VHQA 3LCJA 2YYAA 2ZRFA 5DSTA 1ISPA 5FA5A 5GONB 5CCBA 1ACJA 2E6UX 4OLHA 5AKGA 3S81A 4FMDB 1GU1A 3JRNA 3MD0A 2IYEA 4WOBA 1Q6ZA 1AKEA 5IC5A 2D5BA 1R9NA 2QRNA 1LX6A 5KKAA 2XUAA 3EA5A 1ORHA 1BNCA 4NMMA 5FBVB 1G6KA 2OCLA 3G8AA 3O21A 4LYJA 1QIHA 3IBTA 4OQPA 4PYRA 4ME6A 3CKKA 3AKCA 4DV2B 1E6EA 2RHLA 4RD1A 1FXSA 3FSJX 3UG6A 5BNWA 2H5IA 3NBXX 3VDRA 2GMWA 3NDBB 2JJYA 3B82A 4YIKA 4DLVA 4QYWA 3VU3A 1WMDA 4TLDA 2VYNA 1ZQ1A 2CLEB 3E3LA 3SI7A 3SJ7A 3FHJA 1WMAA 5EXPA 5J2TB 1N2CE 1ZDMA 2P6PA 2TYSB 3HKBB 2IGTA 4MP8A 1OHHA 4L4ZA 3WLLA 3VYUB 3ICCA 2G9NA 3R6GA 1A97A 1UKCA 5JO9A 2B4AA 5B55A 1DFHA 1E92A 1ZIDA 3EARA 4HQ0A 2VBFA 3CV3A 4ZRMA 4MKZA 2E4WA 3L04A 2JW5A 4NENA 2LTAA 3ANTA 3B1XA 3SQMA 3NIBA 3PHJA 4RS3A 3L4SO 3LGSA 3GYGA 1H1DA 4RY8A 4WKOA 4OX9Y 5K6AA 2AKEA 1E64A 1N9GB 3NHRA 4C0JA 4PZLA 4MRPA 1HSOA 2FSVA 4OQLA 1CEQA 1OTHA 3HU5A 2YTZA 4GPIB 3HCOA 3PSAA 4R4JA 1B6RA 1ZJ5A 2GBCA 2JAWA 3DFUA 3CLRC 4XH9B 5DRTA 3IQXA 2J6HA 3H9GA 4H4CA 1QRSA 3UYLA 5ADWA 2DSTA 1L2TA 3P1JA 3VR6D 1DQYA 5BV2P 1KNXA 1PK7A 4CKBA 1X9IA 3BXEA 1YDHA 2H16A 2R85A 3IGFA 4X7PA 1EINA 1PL7A 5KDDA 4JLPA 4XGNA 4HXFB 4QUAA 3JQRA 1RTTA 3B51X 3Q12A 4KNWA 2H7XA 3TG8A 2JFFA 5AK0A 2JCGA 2P0AA 2POCA 1CUGA 1ZN7A 3KOUA 2P9CA 3OJEA 2X8JA 4UMDA 1UT6A 4WAUA 3U9SA 5M7EA 3E2IA 4M8KA 1F2DA 4N3CA 3B78A 1WDKA 4LDZA 3SBEA 1BU8A 3FIUA 5JXJA 2DPXA 4X64B 1DHTA 1I5EA 3DT9A 4TYPA 3D3WA 1WZNA 3ZQKA 4FC7A 2WM3A 2JRCA 1YUBA 3BICA 3C7KA 3M4XA 2XT0A 3GUHA 4EFMA 4MKFA 2ES4A 4FGJA 3TZCA 2B4TO 3O93A 5K8IA 1QFJA 3RS5A 1YT5A 3CT6A 4RKWA 4U9HS 5AK4A 5LYJB 2HCRA 1WSBA 1YHZA 2LR0A 4IDBA 2R751 1J9ZA 3WGZA 1MRNA 2JCBA 2DY0A 1KZYC 1GTSA 5B58T 3TLYA 2HHJA 4B32A 4A36A 1XFAA 1SZCA 2NXJA 2XQKA 3PGA1 4LZZA 4LYEA 4PF1A 1D7AA 1EZ1A 1TA0A 4BVKA 5AW7A 4U7GA 5AWFC 1P7WA 1VKRA 2BGKA 1LJ8A 3FWZA 4DE5A 4DLWA 2HBQA 5CXUA 1S02A 2AN4A 4PQEA 3G0CA 4PX3A 1BRMA 4X3CA 4BQNA 4C0LA 3RUCA 2I5PO 2VUUA 1X7YB 1I80A 4XQ0A 3CZ9A 3LMKA 3V4VB 3ZQ6A 2O8BB 1Q2UA 5EY5B 4DA9A 1T5OA 3SIPA 5A4FS 2IZ1A 3TLCA 1V5GA 4WLNA 2H51A 4TZ6A 3SZGA 4CIDA 1U98A 1X80B 2JLSA 4RU1A 1XNJA 4RAQA 8GPBA 1YZKA 3DMPA 1KU6A 3K5HA 4C9BA 4KXQA 2QE7D 3PPWA 1ZGAA 1C7RA 4MI6A 1TK9A 2XVYA 4L4RA 1SA0B 1CERA 1UP4A 2CWDA 2R8BA 3T4UA 3WLKX 4LRYA 3G0DA 1QZXA 1JAHA 2CF5A 2D2EA 3VPFA 3VFDA 3ER8A 1ZZGA 4A6PA 1TJYA 2CLIB 1QVAA 1K75A 1RJGA 3NWBA 4J0CA 2E4AA 3TM5A 1Y1KE 4BFZA 4IQ4A 3PD7A 4HNVA 4GUAA 1A9XB 4ZT4A 5KWVA 1PBTA 4LOAA 2G71A 4XFDA 4DMHA 3HVJA 1TXGA 4ITVA 1AGXA 2KX7A 1YMUA 3G7NA 5JJCA 3RYCA 4C08A 3QNUA 2VQEB 1D2EA 2G04A 4DSTA 4EG4A 1HL3A 3E1GA 4MQMA 4CIAA 1GTZA 3VC7A 4E6EA 3JTEA 1ATZA 4QYSA 2YJGA 2ZFUA 3GLIE 1YQGA 4IGIA 4F84A 2QMZA 3QXCA 1VIAA 3SS8A 3STXA 3SHTA 4BKRA 3RBXA 1HE3A 4PGGA 1EJ2A 4UM7A 2B2NA 1Y1LA 3THYB 4EHHA 2PS3A 4GR4A 2ODQA 1WCXA 4JWKA 2GAJA 2ZIEA 3B3AA 3VZSA 1F9AA 1NVAA 16PKA 2PVSA 5HKKD 3SZRA 4MS3A 1XV5A 4R6WA 2VNAA 3H1EA 1P5RA 5ERXA 3ZHBA 3K31A 2ZJAA 1USWA 4Z51A 5TS2A 1L5GB 1DZIA 1F9EA 2WKRA 3LYHA 1GQRA 3MBIA 4MQ5A 5IEBA 3G23A 2IT1A 3MJSA 5I8ZA 4RENA 3RO7A 4FBMA 2NACA 2DUNA 2YZKA 3F5FA 3G68A 4Y0AA 5DE3A 4G0ZA 1E1QD 3PK0A 2H18A 2FMUA 2QT0A 4Q9AA 1GGNA 1UR5A 3FFTA 2K5UA 3I5MA 1XZBA 4XX0A 4N1AA 5DBOA 4IXTA 4M7RA 3MT7A 1N6RA 1YQEA 4OTZA 1G17A 4L0MA 1E1KA 3UH1A 4CEHA 3ZZ1A 4BKQA 1GPMA 2Q5OA 1CUXA 2UYQA 1U0HC 1YJ5A 2Q99A 1Z8DA 2XB6A 3E15A 3NANA 2X2OA 4BFTA 4ZICA 4IMIB 1O87A 5E1OA 3THRA 1JQAA 2NYAA 3QIVA 4XIIA 4YC7A 3UJDA 5KTRA 3BGSA 5D8DA 3PWZA 3MD9A 1U1DA 1OX4A 2EC5A 3OM1A 5AUPB 2WICA 2FUG1 2ZXEA 4W1PA 13PKA 2GPWA 1ZONA 2FEPA 2P4UA 1ICEA 3E35A 1R6DA 1E3WA 3LKVA 1ZVVA 3ZD7A 2LKCA 3EXFA 4Q7JB 1NXTA 1YZGA 3KDAA 2UZ0A 3KR2A 4B6FA 2AFHB 1J1IA 2MSLA 1BJKA 1UBMS 3JQAB 4W7HA 3ELYA 1VPDA 4TV9F 2ZIXB 3PI6A 3MYYA 1OHHD 4J7XA 3ZN2A 4KEAA 2X76A 3B38A 3FOCA 4IIHA 3SZMA 3UGKA 4AZTA 4EEKA 1J09A 3NH9A 1GZ5A 4JVSB 4ZJYA 5JWRA 1T1SA 1WZUA 4WKGA 1NU8A 4FOTA 3ZUPA 1PCXA 3GMDA 4UAGA 3RRXA 1OGJA 2YVAA 1MQ8B 2YV5A 1QONA 2OYCA 3KSUA 3DBVO 4LVOA 4R5MA 4CQMA 3CMCO 3SEAA 3NYQA 1Y8QB 4ZGGA 2A33A 1E9SA 1YDFA 2C04A 3MMXA 3OEHD 4HQLA 5DTRA 4B44A 2F2TA 4BYMA 5JD4A 1NR5A 4JI0B 4H6PA 3HHEA 3K35A 1MJNA 4M1KA 5ALRA 5FTMA 4AP9A 3UIEA 3PGXA 1CDOA 4C2AA 5JECA 1P8JA 3BGOS 3PPVA 2FPKA 4QOHA 2ONJA 4LEIA 3K5PA 1R0XA 2JI7A 5DCUA 4WWHA 1HYBA 2H9YA 4C4PA 1LNQA 1RHKA 1OT3A 2A5FA 3W6PA 4Q01A 3C4VA 1Q3HA 1XDZA 4EF4A 3A6LA 5B3LA 3Q0TA 2V6FA 3RTGA 2MYPA 4ZALA 4JI8B 1YK0A 3I72A 4XQCA 2XPCA 3BD8A 1JR6A 3ZWVA 1FA9A 3WGJA 2FPSA 1WKCA 5K4HA 3WLQA 3WRYC 2ZTMA 2C94A 2XIQA 3ETCA 3FF1A 2BGJA 2QTCA 1MO5A 4IQ0A 3R8CA 3EA4A 4BFXA 1K66A 2BY4A 3V6MA 4EY8A 1RS0A 1GXSB 4UZSA 1K63A 4KOEC 1VJRA 3MAAC 4OB7A 1DFIA 1E2HA 2ATCA 4WXRA 4B43A 3U60B 3COZA 2GZ3A 2W2TA 3BMCA 3JVUA 2J59A 3LI2A 3H0KA 4X54A 2B36A 1V1RA 4ZOCA 2WFLA 4P9NA 3QLVA 1K8QA 2VZ0A 3ROGA 1R9GA 2A1UA 4YJGA 1WMBA 1GKLA 3ZKWA 4MPJA 1RWKA 3RKRA 1Z7GA 2ISQA 4JDPA 4U2BA 3CRZA 3VO2A 3ZE0B 4KNYA 1GNLA 3E05A 2O0MA 1DRWA 1JJ7A 4JBXA 4U5XA 5K03A 1W44A 4ENTA 2IRWA 4KRYA 5JSYA 3G5UA 1CJBA 2BTOA 1XDBA 4LF9B 1Y3DE 2CLCX 4KR9A 1BS1A 5KSPA 2XRFA 3KTDA 2Q2VA 3HN2A 3RVRA 4H17A 3EW7A 1N2EA 4CNBA 3BMNB 2O0KA 4OQEA 4GRIA 4IR7A 3ELUA 3RYIB 2VPIA 1O08A 4H7IA 4KQ1A 2R4TA 1UWKA 1PRYA 1KIMA 3U7QA 4BNZA 2AEJA 4S0ZA 1JWLA 1GTMA 4O5AA 4ZMBA 4C3UA 2CXTA 1TCUA 3VR1A 1NHGA 1E59A 1MXFA 2RGBA 2XITA 2C7BA 2EYQA 1F17A 1FFBA 3AILA 3MTIA 4HQ6A 2IEAA 2JANA 1M7HA 2B92A 3KZ1E 3CX8A 2HA7A 1Q15A 4XCQA 1YS9A 1N2GA 3RT7A 4IZHA 2FRVA 2JAPA 4M4SA 1AF4A 3P9NA 2HA0A 2P8SA 3WNCA 1KARA 3H5VA 3VR5D 5KMGB 1II8B 1Z5VA 3CX6A 3G49A 3UXMA 2J0QA 2WR8A 2BEWA 3S55A 3HGMA 2HMUA 3CR7A 4RHTA 4X1YA 5TPWB 4EOGA 1SXGA 1Z16A 2JI4A 4H7KA 2GR9A 4D9NA 1Y6RA 1M0EA 1GAJA 2AGVA 2PCJA 3NKFA 4DL9A 2R66A 5H16A 3WE7A 3KJGA 4AG3A 3N8IA 4BVGA 1NNUA 1QAMA 3ABRB 1KJ9A 4JBIA 5DCYA 5EUQB 1BE1A 4W5QA 4FI3C 4CEJB 5BN4A 1TYEB 2YXNA 3OSZA 4CV3A 4C4AA 2G5PA 1OH7A 3LHIA 2I2AA 4BO7A 1C3JA 4DW8A 4WGFA 4BIIA 1ADFA 2B1RA 2YJ6A 4FDMA 4LCJA 3FHOA 4M6WB 2FSUA 3PXUA 4OHYA 3PFHA 2FF5A 1D6NA 3V2GA 5IF9A 5DLQC 4J7CA 1VSVA 3L8DA 1T1JA 3QPDA 4CCYA 1W5FA 3JR7A 4R8LA 1A9YA 1DJPA 2B2XA 5D5HA 1NW3A 5ALKA 3ZU4A 2WWTA 2VJPA 2V65A 3OKPA 2H29A 1EA7A 1L8LA 3NHMA 2AZXA 4E51A 3L6EA 4AJJA 3LDFA 1OAKA 4NP6A 4BN4A 4EVSA 4BQIA 1P7PA 3DVRX 2C29D 2GTPA 2RGEA 5EN4A 1JEYA 2H9AA 2VSOA 3ZHCA 4Q1EA 5CPBA 4DCJA 1E6CA 1Q3KA 3IQZA 1GUFA 2OUKA 1M2OB 5BQOA 1E7YA 2IYYA 2EDCA 1KVQA 4IRUB 2IYFA 1JG1A 1ENYA 1SKUA 1ULBA 2PQ0A 4HDNB 1H4QA 2VPYA 3HS3A 4QUEA 4DM3A 2OQ2A 1E7WA 4JSYA 2OTCA 3H86A 5DV9A 3C3DA 4KVZA 2DH5A 1MG0A 3DFFA 3R3ZA 4LTMA 5HQ3A 2F3UA 1FUUA 5JALA 5KNCA 3N75A 1RD4A 2WHXA 4LJ5A 1EVEA 1CV2A 5C7YA 5F3DA 1E1NA 5JD6A 2A58A 4G0MA 2Q27A 1EI9A 2FB9A 4LE2A 3RHTA 5LP6B 2C96A 2L82A 2ZU0C 3PDHA 3WYEA 2HU2A 1NP6A 2NO5A 1X0VA 3GCZA 4NRDA 821PA 2B1QA 1DKNA 2DZDA 2R97A 2YY7A 1T8WA 3DQQA 1NQWA 1RI5A 4IDQA 2CFIA 4F6RB 3K94A 2VL7A 4HWOA 4KUEA 3EW9A 2YKGA 2EU8A 3ASYA 4LV6A 1Y89A 3CUKA 5AM4A 3AM5A 3EMBA 1LF5A 4MQBA 2QJTA 4OFXA 1LVHA 3GBVA 3F8WA 2G7MC 4PLTA 4YJ3F 5CM8B 3RVKA 3UHAA 2CLMB 1JGTA 4BJ1A 2DKOA 2WSYB 5FUBA 1KAQA 3ND6A 3R5SA 4OXIA 4QNNA 3E82A 3A1DA 1JR3E 4L0DA 2NUAA 3OH8A 2OLKA 1FP4B 1OWOA 4KBGA 2BR4A 3B9QA 4LZWA 2IE0A 3TINA 3CUSA 2UXDB 1M6VB 2AR0A 4LYFA 5DNUA 1ZXXA 1CP3A 1ND5A 2GESA 3ZBPA 3WL7A 3QVXA 2CNDA 3ANLA 3L7IA 4P7JA 3VR2A 1ZUNA 1NDHA 1T9AA 4HXYA 4X1KA 3I2GA 1IJBA 3I4LA 2XGOA 2O7VA 3IVAA 1XMOB 2W22A 2NU7B 1JA0A 2W2PA 4WKNA 1AB6A 4BX0A 1RI1A 2Q3CA 3EYAA 3C7AA 4RJKA 2RHOA 3CF6R 3CRNA 3OU6A 3GFQA 3IBYA 1NBME 4QDUA 3GJSA 3LW8A 1QG4A 4OG2A 4WK0B 1XKQA 2HSEA 3WBBA 1FFXA 2HSZA 5IBRA 1XJWA 1XQXA 2QAJA 5EJMA 1TM5E 4FB5A 3G8CA 4X84A 2VDJA 2FSGA 2NOAA 2GAOA 2XVZA 3BGDA 2W4MA 1XP8A 2YWDA 4FFMA 3NNDA 3BH7A 5A3JA 1KDRA 2QNIA 4GEGA 2FWMX 2C8KA 4K6CA 2QTMA 1EX9A 4DLTA 1P7YA 4O8ZA 3KQMA 4QHTA 1C1DA 2X0IA 1XVVA 2CXSA 4WBNA 2GXAA 1GHTA 3JZIA 3OLZA 2H11A 4GLJA 4L2IA 1TO2E 1YQDA 3CLTC 4LMPA 4RF5A 4S24A 5AJTA 3ZZTA 4DUGD 3OWOA 3TVTA 4EI9A 2CMGA 5JUWA 3VR0A 1NYQA 4MRSA 1OPRA 2X15A 4IUBS 3N2NA 4XIJA 1K06A 2GDZA 3RLFA 1H1TA 1E2IA 3Q3CA 4OXKA 1F8XA 1BMFA 3K9NA 5BW4A 3TJRA 1Y6FA 4QASA 2PUBA 4FTWA 1IXSB 4AO7A 4F9GA 1GPH1 2BR3A 2XUIA 3NBYC 3D6NB 4JC4A 2H8KA 4IDCA 3FPSA 4MCHA 2FEXA 2Q9CA 3WI7A 5LIPA 4JB3A 3GQBA 4BMOB 3RT9A 1GN8A 2PLFA 3A1CA 3HCFA 3LLCA 4H6XA 3CLVA 4IFIA 4OMDA 3OY7A 4RTPA 4P38A 1M8JA 4NYMQ 4DCVA 3SLRA 2J6BA 3ESAA 4RL4A 4X44A 1DJMA 4FHDA 1Z6TA 2RKOA 2I33A 3RC3A 1VC2A 3FLEA 3EZ9A 5K3EA 2E87A 2GO7A 1ZN9A 4H7EA 4OCZA 3AY6A 4GOND 3U4GA 3U7GA 5HJEA 5CITA 3K0FB 1AN9A 2O0LA 4PFQA 4Q39A 1HSZA 4BIMA 5KJCA 4NXNB 5HP4A 4IIJA 4RNCA 3WLFA 5K2OA 1BKSB 4URHA 5AKIA 1GLVA 3RG8A 2CB0A 2YW9A 2XUPA 3BWDD 4CN9A 1C7EA 4E2ZA 3V2IA 1HT2E 1LEHA 1IEWA 2C82A 3E27A 5F4BA 4CF4A 4G8BA 4TS1A 1UOEA 2VXYA 1YR3A 3AR6A 1GUAA 2OHGA 2Q3DA 4D42A 1G7SA 2IH2A 1BFKA 1YSCA 5J1TB 5JJ5A 1JAZA 1U2PA 2LV8A 2Q1WA 3ODGA 5BNFA 4PNEA 1PLKA 3BK2A 4XE5A 5SV2A 2HCTA 4UM9D 3TPCA 2DERA 3LIIA 2HFKA 2OGTA 2J5KA 3UOWA 1SHZA 2YV4A 3HYCA 1H65A 2FMKA 5JWHA 3U19A 1YF3A 4NEQA 5T5QA 4GLOA 2ZDQA 3VHQA 2CXNA 4ZO4A 2XD9A 2C0CA 1JE1A 4MKIA 3S1LA 1MEJA 1HNNA 1H23A 4QVIA 2Q6VA 3EDCA 1QGYA 4QC2A 5DYTA 1NF3A 1VL6A 4XUCA 1L0BA 5FYDA 3ROPA 5CP8A 5JPIA 3R7SA 3WRYA 4EW2A 4IOJA 5EQJB 2O23A 2NVUA 4JP2A 3T3MB 1XWIA 3IELA 4C0XA 3C98A 3MGBA 1H8EA 1ZRMA 4N3GA 1ZHFA 2A9OA 5AM2A 1DC4A 4O02B 2HX1A 1YUMA 1Z3CA 2EW1A 3FOFC 2Q0SA 2PANA 3ZDXB 1FL9A 1R74A 3GR6A 4IVQA 4ZT7A 5EWMA 1IM5A 2HCJB 3HI4A 4XTRA 1YRQA 1M8KA 2XQFA 5F78A 5EJ6A 1RI3A 2CHGA 3IMEA 4IFEA 4GPD1 3VNAA 3W4JA 1NFRA 2UYCA 3LLUA 4PC1A 1Z4NA 3B3JA 4HAYA 3AX6A 2Z95A 4QPNA 4RKEA 1BMDA 4JLBA 4TRJA 4HSGA 2J9ZB 2QIOA 3VZDA 1XTIA 5JS7A 2C7GA 3TIIA 3WL4A 4PYKA 2WUFA 1Y9ZA 4K6FA 2OB2A 4RABA 1A7AA 3CPJB 5KNCD 4KWEA 2A5YB 2KM1A 2VYFA 3C5EA 4BB5A 1USKA 1XQ9A 4WZBE 2GRUA 1E1CB 5BUZA 7AT1A 4W63A 5I4CA 2JFQA 3U0VA 2XRZA 2DBVO 2JVIA 3GGCA 4I5DA 4LMBA 4WRRA 5DYYA 3W4IA 4ZMRA 5B4VA 1P31A 4L8VA 2WKWA 2H4WA 3BWBA 3QI7A 1GVNB 3FKJA 4FINA 2EQBA 4IH9A 3EASA 4OJMX 4NJOA 2HLPA 4XDYA 3OOWA 3Q5EA 2HRQA 5EAIA 5K0NA 3SE0A 3VISA 4A5SA 3R09A 2EL9A 2IKQA 5JD3A 3P9YA 4MVJI 2PBRA 3DAHA 4TWZA 5CCDA 3OQ6A 4JLWA 2ISCA 1OBHA 1VGVA 3H19A 1U8ZA 2PQ6A 3G8YA 1WXXA 2OOKA 2FW8A 2IYRA 2VP5A 3IPAA 3JRXA 3M5WA 2G0AA 1SH7A 1H85A 2RAPA 3O94A 3QPCA 4AJ4A 1JHYA 1TZJA 4Q00A 1TMYA 1MENA 2Q4RA 5CB6A 1JIVA 1JPVA 3IKMB 3V80A 3RV3A 3DDZX 2W8ZA 1IPEA 4JP3A 4YAWA 3DCJA 4MVXA 4LZJA 5TMPA 4RF4A 4ZVOA 1Q1ZA 2HRCA 2P2ZA 4XW2A 5LPNA 1PUIA 3K0SA 1RIFA 4PO1A 1G8PA 1RI4A 1SUSA 2RHGB 2FLVA 2ZXUA 3SQXA 3BE6A 2GSWA 3OF5A 2R6R1 4E07A 1O7JA 5YASA 2EJUA 2PFKA 2IHTA 3K05A 1LKZA 3RTCA 1Z4PX 1W4AA 3ND8A 3MS4A 2PSHA 4GQAA 1IM8A 1SBZA 3MQ4A 3N53A 4CR6A 3M81A 3A6GA 5ALEA 2PM8A 2ZREA 4Q3EA 3KV3O 3ZXXA 4FEGA 4TMWA 2PMKA 5EXTA 3EPHA 3W5CA 1PV4A 4QJ4A 1CHDA 3CS3A 3BFVA 4Y2RA 1IATA 1UJ2A 5FV4A 3CO0S 1HDXA 3RG2A 1FP1D 3BB4A 5E6UA 2WNHA 3AVPA 7REQA 121PA 1JILA 1AQUA 1EDDA 2J08A 2VNJA 2YWJA 3GDHA 3K9QO 4Q4LA 2ZWVA 1E98A 1H2BA 4OFWA 2Q9AA 4UNPA 3GD7A 5LKAA 1N0IA 4H08A 1W35A 1I2CA 3OO0A 4QPCA 4WBXC 5FFMA 3WBFA 5A4DA 1GAQA 3OTIA 8LDHA 1I1NA 2BJWA 3KYBA 4JLDA 4QXRA 3V8QA 1BO6A 2BGIA 3IRUA 1NQTA 2I7CA 4FFLA 2XVAA 3ENQA 5KHOC 3KOMA 3PCXA 5DISB 4G07A 2CNBA 3HN7A 1TO1E 2X3FA 4LXYA 1UFKA 1UZAA 3W4KA 4EARA 5HUHA 1ZGGA 1VPVA 1CETA 1MP0A 2IXGA 3L7KA 3R74A 1HEYA 5FPSA 3WKCA 3MG9A 4IRXA 3K53A 4IH1A 3RUHA 3UBTA 2FRXA 3ES9A 1CKEA 2HR1A 1Z29A 3JAWB 1CFJA 4BGVA 4J0KA 1FSSA 1NWCA 3MT9A 4FC6A 1SUIA 3ORFA 1ESCA 3SDBA 2WWXA 3A6DA 3EQ9A 2ZRHA 1EHYA 2FDCA 4HNAA 1L7MA 2VCEA 3VO9A 3T5GA 3RBVA 4O4HB 5EP3A 4PSDA 1H5NA 2ZBFA 4J3FA 1N1DA 5EE3A 3ZCRA 4TWBA 4D6YA 1UJBA 5JAHA 1GZ4A 4OUDA 1T9BA 1VG1A 4Y1FA 2WJIA 2WJGA 4HG2A 5K3CA 5ICCA 3TEFA 3ANNA 1RC8A 1V45E 1IUNA 3WWEA 4AROA 1VSUA 4AXBA 4GRDA 1V43A 3WLTA 2FXVA 5DF1A 3UWDA 1Z18A 3P9IA 1LPMA 1R0RE 1UKBA 1EGAA 1G7RA 1QX4A 2PZKA 1G19A 3RAEC 2OFWA 4MWBA 5AT1A 1RU3A 5C34B 1SZDA 4GUDA 3VVBA 2IYPA 4JVLA 4QDTA 1NI4A 4CLXA 2PHZA 3NP9A 2ZPUA 1PF7E 4ARBA 3VTKA 4D44A 3HA7A 2EYUA 4D3XA 2JH8A 4GFDA 2JZOA 4B33A 1ULAA 2R86A 5B37A 4C0KA 5JAOA 2WIFA 2REQA 1W30A 3NYIA 1TCBA 1WNFA 1LJLA 1WD7A 1AHIA 2AC4A 2B1GA 3IOYA 3PUKA 4AJ9A 3RANA 4F45A 5C8XA 5K4GA 1NN0A 1Q7BA 2IYAA 2JCXA 4W6ZA 4BMXA 4ZFNA 2AN3A 3SICE 3OPYB 3WISA 4F38A 3BWYA 1YDWA 1NBOA 3Q7IA 4AY5A 4G01B 4QM6A 3KWFA 5EERA 4HFMA 2UU9B 2WJ6A 1P4AA 3L77A 4IDAA 4G4SO 1ZGBA 4XLLA 3OJOA 1H5UA 1HNXB 3PBKA 5JCXA 2I29A 4H4DA 2BHNA 1NBMD 1L5FA 4R8MA 1RWBA 3OIUA 3PQDA 4DOMA 3OA2A 4EHJA 1YVRA 3TTTA 3OCVA 4EQ6A 5KCMA 3OKCA 4TN1A 3S70A 1HKUA 1BWPA 4HD8A 1N7JA 3E84A 1SC9A 2OORC 1AG9A 3BRQA 4OXYA 4TT8A 2GYVA 4E7PA 5B58C 5C8DA 4NKRA 2D59A 4GZ6A 1CT9A 4E08A 2F3TA 3M82A 4BNKA 1XQ1A 1FTSA 2QUIA 1S01A 1AUVA 4ZODA 4B2IA 2PGAA 2PWAA 5CYPA 5BN5A 1LUAA 1IH8A 2SKDA 2WKPA 3B85A 2Z56A 2X8BA 2H0QA 3H17A 2WF7A 3G1UA 2YQ5A 3PC8C 1D2RA 1WXIA 5FR2A 1G291 1X0XA 2RIPA 2Z2ZA 1UK7A 4HB0A 2ESRA 2J41A 1SKAA 3K0BA 4XFKA 2WSBA 1YVDA 2JLQA 1R5OA 4N47A 4E2WA 1T3HA 1NU6A 2J3JA 3HHPA 1JDUA 3SEZA 4XM1A 5JVDB 5CK4A 1RYYA 4JDUA 4JB0A 4LN1A 1R15A 3LCMA 5JJKA 4JITA 5ENZA 3I73A 1S3GA 3QEMA 1FEZA 1SQSA 2QMYA 3KSAC 4NZPA 1B6TA 3AP2A 3ZJ5A 2XE4A 3S2FA 1EBUA 1JVSA 1V48A 1RZVA 2P4SA 1LPSA 1Z6XA 1W2HA 3DPIA 3DTTA 2P5SA 3K2EA 4H0CA 5CTJA 5CDFA 4A0QA 5I51A 4ZCQA 3EN0A 2WTBA 2J0UA 4XUDA 1IQUA 1FP6A 3USCS 1OGIA 4Q4AA 1NJFA 1N75A 1Z0UA 3AJEA 5E9WA 2EW8A 4Q3NA 5IU6A 3FPGA 2AJBA 2GN8A 3IOCA 4WZAB 1ZBQA 2Q0QA 5HM8A 2OBFA 1U6JA 1EVIA 2N75A 4TSFD 2GPTA 2H4YA 4MGZR 2P7IA 4A3SA 1YQUA 3Q7RA 3IYLW 1VLLA 4MKGA 5FOVA 4ALLA 5KBYA 3MBOA 3CH4B 2AVDA 4BNWA 3NGLA 2LNDA 2JG3A 1QGDA 3C39A 4XSVA 4YRRA 2WYWA 4RUKA 3D0RA 4ZVPA 3QA9A 2IS2A 3UMGA 1FX0A 4UZEA 4WKBA 3ZV6A 3I30X 2VA9A 4RW0A 5E4FA 3JS5A 1XD2A 4F56A 1KEKA 3G8DA 1KBQA 1P4HA 1S4MA 2BEUA 3PGJA 2MWMA 5CIQA 5ECWA 5KVQA 4V02A 3HB1A 3THSA 3WGQA 3P9QA 4HOYA 1R66A 1RPAA 2CXHA 2XGMA 4TLBA 4TRMA 2HCBA 1HOXA 3EUAA 2C59A 4EHKA 4ETIA 1YZHA 1CF2O 4Q3BA 3CCBA 3BIFA 4Y7DA 5K51A 5IDWA 4P0QB 2GK6A 3DPUA 4FHCA 3UICA 4TM8A 1QYCA 4C01A 1SBQA 4EY5A 2REBA 4QLOA 4UNRA 2F59A 2D3WA 4JOSA 4MR7B 1B43A 2DFLA 1FSPA 1UMBB 1RAGA 1XTVA 4M53A 1VMIA 3KBBA 1N5IA 4UNNA 4ZTZB 3AH8A 4WBSA 5AUQA 1YB5A 3OVMA 3V48A 1XTPA 1FTQA 2BMEA 3I1JA 3DCYA 2FZGA 4E5PA 1R8JA 3DMYA 4OP2A 1GKKA 1NTOA 3OQPA 5DP1A 2CD9A 3DCNA 2AD5A 2F62A 3L7NA 1HI9A 3LWZA 3HDQA 2ADMA 1XOIA 3KL2A 4U9UA 1RXCA 4MK4A 1WZ2A 4EG1A 1JSLA 1WXEA 1D5CA 2M98A 4X9XA 4HUJA 5AVVA 5FOUA 3B6MA 3GUCA 4JS0A 4Q7KA 3TX6A 3UXEA 4F4HA 5CU7A 1W2GA 1X1EA 4YJKA 5DRYA 2ZE5A 3HA5A 3VKFA 4I55B 4A73A 1R8YA 4EHLA 5L45A 4LV8B 4KYUA 1JKMA 5EJ7A 4BX8A 4UBJA 3TN7A 1FDWA 4KLZA 4OLAA 3A4IA 1OVGA 5EE9A 4G5SA 1YA6A 2R8XA 1I9GA 2ZSBA 1TKCA 4KO4S 5LNK1 3IEKA 4GR9A 5FUYA 2QAGA 2HSGA 4EWLA 5EXXA 2VDRB 2ZE7A 2PJRA 3SIRA 2Y3IA 3CX7A 3BMOB 1BXRB 3DZGA 2W70A 1V5FA 3SS7X 1NQUA 1TI7A 2QDXA 2YICA 1CQPA 1DTSA 1JR4A 1W5TA 4WA7A 4B4VA 5HGXA 3MFYA 2WUWE 4MYSA 4KRXA 3PE4A 4I66A 3GBSA 5I4BA 4DLAA 1CB7A 3GLUA 3L6RA 4RV4A 4OHVA 1B8VA 2ACVA 2XNDA 2J4CA 2DU8A 2ZRBA 4ZYXA 5TQ0A 2NT4A 1RLIA 1DEAA 3HMQA 2RHJA 2NU9B 3DLPX 2WVAA 3SHFA 1BDIA 1T36A 4GVLA 4PPQA 5DBFA 2VHXA 3TNLA 1M2VA 1BA3A 1YRWA 2YOGA 3H2GA 3QE2A 3O3MB 3QUTA 1TAUA 1E8DA 2I22A 3AHEA 5DXAA 3TF5A 3ROEA 1IDN1 1SCUB 3QBJA 3JYQA 3G5AA 5EUMA 1TD9A 1RYNA 4BATA 2JLCA 4P22A 4F2PA 3QU2A 3VOBA 2I4NA 3WQSB 3TRDA 2QVBA 4XWAA 5T8KC 4B6RA 5MFZA 1XDDA 2WF8A 4OMUA 3U37A 1EWYA 1J06A 4LKRA 1Z5PA 3AY0A 4RLSA 4CGYA 1NBHA 3MQFA 5LP1A 4TV9A 1KZHA 1QIIA 1SPBS 1W47A 4YAFA 4IW3B 5FI5A 1JDBC 4U2FA 1I6KA 3EXHA 3ORRA 4BEVA 5BWNA 1BXKA 1SC6A 3E3AA 1FW8A 3HBMA 3PF8A 4LGVA 4NE7A 4B7AA 4ZAZA 3VI4B 2HPHA 2P65A 2JZNA 4R16A 2OUIA 3RWMB 5IZCC 1VE5A 2OLEA 4ERNA 1YRBA 4B3RB 1J8QA 2UVPB 5DN6A 5EYPB 3CMMA 3RIEA 4TZ0A 2R8ZA 1W0KA 3BX1A 1GFIA 2CBGA 2JK1A 3KJHA 3FTFA 3HWSA 1LBHA 4YMGA 4WOJA 1T24A 3TYXA 4I8IA 5EKUA 1VHWA 4DA8A 4DDUA 3KSRA 2DXIA 3GRZA 1GYQA 3ELWA 1W4CA 2I4OA 2RGRA 2OP0A 3KPVA 3S2YA 3LFTA 1PJRA 4ZQGA 3V2UA 5HFAA 3OCZA 1XTBA 2DSNA 2A35A 5D2CA 4D4JA 1T5SA 3PVZA 4DDKA 3GDOA 3MRSA 4G37A 5K5EA 1C3OB 4JQZA 2IZ6A 3ZDRA 2ZRJA 1M75A 1NOIA 4DADA 2D0IA 2KB0A 3EIWA 2VXBA 4UMVA 1TNDA 1C0IA 2H2FA 3H11A 2ZCUA 3CLTD 3KQSA 4Q24A 3HCEA 4S2UA 4HVTA 1VZ2A 3Q3IA 2SBTA 2RGGA 3AEQA 4H0NA 1TEHA 1XEWX 3NCTA 1RWMA 5H3CA 1PYOA 3FWNA 1K68A 1G3IA 2YDXA 2D0OB 2ZI5A 3FJOA 3HKEA 4RJIA 4US1R 4DCTA 1EIWA 2X2EA 5I9LA 3RF6A 4V0QA 5EXEA 2BFBB 2P2YA 1IMJA 5IXYA 3HY4A 2SCUA 3X0DA 2OL4A 3TW8B 4G0VA 2B0CA 4BGEA 1SK9A 1RSZA 4IH4A 4D41A 4FHGA 2FWBA 5D3KA 5DGDA 2GXSA 3OPXA 1G20A 4TTIA 1YL6A 4QUGA 2C5FA 1NFFA 5AJXA 1VFPA 4RY2A 4Z4FA 1A27A 3OX1A 5DLYA 3D6HA 4F4IA 1NMZA 3U4QB 4N6NA 4MR8B 2D4AA 1RP7A 2ZYAA 4GMKA 1TCVA 4J75A 4ALIA 3WJ7A 4G97A 3R9XB 1RRMA 1SQFA 1WZEA 4GMGA 2ZVJA 3IKJA 4PAGA 3TW4A 2QRQA 4FHEA 4J2HA 3KYJB 2PRZA 3A36A 4LRUA 4NFYA 2BL4A 5C1PA 5TJHA 4DJJA 4QFMA 3KVYA 5AI9A 1M2HA 4FFBA 1PFUA 1XF1A 1ECJA 4ZDIA 4TSKA 3N7AA 1G21E 4L85A 1HQYE 5KTTA 2AC7A 1UXKA 4PRZA 2BGGA 3GOQA 4OP1A 1V9LA 3G9XA 1RM5A 3M9XA 1X92A 1MQ9A 1WUTA 1JHDA 1SUPA 2Y6UA 3D6AA 1ZC4A 1EVJA 1IVNA 1BH6A 4UBOA 4Q9JA 3D81A 1O4WA 3NIDB 4CM1A 5KJ1A 5MGNA 1VJGA 3NHWA 1ZH8A 3ZS9A 3ZW7A 1NG9A 1BG6A 1QRDA 1TKRA 4AYTA 1I94B 2JLXA 2J3MA 3FSEA 3RASA 3TL6A 1JBQA 1YO6A 3R6WA 4Q82A 4B5LA 2CD7A 1TM1E 3M3HA 1A8PA 2XCOA 4AZ3A 1DPFA 1T2AA 5LOVA 5AI8A 3IMCA 4PQFA 1S7GA 2C99A 1A9QA 3DP7A 2EW2A 4CODB 2FR1A 2VWHA 3H5LA 3R3YA 5CNJA 2NUPB 1KYXA 3FF4A 4Z3KA 5I7UA 4G5QA 1SVLA 3ZWCA 1PBNA 3LX8A 2OORA 4M83A 3ZOKA 5CLQA 4DHWA 1Q20A 2WWYA 1UEIA 2X4LA 1QFSA 4BKMA 3ZLBA 5JQGB 1WQ1R 3O3CA 5TXGA 1VLQA 1XJ5A 3V55A 1Q1EA 1N34B 4WIAA 1P2UA 4OA8A 1QCZA 4HDKB 4NCKA 4AN0A 1O77A 3KB1A 4LC9A 5SZHB 1J9EA 3I37X 1DRVA 1T35A 4PGAA 1SKQA 3PC8A 4D8UA 3O8NA 1MU0A 4J0GA 3WADA 3TTVA 4DR4B 3HJNA 3M4YA 4Q1DA 4QRHA 4F06A 4M8NE 4DRYA 1JPUA 2Z3WA 4F21A 1QHNA 2JBAB 3RTEA 3I34X 4FJ1A 4BTEA 2RHDA 1HDEA 5JSQA 1GG2A 3E2MA 5J2UF 4AJIA 5EZ5A 2H5JA 4E7OA 3CB2A 2VDKB 1M1NA 1Y80A 4X95A 5DXFA 4BFLA 1CF4A 4XQGA 3AXSA 2I3DA 3LRPA 4KUHA 5AM1A 3I2YX 1ZKDA 1GADO 1W5SA 1VE7A 4HX5A 4EVQA 5FLYA 1X1SA 4J07A 1OFVA 2CZQA 1UAAA 1TQ6A 1GYRA 2VF7A 4HUQA 3OQMA 2PGIA 1HXHA 2R1TB