3PDJA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with 4,4-disubstituted cyclohexylbenzamide inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
272
structure length
272
Chain Sequence
b'QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRFIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Synthesis and Optimization of Novel 4,4-Disubstituted Cyclohexylbenzamide Derivatives as Potent 11beta-HSD1 Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 101
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pdjA00
1KEVA 4XYLA 1B26A 3JQ9C 3DHEA 3ST7A 1FDSA 3E18A 3KV3O 3OF2A 7ADHA 3HJAA 3H9UA 3VPHA 3W8EA 5EMHA 4M55A 3WYBA 1YWGO 1ZFNA 2EIHA 5ER9A 3NEPX 4ZQBA 4EEZA 3ITDA 1OC2A 3CSDA 4CLEA 1M76A 3VKVA 2DBRA 1PL6A 1A7AA 1C0PA 3RIHA 1E7WA 2GZ3A 4RF5A 5JYEA 4Y8VA 4B8ZA 3H4VA 3ZDFA 1EVJA 4FS3A 1XA0A 1E3SA 3MTJA 4TMFA 3RVDA 3T7EA 1ZCJA 4K28A 3ZI0A 1PJ4A 3K8ZA 1LEHA 1ISMA 1PWXA 3BMOB 3D64A 3LLVA 4IDCA 5G4KA 2VCYA 3P2YA 1XGKA 1I30A 2B37A 2RCYA 1D3AA 3ZNPA 4CUJA 4IDAA 5CPBA 3F5QA 4D44A 4A10A 5C3MA 4DPLA 1E6WA 1O8CA 1I5RA 2ZCVA 3TZCA 3ROMA 3IS3A 2IRWA 3JSAA 5ILGA 3U9LA 2W2LA 3FHLA 1EUCA 3CMMA 2NM0A 3K2BA 2PZJA 2EXXA 1GY8A 1ZEJA 3IP1A 3FWNA 4II2A 4AICA 4E5MA 4CV2A 1R4NB 4BMNA 1TT7A 3KLPX 4NQZA 2PD6A 2GGSA 1A4UA 5U4QA 4P22A 4ZQFA 1GEEA 1LUAA 5A9TA 4QO7A 1W73A 5EJ2A 3LT2A 4DLLA 2H9IA 3KSUA 4P4LA 4DMLA 4CQMB 1JKJA 1NFFA 4BO2A 4R68A 3WLEA 2R00A 4I9NA 2GRAA 3DZBA 4JXKA 3WGGA 3DBRB 4A2CA 3L6DA 1NVGA 4PVCA 3UF0A 2CNBA 3UXYA 2FZEA 2H63A 3NGXA 2V6FA 4KUHA 2CDBA 1GZ6A 4RVSA 2FR8A 2DPHA 5BSHA 1WPQA 1WDMA 1V9LA 4CMBA 2PTGA 1EFLA 1EK5A 3TRIA 1QV6A 4L73A 4DC1A 3X2EA 2IDZA 3FN4A 4RPKA 3IJRA 4TKLA 3HN2A 1KIFA 3GEGA 1N9GB 2R6JA 1LI4A 4DPKA 3F47A 4A5OA 4U6SA 1JLLA 2Z1MA 2EWMA 4WCDA 4UEKA 1VJ1A 1BSVA 4BO3A 5LDGA 1XSEA 3PGXA 2GZ1A 3H2SA 2PZKA 3LDHA 2IYPA 1W4ZA 3QA9A 4YVFA 3ONFA 5G0TA 4UVIA 3VDQA 5JMWA 2AQIA 1W8DA 5IJZA 4W99A 2AEMA 4QQRA 3JQBC 1MXHA 1ZKMA 1QYXA 5IDQA 2EKPA 1WNTA 4RF4A 3TQHA 4E13A 1H2HA 8ADHA 1F17A 2G76A 1LSSA 3UH1A 4XZ3A 3ASVA 3GZNA 1Y1PA 1ONOA 3EK2A 4JJFA 5ER6A 5TGDA 2V6GA 1R37A 3WGIA 3C3XA 2HQ1A 3GFBA 3VZSA 1DIGA 4CMCA 4N54A 3RBXA 4ZJUA 2FR0A 1GTMA 3AFMA 4UVEA 1Y9EA 3O8QA 3D4NA 4ZA2A 4GX0A 1MXFA 3ZU4A 4RL6A 3AY7A 3DQPA 2GSDA 4Q39A 4UEOA 4C4OA 3S2IA 3PJEA 4YAEA 2JCXA 5A9SA 1ENPA 1E3IA 4XJSA 3Q11A 1I2ZA 2PLAA 4BO0A 4WCFC 1LC0A 4I5DA 1EVIA 2QIOA 3VPGA 1NNUA 1SCUA 1SO8A 4JNKA 1BG6A 1IPFA 4Q3EA 3ZW8A 2NADA 4FC7A 1XG5A 3GPIA 4OXYA 5G0UA 4PFJA 3GF4A 3ENKA 1FF9A 2G17A 5I8WA 2BI7A 3JYPA 4BKPA 3K9QO 1T2CA 1K2WA 3UFXA 3U0BA 3UN1A 5HRUA 4BS9A 3H5NA 3S2GA 4FFMA 4LMPA 1NHWA 4HWKA 3GVCA 5T8KC 2POQX 3R3JA 3WIEA 3DHNA 5TT0A 3EMKA 4LRTB 1DC3A 4A0SA 3GVHA 3INRA 2YV2A 3ZWCA 1UAGA 4XQEA 4ALKA 1H94A 4O5OA 2VNSA 2NNLD 4J91A 2WSBA 1ZSNA 4RVGA 1FDTA 1KEPA 1IYZA 3CMCO 5ILOA 5T67A 4L4RA 2B5VA 3D4OA 1KEUA 1M2WA 1NAHA 3I6QA 1EBFA 2J3IA 4MVJA 3M6IA 5F1KA 4PLVA 1E3JA 1YBMA 5GY7A 1U3VA 4PN3A 2FSSA 3RROA 4ILKA 3IJPA 3ZWAA 2Q3EA 5G4KB 3GNTA 4GGPA 3I4CA 4PZEA 3BMNB 4IPTA 2XXJA 5BR7A 4PLFA 1J4AA 2FZWA 4CM9A 2XXBA 2QX7A 4EUEA 3ZGYA 3NT4A 1X0VA 2RHCA 2X5JO 2ZYAA 2VZ9A 3DOCA 3AJRA 4MDHA 4EEXA 2GDZA 1E7QA 3DTYA 3RSHA 3A06A 1E6UA 3PHLA 4R1NA 5A1TA 2O4UX 3VC7A 3GRPA 1ZK3A 3UICA 1Z75A 2VYND 4YDRA 2BFMA 4RLSA 3GT0A 3OEWA 3W8FA 4RVDA 2J5QA 3IDSA 4EBFA 1T24A 2LDBA 3V1TC 5BSGA 3A14A 4XCVA 4II3A 2D5AA 3KO8A 4WPGA 4I9HA 1OMOA 3OA2A 3P2OA 3DMTA 2G5CA 1AUPA 1H6AA 4ZGWA 3MJVA 1C0LA 1P77A 1RYEA 2O3UA 4DREA 2ZK7A 3INGA 4RGBA 5F5LA 3UAGA 4IXTA 3V2UA 2FWMX 4P8RA 1D8AA 3W6UA 3OH8A 1H6CA 3TZKA 3OICA 4MKXA 5F21A 2EKLA 3DR3A 1MC4A 4BKRA 2GERA 1UDAA 4U0JA 5DDIP 3ONEA 3FNEA 4F6LA 1T2EA 3G17A 5DN9A 3MWDB 2HMWA 1DLIA 4FFRA 2PKQO 4NZ9A 4CM1A 2OL4A 5DCYA 2P68A 3DZGA 5L53A 4JN6B 1U4SA 1GV0A 4HFRA 1HDGO 3H8VA 3WSVA 3IKVA 5COAA 1KVUA 4FDAA 3RC7A 4Y6PA 3RFTA 3VPFA 5A4DA 3ULKA 4WLUA 3K92A 3LC7O 1GYPA 2NU7A 2UV8A 4D7AA 1BGVA 4UUPA 1DDOA 3K31A 4E2ZA 3AI3A 1OBFO 4G2NA 4CLHA 4M8SA 3PYMA 4F45A 3MOIA 3TWOA 3D1LA 4I8XA 3ZNNA 1XCBA 2GD1O 4GKVA 2QZ9A 4PZCA 1AXEA 3HG7A 2ZB3A 4U6QA 3ETDA 1E3WA 2O3RA 3JQGB 4BKQA 4DBZA 4J6FA 3SC6A 4AJJA 5K6AC 1R12A 3EYWA 4ZRMA 3R0IA 1HRDA 3Q0EA 3ZWXA 4W4TA 4OM8A 5F5NA 3ZHXA 4ZICA 1NWHA 5CG2A 1LA2A 4RO0A 1D1SA 4YXFA 1RWBA 1H93A 2J5KA 4XDZA 2JD2A 4D0RA 5DP2A 2J8ZA 4DVJA 1NR7A 3U4HA 2ZQYA 3DBHA 1R66A 2H5LA 2CSUA 2P4QA 3RUDA 2Q2WA 1G0NA 3BTVA 3FR7A 3VDRA 4BUCA 2AEJA 4OAQA 5K9ZA 2X9GA 1E1MA 1UP6A 3FRJA 1EUDA 4O0LA 2GO1A 3NTRA 2VZ8A 4D3DA 1LDEA 1PGNA 3C7AA 1E0DA 1ZUD1 4WEOA 3CPSA 1PJ2A 5C37A 3H9JA 2JD0A 1HDOA 4H15A 4RPGA 2A94A 3MOGA 2B4QA 4BIIA 3UUWA 4Q3BA 4NH4A 4Y67A 1F14A 5CDTA 1ZIDA 4BGIA 2NU8A 3EC7A 2B36A 1CETA 4CMIA 1U4OA 1VKNA 5TT1A 3V2HA 1F06A 4BNFA 4XX0A 3WFJA 3VKUA 1Y8QA 2YY7A 1KEWA 2QRJA 3UVEA 5JS6A 2X9NA 5ITVA 1B0AA 1X7HA 4XA8A 4CLRA 1QMGA 1Q7GA 3BMCA 5KVVA 1O94A 2J3KA 4D43A 1CWUA 1LLUA 3L4BC 5CFZA 4BO9A 1E1KA 1JDJA 5TQVA 3STHA 3LT0A 4CM4B 5KJFA 4ID9A 3MEQA 3PLRA 3ZWPA 1KOLA 3WWYA 1Z6ZA 1ISIA 2DLDA 2HUNA 4QSMA 5ES3A 5DBGA 2V7PA 5EQDA 3JD1A 4DWVA 3QSGA 2AQHA 4CODB 1HE5A 4QTZA 4MINA 2VOJA 4CMEC 3DAPA 4YB8A 4WLNA 5JYDA 1B8VA 3JQ9A 1SOWA 3C7CB 3H9EO 4FOOA 1DC6A 4W9NC 4NK5A 4MPDA 4CM5A 3DDNA 3V5NA 1QV7A 1UZNA 3BHIA 4MVJF 2B4RO 3O26A 4L75A 1U9JA 2FN7A 4X54A 1OC4A 3ZW9A 1QYVA 4L4SA 2EERA 1SAYA 4TROA 3ZV5A 1RJWA 1XQ6A 3N7UA 1GADO 2BFOA 2C29D 1VL6A 5T6BA 5AQ1A 1AHHA 3IC5A 4IIUA 3OP4A 4BNYA 3VTZA 3EDMA 2YUTA 1P45A 2WD7A 5CPFA 1JN0A 5GZ3A 5I7EA 1HYHA 2AE1A 4FJ0A 3CINA 4KZPA 2BFPA 4NBRA 5L95A 1LBEA 3AW9A 4WNIA 4WOKA 2X86A 4FPXA 3NJ4A 4BNXA 1H9BA 1GUFA 1PZGA 4LK3A 1TVEA 2AE2A 1SEVA 4NG5A 2YW9A 4OSPA 1MGOA 1T2AA 1IUKA 2VWHA 2Y1FA 1PJCA 4GWGA 1H5QA 3GA0A 4BGVA 1QYDA 5L4SA 1V8BA 3TFOA 1HF3A 1VE9A 1YOVA 4RCVA 3ROQA 1QYWA 4E2WA 4IGEA 3JD2A 3GMDA 2YJZA 1VM6A 1EFKA 1I2BA 4JGBA 4P38A 4CL8A 3C1OA 1MG0A 3D0OA 2HRBA 3IUSA 1W6UA 4GLOA 1SOVA 4UAGA 2LDXA 3TSCA 3IOYA 3ZU3A 3C24A 2DFVA 1E3EA 4A03A 1F12A 1YJ8A 2Y99A 3IAHA 1ISGA 1XWFA 3LU1A 2FPGA 2D0IA 4GX5A 1QLHA 3QVWA 5DF1A 1A9ZA 4XYEA 3S8MA 2P2SA 5U9CA 4MVJM 3NJ8A 4FCCA 4EJ0A 4I5EA 4PLZA 4Y6RA 4AJLA 4LISA 4UREA 3SVTA 1E3WB 2ZQZA 3QRWA 4D41A 2GN8A 4CM9D 1DC5A 4AJ4A 3GHYA 2DBZA 3T4XA 2O3QA 3IMFA 5GZ6A 1IZ0A 4M86A 4NHEA 2BRUA 3HUDA 5CP8A 1NP3A 3ZWYA 3E9QA 1C3VA 5JNLA 1XU9A 1B7GO 1HL3A 1HLPA 1SEPA 3NDJA 5DBFA 4J9UE 1I2CA 1HZZA 4JBHA 3PWKA 5IZ4A 4FB5A 3DBHB 1U7TA 4UUMA 3WNVA 2A35A 5BNIA 1LTHR 4J4HA 4FR5A 4XR9A 2J3HA 3I3OA 3CEAA 5CDYA 1YQGA 1DJQA 2W98A 2PD4A 3EY4A 1PS8A 3JQBA 3OJOA 4N5LA 4XJTA 2ZYGA 4C7JA 1EDZA 1NHGA 2NVBA 2QZZA 1JVSA 4E6PA 1PTJA 1E7SA 2HJSA 4IZIA 3PXXA 2PGLA 2HCTA 3IQDB 4EJ6A 5JAZA 3FPLA 3GUYA 5EESA 1M6WA 1ZK4A 2I66A 3DZFA 1BXGA 4TRNA 3GRKA 3NT2A 1K6XA 4HBGA 2HSDA 4PG4A 2XF8A 2HK9A 2NTVA 1B16A 1GQ2A 2YFQA 2X5KO 4CLXA 4P4GA 1MFPA 2UAGA 1XEAA 1YB1A 3F46A 4NJMB 3SJ7A 5JXWA 4O6VA 1Y8QB 1U3WA 3SX2A 4IBOA 1LQTA 2C7GA 1O89A 4ND2A 5I8ZA 3ZWVA 5A5FA 1ONPA 2I3AA 3LVFO 4CM7A 3BMCB 2YHIA 3K30A 2EEZA 1ZO8A 1FK8A 1V35A 3WQSB 4DLAA 3LF2A 1U2GA 3BYZA 4TRJA 4YRAA 2QRKA 4WCFA 3LT4A 4ZQHA 5A03A 4MVJP 1BXKA 1Q7BA 4NR0A 1HSZA 2P5YA 1RM3A 3QQPA 2X23A 1D4FA 3RBVA 2DTXA 4UVDA 2J6IA 3G79A 4IZHA 4CQLA 3ITKA 1JKIA 2Q1WA 5MDHA 3WGTA 2OO5A 2VTDA 3KUXA 3A4VA 2VYNA 2UUOA 4PG7A 1DIHA 3U09A 3X2FA 1ADGA 3OA0A 1VI2A 5AXBA 1P1KA 5T8KA 4OO3A 5C7OO 4RPJA 5TNXA 3L6OO 1V0JA 1PJSA 4XQCA 4YWJA 3TZ6A 3KLMX 1PX0A 1QR6A 1YQXA 5IN5A 3GN2A 2AQKA 3WTCA 1P9LA 3OIDA 3KSDO 3PJGA 4FFLA 1YDWA 3E8XA 3NYWA 2JFHA 4JP2A 3SLGA 4TZTA 4J4TA 1X14A 3GDOA 4PIVA 4PLTA 4IM7A 1DJNA 3V1UA 1QLJA 2WD7B 1Q2XA 3OJLA 2ZTMA 4RPHA 1JWAB 4Q9NA 1LSOA 4WLEA 4E2XA 2CMDA 5KNLA 3M1AA 1IHYA 5ICMA 4HNHA 3EAGA 4AFNA 3PFFA 5L4LA 5C7LO 2X22A 3DZKA 1MUUA 3MWEB 4TRMA 5T5QA 4H16A 1EZ4A 4DUPA 5L40A 1EDOA 4FW8A 4BNVA 2VOEA 2ZB4A 4OIMA 3K2EA 1N8KA 3OECA 5F1OA 3E1KA 3H65A 4E2YA 1PL7A 3KEQA 1PR9A 2P4HX 1YOVB 3MJ4A 3KTDA 1M67A 4I1IA 2PH5A 4GI2A 4AJOA 3I9JA 1Y5RA 1B8PA 4W7HA 3NT5A 3U4DA 4BO1A 2ZTLA 3E03A 5G0SA 3ZWBA 4JBGA 3H2ZA 3GGGA 1VL0A 4J7CA 1BHSA 4E3ZA 1KVQA 2P91A 4GQAA 1P1HA 4XYGA 2Y68A 4BOYA 4MKZA 1BVUA 3PWSA 1GPDG 4C7KA 4PG6A 1QSGA 3KHUA 3WBBA 2C54A 4GWKA 5HBRA 1BW9A 4TKMA 5KVQA 5COBA 3UCFA 1JAYA 1PU2A 1NTOA 1SPXA 4LGVA 1DPGA 4QXMA 2GUGA 5JAIA 1LLDA 4NBVA 2E48A 4F46A 4XQGA 3I83A 4GSLA 4F6CA 4IIVA 1A72A 2DAPA 1NFQA 3FTPA 1I10A 1KS9A 3KXDA 4E21A 3GNQA 4AJEA 4DIOA 1I32A 3ZV6A 2PR2A 1J49A 4ZQEA 3U49A 1YONA 2W8ZA 3GEDA 3JYNA 1NVMB 3FWZA 5LC1A 2EG9A 1HWYA 3Q9NA 3TL2A 4EJMA 4IUYA 3PYLA 4GX2A 2JD1A 4KWIA 1ENYA 4PLHA 4BQPA 2CZCA 1N1GA 3KBOA 3LC2O 2TMGA 4XB2A 1CJCA 1LJ8A 4RV9A 1ISHA 5I7FA 3RUHA 5JFOA 1KC3A 2QYSA 3GOHA 5B4TA 5K6AA 2D5CA 4XIYA 1K0UA 1LNQA 1KVSA 4YEDA 1P0CA 1W0CA 5TC4A 4EW6A 1BXGB 3BA1A 3ICPA 2DFDA 4CL3A 1O0SA 3UGKA 2BI8A 2ZTUA 2PV7A 5AXDA 2IYOA 3ZV4A 5JPIA 1PJQA 1OZAA 1T4BA 1Y8RA 4LN1A 2HRZA 4OOFA 5BNFA 4ZQGA 4YA6A 3SXPA 4CR7A 2C2XA 3E6AA 4WE3A 1VL8A 4KQWA 2NACA 5L7WA 3HADA 4J16A 3PIIA 4BNHA 4HFMA 2DTDA 1X7DA 2V6BA 2O3SA 1WDLA 4OOEA 4R9SA 5A3JA 4M49A 1KYQA 3TZHA 1BDBA 1PIWA 3WIDA 5FF9A 2WM3A 5JW6A 3H6KA 2Q2QA 5JC8A 1DB3A 1QP8A 5IDYA 3ASUA 2EV9A 4CM8A 1ENZA 2VUUA 3JYQA 5IG2A 3RU7A 2C20A 3O03A 1VC2A 5C7IO 2Y0DA 1ZK1A 4G65A 3EVNA 4B4OA 1FDWA 3FPCA 1R0SA 5KVCA 5KKCA 2G0TA 3D7LA 1Y5MA 4CQLB 5IFLA 3JV7A 1X1TA 3IIEA 1X0XA 3ADOA 1MP0A 1YB5A 2NV6A 1TLTA 3OFSA 4YJGA 5IF3A 4QECA 2H6EA 4FFPA 5CEJA 2BGLA 3PI7A 1DAPA 1LSUA 4NFSA 4R41A 4HADA 1U3UA 2JFGA 5EINA 3WMXA 3VOSA 4ALIA 1ZMTA 4QUKA 1LRJA 3WGQA 2GZ2A 2I67A 2V6MA 4KQXA 1DFGA 3L4BA 4GVLA 2D59A 4XDYA 3UCEA 3BXXA 3KEOA 4NMHA 1DAOA 1A27A 3ABIA 3GVIA 2GASA 2I3GA 3MTGA 1F8GA 2WE7A 4LVUA 4INAA 5DNAA 1ML3A 4CMEA 1I3KA 3ZWNA 1B3RA 1TXGA 5G0WA 5CDSA 1KY5A 3HB5X 1CIVA 4RDHA 4XKJA 4W9NA 1Q1NA 5DCWA 4S3MA 3WSWA 5TJ9A 2BFAA 1QKIA 4MP6A 4KOAA 5B1YA 1AXGA 1OI7A 1FMCA 1HXHA 1E1NA 3I6IA 4DTIA 2I76A 1ZXLA 3NTQA 3EUWA 9LDBA 2DU8A 1E3LA 3V2GA 1JAXA 3O38A 1Y81A 4I5GA 4XYMA 3G1UA 2EF1A 2OHXA 4CR8A 5MGBA 5CG1A 4FGSA 1QYCA 3DBVO 4YJHA 2GCGA 5BQFA 4LCEA 2D8AA 2CDCA 3Q2KA 4QEDA 1GQQA 1PZFA 2UUPA 5THKA 4FJ2A 2XAAA 4WGGA 3NTOA 1YL7A 2Y1OA 4IS3A 1BDMA 2YQ5A 2IZ0A 1T25A 1Z7EA 4J1TA 4Z0TA 2FR1A 1PS9A 1NQOA 1P3DA 4FN4A 1HDZA 1VJTA 2NQ8A 4JX8A 5A05A 1BW9B 1GD1O 4E5NA 4AJKA 2JCYA 5AXCA 4B79A 4RVFA 3AOEC 3WLFA 3KZVA 4BB5A 3IUPA 3L4SO 1R0KA 3PHIA 4BVAA 3K73O 4E12A 9LDTA 2BHLA 4CJXA 1UXJA 3AUSA 2X9VA 2DQ4A 1DXYA 4JROA 2VHWA 4N7RA 4BNWA 3KYDA 4BQRA 3JD3A 3QV1A 4WNCA 4ZD6A 1NPDA 5B37A 5T57A 2UVDA 4L9RA 3PWZA 1LRLA 4A27A 1B8UA 1HDYA 4LSWA 3TN7A 1GCOA 3JQ8A 1EE2A 5B4UA 1R0LA 3QIVA 2VWGA 1ZBQA 1TA4A 2CF5A 2BD0A 2HMUA 1SC6A 1ADCA 3AWDA 3DZJA 2X5OA 4ONEA 2VHVA 1OAAA 1EQ2A 1V3TA 4HY3A 4E5YA 2JJYA 1TEHA 5H83A 3JQEA 4BNKA 1HDRA 3F5SA 3LLSA 1UXGA 3GGPA 3WYEA 2YFHA 3DB2A 4M89A 3DO5A 3B70A 1N2SA 2R2GA 4HFNA 3UW3A 2IEBA 2W90A 4PLGA 1DRUA 3RUFA 4NI5A 4O59O 5EERA 4DXHA 5IDXA 1T4DA 1K3TA 1PSDA 1UXKA 3VZQA 3JQCA 1WXDA 4ESOA 4I5FA 4RJTA 1Y8RB 2CF6A 2ZTVA 1X15A 5TSDA 3Q2IA 3BHJA 2JKVA 4LW8A 3DMYA 5DZSA 3O4RA 3VVBA 4F3YA 2IXBA 4CV3A 1PS0A 2O48X 5IZCC 3RKRA 1ZJYA 4FD3A 4RQUA 3U5TA 1K6IA 4HP8A 4R3NA 4DC0A 4R5HA 5HS4A 5TLSA 1MFZA 3FTNA 1BXZA 4IXWA 3GZNB 5CHEA 3JCZA 2VN8A 1NX6A 2FRDA 1I3NA 3WQQA 4CM8B 4W7IA 4IDEA 4MIOA 3C1AA 2EGGA 5HM8A 4U5QA 1T26A 4NU5A 5KJ1A 2AA3A 3JQ7A 4R3WA 4BGEA 2CFCA 3K6JA 1YS4A 3WJ7A 3O8QB 4KWHA 3GQVA 5T64A 4EDFA 1V3UA 1DBVO 1JTVA 5DOZA 2VYVA 2OP0A 3A28A 1ZJZA 3TFQA 3P7MA 1ZSVA 2C82A 5A9SB 5J23A 5IXSA 1UAYA 3VTFA 3ANNA 3JQAD 5JSFA 4Z9XA 3PZBA 2X8LA 4Q3CA 2O2YA 4DMMA 1E77A 3PHJA 2OP1A 4E32A 5JCJD 2C5AA 2RIRA 1WAMA 1QG6A 2B4TO 2Z95A 1RM0A 2WDZA 3P19A 1X7GA 2NVWA 2B5WA 1DC4A 3H3FA 4JP3A 3W4JA 4AL4A 4YR9A 1NAIA 3QWIA 4E33A 2ZATA 2HDHA 1ONNA 1PGOA 5A9RA 4YPOA 3QLJA 3U4CA 2PKQP 4JLWA 2A4KA 2DM6A 3KYCA 4Q3NA 1YQDA 1O95A 1RYDA 3BMQA 3HWRA 4BO6A 4B4WA 3C85A 2FPPA 1DIRA 2YYYA 3NAQA 5DOVA 1JWBB 2QG4A 4XRGA 4UUNA 3AUAA 3ANMA 2AQ8A 2EW8A 4DQVA 5HWSA 2GF2A 4FQ8A 3NX4A 2OXIA 4EUHA 4RPLA 3H5RA 4TVBA 4BGUA 5BT9A 1P33A 4YRBA 1E1LA 1I0ZA 1EVZA 4E5KA 2Q2VA 2X58A 2OBNA 4YJHB 1CEQA 2EW2A 1LDNA 1R15A 1E7RA 2XPCA 1VKOA 4MP8A 4D3SA 2O23A 3PZRA 4CLOA 3LYLA 1N7GA 1JQBA 1HYGA 3WWZA 3OIFA 4IINA 4R9RA 4IGFA 3H3JA 3RD5A 5GMOA 5JDCC 3WS7A 2VUTA 1X1EA 1Y6JA 3KM0A 1MB4A 1PWZA 3TOZA 3HN7A 2FSVA 2UYYA 1KERA 1QORA 4OH1A 1V3VA 2WMDA 3MJSA 3PDJA 4CLDA 1GQYA 1U8FO 2A92A 3RC1A 3TJRA 3T4EA 2DTEA 4E31A 4HNGA 1WW8A 2BMAA 3KYDB 4EZBA 1ZVMA 1EE9A 3H5AA 2I65A 2BGKA 2VNAA 3WFIA 1I24A 3ETGA 2QYTA 1ENOA 5FI5A 4OSOA 4CM3A 1PQWA 1O6ZA 1T1RA 3JQ8B 3INTA 2Q4BA 3GPDG 3QWFA 4HUJA 1IE3A 2HKIA 1FDUA 1HDXA 3GEMA 5ENVA 1GZ3A 2W2KA 1LDBA 2Z5LA 3RUIA 1LLQA 4UVGA 1OOEA 4LRSB 1K5HA 1Z7BA 3DZHA 3G0OA 4NBWA 4WEQA 1Y7TA 3E5MA 3WGZA 5FEUA 1YDEA 2YV1A 2PGDA 5AVOA 5DT9A 2SCUA 4URFA 5BSFA 1WP4A 3VH2A 2D3TA 1UP7A 3DXFA 1TT5A 3WICA 1ZXBA 2C07A 4K6FA 3SJUA 4NDNE 3FI9A 4ALMA 4XYBA 3TF5A 1HLDA 1KETA 4CMGA 2VHYA 4OKIA 3WQRA 1NFRA 1RM5A 1DIBA 1WZIA 2HK8A 4MIYA 1A4IA 4DLBA 1GYQA 2CD9A 3BZUA 2B83A 4XWYA 4CM6A 4BHTA 2Y1DA 3WGYA 3D5TA 1XKQA 1I36A 2OUIA 1UDBA 5B12A 4UEJA 4O1MA 1Q0LA 3F1LA 3HDJA 4GSKA 5TX7A 1DO8A 4PRLA 1YVEI 1WMAA 3RCBA 4W82A 3GMSA 3MJEA 1YJQA 3ZWWA 3EW7A 1SBYA 4CMJA 4BL5A 3PVZA 1DHRA 3L0DA 2OZPA 3JQ7B 4L8VA 2BGMA 1AN9A 3LQFA 3C7DB 4FGWA 4CMHA 3RC9A 3G3EA 4NK4A 4N5NA 4RZHA 1ULSA 4DYVA 2VWQA 1HYEA 1XDWA 3DFUA 3RUEA 2P9GA 4CQMA 3JD4A 3TOXA 2FMUA 4YACA 1M75A 1N92A 1YL5A 3KB6A 3F1KA 2QQ5A 1U7HA 3QJ5A 2DUWA 4HFJA 4ALLA 3PFWO 4CMIB 4N18A 1WLYA 1YL6A 3D4PA 1ZEMA 3ZCXA 3ZWMA 4BO5A 3AM3A 1NQAO 3S1LA 1AHIA 2PD3A 5TIIA 2ZIZA 3GDGA 2VWPA 3GGOA 4MVJI 2O7SA 2JCVA 3OQ6A 3Q6IA 3FR8A 4GX1A 4NNJA 4CLRB 8LDHA 4GL4A 4B3JA 3EVTA 3LF1A 3OBBA 4HX5A 1FJHA 4KDEA 4UULA 2NTJA 3BMQB 1PQUA 4YCAA 1HKUA 3OSUA 5KOIA 1HZJA 2EGHA 4PLWA 2JAHA 3COSA 3I23A 4Q3AA 2O2SA 4BNMA 4YQZA 2F00A 1N7HA 3M2TA 1O5IA 4DRYA 3AUTA 4NBTA 1U5CA 5AXAA 1WVGA 4BO4A 4BNGA 4A7PA 3Q3CA 5L45A 5KJEA 1G1AA 3WGHA 4B7XA 4PRKA 4ALJA 4CLOB 1DEHA 3Q9UA 1NBOA 1XELA 2X0IA 3GY0A 4U0KA 1B15A 3L9WA 4XRRA 4K1LA 1RM4A 1R4MA 1U2DA 3FNGA 3KRTA 1NR1A 4L76A 1PGPA 3F3SA 4D46A 3PK0A 4D42A 5CAEA 3TL3A 2VYVD 4YT2A 2IZZA 3QVXA 2HO5A 4CR6A 4G5HA 5LCXA 3DOOA 3TZQA 3PPIA 2BLLA 4IDBA 4PLYA 4MVJG 2CVOA 4O63O 3CIFA 1T1SA 5IN4A 3PIDA 5FFFA 2CVQA 4DIFA 4MIEA 1YBAA 5F3RA 5CEEA 1C14A 4MO2A 5JLAA 4L74A 5KJCA 3NDIA 5FWNA 3RU9A 3AK4A 4GVXA 3C1TA 5L3ZA 5K0ZA 2NSDA 1SB8A 4YAGA 3I5MA 2W2KB 2VZ0A 2PFGA 2X6TA 4DIBA 1NWCA 1PGQA 2H1SA 3B1JA 4IMPA 4FOSA 3UKOA 3EGOA 1B3BA 3I9LA 4BO7A 4J3FA 2Z1NA 3WJAA 1H6DA 2GN6A 2E82A 4JJIA 4WLOA 2Y1CA 5FYDA 1U3TA 4J49A 3AOEA 4J1QA 4R54A 3F4LA 3JQFC 4BNZA 3NGLA 1TT5B 2FP4A 5KIAA 1R16A 3ADPA 2C0CA 4WOJA 1GU7A 3L9XA 3ROKA 4GAEA 3GR6A 1LDMA 1ID1A 1HEUA 4MOWA 4YTEA 1G0OA 1PL8A 1T2DA 2PKRA 4KTTE 1J6UA 1T2FA 2WJPA 1DOHA 1IHXA 4PZDA 1GEGA 3PGJA 3L77A 4EI2A 1VRWA 3ZHZA 4JK3A 3OHSX 3GDFA 1MV8A 3QVSA 4ROSA 3HNPA 4KDFA 4Y9DA 4FIZA 4OQYA 3RFXA 4J1NA 3ZV3A 4BKOA 1SMKA 3AM4A 3QWHA 4R1UA 1M66A 3PEFA 5JDIC 4XEHA 3BMNA 1JKFA 4YJFA 1XHLA 3G1TA 4Z9FA 3E9MA 4RF2A 1DFHA 3GAZA 3QWBA 4K26A 3HFGA 3DAGA 2YZ7A 4DBVO 5KJ6A 3RUAA 3NRCA 4OJNA 4OQZA 3ZU5A 3QVOA 3RJ5A 2VTEA 1U5AA 1FXSA 4YAJA 3JQAA 3HDHA 4CUKA 2FPIA 4QFDA 1ARZA 4BB6A 3ZH2A 5ICSA 5JCJA 4XQ9A 3S2FA 3FD8A 2VQ3A 4R16A 5IXYA 4JIGA 4JJGA 3RI3A 3VVCA 5IZCA 3CE6A 4R4JA 3BTOA 5L9AA 1IL0A 1YGYA 2Q49A 3QE3A 3AU9A 1ZMOA 4FFNA 1P0FA 4J9VA 4WLVA 4E0BA 3U4IA 4GH5A 1K6JA 3OMLA 4R01A 3S2EA 1EUZA 1I33A 4AG3A 2HAEA 5A02A 4CV1A 2C59A 4TSKA 1E5QA 5DULA 2P9CA 3W8DA 2GYYA 4BV8A 1YXMA 2PWZA 1GZ4A 2DKNA 1ZK0A 2EJVA 3P5SA 3VH4A 3FSRA 2TMDA 1ZK2A 5ADHA 2YHIB 1PQPA 5EIOA 2IE0A 5JY6A 1UUFA 4NBUA 1JA9A 1UR5A 4UVHA 5TRTA 3U3XA 4M1QA 3VZPA 1VJ0A 4WCFB 4WK6A 2OORA 4Y6SA 2YHUA 3BAZA 2YV3A 2VRCD 2ZJ0A 2JAPA 4FSHA 5COQA 3OIGA 1NVTA 1V6AA 2ILTA 4D0SA 1H6BA 5F1PA 3GZ4A 3V1YA 1KY4A 1LDGA 4XB1A 1YKFA 2I99A 1HE3A 3E48A 3PHGA 1N5DA 3JQGA 2X0RA 4G81A 4J90A 4ND3A 3OM9A 4U7WA 5ENDA 5H82A 3SBOA 1CYDA 3DAFA 2J5RA 3QP9A 4GMGA 1IB6A 5IDWA 5L4NA 3DFZA 3PHHA 4B3IA 1TI7A 1NQ5A 2VRBA 4FJ1A 4DL9A 2E4AA 1R4MB 1IY8A 1J5PA 2QW8A 4XR4A 4YRDA 3RBZA 2I5PO 4NFYA 5EN4A 3NUGA 4NJOA 1E5LA 4ZU3A 1Q7CA 2HU2A 4FFOA 3I9OA 4RORA 3BIOA 1KVRA 5A5EA 3G49A 4A26A 2A9FA 3DC2A 3JQDA 3LC1O 3D3WA 2PNFA 2RH4A 4CQMD 3M2PA 2Q46A 1UZLA 4J0EA 3S55A 3GK3A 3ENNA 3GNSA 1CRWG 3N58A 3WTBA 3ZN2A 5H81A 2Q4EA 1JU9A 4J2HA 4RDIA 3AM5A 5EQFA 1NPTO 5JMPA 1PJBA 3CH6A 3AY3A 5FI3A 4IY1A 2CDAA 5AOVA 5THQA 5U1PA 5I7VA 3GN1A 3PLNA 4IQ0A 3WXBA 4NPCA 4M54A 1O9BA 5I9NA 4D45A 1PJLA 2E49A 4IDFA 2HMVA 3E82A 5JDCA 2RBEA 2GLXA 1LDYA 3OQBA 3E5RA 2EJWA 2WEKA 4JBIA 2DUUA 3PQDA 2CUKA 2NVUA 1CQIA 1D1TA 3HFSA 4PLCA 1LC3A 4IDDA 3RKUA 3AU8A 1U1IA 1Z45A 1ISJA 5TF4A 3PQFA 4Z0HO 4ND1A 1NASA 1GAEO 3AUUA 5BNTA 2Y1EA 5JC1A 2BH9A 4CMKA 5JCXA 4YBZA 1P1IA 4CM4A 1HE4A 2WWRA 1PJTA 3EZYA 2FOIA 1ISFA 3F4BA 3WG9A 1C1XA 4R69A 4ALNA 3W6ZA 1YRLA 3RUCA 1UH5A 3NDRA 3HSKA 5I7SA 4KUGA 2C7VA 2W4QA 3KSZO 4R1TA 1VSVA 4WJZA 3RASA 1DIAA 2X1HA 3PP8A 3WX0A 2G1UA 2PK3A 2B69A 4YJFB 4B4VA 4MKRA 1L7EA 2ZJ1A 3WOHA 3ZNOA 5A3VA 4XGIA 3HE3A 3JD0A 3QWAA 4YQYA 2OFPA 3WBFA 1NM5A 4CPDA 1B14A 1LSJA 3KVOA 3GG2A 3F6YA 4A73A 1LU9A 2AMFA 3ZHBA 2ZKLA 3JQAB 1ULUA 1VSUA 4J7XA 4R5MA 2AHRA 3FBGA 4IS2A 1ZH8A 3DWFA 5I9MA 2NLOA 3IKTA 3GVXA 3NKLA 4WASA 1E7YA 5KCZA 2VT3A 3D5QA 2NU9A 3QVTA 5HTOA 1IPEA 3ETEA 1DLJA 5G4LA 2DVMA 3PTZA 1GUZA 3ORFA 3VZRA 1EEHA 3E9NA 1WMBA 1HDCA 5G0VA 3HDQA 2E6UX 5EL0A 3OQ1A 3UCXA 5TJHA 3DTTA 5L7TA 3TNLA 2PH3A 4OXKA 5KWEA 4Z3DA 5IAAA 3RQSA 4EYEA 4I08A 1ZSYA 2Y0CA 4HXYA 1PR3A 1L1FA 4MJLA 3B20A 3GC6A 3JYLA 5C5IA 4ZRNA 5L7YA 1EK6A 2DBQA 3A1NA 3DEYX 4EITA 2R00C 3MCVA 3PRJA 2I6TA 4GGOA 3ZU2A 3JYOA 4DQUA 2AW5A 1CQJA 2C2YA 1UDCA 3SEFA 1A7KA 3A9WA 1YO6A 4J1SA 3I4FA 3IP3A 1C0KA 4Z9YA 3VPSA 1Z73A 4TVOA 4JQCA 1BTOA 1BMDA 2X4GA 3ICCA 1WWKA 5TS3A 3WNQA 2D2IA 4TQGA 6LDHA 1Y9AA 4YJDA 1YE3A 5CEFA 5BSEA 3JTMA 3GVPA 3SC4A 1PJ3A 2Y67A 4YT8A 5JY1A 1CF2O 1HT0A 3OJFA 3RAJA 4BNTA 1SB9A 1QRRA 4YJGB 3C8MA 2D1YA 2UDPA 1RPNA 2VHXA 1C1DA 2W2LD 1YBVA 1MLDA 3ZZNA 2X0NA 1X13A 3EHEA 4WKGA 1DHTA 2QHXA 1JW9B 3W1VA 3B6ZA 4BMSA 1F0YA 4CV0A 3GH3A 1BVRA 1PZEA 1YB4A 1KBZA 1MG5A 1WDKA 2DBVO 3ANLA 1A71A 3FNFA 4EUFA 1CERA 7MDHA 4U8GA 4D3FA 3D3WB 4OKNA 1P1JA 1P74A 2WTBA 3GAFA 3WMWA 2EHDA 3GFGA 1CDOA 3LK7A 5HS6A 4FC6A 3AI2A 2Q45A 2JL1A 1P1FA 1XIVA 5KKAA 1BWSA 4XGKA 1LRKA 1Z74A 6ADHA 3CTMA 1LLCA 4JCOA 2Q1UA 3DBLA 4AJHA 1F8FA 4GLLA 1ADFA 4RVUA 4GPD1 3FF4A 5KVSA 1XR3A 3LZ6A 3ON5A 2X7HA 4RVHA 4B7UA 1DFIA 2V65A 4YAIA 4NJMA 1U8XX 1A9YA 4AJPA 4IJWA 4B7CA 1HETA 4FBGA 4H7PA 4DA9A 2NVUB 1J0XO 1DSSG 3AOGA 1E92A 2VHZA 1ZZEA 1LX6A 2D4AA 3DL2A 4HKTA 1LXCA 1E7MA 1HSOA 3HB4X 1GL3A 1Q0QA 4AJIA 4OGWA 5JE8A 5A06A 5ITWA 5EPOA 2AG5A 2NUAA 4BNUA 4J4BA 4D79A 1MX3A 1IZ9A 3MJTA 2Q50A 2DPGA 2JHGA 1C1XB 1EBUA 3K96A 3LT1A 1XLTA 4KTVE 3HDYA 5DCUA 4BV9A 2HJRA 2EP5A 3DOJA 3VH3A 4YAKA 2YQ4A 2VUSA 4BKUA 2IEDA 2FY8A 2ZB8A 3WR5A 2CY0A 3D3EA 4DPMA 1IOLA 2BF7A 4PVDA 2PZLA 1I3MA 4S1VA 5JO0A 3R1IA 2O3TA 4Z0PA 3OJEA 3K5PA 4HV4A 3JQFA 3I1JA 2O4CA 1NYTA 3RJ9A 2ET6A 2GNAA 2HK7A 3FBTA 1NQTA 1UP4A 2GN4A 4ND5A 4ND4A 4AJ1A 4MVJH 2HLPA 4IMRA 1EMDA 3ONDA 5B4VA 4BNNA 5L51A 3MJCA 4TZKA 1LQUA 4ZVVA 3O9ZA 3DONA 5GZ1A 1N1EA 5A04A 2NQTA 3OEYA 4BMVA 3TDKA 2PGJA 1NPYA 2Q1TA 3KETA 3I9MA 4QT0A 1ZW1A 4KMSA 2WYVA 2EKQA 1EQUA 3ZNQA 5JDIA 2PA3A 3PJFA 4RZIA 1UXIA 4AJNA 3WDSA 4QO8A 4YYZA 1XU7A 4Q3DA 4PG5A 3R3SA 2Q99A 4K9DA 5KTKA 5LDHA 4Y98A 3VPXA 3WGOA 3RWBA 2FHSA 3QW2A 4B8WA 5JAQA 4W6ZA 1UXHA 2I9PA 4L4XA 4YT4A 2HMSA 1IULA 3W4IA 1UJMA 1H0KA 1KC1A 4J0FA 2ZCUA 2VRCA 1OFGA 3DMTC 2BELA 1H2BA 1HTBA 3BMOA 4GBJA 4AJ2A 1D7OA 1VPDA 1PZHA 3PQEA 4NFHA 4XIJA 3U62A 3PJDA 5DBIA 2E37A 1GR0A 4WUVA 4UUOA 3B1KA 2PY6A 2YDXA 1MC5A 1QXSA 1XYGA 3Q1LA 4MVJD 2WE8A 4MVJE 1KVTA 4KUEA 2JFFA 3QY9A 2RAFA 2OOSA 4I9UA 1GYRA 4E5PA 4OHUA 3AFNA 3AI1A 5DP1A 4OXNA 1R4NA 4PGFA 1Q0HA 4L0QA 2IXAA 4BNIA 2P5UA 1GFSA 3JQ6A 4PLPA 3I9KA 1FDVA 1GUYA 1DRWA 4CUZA 1RKXA 1JVBA 2B35A 2PZMA 2JHFA 2Y05A 3KOUA 4RQTA 1E6EA 2NWQA 5I9LA 4YT5A 1TB4A 2B0JA 4Z3KA 1NXQA 2BKAA 1YH3A 1C1DB 1S7CA 2AXQA 3IL2A 3GHHA 4IDGA 2Y0EA 1P31A 1GDHA 3UOGA 3DBRA 5JBIA 3I52A 4IJUA 4LMRA 3LSYA 1M6HA 2DC1A 1SZJG 1BRMA 2ZB7A 4P4NA 5CDGA 2OMEA 4R1SA 1DRVA 3HQ4O 4WLFA 2O50A 3CXRA 4NIMA 2DT5A 4CMAA 3RC2A 4DGSA 4DYDA 4H3VA 1SNYA 4N5MA 4QX6A 2WYWA 4IQ8A 5HA5A 3UHAA 2OGUA 1EVYA 2WD8A 3MZ0A 4RLHA 2F1KA 4BO8A 5JAMA 1B2LA 3H7AA 4J2OA 1N9GA 1U28A 3BHMA 1K89A 1GPJA 2ZYDA 4OMUA 2RH8A 2O3JA 1P1RA 1PEDA 3AY6A 2C5EA 3CUKA 1MA0A 1P44A 2XOXA 3B1FA 3DZIA 4OYRA 3N74A 4PCVA 3RFVA 4RF3A 2WYUA 4DQXA 3DBLB 3ZHYA 1A5ZA 3KYCB 4E30A 3R6DA 2AEFA 3BTSA 2Q1SA 1L7DA 2G82A 2X0JA 1R6DA 3DHYA 2CVZA 3BTUA 4J43A 4AVYA 4EGFA 1G6KA 4K6CA 4Z6KA 2IZ1A 3OJ0A 3GG9A 1AGNA 1AE1A 3QHAA 3PYXA 4TRRA 3WB9A 4ZN6A 1PGJA 4IQGA 4ZHSA 1I3LA 3T7CA 2YDYA 2GR9A 4PG8A 3HHPA 2EP7A 3M1LA 4QFCA 5JO9A 3NV9A 1UZMA 2QRLA 4J7UA 3VAZA 3I9NA 4BNJA 5G2OA 3HZZA 1ZNQO 2O7QA 1I8TA 4TWRA 1I01A 3ZWOA 4IJVA 5AYVA 2GN9A 2Y93A 3SLKA 2J3JA 4R51A 1HE2A 4E4YA 3L6EA 4B4UA 3F9IA 1ORRA 1H9AA 3GUCA 4B3HA 1XQ1A 1ADBA 3EZLA 4ITUA 3ROPA 2IODA 3OETA 3VH1A 4BNLA 4XD2A 3W4KA 1C0IA 3GLQA 2HMTA 3CKYA 4MP3A 3FCOA 4XGNA 3VHRA 2Y1GA 2GPTA 2VT2A 2AG8A 4M87A 2RHRA 4GMFA 3FNHA 3TPCA 2NTNA 1GCUA 3WYCA 2NU6A 1WZEA 1Z82A 2OBYA 4LVCA 1VLLA 3V8BA 4NU6A 3PDUA 3L07A 1S6YA 4KP7A 2P9EA 4GKBA 3KYBA 4WECA 5CDUA 3CZMA 4IJKA 1GV1A 4LCJA 3CZRA 3H9QA 4LSMA 4OL9A 3H9GA 2Y66A
chains in the Genus database with same CATH superfamily
4RK0A 3KXLA 4XYLA 2BKXA 5JQGB 4PHHA 1B26A 4YMTA 5LOVF 1TVKA 1R5NA 3E18A 5FUYA 3QFRA 4O8CA 3WLTA 3KV3O 4FNGA 5C3UA 3SZMA 1C7IA 1YZTA 3H9UA 3U7QB 4B2LA 5EMHA 4EHNA 4INOA 1TU3A 3GEPA 3AEZA 4PAQA 2INGX 5F35A 3WYBA 1Q22A 1V5GA 3E0QA 3QKTA 3NEPX 2VLIA 1OI4A 2ZAOA 4I9FA 2OXTA 3ICVA 4EVIA 1TVMA 2XMSA 4TTAA 1M76A 3HVKA 2KW5A 1C0PA 2ZIFA 1RSZA 2C7BA 4JNCA 5J4YA 3WHLA 2NSLA 2FEWB 1DWOA 3K53A 4V0LA 4AS1A 1FTSA 1L8AA 1IXZA 1E9FA 4UNIA 4Y8VA 3UHFA 3H4VA 3ACCA 3CO0S 4FS3A 2XCQA 4UPDA 1FFXA 2VHUA 1LTQA 2ZJ8A 1ZD9A 3MBOA 4DWOA 3RGWS 1W5FA 3V32A 4P54A 2XTJA 3G5LA 1O94D 3H7IA 1M8PA 3D64A 2V3VA 5P8WA 4K88A 3GRVA 2HBYA 2DH6A 2VBGA 4R1PA 2VCYA 5G4KA 4HQOA 1YI0A 2O05A 4MI3A 3P2YA 5BY2A 5FBWB 4ZT5A 2R5WA 3OU2A 2DYKA 2VDNB 3ZNPA 2DXIA 4IDAA 5CPBA 4KR7A 4DPLA 3C3JA 4DANA 1O8CA 2Q8QA 3TZCA 2UZ0A 3E22A 3IS3A 3MCWA 4KH1A 3ROMA 3QGMA 3B52X 4FEGA 3LXXA 3T7DA 3U9LA 4F56A 1WJGA 5B58T 1KYXA 2NM0A 2P6OA 2PZJA 3K2BA 1ZEJA 3IP1A 4II2A 2QEQA 2JG3A 5JS1A 3IXQA 1Z2PX 3DGFC 2NXWA 4CV2A 5IPFA 1QOZA 1TT7A 2VHTA 1A4UA 4OAOA 3RTEA 4EHBA 2G7ZA 4KQJA 1KFCB 5LYYA 1PZXA 2XQJA 1GEEA 3EDQA 4KQFA 4ZQFA 1AV6A 4KO4S 5EHNA 1T5SA 3GW8A 4KIWA 3RHZA 3KSUA 2AG6A 4BO2A 3WLEA 1J00A 2D8MA 1S2MA 3SF8B 4A2CA 2PQMA 3A31A 4ID3A 3VU3A 3M5PA 4JIMA 2WIJA 1R8SA 2FZEA 4MR8A 4Q6BA 5F9FA 2V6FA 4S1NA 1SHJA 1GZ6A 1Z4OA 1Y48E 1TO1E 1AIPA 3DV0B 1FFWA 3LQ4A 2FR8A 3KKQA 3Q5GA 4GZ5A 4P08A 2DPHA 1W0KD 3U9SA 2QRZA 4ERNA 3G0HA 4DLRA 4JYBA 1G63A 2ZS9A 3BK7A 1UEXC 4NZYA 1SUPA 1A8HA 1D09A 4JELA 1CZKA 4DC1A 2IDZA 4MQFB 4RMJA 3FN4A 1YHNA 2D5BA 2H2DA 3B9QA 4RPKA 5EWMA 5E95A 1JEDA 3F47A 2IHJA 4MRVA 3OUUA 3BL6A 4NYJQ 4ZI7A 5L3QA 2EWMA 1PBNA 1WU8A 4K6HA 1IXSB 1VJ1A 1BSVA 2GHQA 4B5LA 1NQUA 4G09A 2I22A 4MUFA 3W5DA 4V1CB 1ZM7A 3T3NA 5LDGA 4M0CA 1YZGA 3C6KA 5M3BA 3MT9A 3PF9A 3LDHA 5HK9A 2YBEA 1ND6A 4KNYA 4KAJA 2V9PA 2O20A 5JMWA 2CN1A 2GN0A 4IVNA 1X92A 4RFLA 3SGLA 1X19A 3O9MA 4WHMA 1RTTA 3M6VA 5IU6A 5DASA 2UZ1B 3JALB 1AC5A 1USWA 2F48A 3FLEA 3ZY2A 4MPPA 2PRKA 1K68A 1QYXA 4REMA 3PXBA 1QQBA 3SVLA 3HB9A 5I9BA 4EATA 1WOMA 4L07A 4AZVA 2EZ8A 1F17A 2G76A 3EGIA 3OFVA 3IPXA 4XZ3A 5JWRA 2PUTA 3FBWA 3UC9A 5EHZA 2HHCA 1KNQA 3MWKA 1FXWF 4HDAA 3HXMA 4U2KA 1TRHA 4QJBA 3GMTA 3WL4A 5CMLA 2VPPA 1M33A 2XMQA 2D0DA 2R68A 2HBZA 3H99A 3MGCA 2PBLA 1IQ0A 2RHWA 4I1RA 4OUDB 1R37A 1WP9A 3C3XA 3ZE8A 2HQ1A 1R1DA 3GFBA 3WY9A 4CMCA 1QIMA 4ZJUA 5CNKA 2FR0A 3N0WA 4OFBA 4EFNA 1DJMA 1BOFA 4CZ2A 1MXFA 1SXJC 4RL6A 3DQPA 3EG5A 3STTA 4PTZA 2HV8A 2ZXFA 2R47A 3G2JA 4YAEA 3P9IA 5SY4A 3O8CA 3MS7A 3OZEA 3W5HA 5BWBA 1E3IA 1TF2A 4YCDA 3Q11A 3WGKA 3OVMA 3PG5A 3S7ZA 3H84A 1MBZA 5K0JA 1I2ZA 1MF7A 2C03A 2CXSA 2GEJA 2K2QB 5T4EA 5JZOA 4I5DA 3ZWKA 5H4GA 2EX0A 2OO3A 1SO8A 3NGMA 1MQSA 1BG6A 1YUBA 2ENWA 5J63A 1ZR2A 4Q3EA 3PX7A 2JI9A 2F43B 3H1FA 2IW1A 1NI4A 3LECA 2GEFA 3T9BA 2QRVB 2G17A 2I87A 5I8WA 1T5HX 2NOAA 2HA0A 4BKPA 1EX6A 3PGVA 3K9QO 5DM4A 1K2WA 3UFXA 3EAFA 4QNRA 3THSA 1ZUIA 1NT2A 1O5TA 4HWKA 3T3MB 2P1DA 3IP6A 5LUAA 2R86A 4EP1A 2JIZA 3GVHA 5CIQA 3G2LA 4R9UC 1F6BA 1XZQA 1DZ3A 2XCIA 1N5JA 4TLLB 1SXQA 1G38A 1DKRA 2DB3A 2VNSA 4NBSA 3AI7A 3BVPA 3EGXB 3K70D 2NNLD 2JK0A 2GQ0A 3TRFA 2XB4A 3AFHA 1ZSNA 1XCGB 3VPSA 1FDTA 2X2OA 3NNNA 3NHFA 5AR1A 1II0A 5F7XA 4NYJR 3EFOA 4ML3A 4L4RA 3TLGB 2B5VA 3D4OA 1M2WA 3U60B 1Y5NA 1XEFA 4PLVA 5GY7A 5AVJA 2OBBA 4AX4A 2FSSA 3A1FA 1GA6A 3ZWAA 2Q3EA 1USIA 1I4OA 2DPMA 2ODQA 1UZUA 2HJ9A 2QJRA 4PZEA 3BSYA 4GZ3A 3V33A 4BZZA 1JEYB 3BMNB 3PRYA 4YMUA 5BR7A 4ZT4A 3ZGZA 1HOXA 2VNJA 4EUEA 1OLSB 4B3FX 2X5JO 2YS6A 3H4MA 4NRDA 1U0SY 2BHRA 1RJGA 4MDHA 3EPKA 4BZWA 3L7LA 2J33A 1RQ7A 3WNCA 3RSHA 3A06A 3PHLA 1VYUA 4CEJA 1HTWA 4EL0A 1JP7A 3VC7A 5A1TA 2JIMA 3LTEA 3TMYA 4D4GA 3FRIA 4RLSA 3GT0A 1VGQA 1X77A 2ZRBA 1KSHA 3O3CA 4GR5A 2VH5R 4NECA 3W8FA 3GQBB 4F86A 3NOQA 2IBSA 2J5QA 4EBFA 1ZJWA 2OYSA 3E15A 4A0QA 2LDBA 3A14A 1UKAA 5I9IA 1JKJB 4G86A 2WUEA 3KC2A 1P8AA 4OD0A 2HRDA 3PUZA 2VQSA 4IRMA 1VJCA 3UC5A 3AB7A 4EHDA 3NYRA 4XOIA 1T8UA 3C3WA 1E2FA 3S2SA 1P77A 2QUAA 3JWHA 3L1UA 4S2UA 2B7BA 4AT1A 3INGA 5F5LA 2GPBA 3UAGA 3V2UA 3HKEB 5LBUA 1QWSA 1J8VA 1NYLA 2C3YA 3QY0A 1KQGA 3GLFA 1CV2A 5F21A 1W25A 3ILVA 4UZSA 1ZONA 3D0QA 4BKRA 2Z1DA 1GRRA 4XIGS 4YDHB 3QW4B 3W5SA 1GRCA 2VZLA 1R27A 1M6YA 1W0JD 1S3FA 4DEXA 1EUQA 5J4VA 3G17A 2E87A 3FWKA 3MWDB 5C1IA 1SHLA 4YMSA 2PKQO 2PZFA 1JDZA 5BV7A 4DNPA 3P9QA 2QRUA 1ZMXA 5DCYA 4EX7A 2HXSA 2NZ8A 4O4HB 3JTEA 1Y7IA 2ERXA 3G0BA 1NU8A 4HFRA 3AL2A 3WSVA 2X6RA 5COAA 3R5SA 4FDAA 4N0QA 3RC7A 5A4DA 2QB5A 3FLMA 3ULKA 1W85A 3TSZA 2P8JA 4WLUA 1GYPA 2HFKA 2NU7A 3MTIA 5IHPA 3K31A 1DXQA 2EVWX 4DRXA 3KU4A 4E2ZA 5DM70 2I55A 1UL1X 4D5EA 3DFFA 3ILSA 4BWFB 4UBOA 2P0EA 1QV9A 3ZNNA 1Z2CA 2ST1A 2QZ9A 3AR9A 3PC7A 2ZB3A 2VVTA 4BKQA 3GRRA 2Z8ZA 3SC6A 4AJJA 3HHEA 1R12A 2K5UA 3O8BA 1AA6A 2CHUA 1K7SN 4ZRMA 3W2HA 2HW8A 3LCCA 5D5HA 1N1DA 1GG9A 3EISA 4JL6A 4C4RA 3Q0EA 4BO1A 5LZ7A 2VDOB 3DKVA 4QPCA 4ZYWA 3NI2A 1NWHA 4FLEA 1CY2A 1B8NA 1JGTA 3EOZA 3KCNA 4MRMB 4P32A 1SU4A 3K4QA 4O2BB 4S2EA 7REQB 1DV2A 1O87A 2J8ZA 1YR7A 3C4VA 5DP2A 5DWVA 3A0RB 2ZQYA 3PHCA 4HGQA 2QQ0A 3DBHA 1R66A 4PGGA 2CSUA 3PC6A 2Q2WA 1UJ4A 3FR7A 4U2BA 1QH0A 4QJIA 1K27A 1E1MA 2XKJE 3H19A 4XIFA 2VZ8A 1Y1TA 2CJWB 2IHUA 3H3XA 4DS3A 1PGNA 1RKVA 2QP4A 4WOBA 1SVNA 4R0NA 1MX1A 5K05A 5IYZF 1AK2A 1AH2A 1SIOA 4JC5A 4RK1A 1BH2A 2LKDA 2XBLA 2PV0A 2WFZA 3QNWA 1KI6A 3RS5A 2QT0A 3SP1A 1XZGA 5INTA 3VR6D 4I1YA 5TPWA 1SCUB 2FWBA 2ZUEA 2G5TA 1CFZA 5CDTA 2G0NA 4C1BA 1RHKA 2B98A 3KQWA 4HQLA 1OZHA 2BBSA 1KS2A 1U4OA 1VKNA 3JVVA 1F06A 4IGIA 5FQOA 3UHPA 3IPLA 3V2HA 2PO5A 4HR7A 3EWIA 1G3MA 3H4TA 2ORVA 2XD9A 5EE1A 3N53A 4AZ3B 1VHWA 3VKUA 3TEJA 1AQIA 1Y8QA 3SYKA 4MULA 4AU1A 1NLFA 3U4QB 3DXZA 1SXPA 2F8LA 4IHJA 5E6SA 4MRAA 1LTKA 1ZOIA 4EY6A 1YGPA 2O52A 3O8LA 5AOCA 4DG8A 1TFRA 5ITVA 4XA8A 1QMGA 2PM8A 5D5QA 3MD0A 5FBHA 2N1BA 5AUOB 1Q7GA 2IX9A 3BMCA 5BSMA 1P19A 2TMKA 1AZLA 3R6GA 3SY8A 3LQ1A 5C8DA 1KGDA 2FPUA 3CVXA 3L8FA 2Y1LA 3BK1A 4YX9A 5CFZA 5TQVA 4CM4B 2W48A 4DLYA 5G41A 3FDFA 3MEQA 2ZOSA 5E8JA 4OU4A 3WWYA 1V37A 1ISIA 2HRCA 3GL9A 3H11B 3HYSA 1WTCA 3OIUA 4X44A 5ES3A 4F6RA 5DBGA 5LNK6 1OIWA 5EQDA 4DWVA 3QSGA 3CNNA 3PX2A 1KR5A 3FMFA 4MINA 2VOJA 4N0DA 6Q21A 4FWTA 4YB8A 1T91A 3IQHX 1V43A 3SMQA 2OVFA 3HB1A 3W2GA 4QDJA 5FLYA 1VB3A 4KLNA 4NK5A 4MX8A 1E4VA 1X87A 4CM5A 1DKMA 1P2FA 1ZAKA 2HRQA 4L9AA 5JNVA 1GPAA 3SC2B 3VDMA 1QV7A 2WHYA 4EYGA 2FMTA 4MV3A 4MGKR 3H5IA 3OI7A 5A3RA 2FF5A 3FYUC 1U9JA 4X54A 1RRCA 1OC4A 1WDTA 4L5IA 2BVNA 5IKEA 4JBWA 1N6OA 1LPNA 1XQ6A 3PQ6A 2IH4A 2W0MA 1F4VA 3K0HA 1VL6A 1TRKA 1SUIA 4NC9A 4QGSA 4D9CA 3N2LA 2E5WA 5JD4A 2KMLA 2WWHA 3B3AA 1L7OA 3ZUGA 2WD7A 2D4HA 4BQQA 4YRIA 2GMWA 4US2R 1GG5A 2QBYA 2MCFA 1MPTA 1YRAA 1EJBA 4JLKA 3D0RA 4BJ5A 5GZ3A 4PWYA 3FUVA 4QTXA 1ZH0A 3ZJTA 2JDID 1N8NA 3REQB 2J0UB 2WMOB 2C2KA 4BNXA 3TG2A 1R6VA 3C14C 4YI5A 4KO1S 2AE2A 1KO8A 2BFDA 1NMZA 3MWEA 3TUIC 3AY0A 2YW9A 3FNBA 1FTQA 3HEAA 2VWHA 2Y1FA 3BG5A 3R3WA 5F3DA 3BJMA 3S40A 4BGVA 3BSWA 4F84A 3TR5A 1V8BA 3I4LA 2AMLA 4K2AA 2AN9A 3FB4A 3K6SB 3ELBA 3GEHA 3BWVA 3S1AB 1L8OA 3JD2A 2YJZA 3IUMA 3NP7A 3P8ZA 2IOYA 3D0OA 3IUSA 2JH9A 3LA8A 3S28A 3GEBA 2PJDA 3IOYA 1KI2A 3ZU3A 1YD7A 3C24A 5E2IA 2IJGX 3KD2A 4B83A 3EIEA 4KX3A 5H70A 2GHTA 1UPFA 4JSTA 1JIVA 1XTJA 3HA7A 4LJYA 4GX5A 1XQWA 2RAUA 3RVQA 1QLHA 3K0SA 3SM3A 3M7IA 2XKAA 2JIOA 2IKSA 1WMSA 3CIOA 1GRNA 2YX1A 3KWFA 2VKTA 5LPNA 3R0QA 1NBME 1BEZA 4ZGGA 2HHAA 2O19A 2CL5A 3Q9SA 4AJLA 4LISA 4JZYA 5C8VA 2QTNA 1C3OA 2Z56A 3KD3A 5LA6F 1FW6A 2QTZA 1E3WB 1CP3A 2ZQZA 4C3ZA 1GNLA 2LKCA 2GN8A 1E6MA 4NARA 1FMJA 3WNBA 4D4HA 1M10A 4K9LA 4OQDA 2I4RA 2GN2A 1JS1X 1ULZA 1IN7A 3GHYA 3T4XA 4MUGA 5J2TF 2RI0A 2DHRA 3ZDEA 2X7JA 3OOSA 2PIDA 1H8HD 1SRQA 4E14A 1DTWB 4RZUA 1GL7A 1LK5A 1NP3A 3Q85A 3ZWYA 2XUPA 3A04A 4X1YB 1XU9A 3AVVA 2II6A 1CW2B 1NUHA 1Y1SA 3FFXA 4J9UE 4RHEA 1Y4UA 4JEIA 1HZZA 4L0DA 4X24A 5ELMA 1W9HA 3E7XA 1U7TA 1P5ZB 5E0KB 2A35A 5BNIA 3AKDA 4G26A 3LUFA 2J3HA 3G5AA 5EKSA 1FP4B 1EUDB 3JRXA 4RD1A 4BC1A 2A2ZA 1MRNA 1PS8A 1YJCA 3JQBA 3KQMA 1ZGCA 3NBMA 3B13B 5JECA 4HQ6A 2QZZA 1JVSA 1PFGA 1PTJA 5EP4A 1E7SA 2YWGA 4IZIA 5C4IA 2NUPA 3IQDB 5K2MA 3STWA 4DUGA 1M6WA 1WSBA 2XTAA 3B2NA 3DZFA 2EJTA 2FF7A 3GRKA 2IHZA 4H6WA 4WFJA 1Q15A 4L4ZA 5WRFA 4HBGA 2HSDA 1YMQA 4RJLA 4B6OA 1ZJ6A 4Y9RA 5CB4A 5A0VA 5H9WA 2J4CA 4QE3A 5KYUB 2UAGA 3SJ7A 2DETA 1SURA 4K9KA 4HLUA 2PS3A 3VU9B 3UZUA 1TD9A 2WOOA 3A7EA 2QVLA 3NFYA 2XOKA 2I6GA 3HYCA 1LQTA 2O8VA 4ND2A 2PKCA 1QYRA 4ZRDA 3WLJA 1ONPA 1RAAA 2ZSIA 1EZ1A 3D6HA 1BHJA 4HLNA 5EXTA 4CM7A 5HBGA 3JARB 3ESRA 2DCUA 2EEZA 2ZAIA 2EX4A 4OHPA 1XNJA 3V4FA 3Q1KA 3FCEA 1C3XA 4QTTB 3MUOA 1UANA 4WOPA 2HM7A 5TQ0B 4DLAA 1U2GA 2C84A 2P2NA 2R751 3TE7A 5HIJA 1OWLA 1TJ4A 1ZLYA 4WCFA 4WKPA 5CH5A 3U56A 3GFFA 5A03A 4HMOA 1V8ZA 4NR0A 3WOVA 2H4WA 3RK0A 4EI9A 1HSZA 4ZVPA 1BEEA 3QQPA 1S9HA 2X23A 3QBVA 2IPXA 4C0QC 2ZULA 2C7PA 1RHRA 2VHCA 4MS4B 2AWNA 4N9QA 4UJ3A 3ZE6A 1VKZA 2ZJ3A 3E7DA 3QF7A 5C2JB 2BGNA 3EOBI 5ESWA 1EGVB 2HL6A 2OO5A 3HVUA 3A4VA 1F9AA 2VYNA 5DTEA 4YCMA 4Q1BA 1DIHA 1SXGA 3X2FA 1O95C 4YRZA 1ADGA 4Z51A 1VI2A 5C7OO 4RTMA 3OZWA 4JB2A 1CY0A 2I6SA 4OEHA 4RPJA 1QDUA 1TM1E 4ENQA 2Q8PA 3W5BA 1V25A 1PJSA 2B8EA 4B6PA 2GPYA 4EZEA 1PX0A 1YQXA 4RD4A 5DTQA 3GN2A 3WTCA 4KIFA 1E58A 1T9HA 3KSDO 1J8FA 3E8XA 4ZFNA 2JFHA 3ABSB 3H1PA 5K0SA 5K0NA 3FGOA 1X14A 1FFDA 2WKWA 2G9NA 2QN1A 1ODCA 4PIVA 3X1MA 2D62A 1XTQA 4V0QA 3ZZUA 5IVHA 4U9IS 2V7WA 1XN4A 3C6BA 3V1UA 1N2XA 1IONA 4B81A 8OHMA 1WQ3A 3QENA 2O8EB 4MW0A 4Q9NA 5ALSA 4HB0A 1UBEA 2CMDA 1JXAA 5CD1A 4K5QA 5JCOC 4YDSA 1IHYA 2IZ7A 2R6FA 4I36A 1NMSA 2JJ2D 4LTNA 3HRKA 5K3BA 3TVDA 1SVWA 5T5QA 3UXHA 4H16A 1K8XB 4DUPA 5L40A 4FW8A 4BNVA 1XD8A 3C15C 3K2EA 2Z6AA 1M2KA 2C0QA 3G9TA 4G9GA 2P4HX 1YOVB 5C8ZA 2K2WA 2ZXEA 3KTDA 5CW2A 2CL7X 4I1IA 2L2QA 4IMJB 3NHSA 1EP3B 2GA9A 3I9JA 4W7HA 2UYQA 2ZTLA 1DI0A 4YXWD 4HS4A 1YZ3A 1XZCA 3WYGA 3ZWBA 3H4IA 3N6XA 2C5FA 1G7SA 4EAAA 4F4IA 1VL0A 2IEZA 2ZSKA 4IH1A 1O95D 2P4UA 3WADA 3X44A 3W2TA 2C58A 1YCGA 3C3MA 2QTHA 4ZVSA 1QLWA 3N2KB 4YMVA 2HCRA 3WYDA 5BMVA 4L0MA 3ZU6A 4RA9A 3FFTA 4RTJA 4HEQA 4MKZA 2ZR0A 4MCJA 5DHQA 3V2IA 5JD6A 3LUKA 4DIKA 1MEEA 2QVBA 4IVQA 4DKJA 2VDVE 1WPRA 5CT5A 1KPIA 4AF6A 4AK9A 1QSGA 1RLUA 2C54A 5FBKA 3CCFA 3I1FA 1D03A 1LBQA 1XRJA 4G1VA 1SFRA 4GWKA 4ER7A 4OI0A 3MG9A 3MRVA 1BW9A 1GKLA 4C4ZA 3ET4A 4AN0A 5TQJA 3HH8A 1JAYA 3IAEA 2YMMA 3HBJA 4QXMA 4TLEA 4R1LA 1KEZA 4G23A 1J70A 4F6CA 2IS2A 2YVLA 5LMZA 1A72A 3R6TA 2VJCA 2EJCA 1NFQA 1OBOA 3B6KA 4H0FA 1P7WA 3OCZA 4LUCA 2WG1A 3G9ZA 4E21A 2G6BA 3MVEA 5LU9A 4UHDA 4ZDWA 1ECBA 1HQYE 3S27A 1IG0A 1EFPB 3ZV6A 4EBBA 1QZTA 1J49A 3IAM1 1YONA 1AQNA 1EX9A 3FWZA 2Y4OA 3EXIA 3P5BA 4FEYA 2YJNA 1IHUA 4DM7A 4EJMA 3KKPA 4GX2A 2JD1A 4Q4LA 4TUYA 5KB3A 1W9MA 3RJTA 1ETUA 1H2WA 5FOUA 4KR0A 1MJGA 1G19A 1L7PA 2TMGA 3CR3C 3Q10A 4H35A 4RV9A 1T9DA 3SE7A 3I12A 1ZN7A 3PUKA 1FU7A 3HZHA 2H4HA 2PYIA 2CYCA 3F6PA 4A6DA 5B4TA 4AMVA 1QU3A 1TMOA 2AS0A 2D5CA 4XIYA 1XBTA 4DOMA 1FUKA 1LNQA 4GR9A 1Q2UA 2QN9A 3O91A 4V2UA 4DDWA 3LUDA 5I4IA 2OCLA 4D4MA 1E94E 4M9UA 4P84A 1BXGB 1IVNA 2CXOA 1K75A 4CL3A 5EIXA 1INLA 1C8LA 1O0SA 2R25B 1L1EA 2X2PA 3IAS1 5AXDA 5KNDD 2GCNA 4TN1A 4WXMA 3E8SA 1DIOB 2VUIB 3QYAA 2QD4A 3V7NA 3K70B 1FZTA 1E2JA 4OOFA 1ZC4A 1KRWA 4IUCS 2CLSA 4ZQGA 1CUHA 5CT8A 2ONKA 2XE7A 2XRFA 3F6CA 3C3PA 2ZT5A 1VL8A 1EFRD 4PSVA 3LT5A 2QPOA 4WE3A 1JWLA 5JPDA 3DTVA 3PIIA 2V7BA 1A77A 4G4GA 2E85A 2PLRA 3VPAA 4YJ3B 4LF9B 2DTDA 1J97A 1ZN9A 5KYNA 5CLFA 2AFHB 4XFDA 2HEIA 2I33A 1WULS 1VZ2A 2G67A 5A3JA 3MMZA 2Z0MA 3TZHA 4G0UA 1BDBA 1LFAA 1PIWA 3O3MB 3ZY5A 4EA6A 2A0UA 2FUNB 3MGGA 4H4DA 2QUBA 3H6KA 3CKLA 2E6KA 1N0HA 1DB3A 1QP8A 5K45A 1G7CA 2AOUB 2WIBA 4GNKA 1RW4A 1ENZA 2GEBA 4ZANA 3GX1A 3X1ZA 4MYRA 4F5WA 1G5TA 3EASA 1CJTC 2PXXA 1L3BA 3EIOA 1VC2A 3K4PA 3O03A 3R0JA 5C7IO 2IYLD 1VPLA 1ZK1A 4DJFC 2OZLA 3FCXA 4HX2A 2HCFA 4AG5A 1SKQA 2PS0A 1ND5A 4UNQA 3EFEA 3ZIAD 3HJTA 3QUBA 2X5XA 5AUNB 2Y8EA 1X0XA 3AKYA 4N39A 2B6HA 1AZWA 1TLTA 1IZYA 1U9IA 1WNFA 2DR0A 2WZCA 2Z5VA 2YC4C 2VJMB 5DM2A 4QECA 2Q62A 5IF3A 2E89A 4S05A 2VPQA 2OAGA 2I3DA 4RE5A 5CEJA 4ZYYA 3HCCA 1EH5A 5JS7A 3PI7A 1NRWA 1XZMA 2WBLC 1LSUA 1SM4A 3PF8A 3WMXA 5CVEA 3NAZA 4LKOA 1ZMTA 5A0FA 1LRJA 2XE4A 4FBMA 1N2BA 3HR7A 1P91A 2I67A 2J6HA 3THXB 2JLSA 5DTRA 1DZIA 4GP7A 1K3FA 5CXSA 3KJNA 5CJPA 3OFJA 3ORHA 4REQA 4Q82A 3C5HA 4BBJA 2OE2A 5HJ5A 3OQMA 3KEOA 1EQAA 3AUJB 4XWTA 3UJHA 4EF5A 4YREA 3K0CA 5DLEA 4ZV9A 2J87A 4GMHA 1WXHA 4DQ0A 3UY4A 2C00A 4Y0AA 1RQGA 1F8GA 2JK1A 1EXNA 2HH9A 3QMWA 1ML3A 1I3KA 1B3RA 1KK2A 1TXGA 5CDSA 5AQEA 3Q41A 3WWEA 3JWPA 1Y1RA 4LY0A 3SE0A 2QL6A 2AN5A 1Z07A 3GIWA 3SBDA 4IHQA 1U2DC 2GM5A 3NC4A 1Z5NA 3PUVA 4TQ9A 4Y1EA 2FYTA 3DOIA 4OP3A 5HHTA 2XUIA 4TWZA 3ADDA 2PX5A 4LHZA 2Q9UA 1AXGA 2P3QA 4DTIA 2WWWA 3AF6A 1GHTA 3SQWA 1DKNA 1ULBA 2BBTA 1EFVA 1DUSA 3Q7RA 3WLLA 9LDBA 3NBFA 4AY4A 4XYMA 3O38A 2FPSA 1F2VA 2ZI3A 1RI4A 1VE6A 1OKKA 1P2VA 1NF2A 2KHZA 1G2QA 4IIGA 5MGBA 5CG1A 4FGSA 3IXMA 4IDPA 5GWXA 2UVQA 2C5GA 1AK1A 1CLEA 1P9WA 2FSUA 5LWQA 3W2IA 5BQFA 1HQKA 4FHCA 4LRWA 2V7EA 4FINA 2CDCA 4BPBA 2UUPA 5ALLA 5THKA 4ATNA 3NTOA 1U8ZA 1G5FA 3DUFB 2VSOA 3DDOA 5IK2A 4BX3A 2YQ5A 2WDPA 1Z7EA 3E22B 1J9ZA 4L2IA 2FR1A 2H59A 4ZV7A 1PS9A 4LHSA 3LNCA 1KL7A 4P93A 1GLVA 2MYPA 4JCCA 1A4RA 4A1OA 4KGZA 3JPWA 4CKYA 7YASA 5A05A 5KINB 2JCYA 3R9XB 3LFHA 1T8PA 1NDUA 1BN7A 2DQZA 4FE4A 2HN9A 4JJKA 5AXCA 4CCWA 3U7GA 5K03A 2NMVA 4E12A 1RYHA 4LXYA 5B3JC 9LDTA 5A4JA 2B34A 2BHLA 2FPOA 3AYXB 1UXJA 2W83A 4C6SA 3AUSA 1W5BA 2PLWA 2X9VA 4YV7A 4JROA 3CEPB 1N6LA 2VFAA 2VHWA 4N7RA 5CLHA 1U0LA 3GBSA 4JQOA 3IUBA 3JD3A 5D5PA 4ITVA 4D2IA 1E5XA 2NV2B 4ZD6A 1TTQB 1X8JA 3NBZC 3Q7EA 5C8YA 3U1VA 1AKYA 4TL6A 2UVDA 5CFMA 1RWVA 2J4DA 1EWYA 1XFDA 2Y0BA 2AB0A 1U11A 4WY2A 4JI5B 1HDYA 5FIUA 1EVEA 1OPXA 1PJAA 1EE2A 2H06A 1L9KA 1R0LA 3MGKA 1YACA 2V0CA 2VWGA 5HMMA 1Q0PA 4JP8A 4BVHA 4GM4A 4YHHB 3WLRA 2R4UA 4W7SA 3AILA 1ADCA 3AWDA 3CW9A 3K20A 4KFSA 4ONEA 2IWHA 2N9UA 1IBKB 2X42A 4YRGA 5DGDA 3GEIA 4OGKA 3VOAA 4GKJB 1FUEA 3VBCA 5IXJA 4CG2A 5CFPA 1Z39A 4Q4CA 5JSZA 5L3QB 1TAUA 1HDRA 3LLSA 3HBAA 3QKRB 4FGUA 4R8MA 3A2KA 3ZQ4A 3GGPA 5EE9A 1VFPA 3M6MD 1RJ9A 2H48A 2R2GA 3UW3A 2G5PA 3A9RA 4O59O 5EERA 5IDXA 1RYYA 3ESXA 3IVXA 5CH3A 2DGDA 1CUUA 2JNWA 2BIFA 2N3ZA 3ZBTA 1WXDA 4ZGBA 4I5FA 2ZTVA 3UJ6A 4PSCA 1X15A 4QXOA 1NONA 4RSMA 4RIEA 3KU1A 3BHJA 5C81A 1Q6ZA 3KQSA 4LW8A 1YDGA 4KYIB 2H2HA 2A84A 3GJ3A 1JG1A 3VVBA 1LBHA 2GAFA 1N77A 5EZYB 2YZMA 2O48X 2A9JA 4K9SA 3WBKA 4BV2A 4LHWA 3KOWA 4W1SA 4AZ0A 2J46A 1L2TA 3FPJA 4FD3A 4RQUA 2JFNA 1K6IA 4R3NA 1CBUA 2FV8A 2FN4A 2SNIE 5ALDA 3BD7A 4X1OA 5I47A 3FTNA 2HJVA 1U1CA 1J90A 5JSUA 2OZVA 4IXWA 5DW3A 1FP6A 3N6VA 4QXRA 3HVJA 3MYYA 2NQ2C 4KQ6A 2OV4A 3F7MA 1E9DA 4ENTA 3AF2A 2GESA 4L08A 1JJVA 1ECPA 1TPZA 3CVVA 4IDEA 1PK8A 2EGGA 4FGJA 5F77A 5FAXA 1KWGA 5CD9A 3MUNA 1JFLA 1QMPA 2CBXA 2QPAA 3DCYA 3ESCA 4Q4DA 4AO6A 1NV9A 4KWHA 1U0RA 4Z0NA 1Q1EA 3H0CA 3K7EA 4GP6A 1QNFA 4JYAB 1A95A 5ALXA 1K66A 3C5VA 4CDGA 4CTKA 1ZJZA 2XB2A 5NULA 3QFHA 4JT2A 1O4VA 4H7FA 2OZEA 4G84A 3VU1A 1TYBE 4RTKA 5EXSA 2Q07A 3ANNA 4EKEA 1HA3A 3OZGA 5TE9A 3JQAD 3M9WA 5IJ9A 1ZLXA 2OORC 1E0AA 1ZVKA 1JT9A 2V0NA 2F6RA 3G2MA 3LCMA 4TV9A 4F2WA 2I4MA 2XUQA 3B6JA 2H4XA 3FOWA 3NBQA 4RW0A 4CHTA 2EFGA 1S3SA 1FMFA 2ZBPA 4PX3A 1EK2A 2WDZA 5DX1A 4U5XA 1NI4B 1JQLB 3OLVA 4URWR 1H0RA 1KFJB 5G3ZA 2WHPA 2WU1A 5IBPA 5ADWA 4YR9A 4LJSA 2FUKA 2C42A 3G9UA 2PMEA 3RK4A 3WAJA 2YOGA 3PEWA 3SI7A 5A9RA 4KW7A 1Q1AA 4KYTA 3VZCA 4MR7A 4FONA 1Y42X 2PFKA 1Z62A 1OFTA 3ISVA 3KJXA 4FOLA 1DUVG 2VL7A 3RIEA 2VA8A 4U4AA 2ZUSA 2HU7A 4HPWA 1W8IA 3BC1A 2A4KA 3M6AA 5K8TA 1VIAA 3RSCA 4FFWA 1BQEA 3V55A 1HRKA 1SCNE 4B4WA 3OE7A 2Y4NA 3FYUB 3N2GA 5HOQA 4ESVA 4UUNA 2ZQ5A 3ANMA 2X5NA 4JQZA 5ARBA 4Z53A 5HNKA 3VSAA 2EW8A 4GQBA 5JVDF 3U7FB 5BN4A 2P27A 2QLJA 3EUFA 5LQNA 1W59A 3H5RA 4O33A 4BGUA 4MI6A 2RDMA 5EGNA 1E1LA 2IOFA 3OJXA 1WB6A 4PM4A 4E5KA 2FMIA 2Z83A 1KDRA 2OM6A 2J09A 5CT4A 4YJ2B 5EFZA 5I4BA 4TS9A 2CNKA 1WO8A 1U7PA 4PNPA 4LDPA 1A9XA 5AT1A 3WA7A 3LYLA 1JQBA 4BNDA 1HYGA 2VDJA 4N6OA 3EVBA 2JBHA 4IINA 4RJIA 1G55A 2F3UA 3GIDA 4R9RA 5CA1B 2HSGA 4IGFA 4XAQA 1LS6A 1RXVA 4UAVA 3H3JA 2GUWA 1MVLA 1R0XA 1EM6A 5EWJA 2VUTA 4I9GA 2QMOA 1Y6JA 5B1SA 1D5CA 4JR1A 3LO5A 4BLTA 4M38A 1J8QA 2WNSA 3TOZA 4EIWA 2UYYA 3F97A 4MQBA 4Q5IA 2XXAA 5KQRA 3H1EA 2XTNA 4ZEXA 4D99A 4G4SP 1G66A 3RC1A 2ZP1A 2J3QA 2DHEA 1TQ2A 3S5JA 1A97A 3GPCA 2GJ8A 4BVFA 4RGQA 1R9MA 1PT9A 1TM2A 2SKEA 4NXMB 3H5AA 4CCAA 2I65A 2VNAA 4HX9A 4RK4A 1F3OA 1ENOA 3IV7A 4OJKA 5FI5A 3CYFA 3I5AA 3OJCA 1O6ZA 1T1RA 3EDOA 3BGIA 2P4EA 2RGYA 2Z08A 1CZHA 4Y0VA 2A3NA 5JQWA 3QWFA 2A5GA 3O4IA 1YF3A 2OG1A 1HDXA 2VDRB 2YVQA 3GEMA 4RSGA 1POWA 1SIBE 3TLZA 3BSFA 4AC9A 1H2AS 3T9CA 2MINA 3E9CA 5HFJA 3UT6A 1CVRA 1Z7BA 1TUBB 2X14A 4RZ3A 2J9FA 3B6MA 2R6R1 4NBWA 4KQ1A 3VYTB 2VK2A 2GAIA 3P96A 3MGAA 4EGAA 2PUGA 2HA4A 3M4ZA 4EB0A 4IIYA 2YV1A 3O8RA 1IEWA 5DT9A 1PJZA 4Q16A 3GJZA 3O4FA 1ZJJA 4MV6A 4URFA 5BSFA 1WP4A 1KK0A 5AKXA 3ZZ1A 1APBA 4LWZA 2R4QA 2QF7A 3INYA 1UFVA 1NM5C 5E1MA 2NX2A 2NIPA 3PRHA 5FA6A 4DJJA 1FS5A 1W85B 3D8SA 2IYYA 3R76A 4BN4A 5C18A 2WJIA 4MRSA 2P6MA 5FFNA 5KWJA 4JJAA 3COPA 1ZNWA 4OBXA 4RJ2A 2F62A 4QYMA 5K99A 4B48A 4MQMA 1E1QA 5FOWA 1RIFA 1GYQA 2I2XB 1X7ZB 1VE7A 2B83A 2JAUA 2IEIA 1RHMA 2P3OA 4I55B 2C97A 3WGYA 5FUVA 1U7WA 1M8FA 3D5TA 1E0JA 4M22A 1H4QA 1KMNA 2HIAA 2R2AA 2OUIA 5LQRA 5GJBA 1KIAA 1ACLA 3TXAA 5LM3A 3HDJA 1KMIY 4WUTA 4GSKA 3FUUA 1YSCA 4KFCA 1CZUA 1NOJA 3EEBA 1WMAA 4M83A 2WB2A 3VHXA 2KX7A 1LLFA 2PS1A 2PDAA 4JB3A 3RCBA 4YP0A 4C5CA 4D02A 2J0QA 2XMPA 4W8OA 1YJQA 3V80A 3CVUA 2VNHA 1VA4A 3EZXA 4JOBA 1DPFA 3Q3HA 3A1TA 5J4HA 4UXIA 4OX9B 4XB6B 4F7WA 4FZRA 3DS8A 4BFVA 4TXHA 4M1OA 4M9ZA 4L8VA 1XRLA 4B6FA 1NV8A 1YBFA 1PQ4A 2OBLA 1U8YA 1XTZA 4D9EA 1OH8A 1KO1A 2D5LA 3GOQA 3RVPA 1ULSA 2X15A 4PPQA 4DYVA 3M8KA 2LCFA 1WSWA 1XDWA 1Q84A 1PUXA 1QPBA 1J22A 3RFCA 5IMBA 4DVGA 2JI4A 3JD4A 3QLVC 1NUTA 1H1TA 1DCFA 1Y9ZA 3ORQA 4TM8A 5AHOA 2D00A 2GA8A 4AO8A 2PCJA 1JEQA 4JXXA 3TOXA 4PZAA 4YACA 1GU1A 1HURA 5AFSA 1M1YA 1N92A 2PT7A 4QFBA 1UBNA 3KB6A 5B1HA 4EUKA 5AHWA 3ANXA 3VMMA 2DUWA 4HFJA 2B6NA 2RK3A 2RG1A 2B20A 3ZYCA 3D6TB 3E81A 2O0HA 1XC7A 2PE5A 3CX7A 4U7HA 3ZWMA 4KQIA 1TMKA 3TB6A 1AUOA 4X8MA 1AHIA 2JFBA 1UMCA 3FYDA 2VWPA 3GGOA 4MVJI 4G0PA 4WZAE 2CXPA 5JZSA 1MN6A 1JR3D 1UQUA 3OQ6A 4NNJA 4IRXA 3GLHE 4P8RA 4F0JA 1H2ZA 5BWMA 3EVTA 3OBBA 4HPJB 4HX5A 1I6LA 2GAAA 3FYTA 3BMQB 4XM2A 2H5IA 3V3TA 4YCAA 2Z6UA 2FPPB 2ATIA 2EFCB 1BHQ1 3NWBA 1HZJA 3R7AA 4KE6A 2BV3A 2JAHA 4NAUA 4PLWA 1SUCA 4OG2A 2PZ8A 1KI8A 1UKZA 4X6XA 1HYQA 4FYWA 5AI5A 1HNWB 5LSAA 3L06A 1GXSA 4QYIA 4CG3A 3KJIA 5AXAA 1WVGA 3QUSA 4BO4A 4BNGA 3SQLA 1EFUA 2JEOA 1L7AA 4A7PA 3Q3CA 5EJ8A 4GUDA 3CZQA 1CR4A 3WGHA 5CFOA 1EP9A 2J31A 2G4CA 3L0CA 4HCJA 1ZN8A 4CLOB 2Q3LA 1W581 1DEHA 1G3QA 3J81k 4RS3A 4AF7A 3AZOA 5LZ5A 1L5WA 4FS8A 4AULA 2E4WA 4DCOA 4LYAA 1TPYA 4XRRA 2NZUG 1R4MA 3FNGA 3B5JA 3QOYA 4LF7B 1Z6XA 2JHCA 2QK4A 3OQNA 5EJAA 4O02B 2V54A 4K86A 1PGPA 1O77A 1YS1X 3F3SA 3PK0A 4C4TA 5A71A 1VIVA 1AZSC 1NJ1A 2WB4A 2XYRA 3NTVA 4MLPA 4C43A 4YT2A 2H2IA 3P9RA 1L5NA 3DHVA 1IXRC 4C21A 3HCWA 1FQOA 1G8FA 4CR6A 1QH1A 1VJDA 4G5HA 5LCXA 4FZ3A 4LF6B 2P62A 4F93B 1PRYA 3AIKA 3PPIA 2LR0A 4K7JA 2O2CA 4QXAA 3A6PC 2CVOA 2R7AA 4O63O 4B46A 1C9EA 1TQ6A 1T1SA 4DIEA 3PIDA 1IC6A 3AEQA 5FFFA 3UV7A 5MF6A 4DIFA