3PDJA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with 4,4-disubstituted cyclohexylbenzamide inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
272
structure length
272
Chain Sequence
b'QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRFIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Synthesis and Optimization of Novel 4,4-Disubstituted Cyclohexylbenzamide Derivatives as Potent 11beta-HSD1 Inhibitors
pubmed doi rcsb
total genus 101
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pdjA00
3UCFA 7MDHA 2B36A 1M75A 4H15A 4GX1A 4IS3A 3STHA 3C1TA 1T2FA 2X58A 3NKLA 3GNTA 3VDRA 4YAIA 2DFVA 1P1JA 1WP4A 1MGOA 4L73A 4WCDA 2RHRA 2NTVA 1GQYA 3LZ6A 5JDIA 5EESA 2A35A 3S55A 1Y81A 4KWIA 5DT9A 4FJ2A 3H9GA 3WSVA 3E9MA 2OO5A 4CMIA 2VUSA 3EZYA 4H3VA 3SLKA 1ZCJA 3ZWBA 4MP6A 1MFPA 1T2CA 1S7CA 3K6JA 4IMPA 3KLMX 4I9UA 1CQIA 3JQBA 3LSYA 4IIUA 3V1YA 3E82A 3WMWA 1KIFA 5I7EA 1ONPA 2B0JA 2NU7A 4O0LA 3F4LA 5A03A 1ZMOA 3QWAA 2WE8A 1DOHA 4YCAA 4RJTA 4WLVA 1EVJA 5AXAA 4EUHA 2CY0A 5JE8A 4NMHA 4WUVA 3O38A 2CD9A 3JYLA 2Y1DA 4NK4A 1Z73A 2O48X 3H2SA 1I2BA 3SXPA 4XDZA 4GSKA 4D42A 1P33A 3W4KA 2DQ4A 5L7YA 4DRYA 2BGMA 2HAEA 5TRTA 5JW6A 4MVJM 4WOJA 2J3KA 1EQUA 2FSVA 1AXEA 2HDHA 3NDJA 4LRTB 3U3XA 4NHEA 4EBFA 3AUUA 3DB2A 3K8ZA 1DC3A 3GVIA 3Q9UA 2Q1UA 3COSA 4J91A 4E32A 1Y1PA 2FRDA 4BS9A 4K6CA 3JQEA 4NJMB 1CRWG 2QYSA 4O5OA 3QHAA 4CM3A 5BNIA 4J7UA 8LDHA 3GMDA 2HMVA 1WMBA 1JWAB 3TZHA 1HDRA 4J2HA 3ZWYA 3ULKA 1T2AA 3OQ6A 4CQMD 5DCUA 4IDEA 3JQ9C 4CQMA 3CEAA 3LC2O 3UFXA 2Y66A 4GAEA 3HDQA 3L4BA 3GQVA 2P91A 1ISFA 5FFFA 4E2XA 3VHRA 3WJAA 3ZNOA 4NH4A 4Z3KA 4BKQA 4TVOA 4ZQEA 4OSOA 2FSSA 1G0OA 1E7YA 4Z0HO 5L95A 4YVFA 2OORA 3PWKA 2VTDA 1LSSA 3RJ5A 4JBHA 4XX0A 1VLLA 3KETA 4QFDA 1DC4A 3OFSA 4L76A 4XYGA 4JBGA 2FMUA 2R2GA 3ZNPA 3H5AA 2HRBA 4BNXA 3H65A 3OECA 1LLCA 3KYDA 3W4JA 1YQXA 1XQ1A 4RPGA 4D44A 2O3TA 1KVTA 1A9YA 2R6JA 1P0FA 5KWEA 3GUCA 1EE2A 2FN7A 1HRDA 3ZWWA 1V6AA 2OGUA 2BH9A 1O6ZA 1F8FA 1I24A 3C3XA 1AN9A 1YRLA 4NBVA 3VC7A 2HUNA 2O3UA 5IFLA 3D4PA 3ZZNA 3F46A 2C7VA 2X23A 1FF9A 4TSKA 4FCCA 1EVYA 4L9RA 4HADA 4R54A 1P77A 3TZKA 5JDCA 1GQ2A 4BUCA 5HRUA 2CUKA 4YJFA 1T26A 4RQTA 1AXGA 2Y0DA 1NQ5A 3C85A 3B1FA 4OXKA 4QECA 4ZQBA 1QKIA 4BNJA 4Y6SA 4WEQA 4WJZA 1U28A 1YOVB 1UXKA 5G0UA 1KY4A 1VRWA 4DGSA 3W8EA 4OXNA 4RL6A 1U3TA 3AUTA 5F21A 1BSVA 3HUDA 2NQ8A 1BXGA 5A9RA 2VCYA 1ZVMA 2Y0EA 4PFJA 4NNJA 2UUOA 4PZDA 1JVSA 2J5QA 4PLCA 5IF3A 3ZWCA 4CL3A 4G65A 3GK3A 4DMLA 1Y9EA 3PJDA 2HJSA 3AM3A 4QEDA 4CM5A 3ZW8A 1R4NB 3FNGA 1EUCA 3MJCA 2B4QA 3LU1A 3WBBA 2H63A 4ND3A 3V5NA 2EHDA 4P4GA 3DL2A 1BRMA 3DBRB 2CDCA 5TSDA 1ZJYA 4FW8A 4NK5A 1I3NA 5I9LA 3BAZA 1R0LA 1QYDA 1QYWA 1SB9A 4K6FA 4NBRA 1DIAA 2WJPA 3HZZA 3JQ9A 1LDEA 3H4VA 5HM8A 4Z9XA 4M86A 4NDNE 2EJVA 3PQDA 4PG4A 3L6EA 1D7OA 3IAHA 5FEUA 1ONNA 3I9KA 1B15A 5G0TA 4DQVA 2GSDA 1V9LA 3PHHA 2CVZA 4QUKA 2WSBA 3B1JA 3GNSA 2O7SA 4YR9A 1H9BA 4GKBA 3JD4A 1X15A 2HMSA 2ZCUA 4J1SA 1Q0QA 4TRRA 3OBBA 3ZU3A 4M87A 4R51A 1GTMA 4BKRA 3CMMA 1VL0A 3VH2A 3OJFA 2VYNA 4JP2A 3LVFO 3QWHA 4CQLB 4B4WA 1JN0A 1LDGA 3KYBA 1UZLA 3TRIA 1Z74A 4N5LA 4MVJA 3IIEA 3MWDB 4AJJA 4D79A 5JO0A 3WBFA 2X9VA 1EDZA 2WEKA 3PJGA 3I1JA 1V0JA 5BSEA 1QORA 3I6IA 4HBGA 4CMGA 4WLNA 5CEEA 2ZTLA 3RCBA 3D5QA 4M89A 2O3RA 3LT4A 3EZLA 2EEZA 4E5YA 3TF5A 1QRRA 3GEDA 2I6TA 2D8AA 1PJLA 4BKPA 4R4JA 1YBVA 2GDZA 4Y8VA 1QYXA 1PS0A 3KBOA 5AVOA 1C1DB 4XIYA 2BF7A 1X1TA 5IZCA 1VL8A 1E6EA 2PZKA 3PWZA 4JJGA 3SJ7A 5B4VA 1RM5A 2IZ0A 1PX0A 4CV2A 3V2UA 4YAEA 2FR8A 5ILGA 3LK7A 5DULA 1XA0A 3GN1A 4CMJA 3NDIA 4D0RA 2DVMA 2FHSA 2UYYA 2FWMX 4DWVA 1GZ6A 2O3QA 1W8DA 3JQGA 4CUKA 1JA9A 1NQTA 4ALIA 1NHGA 4IIVA 5JYEA 1E1NA 2QHXA 4WEOA 2YHIB 1TI7A 3DBHB 4A7PA 4BNYA 1ZEJA 2FPPA 4UAGA 5THKA 2HMTA 4INAA 3C7CB 3ASUA 1GR0A 2DBVO 2BMAA 4UUPA 4YRBA 2CSUA 3VOSA 2E82A 1F17A 1BHSA 3OIGA 3JQCA 1ADBA 3TN7A 2JD1A 1NWHA 3RROA 5DOZA 3R0IA 2XXBA 4BNZA 4BL5A 1R4MA 4YJGB 1WDMA 3WNVA 3NT2A 2HMUA 4GX2A 4WK6A 4ZRNA 2RAFA 4Y6PA 3MCVA 2EW2A 3MJEA 3D3WB 1AHIA 1P74A 3ZGYA 1HYEA 4JP3A 4F3YA 1GPDG 3QVTA 4TMFA 5A1TA 2FPIA 3RWBA 1BXKA 1GZ4A 4YJFB 3WIEA 3PYXA 1NM5A 4QT0A 3IP1A 4LW8A 2E48A 2X0JA 2IZZA 4URFA 4Z9YA 3KV3O 4BNIA 4DTIA 4MVJF 3TL2A 1DFGA 3KO8A 4JX8A 3A06A 2YJZA 3X2EA 1NQAO 5HTOA 3GZ4A 4HNHA 4GMGA 3PHJA 2WE7A 5F5LA 4HY3A 1VL6A 4CM8A 2OBNA 2VYVD 3C1OA 1O0SA 3VPFA 2B37A 3WLFA 3BIOA 4ONEA 4BO8A 1D3AA 3LLSA 2D5AA 1SEVA 4O1MA 3WIDA 2ZB3A 1CDOA 1P45A 3GPIA 1XYGA 2DTDA 4FFMA 4UUMA 3N74A 3ZU2A 2PNFA 5JNLA 4A0SA 2ZQYA 4ID9A 4PVCA 4II3A 4YDRA 1UDBA 1NFQA 1P9LA 1QLJA 2NNLD 2YYYA 3BTOA 3GDFA 4IBOA 1HTBA 1NPTO 2O50A 4WNIA 4R1UA 3LF1A 4EJ6A 1B3RA 5JFOA 4AJIA 2O2SA 2J3IA 4XRGA 2V6MA 2VWHA 1DC6A 1VPDA 4P38A 1GUZA 3W4IA 3INGA 2P4HX 1LQUA 1U4OA 4LVCA 5BNTA 2CF6A 1GAEO 2NWQA 4R9SA 5JPIA 4LGVA 4OIMA 2P5YA 4II2A 1HYGA 3H3FA 5GMOA 1QV6A 1E3EA 2AMFA 2Q2VA 3U4HA 3W1VA 4EI2A 4LISA 3M6IA 3RC9A 3TZ6A 2DTEA 1YB1A 1E3JA 5BNFA 4ITUA 4CMIB 2AEMA 4DPLA 4YJDA 3KB6A 3NX4A 1KEUA 1YOVA 3FPLA 2GZ2A 3O26A 4MKRA 1SZJG 4ND1A 3WGZA 1XU7A 5I7FA 1MV8A 4XJTA 2H9IA 4MOWA 1AHHA 1M67A 2GD1O 3G1TA 5CAEA 4CMAA 1IZ0A 2X6TA 4IJKA 4PZEA 4DLBA 1Z6ZA 4RVDA 4Z9FA 2DT5A 2RIRA 5I7SA 1KVRA 1YB4A 2DPHA 3JD1A 4Q39A 3BTUA 3CSDA 4CLRA 1LLUA 3MWEB 1UZMA 1FJHA 4IPTA 2D1YA 1I3MA 2GZ3A 1IY8A 1PSDA 2I5PO 3EHEA 3GVXA 3HB4X 3ZHBA 5L7WA 1X13A 3OIFA 1JQBA 1LLQA 2AG5A 3DFZA 4B4OA 3NTQA 1YBMA 2C5AA 5EQFA 1V35A 5JDCC 3WOHA 4ZICA 2DU8A 3AFMA 3INRA 3PVZA 4J49A 1EQ2A 1DFIA 5TS3A 1EFKA 4TVBA 4R5MA 1N9GB 2CNBA 1K3TA 2EV9A 3F5SA 5A9TA 4CMEA 4XGNA 1NASA 4GI2A 3VZPA 4LSMA 3VPHA 3IJRA 4MPDA 3NTOA 1MX3A 4TRNA 5IAAA 4U6SA 1XCBA 3GDOA 3NRCA 1G1AA 4HFMA 1ADCA 3P19A 2EG9A 2AEFA 1H0KA 3IS3A 5DF1A 5T64A 4RVHA 3NJ8A 1CYDA 4DL9A 1PJ4A 2VWGA 4PVDA 4FS3A 4LRSB 1LU9A 4IGFA 1C1DA 3RUCA 3D64A 4QXMA 4WE3A 4MP3A 1DIHA 3GC6A 4NBWA 4AG3A 3R3SA 5AYVA 4DMMA 5AQ1A 2PV7A 2UDPA 4S3MA 4B4VA 1C1XA 1E3SA 5L4LA 5JAIA 2YV3A 1EUDA 5L45A 3MJ4A 3GF4A 2EERA 2IZ1A 3G17A 1X7DA 4CM6A 5HWSA 5JC1A 1UDAA 4CM4A 4EITA 1UZNA 2YY7A 3CKYA 3PYLA 5AOVA 2LDXA 4FQ8A 4HP8A 3I5MA 1YDEA 4W6ZA 1R6DA 3ZDFA 1R4MB 4G5HA 3K92A 4J4HA 3FNEA 4WCFC 3SJUA 4DUPA 2AQKA 4CM7A 4FOSA 4IM7A 1XG5A 2RBEA 2ILTA 1JW9B 2YDYA 2PKQP 5JCJD 4M1QA 3U9LA 2YW9A 5CEFA 2GRAA 1WZEA 3CIFA 4Q9NA 3W6UA 4E0BA 1HL3A 1ZW1A 4IDDA 4BKOA 4DPKA 2JKVA 3K2BA 2WD8A 1B14A 2EP5A 4LSWA 4Y67A 3AOEA 4LVUA 5G0SA 4CMHA 3KHUA 4J7XA 5F1OA 4E13A 3PIIA 4R16A 4OM8A 3JQBC 2TMDA 3KOUA 4D7AA 2DLDA 3L4BC 2XOXA 2PZMA 3EUWA 1YS4A 3H9EO 1M2WA 3LT2A 5ITVA 2W98A 2V7PA 3MJTA 4RLHA 2EXXA 4B3IA 3ENNA 2QZ9A 3CTMA 1KERA 3PQEA 2GN8A 1VJ1A 4FPXA 1U2GA 3DWFA 4DVJA 3GG2A 3F6YA 4PG5A 1C14A 3GVPA 1MP0A 3PK0A 4IINA 2Z1MA 3FBTA 3ANNA 5GZ3A 1TVEA 4NPCA 5DCWA 4A10A 5COAA 4KDEA 5AXCA 1UP7A 3GG9A 4XB2A 3MOIA 4MVJE 4CM9D 5FWNA 3OSUA 1UH5A 3IUSA 4IDCA 4WNCA 5T67A 5BR7A 5JDIC 1JKIA 4PLYA 4IJVA 1VSUA 1ZJZA 3EDMA 1Q7BA 2DPGA 3KEQA 2XAAA 1DRVA 1NYTA 5TNXA 1PTJA 2AW5A 4R69A 4CM1A 1I36A 3UCXA 3PHLA 3GRPA 4DLAA 5BSFA 3MZ0A 4MDHA 2YZ7A 3QWBA 3FI9A 3JQAA 3O9ZA 3QVWA 4DLLA 3E9QA 4UVIA 3TL3A 2VUUA 2NTJA 1OMOA 1I2ZA 3T4XA 1J0XO 4CV0A 2IEBA 5EPOA 1B8VA 3GMSA 2DFDA 3WR5A 3PZRA 5IDQA 1AE1A 3N7UA 3PLRA 4IGEA 3IJPA 4GWGA 2ZB8A 4IDGA 2WYVA 5KJEA 5IZCC 2X5OA 3GT0A 1R66A 1GCUA 1XWFA 2WD7A 3ZWPA 4YT2A 1QSGA 3RFXA 1NX6A 1PU2A 1KC1A 1U3WA 3ZHZA 2V6FA 4IZHA 2E4AA 3CH6A 4IXTA 4J4TA 3KYCB 3WYEA 4NJOA 3MEQA 3AI1A 1ISJA 1TT7A 4WLEA 3DOJA 1GUYA 2VRCA 2X4GA 3GZNA 4NIMA 4D0SA 2VNAA 3HE3A 1YL6A 1ZZEA 2IODA 2Q50A 4OAQA 1SAYA 1XIVA 2GZ1A 1FDUA 2PWZA 3GDGA 4CUZA 4RV9A 1SPXA 1LRJA 1OC2A 1H6CA 3LQFA 2PKQO 4E5MA 4FB5A 3GY0A 1N5DA 1JAYA 5I8WA 3L77A 4NBTA 5AXDA 2C54A 3JV7A 3TJRA 3GA0A 1W4ZA 1HZZA 5A5EA 1DC5A 3DZBA 2ZYAA 1GEEA 2VHVA 1U3VA 1IL0A 4NU5A 2E6UX 1PQPA 4AFNA 5G2OA 3K30A 4Y6RA 4BO9A 1I3LA 5TJHA 2B5VA 1OBFO 3RU7A 2SCUA 5T8KC 1K6IA 1HF3A 4EZBA 5ENVA 2GCGA 2JCXA 1V3VA 2ZQZA 4XYEA 1IPEA 1RYDA 1U7TA 4FC6A 1PR9A 1ZK4A 4DYDA 3R1IA 3DTTA 1NVGA 2O7QA 2QIOA 4DC1A 3H8VA 3Q0EA 3V1TC 4HFRA 1XR3A 1B8PA 1PS9A 2F00A 1WAMA 5T5QA 1Z7EA 3RUAA 1R4NA 4W7HA 5G4LA 4D46A 2JAPA 1GZ3A 3MJSA 1H6AA 4OOFA 4FJ1A 3LLVA 3V8BA 1FDVA 1GFSA 2Y1GA 1ORRA 5BT9A 4MVJG 3WQSB 4BO0A 3IL2A 4RQUA 1VM6A 4ZU3A 2OHXA 1F06A 3BMOB 4CMEC 1N92A 3FHLA 3GRKA 3HB5X 4J1NA 4RORA 4YQZA 4MVJD 4PG8A 4XEHA 2EJWA 5IN5A 3C1AA 1UXJA 1H93A 1PJSA 2EGGA 9LDBA 1NBOA 3WWYA 3ZHXA 4CLRB 3FPCA 3WQRA 5FYDA 5CPBA 2GN6A 3GOHA 2VNSA 4UEKA 1Y8QA 1R16A 2WDZA 3KSUA 5T57A 4PRLA 2W2KB 2EP7A 3RBXA 1ZK2A 1WVGA 3FRJA 5DN9A 4DPMA 4W4TA 1M6HA 4FR5A 5KVQA 4C7KA 1B26A 4ZD6A 4AICA 3S2FA 4RVUA 2GPTA 1VSVA 4N7RA 4KP7A 5JO9A 3GAZA 4A03A 4CMCA 3QW2A 5JY6A 4IQGA 1PZGA 1UXHA 5EQDA 1DFHA 3VPGA 4O63O 5HA5A 3DMTC 2GN4A 4Q3NA 4GVLA 4ND4A 2QQ5A 4OXYA 4CV3A 2VT2A 2R00A 1G0NA 3WYCA 1M76A 3AI3A 2YV1A 1I0ZA 3TDKA 4EW6A 3I4FA 2AQHA 3E8XA 3VTZA 1D4FA 3H9UA 4ALMA 1ZK3A 1NHWA 2RCYA 3L4SO 4BQRA 4UUOA 1BGVA 3OHSX 4YJGA 1E5LA 4OQZA 3SX2A 4B8ZA 4MVJH 4D3SA 2Y99A 4NI5A 2BFOA 5CPFA 1P0CA 5B1YA 3V2GA 3D3WA 3L6DA 3RBZA 3BMCA 3H7AA 3KYCA 1D1SA 4HNGA 2I9PA 4AL4A 4BMSA 1ULUA 3ST7A 4LCJA 4TZKA 1RM0A 1Y5MA 1V8BA 1OC4A 2DM6A 1MB4A 1Q1NA 3DOCA 4R3NA 3RI3A 2Q2QA 3DZHA 5DZSA 3WWZA 8ADHA 4BNTA 2J3HA 3LC7O 1XKQA 4YWJA 4YBZA 1T1RA 3H9JA 1Q7CA 3JQAD 3G3EA 3B1KA 4RPJA 5L51A 1PL7A 4QO7A 1P1FA 1GUFA 1O5IA 3JQ7A 3FTNA 2H6EA 1AGNA 4MIOA 5BSHA 1TA4A 5CDYA 3JQAB 4J1QA 4GX5A 5CHEA 4ESOA 2D3TA 4PCVA 4W9NC 5GZ6A 5L3ZA 5L40A 1LA2A 3MJVA 1ZKMA 4BGUA 1Z45A 3CUKA 5T6BA 3VVCA 3BYZA 2BHLA 1LXCA 3ZNNA 3MOGA 4G81A 3WGHA 3HHPA 4J6FA 4L0QA 3K96A 2C2YA 3OP4A 1MFZA 3D4OA 4ALLA 1FDTA 5F1KA 4I5EA 1KY5A 2X22A 3GVHA 3Q2IA 1UR5A 2EKLA 3RVDA 2H5LA 5HBRA 3C7AA 5EMHA 4NZ9A 2BI8A 3EY4A 4HX5A 1LX6A 2VZ0A 4E5NA 3PRJA 4BNLA 4DXHA 1N2SA 3BMOA 3DHEA 3OQ1A 4HUJA 4BO7A 2OOSA 2VHWA 4ROSA 1GYRA 2EIHA 3U62A 1XQ6A 2Y93A 3U49A 4RPKA 1R12A 3INTA 2OFPA 4HKTA 1WW8A 4NFYA 4Z0TA 2CVOA 3H2ZA 4ZGWA 2FZWA 4EJ0A 3ENKA 1B0AA 4N5NA 4RZIA 1T4BA 1EBUA 3QVSA 4CL8A 3UN1A 1U3UA 1I3KA 4NR0A 2OP1A 4JBIA 1LDMA 2GR9A 1VJ0A 2AHRA 3IQDB 4BMNA 3IUPA 1CF2O 2C0CA 4AJLA 5KJ6A 4J9UE 1YQGA 3PFFA 2X0IA 3LT1A 3TQHA 3ZV5A 1T2DA 2OXIA 1LSUA 5F5NA 3O8QA 2I65A 1QLHA 5EJ2A 2W2LD 1D8AA 3P5SA 3ZN2A 4KZPA 1FXSA 1GYQA 1ONOA 3D7LA 5JSFA 1HYHA 2C20A 3SC4A 3VKUA 4EUEA 1MXFA 1YONA 2PZJA 2VHYA 4B3JA 1GY8A 2Q1WA 4AJ2A 4UEJA 3WYBA 3UGKA 5TT1A 5GZ1A 1EZ4A 1GQQA 1PIWA 3F3SA 4BIIA 2WM3A 4RPHA 4WKGA 2BGLA 2PTGA 3RU9A 3G0OA 1GEGA 5KJFA 3KVOA 2PH5A 4XA8A 1ISGA 5C7LO 2NV6A 2FZEA 3AFNA 2WTBA 3PDUA 5U9CA 3EC7A 4XD2A 3PDJA 3AM5A 3JQFC 3JYQA 3DZGA 2CZCA 2GN9A 4E31A 4CQLA 5A3VA 4BNUA 1ZBQA 2I66A 3I9NA 4RZHA 2IE0A 3GHHA 3OEWA 3UHAA 3ZI0A 1JLLA 3EVNA 4I08A 5EERA 4BO6A 4JJFA 3ON5A 4QX6A 4PLTA 2HK9A 4J1TA 3QLJA 4R68A 2BGKA 1CERA 2D5CA 3B70A 4EUFA 4WLFA 3GEGA 4TKLA 2WYWA 4TRMA 3RC7A 3I83A 1I10A 1GDHA 4U0KA 1SEPA 4XRRA 5CG2A 1PZEA 4BOYA 4ZRMA 2YHUA 3VPXA 3L9WA 4OMUA 1E3LA 3I9LA 3DBLA 4AJPA 1KVUA 4JNKA 2I3GA 4KTTE 1F0YA 3GFGA 1PJ3A 2YDXA 3RJ9A 3AW9A 3H3JA 1IHXA 2Q45A 4BNGA 5A4DA 1A72A 5KIAA 4E3ZA 3QVOA 4B7XA 1CJCA 3AU9A 1PEDA 2YUTA 2FR0A 2X0RA 4HV4A 4B4UA 3UXYA 1T24A 5A9SB 5JAZA 4ILKA 2AQIA 2PGJA 5JAMA 3K5PA 3D5TA 2FOIA 1K6JA 2DUWA 3FN4A 2I99A 2O23A 2P9GA 3WJ7A 4JN6B 4RF5A 4A2CA 2LDBA 2X8LA 3GAFA 5LDHA 1BWSA 4L4RA 3IMFA 2GERA 2J5RA 4DIOA 1Z82A 4WLOA 3NT4A 3RUHA 4U7WA 2D4AA 3M2PA 2HCTA 3I23A 3P7MA 1K0UA 3RKRA 3KYDB 3R3JA 3WICA 2VTEA 3ZWNA 3LF2A 1DRUA 3M1LA 3NUGA 2DUUA 2J3JA 3KM0A 3CPSA 4MJLA 3S2IA 2W2LA 1X0VA 4U0JA 1XDWA 3WGOA 4EYEA 1HETA 2V65A 4KQXA 2W2KA 2CFCA 4MP8A 5JXWA 1C0IA 4BNFA 4K26A 3L0DA 1Y7TA 3R6DA 4H7PA 3NGLA 4FC7A 1T2EA 4ZQGA 2BFPA 1ZH8A 1KEWA 4MVJI 4RF2A 1I32A 2IEDA 5GY7A 1NWCA 1EBFA 2X1HA 1NNUA 2NACA 3L9XA 1O89A 2ZB7A 1LDNA 2OMEA 3K9QO 3GVCA 3ZCXA 4P4NA 4IQ8A 2Q4EA 2X9NA 2HU2A 2O4UX 3G49A 3WX0A 1YXMA 3PGJA 1PS8A 1IE3A 4IDAA 5K0ZA 1P1IA 3VZSA 3OJOA 3E5RA 2ZATA 4E5KA 1XEAA 3RUFA 4DQUA 3GGOA 5C3MA 1X0XA 1T25A 1OOEA 1O95A 4Q3DA 3PI7A 4BB6A 5A3JA 4B7UA 3NTRA 4LMPA 3JYNA 1V3UA 2HK8A 3JYOA 3VH3A 5B12A 1E7MA 1HT0A 3TZQA 3AI2A 1I2CA 3JQDA 1HDCA 1UUFA 4I5FA 3RUEA 4R5HA 1ZK1A 1LDYA 4GVXA 1WWKA 4IMRA 1I30A 4AJKA 2BLLA 6LDHA 1F14A 2PY6A 3H5NA 3OA0A 4ALKA 4GWKA 2AEJA 4D3FA 4Y98A 1YKFA 3I9OA 5IN4A 3BTSA 1ZMTA 1A9ZA 1N1GA 2HSDA 3HJAA 3UF0A 3ORFA 5G0VA 3E9NA 4IZIA 4BNWA 1PWXA 1RYEA 3GLQA 4BNKA 4GQAA 2YFHA 4GBJA 4BO3A 4D45A 3VVBA 3WG9A 4WOKA 2FY8A 4YPOA 3B20A 3ICPA 2YV2A 1B2LA 4LK3A 1HZJA 1PJ2A 2DTXA 3E1KA 3DAGA 4JGBA 4D3DA 3DXFA 1MG5A 3LT0A 2ZYGA 2EF1A 4E2YA 3GGPA 2NSDA 1DEHA 4EEXA 2X0NA 1BMDA 4YRDA 1YL7A 1E7RA 4BHTA 3Q3CA 4CPDA 5DBFA 1X7GA 4ND2A 4OYRA 1BXZA 5MDHA 2POQX 4P8RA 3RBVA 4E6PA 3HDJA 5KVCA 1WNTA 4BV8A 5KTKA 2NM0A 3BMNA 1N7GA 1S6YA 4ALJA 3OJ0A 3QWIA 1JDJA 3QQPA 5KJ1A 2R00C 1J5PA 4CJXA 1C0LA 2Z1NA 1SMKA 4G2NA 4ZVVA 4FSHA 3U4CA 4E2ZA 3PQFA 3JCZA 1CIVA 2OP0A 4QTZA 3VZRA 4XQGA 2DAPA 1I33A 1RM3A 1J4AA 2Q3EA 3JQ7B 2WWRA 3SLGA 1K2WA 2JHGA 4XDYA 1I01A 4GLOA 1GU7A 2UVDA 3ANLA 2I76A 1M6WA 2NVUB 4UEOA 3V1UA 2NVBA 1DIRA 2ZJ1A 4W82A 4AJ4A 3A1NA 5BSGA 1P3DA 1MC4A 1N9GA 1BTOA 2G1UA 5U1PA 4GSLA 4AJEA 3P2OA 5JC8A 5IDXA 2JJYA 2C59A 3FD8A 3E6AA 2VZ9A 1YGYA 2OBYA 3KSZO 4GGOA 3HSKA 3VDQA 2Q49A 4E21A 2NTNA 4YT5A 2AXQA 5I9NA 4CR6A 3O03A 3AM4A 3OJEA 4M8SA 2W8ZA 2B69A 3ZU4A 2WD7B 1E3WB 1TXGA 2C7GA 1H5QA 3RQSA 1F12A 1RM4A 4ZQHA 3WLEA 1UAYA 4J43A 2EW8A 4GMFA 1U5CA 3P2YA 1DPGA 5A9SA 3IKTA 3RIHA 2NQTA 3JD3A 3QP9A 1I5RA 2PKRA 3CMCO 2ZCVA 5CP8A 1OZAA 3LC1O 4RO0A 5U4QA 2XPCA 4XQEA 3UH1A 5IDWA 4JROA 5F3RA 3DQPA 1EUZA 2Y1CA 1NVMB 4PLGA 1HKUA 1BW9A 1LJ8A 5EN4A 2B4RO 2A4KA 1P1RA 1PZFA 3Q6IA 4PN3A 5CDTA 5A06A 3A9WA 4RLSA 3KEOA 5DDIP 2C82A 4KWHA 4NBUA 3ZHYA 3U5TA 4K9DA 4TZTA 5H82A 4J7CA 1L7EA 4Z6KA 1IZ9A 4YAJA 2GGSA 3ROKA 3UUWA 4AJOA 3HNPA 4UUNA 3ABIA 4P22A 4PLVA 3BMQB 4MIYA 4QFCA 3EVTA 2NLOA 1J49A 3WGYA 4PLFA 3DDNA 2Q46A 1NAIA 4J0EA 1ZNQO 3ETGA 3RKUA 3L07A 4D41A 1VC2A 2ZTUA 3F9IA 3NGXA 1SNYA 4WLUA 3TOZA 3WXBA 3G79A 4BNMA 1WZIA 1LC3A 2G76A 2PZLA 5THQA 1HE4A 1HDZA 3OM9A 5JAQA 2JAHA 4JJIA 3UAGA 4YAKA 4E30A 3FNHA 4R41A 3QA9A 1E7WA 3DHNA 1E5QA 2EWMA 2FPGA 2Q99A 1JAXA 1CEQA 3WMXA 1GD1O 3HADA 4PIVA 3U4DA 2C07A 1SOWA 4O59O 4PZCA 3EK2A 4PLZA 3S2GA 1XU9A 2CVQA 4A5OA 2BI7A 1A7AA 4C7JA 2NU8A 3I9MA 1DJNA 1LRLA 2B35A 1OAAA 2Z95A 2GF2A 4IDBA 5B37A 1EMDA 1QYCA 4FBGA 3SBOA 4M54A 3VH4A 5TJ9A 4PLWA 1PWZA 4AJ1A 3CINA 5ER6A 4XJSA 5KJCA 2ZJ0A 1YL5A 4YACA 5TF4A 3WDSA 3WTBA 1KS9A 4B8WA 3QIVA 1UDCA 2BRUA 1EVIA 4GL4A 1DIBA 2ZYDA 3ZNQA 5JMWA 3EGOA 4NJMA 4A27A 3AUSA 4IJUA 1Y9AA 3DR3A 3E18A 1TB4A 1IUKA 5I7VA 1DAPA 2DBRA 4JK3A 1DSSG 3ASVA 1CWUA 4N18A 3OIDA 1QR6A 3CE6A 2B4TO 3ZWXA 2E37A 5ITWA 1HSZA 5KKCA 4L74A 4CODB 4CR7A 2JFFA 1GADO 4FOOA 1E92A 1ISMA 1PJTA 2VHXA 3CZMA 3ICCA 5K9ZA 1P44A 2PD6A 5LCXA 3TFQA 3I6QA 1D1TA 2PD4A 5TT0A 4CM4B 3WGGA 1H6DA 3PWSA 3U09A 1HE5A 3FCOA 1ADFA 1E6UA 5JMPA 4XKJA 1HEUA 4ZQFA 1MC5A 1VKNA 2NUAA 1LBEA 4E4YA 2RH4A 4J4BA 2CDBA 4OQYA 5AXBA 4XCVA 3C7DB 5LDGA 4YYZA 1Q7GA 1SC6A 1PL6A 1W0CA 3SEFA 1YE3A 4J2OA 3NAQA 5A02A 2VOEA 3PPIA 5C5IA 1NPYA 3GN2A 2JL1A 2ZTVA 2IXBA 3BMNB 3IKVA 4U5QA 1NTOA 3PFWO 3ZV3A 2EKPA 3ZWVA 3AY3A 1YWGO 3U4IA 2A9FA 4YJHA 1DHRA 3SC6A 1ISHA 4IUYA 2AE2A 5L53A 1YDWA 3Q2KA 1EDOA 3C24A 4L4SA 5ENDA 1R0SA 1R37A 2Y1FA 2YHIA 3E03A 1KC3A 1KEPA 3T4EA 3IP3A 1FDSA 1LUAA 2JD2A 3NYWA 4OJNA 1TEHA 4E5PA 3I4CA 1A7KA 3PTZA 1HXHA 1GV0A 5HS4A 4NG5A 1OFGA 4BO2A 1HDGO 1VKOA 3DBRA 3PP8A 4BNHA 3WGTA 5COQA 5IXYA 3WTCA 2AE1A 4IY1A 3ETEA 3HFGA 4K1LA 5TGDA 3PYMA 2Y05A 3UICA 4RVFA 4BGVA 2VZ8A 2IYPA 1FDWA 3JYPA 1EFLA 2QW8A 2AQ8A 3NT5A 5JCJA 4NU6A 2A94A 2Y68A 3D4NA 4KUEA 2CF5A 2NADA 2GNAA 3NEPX 2HKIA 5COBA 4W99A 1YO6A 1E0DA 3GGGA 5CG1A 3ONDA 3WNQA 2Y1OA 1NR1A 4H16A 5DOVA 4BO1A 1LNQA 1E3IA 1LEHA 3DZJA 3F47A 4MKXA 2X86A 2ZB4A 4KMSA 4WCFA 1E77A 1PGQA 1HE3A 3TNLA 2BKAA 3JQ6A 1ENZA 1PJCA 4I9HA 1A4IA 1PQWA 3FTPA 5J23A 1EK5A 4XB1A 3RD5A 3T7CA 1JVBA 3S1LA 4FN4A 3TPCA 1BW9B 1NXQA 3TSCA 3E5MA 3HN2A 1KOLA 3U0BA 4B79A 2Y67A 4DREA 3DHYA 2VRBA 4MIEA 2JHFA 3IOYA 4BO4A 2GYYA 3WSWA 1QXSA 1H94A 3VH1A 1X7HA 2VHZA 4JXKA 4F46A 2P2SA 2H1SA 2J8ZA 2XF8A 1PZHA 4W7IA 4F6LA 2BFAA 5CEJA 2PLAA 1PL8A 2VYND 1E3WA 1IB6A 1QV7A 5H83A 4OO3A 3BZUA 1ENOA 1JWBB 2JFHA 1YBAA 4YJHB 4ZN6A 5DP2A 3KRTA 4IJWA 1ENPA 5JLAA 2OUIA 3CXRA 3ITDA 3HWRA 1NAHA 3BXXA 1DAOA 2QYTA 3GNQA 5ICSA 1GCOA 4DBZA 3Q11A 3EMKA 4GH5A 4YT4A 3UCEA 4CR8A 1Q0LA 4CMKA 4XIJA 5DNAA 5TC4A 4JCOA 2ET6A 4C4OA 1HSOA 3ROQA 1HLDA 1MA0A 5TQVA 3JQ8A 2BELA 2IRWA 4YXFA 1B7GO 1A71A 1E1KA 1Q0HA 1Y8RB 3LDHA 2TMGA 1JKJA 2OZPA 1LDBA 2P9EA 2X5KO 4BKUA 3N58A 3BMQA 4YAGA 5TLSA 4XGKA 4XYBA 4ALNA 2O2YA 3BMCB 4I5GA 5DBIA 2HJRA 3ETDA 1AUPA 5KKAA 3QRWA 1HLPA 4I5DA 4KDFA 1K89A 4XQ9A 3QY9A 3ADOA 1Y6JA 3RC2A 3DOOA 5F1PA 3DC2A 2JCYA 1LSOA 5K6AA 4CLOA 4MINA 1DO8A 3ANMA 3QJ5A 4RF4A 2IXAA 5L4NA 2PD3A 4FJ0A 1DLJA 1Z75A 2VWPA 2PK3A 3H6KA 4K28A 3ONFA 4IDFA 1NQOA 2PGDA 4Z3DA 3WGIA 3GR6A 1DXYA 1UP6A 2QRLA 4CLHA 2PGLA 1E6WA 2C5EA 1C0PA 1XELA 3JQGB 3KXDA 1M66A 4J90A 3F4BA 3W8DA 5I8ZA 4E33A 2Q1TA 4NFHA 2IDZA 1H2BA 4Q3CA 5BQFA 4JIGA 2O3JA 3ZV6A 3I52A 1X1EA 1B16A 5EINA 5A5FA 4XZ3A 2V6BA 3ZWAA 5CDGA 4AJHA 1BDBA 4UVHA 4RCVA 2Y0CA 3PXXA 3F1LA 2B5WA 1IOLA 4GGPA 3PJEA 1BG6A 3H9QA 4NFSA 1H9AA 5B4UA 3MTGA 1H6BA 4GLLA 3AOEC 4U6QA 3L6OO 5C7OO 2NU6A 3DAPA 4YEDA 2IYOA 4WECA 2P5UA 4I1IA 3KZVA 4WCFB 3BA1A 1B3BA 4FGWA 2VQ3A 2FP4A 2GASA 2HO5A 2HRZA 1MXHA 1U1IA 3FSRA 4RDHA 3ZV4A 3G1UA 3ZH2A 5T8KA 2PR2A 3OH8A 1YB5A 2RHCA 2VN8A 3NJ4A 1LI4A 1WDKA 1TT5B 3X2FA 1IHYA 1ZK0A 1ZSVA 3BHIA 4HXYA 4L8VA 5LC1A 2X9GA 2J5KA 5KNLA 4Q3EA 4AJNA 1RWBA 1WLYA 1N1EA 3KLPX 4RGBA 4Z0PA 4UVGA 1SCUA 2I67A 3EYWA 4R1NA 3S2EA 4BO5A 3AY7A 4BVAA 3QV1A 1SOVA 1P1HA 4YA6A 2W4QA 5KVSA 1ZO8A 4J16A 1JKFA 4FIZA 1R15A 1E7QA 1SO8A 1HDOA 3C8MA 9LDTA 3RUIA 2C2XA 4MO2A 4FFPA 3NDRA 4YT8A 1W6UA 1DBVO 1UAGA 5EIOA 2QRJA 2PH3A 1RPNA 3PEFA 4B7CA 5ADHA 4PLPA 1PGOA 1YH3A 4I8XA 6ADHA 1Y5RA 2DBZA 2PFGA 1WPQA 3RC1A 5DBGA 4BGIA 1G6KA 4EGFA 1ZSYA 4FGSA 4DIFA 4PG7A 2ZIZA 2AG8A 4X54A 1RJWA 1NP3A 5C7IO 3BTVA 3V2HA 4TROA 3HDYA 3WFJA 4KOAA 4RDIA 4ZA2A 3ITKA 3UKOA 1ZEMA 3EW7A 4R9RA 3VKVA 1U4SA 4JQCA 3AJRA 3KSDO 1Z7BA 1NFRA 3OMLA 1O8CA 4LN1A 7ADHA 5L7TA 2P68A 3B6ZA 4Q3AA 1VI2A 5IDYA 2ZTMA 1I8TA 2JD0A 3DMTA 4L75A 4BQPA 4DBVO 4EDFA 3QSGA 3DBHA 3FF4A 3DAFA 4WASA 2HK7A 1FK8A 4BGEA 3AU8A 1U2DA 3VAZA 3HG7A 1SBYA 2V6GA 4R01A 1V3TA 1R0KA 4PGFA 2PA3A 4R1TA 3F1KA 4D43A 3DO5A 1RKXA 4KTVE 3WFIA 1U9JA 3OJLA 1J6UA 3GPDG 4KQWA 3VTFA 4M49A 3WQQA 3AUAA 3QVXA 4A26A 5I9MA 1NVTA 1DHTA 2D59A 4OHUA 1KVQA 1N8KA 2Q4BA 1OI7A 2ZK7A 3Q9NA 1C1XB 1LQTA 2X5JO 2G17A 1UXGA 3RAJA 4WGGA 4RVSA 1WMAA 5TIIA 1GYPA 3DTYA 3GFBA 3FNFA 1A5ZA 1HDYA 3HFSA 3IDSA 1NR7A 3Q1LA 4AVYA 3SVTA 1DLIA 4IQ0A 3H5RA 3T7EA 1H2HA 3A28A 4OKNA 5FI5A 4CMBA 1JTVA 5FF9A 3JTMA 4YRAA 4HFNA 3TZCA 3FWZA 2YQ5A 5G4KA 4P4LA 1ISIA 3DMYA 1EEHA 3UVEA 4F45A 1ID1A 4ZHSA 2A92A 3ZW9A 2QG4A 2Y1EA 3UOGA 4GKVA 2HMWA 1ENYA 4BB5A 3VPSA 3K31A 3GZNB 4OKIA 1LRKA 3TWOA 3DZKA 4WPGA 2NVUA 5L9AA 1YJQA 2I3AA 5A04A 1HDXA 1XGKA 3IC5A 1DJQA 4XWYA 3RFTA 4J9VA 4TRJA 2OL4A 3D3EA 4CLOB 1A4UA 3PGXA 3DONA 1KETA 4FFRA 3S8MA 3DFUA 3HQ4O 1QMGA 2Q1SA 4YTEA 4FDAA 4LMRA 4Y9DA 3RFVA 1IPFA 4GPD1 1DIGA 4UVDA 1C3VA 1JU9A 1MLDA 2UUPA 5IJZA 2P4QA 3PIDA 2JFGA 4XR4A 1U5AA 4CLXA 3RUDA 1LLDA 1PGNA 1HE2A 3OETA 5A05A 4HFJA 3FBGA 3DBVO 1ZSNA 2ZKLA 4QSMA 3ADPA 5ER9A 4XR9A 3WGQA 3AWDA 2Q2WA 3A14A 3JQ8B 3QWFA 1ZXBA 4ND5A 2BD0A 1HWYA 3OQBA 1K5HA 3GUYA 4PLHA 5ICMA 3TOXA 2WYUA 1K6XA 3GHYA 4MKZA 4UREA 1FMCA 3I3OA 4XYMA 2B83A 5C37A 2VRCD 3M2TA 1VJTA 4CLEA 1BVRA 5DCYA 1YVEI 3PHGA 2DC1A 4PG6A 4CUJA 2HQ1A 3FR7A 4BNNA 4I9NA 4IXWA 4KUGA 3WS7A 3PHIA 3ROPA 4RVGA 4OGWA 1ZXLA 1LTHR 1Y8QB 4EEZA 4RPLA 3MTJA 1XHLA 3OEYA 4O6VA 1GPJA 2E49A 3DBLB 4QQRA 4U8GA 5DP1A 1TLTA 3KTDA 4Q3BA 2VYVA 2UAGA 1KBZA 2X7HA 4IS2A 3M1AA 4F6CA 1U8FO 2EKQA 3HN7A 4OSPA 2CDAA 3JD0A 3O8QB 1ZUD1 4FFOA 1C0KA 5HS6A 4BNVA 5FI3A 1CQJA 5K6AC 2Z5LA 5EL0A 1YQDA 2VWQA 1ADGA 4CM9A 3ROMA 4XQCA 4NQZA 3PJFA 2D2IA 2P9CA 4UULA 4JLWA 5KOIA 2BFMA 4M55A 3VZQA 1WXDA 2FR1A 4A73A 1KEVA 4GX0A 3DZIA 3NV9A 3F5QA 2HLPA 2EGHA 2VUTA 3OF2A 3K2EA 3D1LA 1KVSA 3PLNA 2GO1A 2J6IA 2O4CA 4HWKA 4FFLA 5CFZA 2F1KA 2JCVA 4BV9A 4CV1A 3RSHA 1MUUA 4ZJUA 4OH1A 1UJMA 4DYVA 3RASA 1PR3A 1GV1A 1P1KA 1KYQA 3GEMA 2QZZA 4OOEA 4XGIA 4YQYA 1B8UA 5G0WA 2GLXA 3O4RA 5IXSA 3PZBA 4FFNA 4BMVA 1UXIA 5KCZA 3E48A 1PGJA 2DKNA 5CDSA 3ZWMA 4QO8A 4TWRA 2NU9A 1BXGB 1ML3A 1ULSA 1XSEA 3LYLA 1DRWA 1EVZA 1PGPA 1UP4A 1TT5A 1U8XX 3CZRA 5KVVA 1U7HA 4DIBA 5G4KB 4TKMA 4YB8A 2WMDA 3ONEA 2VT3A 1L1FA 3OICA 5JY1A 1BVUA 4MVJP 1A27A 3AOGA 1XLTA 3W6ZA 3QE3A 3KUXA 1E7SA 4DC0A 3JSAA 5H81A 2G82A 5TX7A 1E1LA 5IZ4A 5ILOA 4W9NA 2VOJA 5IG2A 1QG6A 1GL3A 3I9JA 2C29D 5MGBA 4L4XA 1DDOA 1ZFNA 2GUGA 1SB8A 2XXJA 3ZU5A 5B4TA 1E1MA 2AA3A 1MG0A 3EAGA 3GH3A 4EJMA 3A4VA 2G0TA 3DZFA 4LCEA 1O9BA 5JYDA 1WDLA 4S1VA 3FR8A 1DB3A 1ARZA 2QRKA 1LC0A 1EE9A 4CM8B 1BDMA 1QP8A 3BHJA 3HDHA 4XYLA 2DBQA 4UVEA 1P31A 4PRKA 1LSJA 4N54A 3WB9A 2CMDA 1PJQA 3OA2A 5CDUA 5L4SA 4J3FA 4FD3A 3W8FA 1IULA 4J0FA 1PQUA 4OL9A 1PJBA 1F8GA 3ZWOA 4CLDA 5JCXA 4DA9A 2NVWA 2YFQA 5ES3A 2QX7A 1ZIDA 4E2WA 2D0IA 4E12A 3TFOA 3BHMA 1NFFA 4TQGA 1T1SA 1Y8RA 1N7HA 1Q2XA 4B3HA 1T4DA 1W73A 2O3SA 1VE9A 1NPDA 1O94A 4CQMB 1QYVA 1IYZA 3FWNA 1L7DA 4DQXA 1X14A 3AY6A 3UW3A 4N5MA 4R3WA 5JBIA 3AK4A 2UV8A 4RF3A 3JQFA 4KUHA 1CETA 5JS6A 3DEYX 2RH8A 1YJ8A 4R1SA 2YQ4A 3JD2A 3D0OA 1EK6A 2G5CA 3K73O 2W90A
chains in the Genus database with same CATH superfamily
2I2BA 1A0OA 7MDHA 2B36A 1M75A 2IK8A 5K1ZA 1G3UA 4GX1A 4RHCA 5LOVF 2X58A 2Z9CA 4YN3A 3VMFA 5AKLA 1IU9A 1DCMA 2I6GA 4WGFA 1NYLA 1E4VA 5EJ5A 4GO1A 4XWTA 5JYCA 1IHOA 5JDIA 4B34A 1H4SA 3G9UA 3BWMA 2JANA 2MIIA 4LHYA 2F3QA 3F8WA 1XRMA 4KWIA 5DT9A 4PZYA 4C7XA 1QFXA 2I6XA 4FJ2A 3H9GA 3T06B 4EY3A 2E4ZA 4LBYA 2QNRA 2ZJ6A 1U6KA 1OR8A 1XALA 1ZCJA 3C8ZA 3LHDA 4G9BA 4JOQA 5CYFA 3G6WA 1GPKA 3PFKA 4YAFA 3DKVA 4IMPA 2CZQA 1VYTA 3NCTA 1ZGGA 3V1YA 4ZOQI 5KREA 2BFDA 3HHEA 4B46A 4F1JA 4HCJA 2XSZA 1O96A 2VBFA 1ONPA 5EWLB 1L5LA 4US2R 1RWPA 4A4DA 2L82A 4KQ6A 2DRIA 4KE6A 1HT1E 1T36A 3WK8A 3AKCA 2WE8A 3VR4A 1UT8A 3PXCX 4YCAA 4RJTA 4BE9A 2B94A 5JE8A 1NV8A 4ZMSA 3OX2A 3NKVA 2XNKA 1BOOA 4EVIA 1EDBA 2AF4C 2O48X 3SXPA 4XDZA 1E2HA 2C4TA 2Z2XA 3E3NA 1C30A 3QUAA 2XIQA 4GSKA 3EZ7A 4D42A 4DMGA 5LR6A 1UMBB 4MGZR 1M8FA 4MAAA 3N3BC 4HAXA 4DRYA 3MTDA 4XE5A 2HAEA 5TRTA 3VZBA 1I4LD 2IBTA 5HK9A 1JMVA 1EP9A 4HK4A 4NECA 1G2IA 3LHFA 4KC0A 5CIYA 1A5BB 1FP2A 3D2LA 4EBFA 3NMUF 4B2LA 4UTZA 3K0FB 5CFRA 5HF9A 2HXGA 2IHBA 3GVIA 3Q9UA 2Q1UA 4PZ0A 1UPAA 3WK5A 1Y1PA 1YASA 3HJFA 3AFIA 3JQEA 3N1UA 1SZCA 4NJMB 4CKWB 3QHAA 5AKXA 4CM3A 4J7UA 3PU6A 1QRSA 1D2AA 2ZZNA 3FRHA 4Y6LA 3D5EA 1FTQA 1H5NA 3QFHA 3ULKA 3OQ6A 4RSMA 4IDEA 1CVIA 1R74A 3ESZA 4CQMA 1T5DX 4U2DA 4UQPA 3CUUA 1GPLA 1XTKA 3VO9A 2QTWB 4ZHQA 2O8NA 1HYQA 3ENWA 1HDIA 2MR5A 4KX3A 5FULA 3HM9A 5KYKA 4E2XA 1A8HA 3HXTA 2LKCA 4OBWA 4FLFA 2WJ4A 3V4ZA 4MLPA 4L85A 1YUNA 3T1OA 2LCIA 3IB3A 3ZX4A 1XAGA 5EXEA 1E5DA 2BFCB 2UUAB 4YVFA 1EB9A 2VHUA 2WWGA 3WGUA 5CAEB 5JCZA 5TVKA 3C3AA 4B85A 5EJ4A 2XRZA 2JGNA 4AC9A 2R11A 3WP0A 3WY9A 3T12A 3UHPA 1EA7A 4XWOA 1GA4A 3RVBA 1VLLA 3AF5A 2JIPA 5DNYB 4FYIA 3OFSA 2WAOA 4XYGA 2BT4A 3R20A 3JZFA 1SJ9A 1YNSA 2FMUA 3SQLA 4C04A 3B1WA 3OECA 2NO9A 1IUOA 2EDCA 1XZGA 4GQBA 1NY5A 2GCOA 3EGXB 4OYLA 3JU3A 4R1PA 3VC1A 2YJ6A 1M2KA 2PMBA 4FZJA 4EKEA 2J3DA 1FZQA 3GUCA 1SK8A 2FG7C 2OESA 5GJWC 3WB0A 1KO4A 1JHXA 2BR5A 4M0CA 4MA0A 1V6AA 2OGUA 2P2GA 2WIDA 4FGUA 3ZZ0A 4YV2A 2IX9A 1I24A 1R7RA 1EDDA 2ZI4A 4LS3A 4UCFA 2Y9MB 1YRLA 5ALJA 3VC7A 3M6LA 5IFLA 1KORA 3D4PA 4JASB 1DQRA 1P2FA 3PDWA 4AMBA 3UTDA 2VG8A 4HVTA 4RD3A 2C7VA 1FF9A 1C41A 4JGGA 1MJ5A 4L9RA 1LNSA 2YC4C 2PJUA 5JDCA 2C94A 3DE3X 1C9MA 1VECA 2CUKA 2FWBA 2N0SA 4QQKA 4YJFA 3REQB 4JITA 1QIIA 3HNOA 3TOVA 4B6RA 4BJHB 3UFBA 5B30A 5TB5A 1JECA 2XTAA 4MVYA 4B1FA 4ZQBA 1G16A 13PKA 1KI6B 1QCDA 1S2DA 2AJTA 4Y2JA 2NO7A 3OLVA 1R9JA 2HNBA 1UWCA 1U28A 1V39A 1UXKA 1YOVB 1ZH6A 4WEQA 5G0UA 1KY4A 3KXKA 2PU7A 3E7XA 3AUTA 4JSYA 4RGVA 4DY6A 4OPMA 3ZIAA 3G1WA 3Q8KA 3PPYA 2R62A 5FXMA 4ZT7A 3E1SA 3WRWA 3R41A 3L8EA 1V8FA 2VCYA 1HH4A 4EA8A 3L41A 5TMEA 5AVVA 2OKCA 1GNSA 4PFJA 1JDPA 2YRFA 1SA0B 1KMNA 4XXHA 3BH6A 3W3AH 4B84A 2OSVA 4PZDA 2GF9A 3G9XA 3SX0A 4MRVA 5IF3A 4C0JA 2YMMA 4GDMA 2P79A 1MABA 3ZWCA 4CL3A 3LUCA 4G65A 4TMVA 4BB9A 3E23A 4Q02A 1W1UA 2HJSA 2BMFA 3AM3A 5K51A 4QEDA 4AURA 4BAUA 4CI0B 3EIUA 3ZW8A 3FNRA 2C92A 4EJSA 4QPJC 3QY0A 3KQSA 1URPA 1DCKA 2R79A 5CGQB 1ZYUA 2B4QA 2WHRA 2ZUWA 4EECA 2I7VA 2DPMA 2M1XA 2H4JA 4JBLA 1U2SA 4AUKA 5MFZA 2GEDA 3DL2A 3EDOA 1FJ2A 4ITVA 4WXHA 2CDCA 4AXBA 2V6JA 3KQPA 3OZBA 1KSGA 3KUCA 2P4UA 4NK5A 1DWOA 1VYUA 4GPAA 2B2NA 4D9HA 4MWZA 2XZTA 6AT1A 1Y4UA 2WJPA 4NBRA 2F7SA 3IUEA 3TX6A 5FI0B 2I6QA 1F0KA 3GD7A 2EJVA 4NDNE 4PG4A 3B7PA 3G13A 1H3NA 4YCDA 4OGKA 4Q9LA 2WNIA 4D96A 1B15A 2QX9A 4FNMA 1V9LA 1DOAA 3PHHA 4B31A 3VNUA 1NSYA 1L8QA 3B1JA 3EA0A 2VAMA 1VMDA 2O7SA 3ED5A 3H11A 2R47A 3O93A 4CM9D 2CKDA 4YR9A 5KYNA 3FTQA 2HMSA 1TPYA 4HS4A 3IXQA 4QHTA 4ZTBA 4J1SA 1TO2E 2B8EA 3OBBA 1QRDA 1GTMA 4BKRA 3A58B 2Z5GA 4TKVA 5IW8A 4LMAA 3KQQA 3VH2A 4INPA 3PNLA 3G2JA 1O03A 4JP2A 4ENPA 3BG5A 1LDGA 3KYBA 1UZLA 3F8TA 3O7MA 3PQ3A 4N5LA 1TYEB 3IIEA 4GXTA 1EK1A 1Z6GA 2FX5A 5I3CA 4JL8A 5FBHA 3C48A 4GLFA 4K46A 1RC0A 1EDZA 2JBWA 2X9VA 2ZBQA 3DEAA 4F3TA 4YXWD 3M5DA 1M0EA 2C2OA 4MA4A 1OLSB 3V48A 5DB4A 3AL3A 2EX4A 1QORA 3I6IA 2CMGA 4D97A 2Q5QA 1TOAA 2IQ5A 1QIFA 3MTBA 3QMVA 4MRAA 4OI1A 3D5QA 2O3RA 1R8SA 5DSZA 4B6OA 1MOSA 1K7SN 1WXEA 1KAEA 1Z07A 3IDOA 1RLUA 4RUKA 2HF8A 4HSGA 5EWJB 3AHHA 1QRRA 1GZ7A 2ORYA 4UE2A 3LECA 2BMEA 3IHLA 1ZJJA 2K5UA 3IVMA 4BKPA 2ZPTX 1D2RA 1QYXA 2FZ4A 4D4GA 4XIYA 3R3YA 4LZPA 1ZH4A 3TPZA 3S1SA 4FUQA 5IZCA 2XUHA 1EFRA 3V6LA 3OLXA 3PE3A 4CNBA 2ZXEA 3KB1A 4JJGA 3SJ7A 3NW9A 4GWLA 5M04A 2JI8A 2Q3JA 4WUVA 2FX2A 4CMJA 3EBLA 5DTJA 4DLWA 3EPLA 4LVOA 1OTHA 2O3QA 1JR3D 4TMWA 3JQGA 4PC3A 5AJZA 1Q92A 1JA9A 1NQTA 3DF9A 3THOA 3FF1A 2R6GA 3IUQA 3RUPA 1E1NA 2QHXA 3O9VA 4XB6B 1RRKA 5KNDA 1UPTA 2VTBA 4A7PA 4EY5A 1LPSA 4K9NA 4RZ2A 1CJKC 4HEA6 4JB2A 4A2WA 2CE7A 1R6BX 2ZRCA 2DBVO 1MX5A 5AK5A 1KI4A 4FDUA 2ERXA 4DCJA 2CSUA 4ZVLA 3VOSA 4AKTA 1KP9A 4DHWA 1Z0UA 5EP2A 4F86A 3TN7A 3SQXA 2JD1A 4UHEA 3MBIA 2GEUA 4RMIA 2UXDB 1CC1S 3N59A 1B1CA 5TEWA 1KMHA 2N1MA 4BE7B 3FPEA 1WDMA 1F3OA 4WN9A 3OKAA 2F8SA 2ECKA 2HMUA 3TH5A 5C5CA 2RAFA 2ZLBA 1EWVA 3Q85A 5AJUA 4YCCA 3MCVA 3A10A 5FUXA 3MJEA 4GICA 4NICA 3RYHB 4JL5A 2R86A 3KZCA 5DTIA 2QPTA 1OF1A 1HA3A 4JP3A 4PR0A 3FH0A 3UWOA 4F5ZA 3DDZX 3WJ2A 4PSDA 2R751 1GJRA 1TDJA 1ZM4A 4YJFB 3AW8A 3DOHA 1YS9A 4IJMA 1QRUA 4KE8A 1NM5A 4QT0A 4BJ1A 1FYVA 3AF6A 1VCHA 2E48A 4BVHA 3I05A 3KV3O 3TQCA 3V4PB 3O90A 4MVJF 3TL2A 2O1SA 4QBFA 1U0NA 4OMFG 2LR0A 1XA4A 3X2EA 4D74A 5HTOA 4L9WA 2VH2A 1WL8A 3K05A 2WE7A 3N0TA 3LQYA 4CL0A 2LZ0A 2OUKA 4CM8A 2OBNA 2VYVD 3G6KA 3IODA 1O0SA 3EAFA 1RYNA 1BN7A 2GX6A 4NZOA 2G7MC 3WLIA 4R1LA 4B35A 4F11A 4YCSA 3GA5A 5C0OE 2VSOA 3D6HA 4OYYA 4HDMA 4MGYR 3JAKB 5F1YA 4BO8A 1D3AA 3LLSA 3QM1A 2AL7A 3N2NA 2I2FA 3K4PA 4CNQA 1CR2A 2MSEB 2IW3A 1DT3A 3A25A 4YLEA 5FWXB 1SVUA 2FZCA 2C5HA 5J4YA 4N76A 4XIIA 1XYGA 1TVMA 3AXTA 3ETHA 4QDOA 3ZOKA 1DEXA 3FMIA 2CXQA 1JLMA 2YIVX 2QDXA 5AHKA 1NOKA 1ZGJA 2GBCA 4M53A 3ZDAA 4GM0A 2X1VA 3SQWA 3E3LA 4QUDA 1CJTC 3GDFA 5AUNB 4ESEA 2GZRA 2P6OA 3U3RA 1C3OB 2FQYA 2O50A 2ODEA 5BRNA 1CE8A 4PF1A 2GPYA 5MFPA 5EJMA 1B3RA 1TECE 3A3YA 4GUDA 4MARA 5LA6B 2O2SA 2G4VA 5BN5A 1M7BA 4M0PA 1DC6A 1TUEA 1ONBA 1VPDA 1KIMA 3FZEA 1COWD 1WOYA 3PC2A 3DKPA 4HGRA 3GLSA 5ARCA 1S96A 1TRKA 5FWXA 3W79A 1IBLB 3ZD7A 1LQUA 1N2IA 1P17A 1A5TA 2G63A 3PX2A 4PC6A 5JH7B 5D3KA 3TNJA 5C9ZA 3I8XA 3KOWA 3Q8XB 4P58A 1OJLA 1U0RA 2MR6A 4KG7A 2B1JA 3RG8A 3ZHCA 4LF9B 2VIIA 4FDMA 4IOJA 5EXDA 2PZAA 4OIMA 3RVMA 4FMCB 4C14A 3I73A 4K81B 4YROA 5BORA 1T1GA 5KTTA 1K4YA 1RBQA 1QV6A 2Q2VA 3Q7EA 1HNXB 2GAIA 2BGNA 3OU7A 1WUHS 3LH5A 1CUZA 3LHSA 2PM8A 3GLKA 1E3JA 3MTQA 5BNFA 3CFYA 4JLBA 4CMIB 5F23A 5JRDS 3PXDA 3DV0B 2AEMA 3EGVA 4RD4A 4AMGA 4B6JA 4ND1A 3AR2A 3FPLA 4OBBA 4MKRA 2J33A 3O26A 2VSQA 2O8FB 5I7FA 2XUQA 4JP8A 2H9IA 2PBLA 3CH4B 4Y6QA 3T6KA 3ROGA 4CMAA 2GNPA 3DCIA 3UKJA 4PCUA 4Z9FA 4ND7A 4LNHA 2DT5A 1ZRMA 3WYGA 2IPNA 5I7SA 1KVRA 1YB4A 1MA3A 2DPHA 2LP4Y 3O21A 4B6EA 1EGAA 4D4KA 2WPNA 2RD2A 3BTUA 4H7FA 5K0LA 3DM5A 1LLUA 2ONCA 3NRBA 3OQNA 1EK0A 2BFBB 4JR2A 5CCDA 1J0DA 3KEFA 1OFUA 2I5PO 3HB4X 4AYXA 3ZHBA 5L7WA 4W5RA 5NLLA 4B4OA 5JI3E 4V0NA 2QUKA 1YBMA 2ZSAA 1PLJA 1V35A 2JGIA 4LKRA 1I7DA 1XE3A 3ZBQA 2ZYVX 1ADJA 3TQOA 1EQ2A 4E03A 3EW9A 5CB6A 3B7GA 1ZR4A 1JG4A 2RI6A 4TVBA 5JNSA 5CNMA 1F8XA 1SG0A 1XZNA 1BXRA 1K9VF 2CNBA 2JFZA 1O6FA 2F4VB 1Z38A 2WD9A 5A9TA 1PTJC 2HU5A 1TYDE 5GQSA 4BYGA 4CG0A 4WK0B 1NASA 4Z1MA 1E3TA 4HPWA 4WOPA 3DYIA 3CRW1 1VJCA 4B09A 3NTOA 1V11B 4XFKA 4P80A 5HOEA 2BBWA 3NRCA 1NN3A 4MW4A 5JAUA 3R23A 5AI0A 5GINE 4TZ0A 2QAGB 3Q7RA 4AX4A 2NZ8A 3USES 3VNSA 1GPYA 1ADCA 4HFMA 3WDKA 5CB8A 1DAHA 1DRJA 1FMTA 2BF4A 5T64A 3HUUA 3A1CA 1M0SA 4FYWA 2AG6A 4ZC8A 3V4OA 1B43A 1YIAA 2RBKA 4JI7B 1BN6A 2FQQA 1QQ5A 4LJRA 4FS3A 1JDVA 3PB3A 1NV9A 3VJRA 4L2IA 3RUCA 2YQZA 2WHPA 4QXMA 3RIEA 5DHQA 4Z1MD 4AG3A 4NBWA 5AQ1A 1QRTA 2XUGA 4OJKA 2PV7A 1HORA 3I1YA 2XUAA 3THYA 1C1XA 2VAXA 4NYIQ 4C3ZA 1U7PA 5JAIA 2V97A 2YV3A 2IVZA 2SKEA 2HBQA 3MJ4A 1X7DA 1TJNA 3DW1X 5JC1A 1UDAA 3DE6X 1YNOA 4E7PA 4MDFA 4GC9A 1FCJA 4DA8A 3PYLA 4YUYA 2CL0X 2W6ID 3QGMA 4PYMA 2ZU0C 2C2WA 5IYZB 3I5MA 3K0CA 3LBNA 4C1NA 4DT1B 3W5JA 4Q00A 1P6XA 1PBNA 3FSGD 1NUAA 2K4MA 3PFBA 3LY9A 1G55A 4US1R 5ALPA 3ZDFA 4WZAE 2FFQA 1AGYA 1H2AS 1DWPA 2K7FA 4WCFC 1Q22A 4DUPA 1VRCA 3QOYA 1AV7A 2AQKA 4IYJA 2GAAA 2W2VA 1KMCA 4FOSA 1EESA 4AY3A 3UMVA 1KQOA 3KJIA 3FYHA 3SFZA 4KQKA 2O8DA 1JPJA 4E15A 3IULA 1JW9B 2YDYA 1SQSA 2VDJA 1AU9A 2AUNA 3R3XA 2JZNA 2X0FA 2OCLA 4JXJA 4RWZA 2AFVA 5EIBC 2IDKA 3AVQA 1O96B 1AQ6A 2GRAA 3HMQA 5SYAA 1EBBA 2CK3D 3CGWA 5DM1A 3W6UA 4DRZA 1WXHA 1T4CA 1X94A 4IDDA 5HDQA 4BLPA 4EY6A 5T7BA 2WD8A 2NMVA 4LSWA 3P1JA 3AOEA 1PR6A 1YR9A 4MQUA 2O2XA 3K09A 1KBOA 4TXLA 1QAOA 4J7XA 4DKXA 3HVRA 3RE1A 3PIIA 4FYKA 4R16A 5BW4A 1MJGA 1CZUA 2XY4A 2ILVA 4TTJA 5B6IA 4FMPA 3LFHA 3KR2A 5LSAA 2PZMA 1M83A 3EUWA 1MNAA 4FYJA 3GO4A 3KDAA 4ZVRA 3N7TA 1JEQA 1QH9A 4G4IA 4W5TA 3LT2A 3O3MB 4EB3A 3E3OA 2A0UA 3BXEA 3I9V6 4TTTS 1V1MA 3K1JA 3MJTA 1WE2A 2HTEA 2ZE6A 3N76A 3VBEA 1ZOIA 1IBMB 2PPLA 4HLQB 3RSOA 5HRAA 2BN4A 4K8OA 1JG6A 1EFAA 3GEPA 5JAOA 3AHIA 3H86A 1IRIA 3PQEA 3R5SA 1NRJB 3I30X 1Q5PA 2VXCA 3EDQA 2V9CA 2W42A 1T1JA 4A0GA 4FPXA 4OI4A 1FQKA 3K15A 4R05A 1W4AA 2O20A 3GG2A 2Q6TA 3B8EA 3F67A 4HAUA 2NAFA 1N6IA 1XTJA 1IN8A 4O4JF 3DBIA 3OPMA 1P5HA 2W93A 1L5KA 3MB5A 5DCWA 5B3JC 5COAA 4G23A 4RCYA 5KOYA 2NTYC 3K3PA 3RC8A 3VUEA 4EQ6B 6YASA 4NCAA 1TUBA 4O4HA 1OVGA 3CPEA 4XB2A 4Y1FA 4EMTA 4LJ4A 5FWYA 2NO5A 5BR7A 3NNDA 4RNDB 1PDVA 1ICEA 1RZ3A 1VSUA 2D06A 2OCYC 3QLTA 4GBMA 4NAVA 2I29A 3PX7A 2VVTA 1SCNE 2WWIA 1CUJA 1HI9A 1LBTA 1NYTA 2QQEA 3CWZA 1QFYA 2HHHB 2AW5A 1USWA 4NQRA 3G2LA 4QBHA 3UCXA 4CN9A 3IQEA 2VP5A 4NDAA 1L4KA 3TM5A 3RRBA 3ZLTA 4CEHA 3GFVA 2ECPA 5KTOA 5TPWA 2IPXA 3FI9A 3JQAA 1JA1A 1VQ1A 3STWA 1N2GA 3F7TA 3HCAA 3E9QA 3SZ3A 3V8EA 1FQJA 2VUUA 3CUSA 3X1XA 2REXB 2CMHA 2HWWA 1I2ZA 2NTJA 3T4XA 4FMCF 2VQDA 4BZWA 3KR1A 4QYMA 1ZY2A 3FVVA 1SXHA 2JASA 2J0UA 4X1KA 3MJRA 3WR5A 5IDQA 1YA8A 1AE1A 5BSRA 1JSLA 4YDHB 3MM4A 1RC1A 4EA7A 4GM1A 721PA 2QORA 2ZB8A 4IDGA 1N8SA 1B4DA 3X2SA 3HXQA 4MRPA 1MN6A 2PX5A 2WUDA 3EOAI 5IZCC 4YV0A 3VR5H 1QH1B 2PS9A 2JJ1A 3WKDA 4BXOB 5EEGA 1WNFA 1GCUA 2Q28A 1T3TA 2Q8NA 2XODA 4KO2S 4X97A 3G9TA 4N47A 1U3WA 4UCXA 2P5SA 2QVYX 1K27A 3TW8B 1AJEA 3RT1A 1AQIA 2J09A 2E4AA 4IXTA 4IZHA 3WYEA 4NJOA 3AI1A 4KR3A 1P3Y1 3EGWA 4WXPA 1GUYA 2VRCA 2PDAA 2YMPA 3HUFA 4NIMA 4RA9A 2VNAA 2FLKA 5B3LA 1KJZA 4PAOA 1XEFA 4EA6A 4S1NA 4L8GA 3GDGA 3RSCA 3FPKA 4DN6A 1QTRA 1RSZA 3AR8A 2Q9CA 2JBAB 1SPXA 1LRJA 4KZKA 2QJTA 5DI3B 1OC2A 2QL6A 2XQIA 4G1VA 3LQFA 4LYYA 1S4MA 3U80A 4FB5A 5DTEA 5KYWB 5C52B 2J4DA 4O1HA 3UY4A 5AXDA 2YV4A 3GX1A 3JV7A 4TWIA 3TJRA 3FLBA 2VQSA 3FA2A 1DC5A 2LWIA 2ZYAA 1W36D 4HGYA 5ITSA 5L6MB 1XD9A 3KR0A 4NU5A 2CXPA 1PQPA 3MD9A 3PRHA 4D0GA 1L5MA 1ZM7A 3INYA 1QLWA 4JJ6A 4BO9A 2BTOA 1GGNA 4U00A 1VCMA 1O58A 3IALA 2HYIC 4LRXA 1G3MA 5T8KC 8ATCA 1K6IA 4KJZA 3I8SA 3NWBA 1W5BA 4K88A 3GMIA 2V1XA 4N5IX 4XYEA 1LB1B 1EWTA 2NV2B 2ZQZA 2IXFA 3C7KA 1IPEA 3RS7A 1PZXA 3ILVA 2XHZA 1PW5A 2RG1A 1HT3A 3O7WA 3RS3A 1L3IA 2CFRA 5DWQA 3QBVA 2DH6A 5J5CA 1PZNA 2QGZA 5EZYB 2L69A 1YOBA 3LC0A 3I6ZA 3N6RA 1STOA 4DCOA 5LP1A 1L3BA 2K87A 2H1HA 3EVZA 2EATA 3OZRA 4PAGA 4QYWA 3SE7A 3R6GA 4YMLA 5ICFA 1LW7A 1L7PA 1QK4A 2XRMA 2GCOB 3BXGA 3EGXA 3QXSA 4KAJA 1X6VA 5G4LA 4E1AA 4F91B 5KWVA 2VHTA 5LYJF 1H6AA 3MTIA 4OOFA 2Y0PA 1JEYB 4WFQA 1SZPA 4E09A 2DJ5A 1DT5A 1HZZC 4GD3Q 5GOTA 1KYZA 1ORRA 5BT9A 1JDSA 4IF4A 4MVJG 3MELA 4BO0A 1UK9A 3GPCA 4ZU3A 4IX9A 4TS1A 1F06A 4ADSG 2Q6LA 1N0VC 4R1QA 1YS2X 2AEEA 3L3BA 5E2IA 4ZI7B 2P6RA 1YT5A 4PG8A 2NUPB 2XCLA 1LVGA 2QVBA 3OMWA 5DW3A 5EVCA 3AHDA 2GS9A 1P7VA 5KNDH 1G5HA 5DX0A 5B1HA 3RT9A 1I94B 4RTSA 1FS4A 2NZJA 3OLZA 4G4SP 5CDFE 2VF5X 3FPCA 5AJXA 1SXIA 2QD2A 3CJQA 1YQEA 4R8MA 2FZLA 2ECQA 2WVGA 4JT8A 5FYDA 3GOHA 3GXOA 3KELA 4UEKA 3KSUA 4XTRA 4QPZA 2EEPA 2EP7A 2X2PA 4UTRA 3OT5A 1KZ9A 1WB4A 3Q4GA 4XD7D 5TV2A 1WVGA 4EHNA 4DPMA 4B82A 2EFJA 4GNRA 2ZRBA 1KZHA 1T5OA 1E6KA 1YAJA 1VG9B 2D2VA 2FPOA 2FFBA 2ZULA 1GFZA 4JUBA 2F9MA 4N7RA 3PIRA 5I7AA 5JO9A 4A03A 2EWVA 5D7NA 4I9FA 2J6CA 1ABEA 3IEXA 4PPNA 4ZEOA 3M9WA 4TL9A 1ODIA 2QUHA 1UKCA 1TQ4A 3VPGA 2JFOA 1AMNA 3N6XA 3DMTC 1YJBA 3TEMA 1KO1A 4GVLA 4ND4A 4ON9A 4CV3A 3K0FA 2PG3A 2R00A 4DDKA 3SZMA 2IYUA 2YV1A 1SM4A 3MGKA 1QCZA 3IOMA 5E1MA 1X74A 1ZG3A 4PX2A 1D4FA 4I1PA 1DGQA 1W4BA 5KYGA 4D8YA 3L4SO 1NHWA 5K3EA 3QX8A 4UUOA 4HVLA 4QA9A 2Z6VA 1N5OX 3OHSX 3PSHA 2BHNA 2IYWA 3KXIA 1E5LA 3O4JA 4YJGA 3P9NA 1BGXT 4D3SA 1G17A 2AJCA 5IVPA 5B58T 4ZEWA 4KIUA 4LZJA 1R5JA 1R5NA 4PSUA 5I7RA 5EIWA 3R5HA 2ZS7A 2CL5A 2ETXA 3D3WA 2JJ1D 3BMCA 5AVWA 1MVLA 3G2PA 5EMMA 1CR0A 1TQHA 4PZPA 1UPCA 1UJNA 1ULUA 1YTLA 1Z5GA 3PVSA 3L79A 1OC4A 5KHOC 1MB4A 2RAVA 1G20B 1Q1NA 1Z34A 2H2AA 2I6FA 2WDPA 2XMDA 1XTVA 2Z57A 3PTLA 4PQFA 3WE7A 2BKUA 1PQ4A 2DXIA 2WWWA 4IRMA 5DZSA 1Q0RA 1QF7A 1UINA 1YU9A 3QU5A 1ZRSA 2OQRA 2CJFA 5AI8A 2ID8A 4YBZA 1H0RA 3NWPA 4QYXA 1Q7CA 3JQAD 3KJXA 1WUJS 2OM2A 3OZUA 2HY7A 2JGMA 2DHCA 3G3EA 3GFFA 4ZYYA 5FLXA 5HP4A 1Z2DA 3CX3A 1L4UA 5AW6A 3ESXA 2ZR9A 1E5TA 1CVLA 1O5IA 3IXLA 2P2LA 3FTNA 3LOUA 4MQLA 4WA7A 5FUQA 3QENA 4RTJA 4LKOA 1YCGA 4QVKA 3ZDYB 3M1IA 1BAPA 1T34A 2ZRDA 4MAFA 4W9NC 4ESOA 5EJEA 2IHNA 5B3AA 5JT1A 3TZLA 5JBQA 4MHOA 3RK1A 4EFMA 1QGUA 3KL2A 3ANYB 4EMSA 3WLJA 1M0WA 4PNPA 5DYWA 2QQ0A 1Z45A 3CUKA 1Z6PA 5T6BA 3SXUA 3T1NA 4B3FX 2BHLA 5KYXA 3KPWA 1K9SA 5EKUA 4G41A 4CTMA 5A4KA 3HUTA 3KDPA 5D5QA 2FMIA 4G81A 1R88A 4NEQA 4QPDA 3E3AA 3OP4A 4HVCA 5ISMA 1XTIA 2DQZA 3D4OA 1YZUA 2FXIA 4AAYA 4D8TA 1QF6A 2WSIA 3A9CA 3BEOA 5K5EA 3LL7A 3GVHA 4F6LA 1UR5A 1FBNA 3P27A 4HDNB 3AETA 5HBRA 5K0NA 4BDTA 3KAKA 4IWNA 2XGMA 1P5RA 4NZ9A 2VT6A 1C2YA 1OTXA 3EY4A 3MPOA 4BB0A 1LX6A 3Q9SA 2PUDA 2XBMA 3QUBA 4AZ3B 1DKPA 1NVEA 3G85A 2PQMA 1PKEA 2QTRA 3PPXA 3OQ1A 5EWMB 2OOSA 2WJVA 2XB2A 2VHWA 2WJZB 4ROSA 5I48A 4BKMA 2W0MA 3AKDA 3AL0C 1BYIA 5FR1A 2BUCA 3GLIB 1R12A 3KJQA 2OFPA 1TKCA 4NOJA 4ZV7A 1S8FA 1XU4A 4MS1B 3EGDA 5HMLA 1FNBA 3STYA 4JYZA 1CUGA 3T1HB 4N5NA 1B0AA 2Y4OA 1J9EA 2EBWA 2VSFA 3GCDA 4E5VA 1WB5A 4EPWA 3QVSA 1YKGA 4GZLA 4UBMA 1P0QA 4JBIA 1LDMA 2GR9A 3NASA 2BGTA 3O74A 1FYEA 3FCEA 1H65A 3CNEA 3EXG1 1E2GA 1HQYE 2WUFA 5I8PA 2O52A 1C8LA 3PFFA 2Q5OA 4KPFC 2WG2A 3MUEA 4X24A 1W0KD 4F84A 2RJ3A 3PNMA 3HPQA 2Y9PB 3HDGA 3ORYA 2OXIA 3UUFA 2ZVJA 5EJ2A 3U3DA 4AY5A 1Y1SA 5JWRA 2W2LD 1D8AA 3ZN2A 3QMWA 5KTRA 3RVSA 3TLBA 1FXSA 3PNOA 3D7LA 4G5QA 4JYAB 3SC4A 1NONA 1BS9A 3HYCA 2O2JA 5CITA 4L15A 1HFWA 2JVIA 2NUPA 4B3JA 2WKRA 2Q1WA 4NENA 1ML4A 4QTTB 3EQZA 2IL1A 1C50A 2GJ9A 4UEJA 3WYBA 3KLNA 1RZVA 2V74B 3UWMA 2V54A 1EZ4A 1D2HA 1XZLA 3JZDA 4JNCA 3WA6A 1U8CB 4G0NA 3RU9A 5F7XA 4JQYA 3MA0A 3PGMA 4R2HA 2I34A 5C7LO 2JFYA 2NV6A 4PYIA 5DCLA 3ZZMA 1NN1A 4RY9A 3PDUA 1BHJA 3DWIA 4O5AA 2C61A 3OFVA 3PDJA 4KKVA 5IX8A 3IQFA 3ZGNA 3DZGA 1IHUA 2CZCA 2Q5FA 5KI6A 5A3VA 1JEQB 3UWSA 4BNUA 1Z62A 2I66A 5LZ9A 2IE0A 3EUFA 1KXZA 3ICVA 5FOTA 1VBMA 4LIPD 1N3YA 2XSZD 1U04A 2Y1XA 1XI2A 3C5VA 3L40A 4WJKB 3EFEA 3TRHA 4QYSA 1AGXA 4QX6A 1H42A 3PFGA 3PDIA 4PLTA 2C83A 4WFJA 3CLKA 3ZGOA 8AT1A 1Q77A 2KB0A 4WERA 4UOQA 4J1TA 1BFUA 2ADOA 5FL7D 1NP6A 4YRKA 1GZSA 1U7ZA 2WLSA 1IHPA 1CERA 4E51A 2D5CA 5AW0A 2GM4A 4UZEA 3GROA 5IUJC 3P9KA 4WLFA 5BSMA 4JLNA 4IEIA 4P36A 3TM4A 5IAOA 3RC7A 4NABA 3M33A 4QELA 3PD0A 2CNWA 3FVTA 2QN3A 4MMXB 3AF2A 1I10A 2H16A 3ZQKA 5CG2A 1PZEA 3T3MB 3VBCA 4E1VA 1P29A 4WESA 1E3LA 3GLTA 1G4AE 2P2NA 3I9LA 3PQCA 5AVRA 1NN5A 4DY4A 3AF1A 1DRKA 5IDVA 3EMDA 1JH8A 4R7GA 3RJ9A 2GZSA 1GITA 1E59A 4BNGA 1JDUA 1I3CA 4R9VA 4V03A 1RQXA 3USCS 4JWTA 2WUEA 3OE7D 3AU9A 1SUDA 3FCCA 1U8EA 5JAZA 3LKZA 2AQIA 5BVGA 5K8TA 3FCYA 1N0IA 1ZGAA 4G0PA 1K6JA 4BNNA 4NS1A 3GJ7A 4OK3A 3AEXA 3OO0A 4NOKA 3TNFA 5HRCA 4JKIA 1HOXA 1U8UA 5DX1A 2LDBA 4FT4A 3GAFA 4YUAA 1GNTA 5LDHA 1CVRA 1RXYA 1SG9A 1MX9A 1YHZA 2DUJA 2OCPA 5ALMA 1CRQA 2J5RA 1G9TA 4GZMA 3RV4A 4WLOA 2YBDA 1G7CA 3BVPA 3GRCA 3RUHA 4U7WA 2XCTB 4ARIA 1ZUIA 2Y4NA 1I1OA 3I23A 3M2PA 3H1PA 3AERB 3AUFA 2VJLA 2V5AA 3P7MA 2UXCB 1H8EA 5P21A 2PH7A 4QJ5A 2BHSA 3LYAA 3PG5A 3N2ZB 3PGKA 3R3JA 4U7FA 4UD2A 5F73A 2OY0A 3UG6A 3KAJA 3H2IA 2G7ZA 3BF8A 4OBEA 1JPUA 4Q9AA 1C7IA 5BRAA 2IH4A 2PX4A 1E1CB 4UASA 4FK8A 4FWTA 1E96A 1H4VB 3S2IA 2ANBA 1NYRA 2OB2A 3DVQX 3FKSA 4U0JA 1XDWA 4CCSA 1G20A 4C0WA 4EVRA 3TI9A 4LOKA 2W2KA 1UOQA 1DINA 2CFCA 1ZNZA 1CRLA 2VRWA 4OHMA 1QGDA 5CVEA 5LXTA 2LRHA 4HAVA 2XT9A 2G36A 3C7TA 4H7PA 1KI9A 3ELWA 2WFZA 3OLYA 4TLMB 3NGLA 2GEVA 2RKOA 3NYIA 4D4JA 2EGUA 4FC7A 4IJ6A 1M1YA 4ZQGA 3W2GA 5JXGA 5J2TB 4MUYA 2PWYA 2CFIA 2WJGA 1XN4A 5ALDA 2R9VA 2X1HA 1L5QA 1P6QA 1NNUA 3MWLA 1R50A 3O2QB 3REFA 1XV5A 3GOQA 4OLJA 1H8HD 1U5BB 2OMEA 2UVQA 4P5DA 2C2GA 9ATCA 2HU2A 4MZXA 1YXMA 5BPFA 3RK4A 2CHUA 4OP1A 1ZHFA 3BGVA 3IAXA 1N2XA 2P6PA 1CDEA 2MOKA 4N6GA 4OQQA 4P53A 1MMFB 3UENA 1PV1A 3CZ4A 3VZSA 5K0ZA 3HXMA 2JLWA 1T8SA 1XJ5A 4KE7A 3E5RA 1IOWA 3GRUA 2G1JA 2IEGA 2XVXA 3OHMA 4BECA 1I80A 4RXUA 4DYHA 5C3MA 2MDTA 3I01M 4H3SA 5A5GA 1VSQA 5D3MB 3FAKA 2I7CA 3OQJA 1O95A 3BX1A 1S02A 2IYSA 3N0XA 4ZAZA 4LY9A 3CVVA 2ZRNA 1FW8A 1V3UA 3JYOA 2IFTA 2M1ZA 2YXNA 3LUJA 1FC0A 3CZAA 1J7JA 4JVMA 4MS1A 4RFLA 3U81A 3JQDA 1HDCA 4JBYA 5EHQA 1U3FA 3G2QA 4BLWA 2O0KA 5B58C 3CBGA 5BN3B 8OHMA 1I30A 2BLLA 3BB1A 1F14A 2H1LA 1KZYC 1XDBA 2HCBA 4OHZA 1Z6YA 3EN0A 4PBRA 2IW1A 5BV1A 2P9BA 5KWJA 1A4XA 4JXXA 4RULA 1RJFA 2QX6A 3ZIUA 1ZMTA 1A9ZA 5I7WA 2FP3A 5M29A 1Z28A 4P2GA 1M7GA 3UF0A 1SCIA 4TT3D 4ZU1X 5G0VA 4DLYA 2Y92A 2G40A 1OPRA 4XDHA 3FGNA 4RTMA 3GLQA 1NVKA 1N75A 1X8LA 4O4LB 4TS9A 2EFCB 2YFHA 4GBJA 3BORA 4D45A 4DTCA 3VVBA 4EPVA 1YRAA 2IP2A 2ODAA 1KQNA 2FH5B 2QM8A 1NBMD 1M72A 3WLLA 3CEJA 2O8DB 4HDRA 3A1UA 4LK3A 3A6FA 2X15A 4BWGA 5F98A 3R7AA 5ALLA 1LPOA 5K2OA 2QGFA 2ZRPA 3RIXA 3LT0A 1P80A 4E2YA 3BWBA 2X7JA 4H35A 1HBJA 1G60A 2VHCA 2V7GA 4I1YA 1MHTA 4OHWA 2QTMA 3BD9A 3O1LA 3EEFA 5LP6F 3EIXA 3K0HA 3M5PA 1TQ8A 5FL7A 4OYRA 1BXZA 1RYFA 4DSZA 4JX9A 4OUDA 4DJTA 1SBNE 1ABBA 1PR0A 1YBFA 3IIKA 3X1YA 3G2HA 3HO6A 4X6XA 1X1QA 2NNWB 3PF8A 5A6VA 1XKTA 1V5IA 4ALJA 2B6NA 3D6FA 1JDJA 2XJ9A 3LXXA 4YJKA 4MUEA 3TLEA 1C0LA 1C8KA 2UVPA 4Q7JB 4TYYA 3LPMA 1C1HA 3U4CA 4F4IA 1HEYA 1PHPA 4NBKA 1NU6A 3EEYA 3M9LA 4QTZA 1OXVA 4PAWA 3R7SA 4RTPA 1UBLS 3COZA 5HJ5A 2DAPA 3O84A 1RM3A 2KW5A 5LWQA 2WHYA 1GAJA 2JGDB 4L3VA 3ZJ5A 4MR8A 3RTBA 2B1IA 1YZNA 1I01A 5LP6C 3V1UA 2VXBA 2JATA 2PXAA 4G2TA 4UEOA 5EXSA 5IC6A 4PN7A 3A1NA 2Q7OE 4CHGA 1P3DA 4V1CA 2Z43A 1MC4A 3W9BA 5DSXA 5FBWB 3Q6MA 4GSLA 5H80A 4OATA 2OK8A 1WTAA 1DG9A 2D13A 4URWR 3WADA 4BIMA 4DCMA 5IYZF 3PCXA 1IN5A 2BJWA 3E6AA 2X5XA 3ESBA 4K03A 4QM7A 1DQYA 3QXXA 3HDTA 1YGYA 3E53A 3HSKA 4QE3A 2ZI3A 3VHXA 3DXZA 4IIJF 4UQLA 1LZKA 2GF0A 1P4JA 1GGEA 2A8YA 4CR6A 4UTOA 5CH8A 5JHGB 2W8ZA 3NAGA 5JSHA 2OZEA 2JI4A 1KRHA 4PNZA 3T5CA 3H83A 3RQSA 5KZMB 3DC7A 4UNPA 4J43A 1H0HA 3DMFA 1U4NA 3WKCA 4GMFA 3P2YA 4DCVA 3EY9A 4EY8A 2A88A 4CBVA 4N7MA 1JIIA 3SHOA 2YOFA 4XVQA 5KKNB 1BE1A 2ACVA 2P9TA 3KT3A 1LI5A 4MR9A 1EJ0A 5CP8A 1CP3A 5DN6A 4QDZA 1MR3F 1MNQA 4RO0A 2XPCA 4UATA 2OHHA 3UH1A 1M1ZA 4FOLA 2AJDA 2W37A 5IDWA 1Z6TA 3BFPA 5TXGA 3EIQA 4LOHA 3DQPA 1E6LA 2YZGA 5L3SA 2O8BB 4PLGA 2QUZA 1BW9A 1U0FA 4B75A 1LJ8A 1I13A 4YK7A 4DJJA 3HJGA 1P1RA 3MAAC 2PBRA 1RLIA 4PN3A 2PSHA 1D2NA 5A06A 1P3JA 4X00A 1HQDA 2FW9A 2QRHA 3AR9A 2WJHA 2C82A 1OV6A 3OTHA 1R3DA 4KWHA 4K9DA 3GBVA 4Q21A 4ZEMA 1BU8A 1RI4A 2ZBRA 4AJOA 1AQUA 4U3JB 3F3YA 3HNPA 4YMGA 1L5ZA 4BRZA 4DV4B 4P22A 3VR6D 2IHKA 5JALA 4RABA 4QFCA