3PDJA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with 4,4-disubstituted cyclohexylbenzamide inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
272
structure length
272
Chain Sequence
QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Optimization of Novel 4,4-Disubstituted Cyclohexylbenzamide Derivatives as Potent 11beta-HSD1 Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 101
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pdjA00
3DBHB 5FI5A 4ZN6A 4TZTA 4PLWA 3CMCO 4G65A 4EEZA 1C14A 3JQBA 4BO8A 2ZYDA 3ZZNA 3NT5A 4BO5A 1ISGA 3OA2A 2I3AA 3VKUA 3ONDA 1ZCJA 3LT2A 5A5FA 4UEOA 3PHLA 4EUFA 2GASA 3T7EA 1U2GA 3FHLA 4U6QA 4K26A 1NVMB 3V1UA 3WSWA 3EK2A 1LRKA 4AJHA 3ZHZA 5AVOA 1Q7CA 2FSSA 1TB4A 3MEQA 4A27A 3DZIA 4GVXA 1OC2A 1B7GO 6ADHA 1IHXA 3FN4A 3OBBA 3PVZA 3RVDA 1I2BA 1YXMA 3GHYA 2XPCA 4KDEA 3QW2A 2AG8A 1WDLA 3AOEA 4Z0PA 4II2A 1KEPA 2NU6A 2YUTA 3DZJA 2A94A 5CDSA 3DB2A 2CNBA 1RWBA 1XG5A 1JN0A 2E48A 4YAKA 1E3EA 1QLHA 2HCTA 1HETA 2NTVA 1K89A 2B83A 4K9DA 2YY7A 4YYZA 2NVBA 1DC6A 2OGUA 1YKFA 4EW6A 5I8WA 1UR5A 4RVDA 4MVJI 1BXZA 1NR7A 1MLDA 3PP8A 3GGOA 2X9VA 3FWZA 2P68A 2CF5A 1ZNQO 1DHRA 3BAZA 2VUSA 3R1IA 1EK5A 2PKQO 3MTJA 3CZRA 5CDYA 1IYZA 1XKQA 4OKIA 5DULA 2B5VA 1B8UA 3W4KA 2EV9A 4FFPA 2EP5A 3RIHA 1Z75A 4CUJA 1IL0A 1DHTA 2GZ1A 3FF4A 2Y93A 3BMNA 2YQ5A 3ETDA 3I23A 1EVJA 1XU9A 3L77A 4MVJD 4NQZA 3IP3A 4NBRA 3WTCA 5DP1A 2BD0A 5A9RA 1K6JA 4IDBA 2Y1FA 1SPXA 4ND1A 4CUKA 3P5SA 3PRJA 1DIAA 4IJVA 3GH3A 3C1AA 1TA4A 4YJHA 3WGOA 3BMNB 2NNLD 2W90A 3S8MA 1HE3A 3HWRA 3OIGA 4J9UE 3PFWO 1ENYA 3EVNA 3WBFA 1GV1A 4YCAA 4E13A 2VT2A 3ZV3A 3DO5A 2YQ4A 1YWGO 1YQXA 3JQ8B 1ZK3A 3HFGA 2ET6A 3WQRA 2OBYA 3QVSA 4HX5A 5LC1A 3ZWOA 4AJ2A 2Q1SA 1KC3A 1H6CA 3OQ6A 4MKZA 2R00C 3F9IA 2W98A 2P4HX 4E12A 1ZXBA 3L4BA 2WM3A 3FWNA 4GSKA 4EYEA 4Y8VA 4U0JA 3KETA 4KUHA 2FR0A 4J4TA 3JYNA 3RUAA 3V2GA 2HK7A 3GZNA 3MJTA 1ULSA 1UJMA 3HDQA 5L9AA 3CSDA 3TFQA 3WJ7A 1NBOA 1L1FA 4NIMA 7ADHA 1EVYA 3AM3A 1I10A 1ULUA 4RO0A 1I3KA 4RQUA 2YDXA 3ST7A 1JWBB 1IY8A 1FJHA 1BXKA 1A4UA 3NDJA 3V1TC 3DXFA 3VVBA 3MOGA 2PD4A 3CH6A 1W6UA 2OP1A 3QA9A 1PJSA 2VN8A 3H8VA 5COQA 4QX6A 3TZCA 2VHVA 3LU1A 1U8XX 3TF5A 4W4TA 3JQDA 4UEKA 1WNTA 4LMRA 4FN4A 1Z82A 5G0TA 1BW9B 3BHJA 3PYXA 4J90A 1YDWA 3RUCA 4TKLA 2D3TA 3M2TA 3PDUA 5KJEA 3KEQA 4J1SA 5JC1A 3FD8A 1R4NB 3GUCA 4IDGA 2RAFA 3VTZA 3CPSA 3WMWA 3HADA 4E5PA 1KY5A 1PJBA 3Q6IA 4RDHA 3IJPA 3RC9A 5L3ZA 3M1LA 5JE8A 1PSDA 4LISA 1AE1A 4R5MA 5KNLA 1Y7TA 5KCZA 5JXWA 5IXYA 2Q49A 2NADA 4O1MA 3VH3A 4N5NA 3GFGA 1EDZA 1I2ZA 3W4IA 5DOZA 2WEKA 1PZHA 2EKPA 3H65A 4GPD1 2CVOA 3TZ6A 1LLUA 3UCXA 3DTYA 2C82A 3K31A 1E7MA 4GLLA 2EIHA 3PJDA 1NX6A 2HRZA 2OO5A 4GX5A 4WGGA 5BNTA 3JQEA 5JAIA 2HJSA 3GDFA 4BOYA 4R1SA 2Q1UA 5B37A 1I8TA 1PZFA 3L4SO 5B1YA 2UV8A 3VOSA 1N5DA 2HK9A 3N7UA 1SB8A 2D5AA 2NSDA 3C85A 1CJCA 1HF3A 1XR3A 2P2SA 1IULA 4CM8B 3VPHA 4Z3KA 1GFSA 5CPBA 3IL2A 3ROPA 3JQAA 1YL7A 4OXKA 1C1XB 4INAA 5F5NA 3D0OA 5CP8A 4PLPA 3OF2A 4RV9A 3GHHA 2Y1OA 3CUKA 5C7OO 3UGKA 1IHYA 2X22A 2E6UX 2HMTA 1N1GA 1R0KA 4ND4A 5TF4A 4HADA 1DXYA 1LDGA 2GN4A 2VWPA 1F14A 4LRSB 3AFMA 3O8QB 3E9QA 5F3RA 5A05A 1Z6ZA 4BKRA 1WZIA 3UXYA 3I9NA 4KUGA 4MVJG 3TSCA 2P9CA 4NJMA 2HU2A 4KQWA 3ZWVA 5A3VA 2WYWA 4WPGA 3NAQA 2AHRA 3L6OO 4KTTE 4XX0A 4L4SA 4QTZA 1YE3A 2AEFA 2FHSA 1JVBA 2POQX 3QV1A 3JQGB 1AXEA 1E1LA 4O59O 3DMYA 2C5EA 3I83A 4OOEA 2ZQYA 4QFCA 4E0BA 5BSFA 4E21A 3LDHA 1ZXLA 3RJ9A 3TFOA 4AG3A 5KJ1A 3IAHA 3WLFA 5IZCA 4YAIA 3LC2O 3AI2A 3WNVA 2V7PA 2JFGA 1LXCA 5LCXA 2C7GA 3DBLA 4MIEA 1OZAA 5EIOA 1EUDA 1B15A 2IXBA 4YRBA 3OSUA 1B16A 4JJFA 4OQZA 3L9XA 1WZEA 1PJCA 1NVGA 4DMMA 2B69A 4NJMB 3VZPA 1N92A 1UUFA 2WD7A 3NDIA 1HT0A 1R66A 2VYND 1W73A 3DDNA 4NI5A 1G6KA 3BTOA 1IPFA 3QY9A 3DAGA 1H2BA 1ARZA 2V6FA 3KTDA 2HLPA 4QO8A 3KV3O 1ONOA 3GK3A 4N5LA 4JGBA 1NFFA 4BMNA 4C4OA 4FJ2A 2CF6A 1Q0LA 1D7OA 1RYDA 3CIFA 1TT5A 4ZRMA 5L7WA 3D3WB 4KWHA 3FR7A 3HQ4O 4BNLA 3HSKA 4CLDA 1NQTA 2BGLA 4Y6SA 3U4HA 2CDCA 2PK3A 2UYYA 4F3YA 2GERA 4RF4A 4ZQBA 1HDXA 5J23A 4WK6A 5F1KA 2PLAA 5C7LO 1T4BA 4NZ9A 2O3SA 5U9CA 4PG4A 1NP3A 1SOVA 3FNGA 3FR8A 3KSUA 1E6UA 3WB9A 3WBBA 3L9WA 3WICA 4LSMA 4MKXA 4LSWA 4W7IA 5IZCC 4Q3AA 1N7GA 4JNKA 5JDCC 3W6UA 2VWGA 1KVQA 4PG5A 1ADGA 2PV7A 4B4OA 2Q45A 3GQVA 3IS3A 3KB6A 4BNVA 4LW8A 2O3TA 4UUPA 1LDNA 5HS4A 2VHZA 5I9MA 4PVDA 4DUPA 3BTUA 3LF1A 5JYEA 3GY0A 3RBZA 2OXIA 2HUNA 4YT2A 4B7CA 4R1UA 4UEJA 4BQPA 4ALNA 2WE7A 2WSBA 3GZNB 3JV7A 3LT4A 4CLRB 4JP3A 4R5HA 4HFJA 4PG6A 5FYDA 4EEXA 5K6AA 4OAQA 1PS8A 1ZK0A 4BV8A 3U5TA 3A06A 3ZWAA 3E9NA 2DFVA 3M6IA 1GYQA 2AE1A 1Q7BA 1Y9EA 4NJOA 5EINA 3TZQA 5MDHA 3BHIA 3WFIA 4CM7A 1O9BA 1U9JA 1GCUA 2FPIA 4GAEA 1BMDA 5ILOA 3SC4A 1FXSA 1HDYA 1QG6A 3DOOA 2DBZA 1P9LA 2BRUA 1GYRA 1HLPA 1X7GA 4XIJA 1SB9A 1GAEO 1R4NA 4OGWA 4YJHB 2YFQA 1H6BA 1H94A 4N7RA 2J3JA 3T4XA 2Q2QA 1XSEA 1NVTA 2PH5A 5EMHA 2EGHA 2A9FA 1PIWA 4W82A 2IZ0A 3V8BA 5KVCA 2EKLA 1ONNA 2G76A 1Z7EA 2VYVA 1A27A 3D1LA 4HXYA 4IS2A 3SLKA 5TT0A 5JDCA 4NH4A 1XEAA 5ENVA 5JCJD 3LC7O 1E3SA 5KVVA 1ZMOA 3JQ7B 4GWKA 1ZBQA 1BXGA 2EEZA 2XAAA 3SC6A 1ISFA 3HDYA 5JAZA 4PIVA 3BMQA 1YRLA 3TRIA 4CLEA 1GY8A 5A9SB 1DPGA 2O7SA 3AUSA 7MDHA 3HN2A 5DNAA 4ZJUA 3TOXA 4D44A 5DOVA 3C3XA 4MVJP 3AY6A 1B26A 4CM4B 1ZJZA 1GTMA 2AEJA 5I7EA 1PS0A 5FI3A 1ID1A 1LLDA 1P44A 1VJ0A 3GNQA 3NX4A 4PCVA 5EL0A 3FNFA 4DXHA 1SC6A 4O63O 5DZSA 3R0IA 3C7DB 4GLOA 3MJ4A 1BW9A 3DMTA 3OETA 4DYVA 2OHXA 4NU5A 4NFYA 1N9GA 3QVTA 3NYWA 4GKVA 2V6BA 4JQCA 4OQYA 2HMSA 5JDIC 3GF4A 2JHFA 3DAFA 3WIDA 1LSJA 4OSPA 4GH5A 5A04A 1E7WA 2BGMA 4CM9A 4YT5A 4XGIA 1XQ6A 1DLIA 4YT8A 1P1RA 2VNSA 4PG7A 1EE9A 1Y8RB 3RUFA 4IXTA 3ZHXA 1X1EA 2YV3A 1WMBA 2DC1A 3AUUA 5IN4A 3H2SA 2OFPA 1OBFO 2BFOA 3B20A 5CDGA 1K3TA 1D1SA 1E7SA 1KVSA 2I66A 2P5UA 2CFCA 1P1IA 4GGPA 1VM6A 1Y8QB 4RPKA 4RF5A 2Y99A 1E3JA 2I76A 1OI7A 4CMHA 1YJ8A 2ZJ0A 3MJSA 1GL3A 4GWGA 4MIOA 4WOJA 5G0VA 3TNLA 4WUVA 2AE2A 1E3LA 3D5QA 1DAPA 3O03A 4QUKA 5ER6A 2Q3EA 2NTNA 1BXGB 1HDGO 1EFKA 3GNTA 4LCJA 4DC1A 1DEHA 4BIIA 3PIDA 2X0NA 3GN2A 4QXMA 4BO7A 1QYWA 1FDWA 2HSDA 2D8AA 2D0IA 4I8XA 2NUAA 2X4GA 2GD1O 4E6PA 4M8SA 2XF8A 3F6YA 3Q3CA 1QV7A 5L7TA 2WDZA 3DMTC 3JD4A 1R4MA 3AY3A 1GYPA 1JQBA 2Q4EA 2DTEA 4J6FA 4CM4A 4KZPA 1N8KA 1DFGA 1F06A 1R6DA 4FS3A 4K6FA 4WLNA 4DLBA 1EDOA 3RBXA 4WLVA 1GPJA 3GVHA 1HDOA 2WMDA 1K6IA 3INRA 4F6CA 4D0SA 3BMOA 5HM8A 4WLFA 1LRJA 3H5NA 3I9KA 2PY6A 2ZYGA 2QRKA 4FFNA 4J7CA 1VL6A 3TPCA 4JX8A 5EQDA 4CMIB 4U5QA 5ILGA 2IE0A 3RC1A 4J0EA 1N7HA 4EUHA 3PTZA 4ZGWA 2UUOA 2AQ8A 4MIYA 2FWMX 4YPOA 4CPDA 2B35A 3GDGA 3WLEA 1VC2A 4EJ0A 4YWJA 3U3XA 1B3RA 4O5OA 2C07A 4FFOA 4U8GA 3AJRA 4IMPA 1SZJG 2R2GA 4E2XA 5CG1A 1SNYA 2VYNA 1A4IA 4LCEA 4Q3NA 3RUHA 4Z6KA 3ETEA 4CMGA 4XGKA 3H4VA 1HRDA 1JAYA 4N18A 2JAHA 5U4QA 1WDMA 2W2KA 4HBGA 2FY8A 2NVUB 4DREA 3M2PA 5FEUA 1YGYA 4NBWA 1EUCA 1YO6A 1MXFA 1AUPA 2AW5A 4UUMA 1OC4A 1LC0A 5C7IO 3NEPX 3IIEA 1DFHA 4WKGA 4QECA 3X2EA 3OJFA 1HLDA 3PFFA 4DVJA 3RAJA 2IDZA 1N9GB 1Y1PA 5COBA 3NJ4A 1HE4A 1HYEA 1VLLA 4AJ1A 4EITA 4FGWA 2FN7A 5IZ4A 1S6YA 4GMGA 3ZN2A 3BA1A 2R6JA 4P8RA 3EMKA 4ZQGA 2ZK7A 5JCJA 1EMDA 1E3WB 3SJUA 3A9WA 1OOEA 5GY7A 3ZNOA 2JFFA 3MOIA 4ONEA 3GG2A 4R01A 3H9GA 4NHEA 1YQGA 2I6TA 3ZV4A 4BNUA 5IDXA 2DU8A 3A4VA 4A5OA 3MJVA 2B4RO 5GZ1A 1WW8A 2VYVD 5KKCA 2BFAA 4RVFA 3QVXA 3E1KA 3OEYA 3GZ4A 3UCFA 1FDTA 3RI3A 3VH1A 2BH9A 5JY1A 5KJFA 2DTDA 1Z73A 2NM0A 3PZRA 4NU6A 4F46A 1M6WA 5GMOA 2EGGA 3NTRA 4X54A 3FTPA 5I9NA 4EBFA 4IINA 3WWZA 1E6EA 3VAZA 4BO4A 1KBZA 4RGBA 1PR9A 1MC4A 4TKMA 2QRJA 5CFZA 3ZW8A 1P0FA 1MV8A 4A0SA 2IODA 1TLTA 5C5IA 1WVGA 1LLCA 4P4NA 1C0LA 3W6ZA 5DBFA 2PZJA 4ZRNA 2I67A 1O94A 4BS9A 1XGKA 1UXHA 1R0SA 5TT1A 3AK4A 2JD1A 3GMSA 4E33A 3BMCB 4FPXA 1YOVB 1B2LA 2Y66A 4BNKA 2OUIA 2RHCA 4A2CA 4CMKA 5JCXA 1P74A 1QR6A 4XR4A 2Q1TA 3HZZA 3RASA 4UVDA 5G4KA 1DLJA 4JJIA 1C3VA 4CMBA 1SEPA 3ZWXA 1D4FA 3ITKA 3RUIA 1EVIA 2QX7A 2XXJA 3LC1O 4PLYA 4RPHA 1AN9A 2NTJA 3AUTA 3B1KA 2Q99A 3QIVA 4D41A 1I33A 1LX6A 3HHPA 3AOGA 2GLXA 1TI7A 2YHIA 3C1OA 4GKBA 3CMMA 3PWKA 3F5QA 3QJ5A 3I3OA 4WE3A 2VRCD 4JCOA 4TVBA 5BSEA 4M1QA 4BNWA 1PQWA 2F00A 3HNPA 3JD3A 4IDAA 3PZBA 1JKFA 3L07A 8LDHA 1C1XA 3LZ6A 2DLDA 3H5AA 4B8ZA 1DAOA 4FOOA 3PK0A 5IXSA 1RM4A 4MVJE 5C3MA 3WNQA 2AQHA 2YV2A 3CKYA 3GG9A 6LDHA 4J3FA 3F1LA 3HB5X 5ADHA 3ZHBA 2E49A 1X14A 4E30A 1GDHA 4XWYA 3H9JA 3PI7A 4ND5A 4I1IA 3FPLA 4CR6A 1EQ2A 1ISHA 3PHIA 1R0LA 4DLAA 1NASA 1WAMA 4WLOA 3IUSA 1U5CA 3EZLA 1C0PA 4I5DA 3PYLA 2FOIA 3INGA 3RKRA 1P1HA 2YJZA 1FF9A 1HSZA 4IJUA 3D4NA 4Y67A 2GR9A 3D3WA 2VTEA 2B0JA 2B5WA 4AJJA 4Q3CA 3U49A 3S2GA 4YAGA 4K28A 2Q4BA 3CINA 5AQ1A 3KYBA 1TXGA 3EY4A 4ZA2A 4W99A 1Y9AA 4Y6PA 3WGYA 4Y98A 1A9YA 1OAAA 3U4CA 2FRDA 5JMPA 1KIFA 2QRLA 3ANNA 4HUJA 4L4XA 2WD8A 2C2XA 3BMQB 1PL8A 3RROA 3MJCA 4D7AA 1PGJA 2QZ9A 3HG7A 3H5RA 5TSDA 4IIVA 3DZFA 3MCVA 4PRLA 4L74A 4FCCA 1J49A 4OHUA 4RPJA 4TRMA 3FRJA 4ZQHA 4BNNA 4RDIA 2W2LD 2YFHA 1BRMA 2BLLA 4D79A 4PG8A 3JCZA 1JW9B 2UDPA 4IZHA 4E3ZA 1R16A 1YBAA 5DN9A 4CV1A 1M66A 5G2OA 3PWZA 3O9ZA 4L0QA 2Y0CA 4J2OA 1D3AA 1Q0HA 1ENZA 2GN6A 3P2YA 4P4LA 4Q39A 3SBOA 3ZWPA 1YDEA 5T6BA 2Y1CA 4BGIA 4GQAA 4AJLA 1LQUA 5CAEA 3ZU2A 4DBZA 2AQKA 2X5OA 3KZVA 4JBHA 3PHGA 3I4FA 1GUFA 4BNJA 1ZVMA 2HMUA 1ISJA 1HE5A 3SVTA 3H9QA 3ENNA 3VPFA 2IRWA 3WGZA 5I7FA 4URFA 1VE9A 3QWBA 2O3UA 2NU8A 1H9BA 2YW9A 3I52A 5TJ9A 3INTA 1D8AA 2PD6A 2A4KA 3DZKA 4AJPA 3ANMA 3KSZO 3H2ZA 3NKLA 4MKRA 3ZGYA 1SO8A 1MUUA 4G81A 3LVFO 1W8DA 3GOHA 1P31A 3UAGA 4IGFA 1HL3A 2ZTVA 4O6VA 1YB4A 5G0UA 2V65A 3RD5A 2JFHA 4U7WA 2PWZA 4BL5A 4NPCA 1E1MA 2I3GA 1HE2A 1PQUA 1XU7A 1HYHA 1I3NA 2NLOA 4M89A 5DP2A 4UVGA 3JYOA 1J5PA 4PZEA 4YACA 3WYEA 3QRWA 5KKAA 4I08A 3AW9A 5JC8A 1M6HA 3WMXA 2JD2A 3I1JA 5ITWA 5C37A 1XWFA 3KXDA 2VHXA 3KOUA 4OH1A 3OJOA 1LA2A 1NHGA 4YVFA 3S2IA 2DKNA 1HZJA 4UUOA 2FPPA 4XRRA 4XYLA 4M87A 2TMDA 2QZZA 4RPGA 3RBVA 4B4UA 4O0LA 5KWEA 4HNHA 1O0SA 1G0NA 2DBVO 3HFSA 4DL9A 4NG5A 2Q2VA 4NMHA 2J5KA 1Y5RA 1TT5B 4LVUA 2BI7A 1LDYA 2VT3A 2VRCA 4ND3A 4S1VA 3DHEA 1DFIA 3ZWYA 4BNGA 2NACA 3PQEA 2BF7A 3KYDB 4MVJH 3H6KA 5CDUA 1C1DA 3WQSB 2HRBA 1ZSVA 1IPEA 1JTVA 1O95A 1YONA 1XELA 1ORRA 4YJGA 3NDRA 2ZKLA 3ONFA 3GFBA 3RU9A 3S55A 1NWHA 5TX7A 2J8ZA 2PZKA 4FJ0A 5KVQA 2X5KO 1Z74A 1ZKMA 3KM0A 2X58A 1LBEA 4N5MA 4DIOA 5CPFA 3JQBC 4IUYA 5EESA 2RH8A 1KOLA 3A1NA 1LDBA 3DOCA 4I5FA 4WOKA 4AJEA 2AQIA 2I99A 2ZIZA 3E82A 3K92A 3QVOA 4I9UA 5BNIA 1ONPA 3GDOA 3K5PA 4E2ZA 4LK3A 1YL5A 3BXXA 4BNYA 1BTOA 2NU9A 1WDKA 4DQVA 4CV3A 2JAPA 1SAYA 3WFJA 4CL8A 4R54A 1I3LA 1DIHA 1V9LA 1X13A 3H3FA 3ZDFA 2PZLA 4ZHSA 1V3TA 2PFGA 1HZZA 2P4QA 2AG5A 5FWNA 4ZD6A 4E5KA 3DFUA 3K73O 1V6AA 2JCXA 2AA3A 1GU7A 4KTVE 4ALMA 4HP8A 1QYXA 2HO5A 5DCWA 4Z0HO 3V2HA 4ESOA 2OBNA 4DMLA 4FOSA 3ZW9A 1PGQA 1M67A 3NUGA 5IDQA 4IDDA 2C59A 5JNLA 1Q0QA 1XIVA 1MX3A 1NPTO 4QQRA 5AXDA 1B8VA 2IYPA 2QHXA 1GZ6A 1L7DA 2GPTA 4TRJA 1F12A 2WTBA 1U7HA 3B1FA 3NRCA 2O4UX 1P45A 3PYMA 1YOVA 2CDAA 3QQPA 5JS6A 3LLSA 2QQ5A 2Y1EA 3ZU4A 2ILTA 3A14A 1CIVA 3I9LA 2QIOA 4YR9A 3H7AA 4CQMD 4E5NA 1BVRA 3RU7A 2J5QA 3B1JA 5LDHA 3ZNQA 4CMAA 4CMJA 1DB3A 3P19A 3ZHYA 3RJ5A 3IKTA 2BHLA 3QHAA 4HFRA 3FI9A 3SEFA 1J6UA 3JQAD 5ITVA 1GQQA 4PLFA 5GZ3A 1PJ4A 3JQ7A 1I5RA 2O23A 3C8MA 4RLSA 4CLOB 2E82A 2LDBA 5F5LA 2IZZA 3ZCXA 2G1UA 3WSVA 4FGSA 1U3VA 4XQEA 1E0DA 8ADHA 1VKNA 4FC7A 3STHA 4CMIA 3RQSA 1I3MA 4H15A 4II3A 4UAGA 1DIBA 3SX2A 2ZCVA 2HDHA 3TJRA 3UVEA 2A92A 4B8WA 5IG2A 3IJRA 1LSUA 2B4TO 4XYEA 1FMCA 4YJFA 1M75A 5A02A 1E3WA 4D46A 1R4MB 1Q2XA 1ADFA 3RC7A 1UDAA 1I32A 4WCDA 4XB1A 1BHSA 1JA9A 3NGXA 4C7JA 3S2EA 4I9NA 3BYZA 3RSHA 2OOSA 1XDWA 3GPDG 1JAXA 1U4OA 2IYOA 2UVDA 3COSA 1MG5A 1QV6A 2FR1A 4R68A 2EG9A 1X0VA 1BDBA 3OMLA 3U09A 4CLOA 1OFGA 3WWYA 4CQMB 3G1UA 5IDWA 4S3MA 3EHEA 3KLPX 3P7MA 1NR1A 3IQDB 2CD9A 1NWCA 2GNAA 4GX0A 2X0JA 5A06A 4H16A 3KLMX 4CLRA 2C0CA 3Q9NA 2EJVA 4A03A 4B3JA 4NBVA 4RZHA 4UVIA 3VKVA 5T57A 4R4JA 1H6DA 3AWDA 1VJTA 3RFTA 3WS7A 3ZV5A 2W2LA 2EWMA 3L6EA 4IY1A 3VPXA 4RVGA 3PJGA 2Z5LA 2HQ1A 4PN3A 1CRWG 5BR7A 2YYYA 1E6WA 4J1QA 1P33A 3ABIA 3AUAA 4L73A 1UXKA 1T2AA 1H2HA 4XQCA 2ZB8A 3ZWWA 2DAPA 1HDRA 5DBIA 1SMKA 4FFRA 2X0RA 3LT1A 3KBOA 4TRRA 4EJ6A 3T7CA 4LMPA 3F3SA 4WLUA 4I5EA 3FNHA 4OO3A 3HB4X 4BNXA 4BUCA 1Y5MA 3GEDA 2FZEA 4OXYA 1ZSYA 1O89A 4BMSA 3WX0A 1CQJA 1RM5A 3DHNA 1ZW1A 2PGJA 4OIMA 1PWZA 3NTOA 2ZYAA 2WYVA 3AI3A 2DT5A 3G3EA 4CUZA 2C2YA 3E03A 2DUUA 3NJ8A 1DSSG 2C7VA 2A35A 3ANLA 3FSRA 1NQ5A 2PA3A 3F4BA 4R3NA 2GDZA 3DBRB 5ICSA 1ZUD1 2DBRA 3K96A 1VSUA 3TDKA 1FK8A 3ZU3A 4MP3A 1H6AA 3DZGA 4BGVA 1LJ8A 2NVWA 4TROA 2DTXA 1DC3A 3FBTA 4HFMA 1DC5A 5COAA 3IUPA 1LTHR 5TIIA 4XDZA 2QW8A 2Y67A 3BMOB 5BSGA 2JCYA 2J6IA 4L9RA 3GEMA 4NFHA 4D43A 2G5CA 5MGBA 1KVRA 2VOEA 3PLNA 1QKIA 3EAGA 4J7XA 5AXCA 3F1KA 4WCFC 3C7AA 1E92A 4BV9A 4XA8A 4D3SA 4XJTA 3MTGA 3E18A 1HEUA 2ZQZA 3OIFA 4D3DA 1C0KA 1IZ0A 4EDFA 1PGNA 4FB5A 4JXKA 2DUWA 1ENPA 3M1AA 4J2HA 3GVPA 3E6AA 3HUDA 4WLEA 9LDTA 3ITDA 5IFLA 1DOHA 1T25A 2R00A 3ROKA 2H1SA 4M55A 1YS4A 3L4BC 3R3SA 3GGPA 4OJNA 4CR8A 1CDOA 1WLYA 3KHUA 4PLCA 3WQQA 3OJLA 4MVJA 1NAHA 1RYEA 1G0OA 1KERA 3VH4A 5TJHA 3DHYA 3ORFA 3F5SA 4RVSA 4E31A 1T2CA 1SCUA 4DLLA 4FDAA 5TRTA 1P1KA 1V8BA 1F0YA 1WPQA 4B7UA 3PQFA 1YB5A 3OM9A 4YTEA 4YB8A 2CZCA 2X9NA 3I4CA 4BO1A 2NQTA 2W4QA 4XJSA 5IAAA 3MZ0A 4RPLA 1HTBA 2GSDA 4MP6A 3RWBA 3LYLA 3UH1A 1QLJA 1ZK4A 2D2IA 3JYLA 1E7RA 4NR0A 1V3UA 2Q2WA 3D4OA 4CM8A 4EZBA 1LRLA 4CM6A 4W7HA 1PQPA 4OXNA 4E2YA 5G0WA 1Q1NA 4EUEA 3QWHA 1U2DA 1ZZEA 3WXBA 1KEWA 1LNQA 1O6ZA 4TZKA 2H6EA 3DBVO 4XB2A 5IN5A 1EEHA 4BQRA 3WYCA 2PGDA 2Q1WA 5TQVA 3AM4A 2ZATA 4QT0A 1SBYA 1U3TA 3VDRA 4Z3DA 3OHSX 3UHAA 4DWVA 3DC2A 4IIUA 4WCFA 3RFXA 4NK5A 3EVTA 4R3WA 3UICA 1P77A 1PJTA 3NT4A 2OZPA 4YJDA 1Z7BA 3LF2A 1UZMA 4CM3A 1VSVA 2GYYA 1W0CA 3GVXA 3KYDA 2PGLA 1GCOA 1I30A 1JLLA 3ZWNA 3IKVA 4R51A 3JQCA 1LEHA 2I9PA 4OKNA 4BKOA 3IC5A 1RM0A 4RCVA 2D5CA 1H5QA 2X6TA 5B4UA 3GAFA 4KQXA 5B12A 4TMFA 3DFZA 3OFSA 4MINA 4FC6A 4CLHA 3E5MA 4ZU3A 2RBEA 3F4LA 4Y9DA 4CM5A 2VOJA 2X9GA 4ROSA 1IB6A 1X7DA 3C7CB 4PLTA 1DDOA 3G0OA 3DAPA 3FPCA 4IJWA 4GL4A 5ER9A 5THKA 5A9TA 1O5IA 2XOXA 4BB5A 1IZ9A 4BVAA 1LC3A 5JO9A 5KJCA 4M54A 2X5JO 2HMWA 3TQHA 2Y1GA 5JY6A 4J1NA 3ZWBA 1Q7GA 1EVZA 4NNJA 3CE6A 5K9ZA 3HDHA 1VPDA 1W4ZA 4PZCA 3GPIA 4RQTA 2VNAA 3VPGA 1U1IA 2NU7A 1KC1A 2O4CA 3TOZA 3U62A 1BSVA 1UZNA 4RJTA 4E5MA 3KVOA 4PLZA 2EJWA 3RUEA 3CXRA 5TGDA 2FZWA 2VWHA 4A73A 2G0TA 4XR9A 3I6QA 4BKUA 3HDJA 1UDCA 1K0UA 4R16A 3U9LA 4IMRA 2IEDA 3UCEA 2PTGA 1U3WA 1ENOA 3AI1A 4NBUA 1EUZA 1AHIA 1YH3A 2J3IA 4Q3DA 5JFOA 1ML3A 1XA0A 2OORA 1U3UA 1E5LA 3BTVA 1B3BA 3DZHA 3ICCA 2ZTMA 1FDUA 4I9HA 2G82A 1H9AA 3I5MA 4AJIA 4ID9A 2HK8A 4K6CA 4YQYA 4BKQA 4TWRA 4YT4A 1P1JA 4M49A 1UXGA 4YAJA 3QWIA 4P38A 2WJPA 2DPHA 4R41A 2X7HA 4NDNE 3UN1A 3A28A 3E9MA 3GT0A 4DA9A 1QRRA 3WIEA 5JW6A 1LI4A 3C24A 4YRAA 4F6LA 4YBZA 5TS3A 3E8XA 1QMGA 4OYRA 3ASVA 4YRDA 4PZDA 1E1NA 3JTMA 3WGHA 1GUZA 1NAIA 4Y6RA 3VZQA 3PGJA 4PVCA 1UP7A 3JD0A 4JBIA 4I5GA 2JKVA 3QWAA 4LVCA 4B79A 3FNEA 2ZB7A 1VKOA 3V2UA 1P1FA 5KVSA 1KVTA 5AXAA 4BMVA 3UKOA 2VZ9A 4RL6A 4WEQA 3RCBA 5TLSA 2NV6A 1DRVA 3GVIA 3VH2A 3MWEB 4Z0TA 1KY4A 4GBJA 1RM3A 3S2FA 1EE2A 1WMAA 3DBRA 3OQ1A 4JJGA 4GMFA 4B3HA 4WECA 1T2FA 3HJAA 1I24A 2HAEA 5L4NA 2C29D 1VI2A 4P4GA 3D4PA 4FSHA 1PL7A 4CR7A 3F46A 3OEWA 1PEDA 2ZB4A 4R1TA 3CZMA 2CVZA 2DBQA 3ENKA 4XYMA 1MGOA 1YBVA 3W1VA 3I9JA 3K2BA 1T2EA 2WD7B 1NXQA 1GQ2A 5JSFA 4CQLA 1AXGA 3ICPA 4FQ8A 1R15A 1YVEI 2CY0A 3MWDB 4CQMA 2O2SA 1EFLA 2V6MA 4K1LA 4RVHA 3GAZA 3ZNNA 2VQ3A 1YB1A 2YDYA 1F8GA 2EW2A 4D45A 2ZTUA 2X86A 3JD2A 4CV2A 3DL2A 1BWSA 4CM9D 4RF3A 1ISMA 1KEVA 2IZ1A 1XCBA 2F1KA 3TZKA 4FIZA 4J4BA 2PD3A 1FDVA 5L45A 1PTJA 2VZ0A 2JD0A 1QP8A 4AICA 4XQ9A 3X2FA 3EZYA 2FR8A 3JQGA 1M76A 2W2KB 3KYCA 5K6AC 5BQFA 4PLGA 1ZFNA 2QYTA 3C1TA 1GEEA 1JDJA 2G17A 4TQGA 5HBRA 4IPTA 3KEOA 3GR6A 2O3RA 1ZK2A 1HDZA 3O8QA 3DWFA 1JU9A 3WJAA 4AJ4A 4TSKA 1CYDA 4MPDA 2RH4A 2VHYA 1QSGA 1XQ1A 2B36A 5DF1A 5DCUA 3VDQA 1ZMTA 1DC4A 2BKAA 5EJ2A 1IE3A 1A71A 2PZMA 3FTNA 2CDBA 4Z9YA 3WGGA 3EGOA 2O2YA 1EBUA 2GO1A 5IJZA 2EHDA 3GMDA 1BGVA 4OOFA 5JAQA 4XZ3A 5H82A 4IQGA 1U4SA 3EYWA 1YL6A 4R9SA 3N74A 3ZNPA 2E37A 1PX0A 4KUEA 1UZLA 4R9RA 1MG0A 1ZO8A 2FPGA 3D7LA 3KYCB 3O38A 5H81A 1JKIA 3S1LA 1DBVO 4MDHA 4OM8A 2VRBA 1JVSA 4MP8A 4OL9A 5BNFA 2CMDA 3KRTA 4BO0A 2ZCUA 5CEFA 3JQFC 1TT7A 1SOWA 3GRPA 4J9VA 4AJOA 3JYQA 3VZRA 2Z1NA 1PWXA 3R6DA 5G4LA 5EERA 1U8FO 5A3JA 3B6ZA 3ONEA 1LDMA 3PLRA 3CTMA 2PH3A 2H63A 2RHRA 3EUWA 1NNUA 4ZQFA 1CETA 2NVUA 3UW3A 4FBGA 5T8KC 1V35A 4UUNA 2IEBA 2D1YA 4TRNA 3ADOA 1Y81A 1T1SA 5KOIA 4J49A 2EW8A 1KVUA 4DTIA 2CSUA 1LQTA 3NV9A 1PR3A 1YBMA 3Q11A 2SCUA 3OQBA 1E77A 1IOLA 4L8VA 2JJYA 4XQGA 2ZJ1A 5F1PA 1V0JA 2YZ7A 1X0XA 2BGKA 3F47A 4M86A 2JCVA 5JDIA 2BI8A 5CEJA 1B14A 5BT9A 1HKUA 1U7TA 3QSGA 4GX2A 4OMUA 3WDSA 2GUGA 2YHUA 1AHHA 2V6GA 4CMEA 3PJEA 4J91A 1PJQA 4HFNA 3LSYA 4G2NA 1ZK1A 2UUPA 3VHRA 5A03A 4GI2A 4J0FA 5HA5A 3I9MA 2O7QA 2VTDA 5JAMA 4W9NA 2DVMA 4WEOA 1VJ1A 4QO7A 2VUUA 3AY7A 3EW7A 4QEDA 2EERA 4PFJA 3PIIA 5FFFA 4CQLB 5A4DA 5LDGA 3DR3A 4IDFA 4ALKA 2P5YA 2X8LA 2VZ8A 4NBTA 4CJXA 5HTOA 1AGNA 2LDXA 5L95A 3TN7A 1E7YA 1DIRA 1T4DA 4E2WA 5JLAA 3OICA 4YJGB 4XYGA 3RUDA 3NTQA 1GD1O 1HWYA 3QVWA 3WTBA 1E7QA 1K2WA 4DGSA 4XKJA 1BG6A 1NQAO 1C1DB 3JQFA 5T67A 1ZH8A 3U0BA 4B3IA 1DRWA 3W4JA 5L40A 4ALIA 4XDYA 1GPDG 1GADO 3PXXA 4IXWA 1CWUA 3SLGA 3JQ9C 1MC5A 3U4DA 3G1TA 4DIBA 3QWFA 5BSHA 1CF2O 3Q0EA 2WWRA 5H83A 2PKQP 5T8KA 5A9SA 5JO0A 2AMFA 1HSOA 5THQA 3PPIA 1DJQA 2C54A 5DT9A 1VRWA 3JQ8A 1GZ4A 3AM5A 2EXXA 2GF2A 4YDRA 4R1NA 4BHTA 2X23A 3DTTA 3UUWA 1NYTA 1PS9A 1T24A 5G0SA 4KDFA 1Y8QA 5K0ZA 1BDMA 2PR2A 3W8EA 4HKTA 2Z1MA 5EN4A 4BNMA 5HS6A 5CG2A 3I9OA 3TZHA 1B0AA 4PLHA 1H0KA 3IOYA 3IMFA 3HN7A 3UOGA 1K5HA 2TMGA 5CHEA 2Z95A 4BB6A 4IM7A 4CMEC 1Y8RA 4CV0A 3K2EA 3GUYA 2CUKA 4KMSA 5B4TA 2J5RA 4ZQEA 5F21A 1ZEMA 4Q3EA 5FF9A 3VZSA 4IGEA 4RZIA 3ULKA 1TEHA 4W9NC 3IP1A 4BO2A 4ZICA 2P9EA 1NM5A 1UXIA 4FW8A 3ZH2A 5AYVA 3WG9A 3K8ZA 1LUAA 3LK7A 4DPKA 1EQUA 1EZ4A 2VCYA 3ZV6A 5I7SA 3D64A 2OP0A 5T64A 1A7AA 4R69A 1MFZA 5L4SA 4BO9A 1N1EA 3KSDO 3WOHA 4BNFA 2WYUA 2H9IA 1H93A 1GV0A 2GCGA 5DCYA 1JWAB 3JQ9A 3DEYX 4L75A 3OECA 3WGTA 4JIGA 4Z9XA 4Z9FA 1LSOA 4QSMA 3GN1A 1UXJA 4MOWA 4UREA 3AU9A 1T1RA 3H3JA 4PLVA 4JK3A 1X1TA 3JSAA 1F17A 3BTSA 1NHWA 3UFXA 2B37A 3JD1A 1L7EA 5F1OA 3VC7A 5HRUA 4IBOA 1QORA 1A5ZA 1MFPA 2I5PO 4XEHA 4EI2A 3OIDA 3MJEA 1MP0A 4YA6A 1D1TA 3ON5A 4WCFB 4DPMA 5KIAA 1EBFA 5A1TA 1K6XA 2O48X 5L51A 3PHHA 3K9QO 1PJ3A 3FCOA 3R3JA 5I9LA 4FFLA 3PGXA 3DOJA 1Y6JA 4JBGA 4PRKA 1UAYA 1DJNA 1ZSNA 1DRUA 2YV1A 4MVJM 4TVOA 1X7HA 3DBHA 3AU8A 5T5QA 4U0KA 3I6IA 1CEQA 4GSLA 4QFDA 1RJWA 4BO3A 1SEVA 3DONA 4EGFA 3E48A 3SXPA 1CERA 5A5EA 3GA0A 3QP9A 4LN1A 3UF0A 1GQYA 1IUKA 2RCYA 3KUXA 5TC4A 2EF1A 3EDMA 3V5NA 2J3HA 3RKUA 1G1AA 1MB4A 3JYPA 2EP7A 2GGSA 1LSSA 4DC0A 4FD3A 3D3EA 3EC7A 1RPNA 3OJEA 3G17A 4CLXA 5I8ZA 4RVUA 3ADPA 1UP6A 4UVEA 5JBIA 5DBGA 1I2CA 2B4QA 3ZWMA 2D59A 5CDTA 2DFDA 4L76A 1RKXA 3WYBA 3BZUA 3O4RA 5L7YA 3WGQA 3BIOA 4F45A 5CEEA 1YJQA 2D4AA 2NWQA 5B4VA 3W8DA 1WWKA 2BELA 3LQFA 3W8FA 2OMEA 3HE3A 2AEMA 3H9UA 4XCVA 2OL4A 5KTKA 1GZ3A 3B70A 4C7KA 4E32A 4MO2A 1I01A 1QYCA 3OH8A 4HWKA 3RC2A 4IQ8A 4DQXA 5EQFA 4AJNA 3Q1LA 4ALLA 4D3FA 1UAGA 3GNSA 4YEDA 4YQZA 2P91A 2PNFA 3V1YA 1B8PA 4GX1A 4NFSA 4JROA 1XLTA 4L4RA 2Q50A 1ISIA 4U6SA 2O50A 1R12A 1J4AA 2ZTLA 1EK6A 3ROMA 1KETA 1LU9A 1P3DA 4LRTB 2EKQA 4ZVVA 4G5HA 3T4EA 2JL1A 4DIFA 4W6ZA 4IDEA 4MVJF 5AOVA 3VTFA 1OMOA 4HY3A 3PQDA 3Q2IA 4E5YA 1DIGA 1P0CA 4BNTA 1NQOA 3PWSA 1QYVA 2O3QA 4MJLA 1NTOA 5JYDA 1HYGA 1VL8A 4BGEA 2BFPA 3H9EO 3OP4A 2E4AA 3PEFA 2Q46A 4OSOA 3OJ0A 4D0RA 3IDSA 4IS3A 3GRKA 3BMCA 3GC6A 3RFVA 1E1KA 1JKJA 3JQ6A 3U4IA 4FJ1A 4JP2A 3L6DA 4YAEA 4J4HA 4B7XA 4CL3A 3PJFA 1ADCA 1PGOA 4E4YA 3GGGA 9LDBA 5ENDA 1PL6A 4KWIA 5JPIA 3K6JA 2ZB3A 1S7CA 2HMVA 4J43A 4B4WA 5IDYA 1F8FA 4H7PA 3PDJA 4KP7A 3DBLB 2QG4A 3GVCA 1ADBA 3ETGA 2BFMA 2P9GA 2Y1DA 1WXDA 3QE3A 3TL3A 4D42A 4B4VA 4NK4A 1PGPA 4N54A 5KJ6A 1A7KA 1LDEA 3BHMA 1ZJYA 1ZEJA 3G79A 4ITUA 4CMCA 3WR5A 4XIYA 2GZ3A 2Y68A 3Q2KA 2Y0EA 4J16A 4RF2A 3FBGA 3O26A 4UULA 4XGNA 5ES3A 1PU2A 1UH5A 2I65A 1I0ZA 1UDBA 3K30A 2HKIA 4XD2A 4A10A 3N58A 1WP4A 3OA0A 4DRYA 2YHIB 4AFNA 5DDIP 1QYDA 1GEGA 2H5LA 3LT0A 1M2WA 3DZBA 4GVLA 4AVYA 1XHLA 2C20A 4BO6A 4WNCA 3WGIA 4HNGA 2GZ2A 4FR5A 1U5AA 4UVHA 1Z45A 1E3IA 4AJKA 4Q9NA 1NFRA 3TWOA 1J0XO 4J1TA 3ZI0A 1UP4A 5G4KB 4ND2A 3KO8A 4P22A 4YXFA 4EJMA 1C0IA 4GGOA 4PGFA 3L0DA 1HXHA 1TVEA 1E5QA 3GLQA 3JQAB 5TNXA 2IXAA 4IJKA 1PZGA 2O3JA 2PKRA 2FP4A 1I36A 5AXBA 4BGUA 4XRGA 1DO8A 4YJFB 3ZU5A 4BNZA 4DQUA 5EPOA 4A26A 2J3KA 1GUYA 3AFNA 4IZIA 4ALJA 4BNIA 2C5AA 2X1HA 1CQIA 3D5TA 1R37A 3ASUA 4WNIA 4A7PA 4RORA 3LLVA 3QLJA 3ZWCA 2Y0DA 4CM1A 4KOAA 1GR0A 1HDCA 2QYSA 5JMWA 1KYQA 4Q3BA 3ROQA 4BNHA 1NFQA 1U28A 4JLWA 4RLHA 1O8CA 4H3VA 3TL2A 3NT2A 1FDSA 1ZIDA 4IQ0A 2DPGA 4CODB 5IF3A 1XYGA 2RIRA 5GZ6A 1A9ZA 5U1PA 2VWQA 1PZEA 4HV4A 4AL4A 4J7UA 3CEAA 5ICMA 2W8ZA 2FMUA 5L53A 1N2SA 3NGLA 3VVCA 1MA0A 1NPDA 1BVUA 1NPYA 2VUTA 4IDCA 4JN6B 3SJ7A 3AOEC 4WASA 4DBVO 3Q9UA 1T26A 1QXSA 2AXQA 3GEGA 2GN9A 2Y05A 2GN8A 2X0IA 1A72A 2HJRA 4LGVA 1PJLA 1T2DA 1VL0A 3G49A 3PHJA 4XYBA 4DPLA 4DYDA 1V3VA 2DM6A 2GRAA 3DQPA 2BMAA 5I7VA 1KEUA 2CVQA 2FSVA 3VPSA 4WJZA 1YQDA 1PJ2A 4BKPA 2WE8A 1LLQA 2VHWA 3P2OA 5L4LA 5HWSA 1KS9A 2NQ8A 4ILKA 2DQ4A 1X15A 2JHGA 2XXBA 3E5RA 1MXHA 4FFMA 2UAGA
chains in the Genus database with same CATH superfamily
4QT4A 5AJYA 4BP9A 4YUZA 4PLWA 1NBEA 3VNAA 2X19A 3CMCO 4EEZA 3JQBA 4QU9A 2VA9A 1U28C 2QNIA 4YASA 1M10A 3B51X 5ALRA 2XUDA 4OCZA 3FW1A 3P9NA 3EAFA 3GLIA 1PNTA 1JDBC 1IXSB 2XMPA 5KTMA 2P8JA 5A7GA 5A5FA 3CUTA 2QRVA 4WY5A 1W85B 3IAXA 3TLZA 5BWNA 5HK9A 1EFAA 2GASA 3LOPA 3AZQA 4MUXA 4U63A 2PDAA 3CX7A 3OVMA 3T4UA 2HRDA 3WK7A 4P3KA 1AH2A 4EQ6B 5CCEA 1ZVKA 3NH6A 3ONVA 2ZROA 1FY2A 4B74A 1SKMA 1K9VF 2DULA 1Q7CA 3CLUD 5DMHA 4EEKA 1TB4A 3L8EA 3MEQA 4A27A 3DZIA 3C74A 2PYDA 3ZBPA 3VKWA 3P96A 2HK6A 3PVZA 3B5EA 4ZVTA 3RT9A 2GI4A 3CEJA 4JT8A 1I2BA 1TVCA 3GHYA 3QW2A 3D8BA 1EDEA 2AG8A 2GKOA 2PPVA 2XQVA 4UXIA 5HM6A 4RHUA 5JROA 3R9XB 1P5JA 4II2A 2JIRA 3M4JA 4QGGA 4LQ4A 4L4YA 1OXBB 3JWGA 4HXEB 2FQQA 1NBHA 1SRQA 2IELA 4YAKA 4U00A 2BZGA 4YYZA 2HCTA 2O8CA 3N2EA 1K89A 1ULTA 3V00A 1Z12A 1DC6A 1VG8A 2VEOA 1YKFA 2NU9B 4BNDA 3HCRA 4R98A 3IT0A 3FVVA 4LY6A 4LJAA 1CTQA 1UADA 1SQ6A 1Z6AA 1CF4A 3OKFA 4X8OA 1DNPA 5FQOA 3X1DA 4W5HA 1NY5A 3GGOA 1HM5A 2X9VA 1N78A 4M7OA 4LDRA 4LYGA 2IGTA 4YJ3A 4UBNA 3BAZA 1XTVA 1ESMA 2D1QA 3OHPA 3ZDDA 3MS4A 4YS6A 1NRXA 3C98A 3DE0X 3P0FA 1IK6A 2C2WA 2V7WA 4PV7A 5DULA 1SCIA 1B8UA 2ADOA 1PE0A 2EP5A 5EFOA 4FHFA 2R6AA 1IL0A 1J06A 2P79A 3FF4A 4S2EA 4HZIA 4GQBA 1YACA 4MUAA 4S1OA 5CH5A 4EL0A 4JT4A 1XU9A 1EJ6A 4DA4A 2NUTB 2IOFK 1B6TA 3AVOA 2VJCA 5DP1A 2VRNA 2I6GA 2IVFA 3DLIA 1DIAA 4YFVA 1BE6A 2NPIA 5E9WA 3RS8A 1A5TA 2G1PA 4YJHA 4KREA 3KEGA 1RS0A 4WNYA 5AJXA 3S8MA 3Q5EA 4O02B 3B3FA 2ZPTX 4L95C 5EHXA 2P2LA 1FVXA 2CXUA 2P5TB 3EVNA 1GV1A 3LDUA 3O5AA 4TSRA 2VT2A 3DO5A 2QP9X 4AKHA 5D85A 1YQXA 1PK7A 5JS7A 4MW0A 3PUJA 5GIPE 1USIA 3CVJA 1WMFA 2OBYA 1FFGA 5JXHA 2PUFA 2YNMA 2WF5A 3ZWOA 2BPOA 2JIMA 3Q7EA 3EXEB 4PCAA 5I8PA 1CEXA 3F9IA 3WDLA 4WNAB 2P4HX 3KK0A 3PTLA 4YRCA 2IVZA 2RGWA 1CHNA 1Z2OX 4F4DA 4U0JA 3T3OA 3QE0A 3IBGA 4KHZA 4G41A 5HK8A 2V0GA 1H5NA 2B21A 3O9MA 3NWBA 4X85A 5AIAA 3GZNA 5IMSA 3HDQA 4UHEA 2NZVG 3IDOA 5KYUA 1CUUA 4B3TB 2V4MA 2RGUA 1K92A 3DB1A 3A1WA 1JF8A 1EVYA 3AM3A 2M6KA 4YJKA 3TR6A 3U5ZB 4G0UA 2OB2A 4NCNA 3V4SA 2OTCA 1UFVA 2HDNB 1C2TA 1IY8A 5SZKB 4NPAA 4PQGA 5L3QB 1P0MA 2MWMA 2ZSIA 4LF4B 4R8VA 2CHVA 3LY7A 4TUYF 5FX2A 3N8KA 2OYSA 1Z18A 4ARZA 4EB0A 2F64A 4LX8A 3PT9A 4ZVMA 3DGFC 3SJCA 1X7WA 1PUIA 3QKRA 4M0UA 5KOHA 1CUIA 1Z0ZA 5HKBA 4TYPA 1U8XX 3JR3A 3TF5A 3A7EA 3JQDA 4W4TA 2PX5A 3EJWA 4FN4A 3L0SA 2IU0A 3IP7A 2Q5JA 1XDBA 3BIFA 4DSAA 5BW5A 4EX7A 4NAHA 1YDWA 3JAKA 1ETHA 4RXMA 5JC1A 3FD8A 1R4NB 3GUCA 4GI5A 3ZZ1A 2QBYA 3VTZA 3P2KA 5DLEA 5JATA 3EVFA 1FU4A 1BU8A 1Y4DE 1GRQA 4XH9B 5DHUA 3KL2A 4GPZA 1EK0A 2F43B 1WMDA 3W5JA 1XKTA 2YINC 3TQOA 4WK2B 3UMFA 1PJBA 4UHDA 3M9LA 1A88A 3IQEA 3GV0A 2CXSA 3OHMA 3QLVA 5LDDC 5EVJA 5C18A 1GSIA 1RJGA 1S7GA 2QTTA 3KQWA 3OFJA 5JE8A 5IEBA 2ODEA 3C6XA 4DOMA 3RVQA 1S3SA 4R5MA 3QU5A 5KCZA 2WFMA 1UMKA 4RSHA 2Q49A 4EZIA 5BNWA 4ENQA 1ST2A 1TYDE 3VH3A 4R05A 3A25A 1A04A 2QI9C 3GFGA 3SFZA 2P0YA 5L6LB 2WJIA 1JSRA 1AUOA 4KNYA 3NR2A 1MB3A 1BKYA 1BQ3A 4M9QA 4GPD1 3VR0A 4W5RA 5HBGA 1AKRA 3DTYA 2C82A 2Y71A 1PR1A 2ZTHA 3K31A 3TXYA 3VX3A 1R00A 1LF5A 4K87A 5DWQA 3RUPA 2ZRPA 1WXXA 2EIHA 3PJDA 3R75A 2HRZA 2VPTA 3IPYA 1YS7A 2OO5A 5BN3A 5BNTA 3GWZA 1O0CA 3JQEA 3VTKA 4DG8A 1CQIB 3GDFA 4BOYA 4R1SA 1A2KC 2QDKA 1XDGA 7GPBA 5KYNA 2Q1UA 1KO8A 2ODBA 3RTCA 3VPCA 4D6XA 3ER9A 1FXWF 4CE6A 3N7UA 2FPGB 4TOIA 3UNXA 4IJ6A 3B5IA 4RPIA 5ITZB 2RH9B 3RJMA 1RJ9B 5MFPA 3OOYA 3RT1A 3LLUA 2O6LA 1H2YA 4RKYA 5K4HA 1GRNA 2OO7A 4NENA 5CPBA 3IL2A 2BLNA 3TKLA 3JQAA 1YL7A 2IL1A 5GQSA 4HTAA 2ZE5A 3IT2A 2AC7A 1LVUA 1OV6A 2GTHA 4JLOA 3TTUA 4RV9A 1E5VA 1XZIA 3BRQA 3TX2A 3HCCA 2HNBA 1UEJA 2JGFA 4JYPA 2HMYB 5CT6A 4JC8A 3NBFA 5BN1A 5K6TA 4MGEA 3D4LA 4RTJA 2XNDD 1ECLA 4FZ3A 4YONB 2O8FB 2O2EA 2HMTA 3SQLA 1R0KA 3BVPA 2JGNA 2IWHA 1EXMA 1KAEA 3E22A 3PNOA 5TF4A 2NP6A 4V1CB 1LDGA 1G2IA 1XDZA 1F14A 2Q2NA 3IESA 2B2XA 4LRSB 1VXOA 3U4AA 2E4VA 2QOEA 4A15A 2EBHX 6CHYA 5JSZA 1WZIA 3L0PA 5LUBA 3D6NB 4AKTA 2ZWAA 2CE2X 3WK4A 4B6OA 3ZGLA 4KUGA 4MVJG 3Q10A 2WJZB 2HU2A 2QVYX 4LHEA 2QTVB 3T5BA 4EK9A 1SVOA 3NAQA 4CNBA 3Q85A 3T8YA 4L4SA 1ZIXA 3ORYA 3HYSA 4PZ9A 1XNJA 1VCIA 3QKSA 4HDAA 2POQX 1EX9A 4QTZA 3CF4G 3QV1A 1VIAA 3STVA 1NVEA 2QZ4A 4DSNA 1AXEA 1G21B 2ABWA 2COUA 5HUQA 3DMYA 4D26A 4NMMA 4QFCA 4N3BA 2R87A 2EFCB 4JB3A 2YJ3A 3LDHA 3RJ9A 1IG3A 4WRRA 1QH1B 1T35A 3OZ7A 3VBEA 1UMBA 1L9KA 4IIJA 5E6RB 1PD0A 3DTNA 4A6DA 4K2AA 3WNVA 2J7KA 2V7PA 4K9NA 2JFGA 3GNLA 3TBHA 1IK4A 4XPIB 2C7GA 2DE0X 3DBLA 5EIOA 4YCCA 1EUDA 3ANXA 3DDOA 2OO5C 3CUSA 4OQZA 3WISA 1CLUA 2C9CA 4V0LA 4ZOLB 3RYFA 3B6IA 2GJSA 4JC5A 4OUDB 1O5TA 4WKNA 2WOOA 2XVMA 3T6KA 1XNRB 1V6SA 4U39A 2ISSD 3DVAA 3CN9A 3ZBUA 1N92A 2JVIA 2IHNA 4PAOA 1KP3A 2WD7A 4YRNA 4G24A 3MWYW 2VYND 3FFWA 4Q7EA 3DDNA 3K0FA 1QGZA 2I33A 4LQLA 1XNGA 1NSTA 1IPFA 3BTOA 3DAGA 1OYVA 4YXWD 1H0HA 3MILA 4KE9A 2WUVA 5CT5A 1WR8A 5TGZA 5KOJB 4G1MB 4YP9A 4CT0A 4C3OB 3H8WA 2ZRIA 3ZC3A 1Z0SA 1EX6A 3EIUA 3NTXA 1ONOA 1OPXA 1WQ3A 2VDKB 3GK3A 2H2GA 2WSMA 3OKPA 3EGDB 4FQ5A 3SF8B 4HC4A 4D8YA 1DKLA 1BROA 2JK1A 2WAYA 2CDRA 2Y76A 3AV3A 2Q21A 3QVJA 1D7OA 2F3SA 1BJRE 4MKFA 1CY1A 5HUJA 2PZEA 5EJFA 3SGLA 3AFHA 3WK6A 3L84A 3FR7A 3HQ4O 2QPLA 2CB0A 2V5AA 3SYLA 3V9PA 2WUGA 5I9IA 2H4XA 4ZT7A 2BGLA 5LWHA 1MDFA 2UYYA 2GERA 5E7IA 2HIHA 2JIPA 1PYGA 4RF4A 3TNYA 4MRVA 3LTEA 3CRW1 2FUG1 1OR8A 1NR5A 3PEEA 4P82A 4YRFA 3EZ2A 2PMWB 1NP3A 1YD7A 3FR8A 4F5DA 1DAEA 2ZBQA 1CULC 5DYWA 3SCZA 1YA6A 5C8DA 4M1MA 3L9WA 4Z1MD 5IWCA 2WF8A 3WICA 4LSMA 2GCOB 3AEXA 2RGEA 3T15A 1M0EA 4HQOA 4G97A 1A5SB 1T1JA 3KQPA 2IHJA 1MO4A 3IAM1 1ADGA 2R44A 3P9CA 1XEWX 2BMFA 2GEJA 4TXNA 4B4OA 1CZUA 1F5NA 1N6LA 4LW8A 2OGWA 3UMRA 4UUPA 3FHJA 2VHZA 4ZCMA 2C7QA 4XX0B 2AK3A 3BTUA 4CEJB 1AUXA 2QJWA 3GY0A 2OXIA 4YP6A 3O6VA 1NXVA 4PZUA 3ID6C 4UEJA 2NO4A 2WF6A 3DLAA 4JB8A 4ALNA 4EGSA 2BKVA 3FX2A 2WSBA 2CNLA 3A7DA 1Y63A 3EG9B 3LP5A 2WY2D 4INJA 1NYQA 4B3CA 1ZK0A 1TADA 3U5TA 1JX6A 3ZWAA 1VQ1A 3E9NA 5TR9A 4S05A 1OWNA 3M6IA 5A6SB 3M6LA 4NJOA 4BJHB 4DF3A 5MDHA 1GKKA 4DCVA 3BHIA 1ECCA 2R2AA 5CK5A 3WFIA 1NLZA 3E4DA 4GUAA 4ZVQA 1QPBA 3PC8A 5EXPA 1J70A 5HILA 5TVKA 4Y3UA 1Z35A 3UK6A 1E2BA 5KWIA 3OCJA 3VR4H 5C8XA 5KYXA 5ILOA 2NVOA 1BMDA 3WDKA 3ZGOA 3ZVNA 3C3YA 3WZMA 3JWEA 2FUNB 1NF9A 2ZE8A 5EXSA 1T34A 1QZZA 1H2XA 2INGX 2R8PA 1Y5NA 1XRQA 4Z7OB 1QMPA 4ARUA 1IOVA 4KXYA 1HLPA 2XNJA 1L4FA 4EY4A 1NSFA 1GAEO 3HCAA 4JI5B 4GI1A 1AD2A 2J1LA 3T4XA 4ZCSA 1X42A 4QHYA 1XSEA 4EPYA 4M88A 5EMHA 1PT5A 4JL6A 2PAFA 3A1VA 4JA0A 2AR0A 4W82A 2IZ0A 3TE6A 4HZUB 1UWLA 3ZHOA 5KVCA 3BPSA 2VYVA 5A1JA 2BEVB 5JZBA 3A1SA 3HSSA 2WSYB 4QOIA 4QRDA 1L5KA 2IYYA 1UT8A 5JRDS 4RY8A 1RFGE 4NH4A 4UHKA 5JCJD 4BZZA 1E3SA 1ZGCA 2J07A 3DJYA 3JQ7B 4GWKA 4KJZA 1DBIA 1LTQA 1BXGA 2JFPA 3HB9A 4FSDA 2R5WA 1CJBA 2C57A 3UTCA 4DQLA 4FU0A 3EXG2 3INNA 1Q44A 1W4BA 1G7TA 3LC0A 2QYHA 2BFCA 4AJ9A 3OUTA 3D1JA 4GBGA 1TZ2A 3Q7PA 5DLDA 4ZVUA 1EESA 1DPGA 1QUEA 4XWKA 2O7SA 3DKIA 4ARBA 1DVRA 2YRFA 5DNAA 2X1MA 1R7RA 3TOXA 4L6AA 2PIAA 3DEJA 2XQJA 3C3XA 4MVJP 3REGA 1QQBA 5I7HA 2CD7A 2ZYIA 2VP5A 1TF5A 3CR3C 1GTMA 3F6EX 3W8NA 4JV5B 5CA1B 5I7EA 1PS0A 4TN1A 5FI3A 1SCDA 1VJ0A 3NX4A 1UM9B 4BMZA 5J2UF 3B82A 4JWKA 3R0IA 5DZSA 4GLOA 1RDFA 3R6TA 4OQDA 5D6OA 2Q6KA 4JFAA 1Q0ZA 2B9VA 1E96A 2V7TA 1KZ1A 3VR6H 5EXXA 5AW6A 4G36A 1VSBA 3QENA 1MF7A 3TI7A 1T3LA 1W88B 2I7TA 4KFSA 3SR4A 3BZWA 5JS2A 3U7EB 2KX7A 3E1SA 2HMSA 3V1NA 1M7HA 3G2HA 1QIIA 1JYSA 4PHFA 2JHFA 1CXZA 5M7EA 4E51A 4GH5A 4CM9A 1XXHB 5FA8A 1HNNA 5LMUB 2F8TA 1CZNA 3A1CA 3ZQ4A 3FYUB 5I4KA 3ACDA 2G9QA 1IWPB 1D1QA 1P1RA 2N1MA 2REOA 3EEBA 1Y8RB 4YT8A 4IXTA 1A76A 2DG2A 3AUUA 2YV3A 1MAWA 2DC1A 3K72B 3IOCA 5K8TA 3GOQA 4MW9A 2R1UA 3I01A 5HZKA 1Q21A 1T10A 1UM8A 3JAWA 3CVXA 1KVSA 4BMCA 2ZIVB 4JU8A 1I4DD 2F55A 2CDNA 3IXMA 2DCMA 1P1IA 2E18A 2VK4A 1P4SA 2UZ3A 4ENVA 3AGPA 2PUDA 1VG0B 2XTNA 3A0UA 3ZD6A 2RK4A 3K0BA 5BSUA 4JENA 1ESNA 4M9XA 1BS2A 1OE0A 1W52X 3UMVA 2WB2A 2R8OA 2VF2A 1ZN7A 3DMDA 3RUCA 3UG6A 1QTNA 1DAPA 2PIDA 1K5PA 3ZDYB 1ACLA 2DSTA 1ZMRA 4OH7A 4WXPA 4MLZA 3TD6A 3PQ4A 3TSAA 2ZULA 2PR7A 5DFAA 3V7FA 2C0PA 2B4AA 3GNTA 2FLVA 1PW7A 4DC1A 1JIUA 3OOHA 4NOJA 2AJBA 1WCXA 3DKKA 1I5EA 1U98A 1DBQA 4YI5A 1QYWA 1FDWA 1E9VA 2BEVA 3R5TA 1G3RA 3HKCB 3S7TA 2D0IA 5H5JA 2EBUA 1TD9A 5CM9C 3R3YA 3I9FA 4GMXA 3CIOA 5FUBA 4E6PA 2ZUCA 4MA4A 1E0SA 3BOSA 3F6YA 3HZRA 1KJWA 5IAGA 3DMTC 3KALA 3MQ4A 3K6SA 2EDCA 2C8KA 3AY3A 3FKSA 4P34A 2BMVA 4QU8A 1N8KA 2ENUA 1DFGA 1OVMA 1UBRS 3TLCA 4BP1A 1DTWA 1EDOA 2OGSA 4FZRA 5GOZA 3RBXA 1XTSA 1GPJA 3EUEA 3GJZA 3MS7A 1W59A 3C3KA 1AX9A 5GJCA 3T06B 2HJHA 1ULBA 4D9FA 3INRA 5HM8A 3BMOA 3H5LA 4K03A 1RWQA 4JLMA 3FYHA 3H5NA 4WLFA 4J7CA 1D07A 4FFNA 1E9EA 2J32A 2QRVB 1WS6A 4N8DA 2XY4A 4RIEA 5C32A 1XCLA 5JZVA 4DDTA 3PF8A 1FYXA 3RC1A 3CLRD 1MABA 1N7HA 3PTZA 4G26A 3AHGA 3HNOA 3MWJA 2ATXA 2DMRA 4JP1A 2M1ZA 4MIYA 1GSAA 4Q1CA 3MVEA 4XVHA 1QH0A 3DEHA 4XOUA 9ABPA 1NM5C 3QE2A 4V2IA 3QX8A 1N0VC 4XD7A 3I1FA 4RTLA 1ZH4A 3FG9A 2V9PA 1OIVA 2XYQA 3CX8A 4O5OA 2AL7A 4JQYA 2OV4A 4B81A 4DCNA 1Y3AA 2C07A 5HQTA 5LQMA 2GF0A 3ONWA 4IEFB 1S8OA 2ILVA 1J33A 4D96A 1Y3BE 5D84A 1MO6A 3IPXA 2ZI5A 4RMGA 2RK6A 2IZOA 1A4IA 1J7JA 1YR6A 3ETEA 4RCZA 4AURA 5C5IA 3A6DA 4ZO7A 4NCIA 4BMDA 3A2KA 1N6OA 4OMCA 3A9RA 1WDMA 1IQUA 3AR6A 4HBGA 3UMYA 2C4VA 4LJSA 3M2PA 2Z2YA 4NMWA 2NVUB 5CXUA 5FEUA 5LZ4A 3LX5A 2PX6A 2AW5A 2HRRA 4KI7A 5JD6A 3WMEA 4F85A 5C7IO 5A0TA 2M2IA 3ZE6A 5FPQA 1DFHA 1JRLA 2AI1A 4WKGA 4FYJA 1P1CA 3X2EA 2IDZA 3BDIA 1HTWA 1W88A 1Y1PA 5COBA 2YS6A 2QU8A 4B47A 1XEXA 2WZBA 4ARIA 2FN7A 4GMGA 3ZN2A 4C7OB 1V9CA 1P39A 3FF1A 2R6JA 3C6ZA 2Q5QA 4AO6A 1J8QA 4RMHA 4P8RA 2H2DA 1IEWA 3EMKA 2ZK7A 1VKZA 1IQPA 4P1ZA 3M6XA 3HK2A 3A70A 3RV4A 3A9WA 1OOEA 2XOEA 3M3HA 1G8JA 3N28A 2JFFA 3F8TA 3MOIA 1W25A 4LK2A 4ONEA 4EVSA 2NIPA 1QWOA 3EC2A 3H9GA 2FEWB 3BWMA 1XK6A 1YQGA 2HV9A 4L5AA 4IX9A 4OEHA 3K71B 2DU8A 2ZJOA 4G9GA 4RA6A 2XTJA 4KX3A 1WW8A 2V96A 2BFAA 4X20B 1E2MA 2AN1A 3GJRA 5DLPA 4F1WA 3R24A 5CCDA 4UQPA 3O8LA 2Z3VA 5KJFA 1HL7A 2RJ3A 1U7PA 4LOLA 4HDNB 3GUUA 3KOYA 3DW1X 3A6FA 1VKHA 2FVXA 5CVVA 2WT9A 4X54A 5FLXA 1V4NA 3VAZA 1MC4A 1FP7A 1WY7A 3AHCA 4TKMA 1IDOA 2Q7DA 1X1AA 3FFAA 4G8JA 4L22A 2A3NA 2CVPA 2ZRQA 4EUNA 3AIOA 1T8YA 4RA9A 5CT9A 3KAQA 2AXEA 3RJZA 1UAAA 2IODA 1TLTA 1U9IA 2BHRA 1WVGA 1LLCA 2FSFA 1C0LA 1ZU4A 1O4WA 1X86B 4P4NA 5TS2A 1HC7A 2R66A 1DU4A 3W6ZA 5DBFA 2PZJA 4J7AA 5DTIA 4P4TA 3R7WB 1GNVA 1EVKA 3K0CC 5ERYA 5H8WA 4IHJA 2JD1A 1JU3A 3MRVA 4E33A 4EJSB 3BMCB 4KAJA 3NIBA 1YJBA 1YOVB 1L8LA 1X7XB 2P78A 4BNKA 4JI4B 4N5DA 4E5NA 4A2CA 4M0PA 1QF7A 2VJLA 2WIJA 1Q1AA 5JCXA 4A2PA 3T9AA 1Q7TA 2ZJ6A 2GXQA 2K7ZA 3HC7A 1RSZA 1DC7A 2QRHA 4HUQA 2HL6A 3BZBA 2H1IA 4Z86A 3RASA 5H4GA 5G4KA 2GCEA 1JHVA 3LIIA 3ZVMA 2V7QD 4CMBA 1AZWA 2B7BA 3WNZA 1E8NA 3PWTA 3ITKA 3B1ZA 2FNAA 4YDQA 3LC1O 4DV5B 5C5DA 3LK6A 3AUTA 4O1HA 2GDJA 3VUEA 4CFSA 3LGXA 2CNKA 1QGOA 2Q99A 4NBLA 3HHPA 1WZCA 3AOGA 1EH5A 3C1OA 5D8DA 3HJUA 3JPYA 3CMMA 4JEUA 1FTYA 1T5DX 3F5QA 1EK2A 5D3QA 3ZZUA 1SIWA 221PA 3WVNA 5LXTF 3NDBB 3B2EA 4PYRA 4UOEA 1EUDB 2A1IA 2D5BA 3NQ41 5FLEX 4IDAA 5EJ8A 3PZBA 4MUFA 3KKPA 4O2BF 3J81k 2DLDA 3H5AA 4TT8A 1CG6A 1N0UA 2QD2A 4B8ZA 3I8SA 4Q12A 3PUHA 5I7OA 1VPLA 3MYYA 4LYAA 1RM4A 3GRAA 3SKVA 5AVZA 2CLMB 2NXJA 3A32A 3W6NA 4R7GA 1JQKA 3R20A 1OZGA 6LDHA 4TXLA 1F9EA 2H48A 3IPCA 1LI5A 2QMOA 4F72A 5IABA 4Q01A 4FYXA 2DBYA 4ZANA 3FPLA 5FA6A 2DFLA 1DXHA 3G0DA 1NASA 3MMNA 1NXTA 1WAMA 1W0KA 1WVMA 2AFVA 2YXEA 4NMXB 1CD5A 1U5CA 2Q6IA 2XYGA 2FOIA 2I22A 2VK2A 5EKSA 2L17A 3GJ5A 3RKRA 1HSZA 2JFBA 1DKMA 3F73A 1RPTA 1VDZA 2BC9A 2NGRA 5C8ZA 1K8YB 2R8RA 3HPRA 4TL9A 4L9WA 1JQAA 2JHAA 2ZU0C 1QE5A 3O2NA 3U49A 3S2GA 3HA2A 3LPDA 3CINA 3NWJA 3S2ZA 3KYBA 4M8LA 3WHKA 4ZA2A 3W1WA 4UBOA 3G6WA 4C9BA 2CHGA 2PS9A 4OPMA 4G1FA 3T3GA 3VKGA 4EO9A 1RJEA 4G2TA 5JMPA 3U4CA 3HBMA 2QRLA 1E6MA 4QBIA 4R1QA 1I7SB 3H6HA 4HUJA 4CZ2A 2PCLA 1GIAA 4EJ2A 3PLAE 2WFZA 5EVCA 1RWMA 2BBWA 4BLPA 3SHWA 2JBHA 4G0WA 3PGA1 2IIQA 2Z9BA 1BH6A 1PGJA 2NG1A 3I8OA 4X7RA 1F20A 5TSDA 3DZFA 4PRLA 2C2GA 4L74A 4DRZA 1J49A 3QXHA 2BEUB 5EZSA 2G6TA 4ZQHA 4BNNA 5E1MA 1IB0A 1FYDA 1L4EA 1RR6A 1S01A 1Y98A 1XTKA 1GITA 2W2LD 3AXTA 4PBTA 1JHQA 1RTTA 1UFQA 2BLLA 4MTLA 1TECE 3K4PA 3I6YA 5LUAA 2JFVA 4PG8A 3JCZA 2UDPA 4JOCA 4EPXA 1R16A 4UTXA 4CV1A 4M7RA 3EEFA 3O9ZA 4F5YA 4JI8B 4BGDA 1Z47A 2O59A 1JB9A 2ON6A 3AJDA 3D7NA 2Y0CA 3OEHD 1D3AA 1WULS 3P2YA 3WJ2A 1IDN1 3HFJA 1TUGA 3FTDA 4HQFA 3E1GA 4OFXA 1FDIA 1PZXA 2H7XA 2O2DA 4J1TC 4MV5A 3J7TA 5DXFA 4EFKA 5BQOA 4NS1A 1JEYB 4H7KA 1V37A 5CIYA 3GJTA 2FX3A 3EGXA 3UYKA 1LQUA 5FL7D 5K03A 4DBZA 3BB3A 2X5OA 3M4XA 1K2VN 4K05A 1VJGA 3I4FA 4JOBA 2XDYA 5KWSA 2P9TA 2HMUA 2Q3BA 1HE5A 3SVTA 2B1GA 3ENNA 2HWWA 2BGNA 1CVLA 4FT2A 2HF9A 2IRWA 3CONA 1SQSA 3OLXA 4L5BA 4URFA 1G8KA 4O08A 3ZJYA 4C3UA 1VE9A 4AUKA 2O3UA 2WFLA 2HO4A 2MSLA 2FLKA 1NVWQ 1Z36A 1H9BA 1OLXA 3VPAA 3O8CA 2H4WA 1O95C 4Z49A 5M04A 1XN4A 4TMXA 3CKMA 4GWLA 2FE1A 2ECQA 4FDMA 2A4KA 4LJ7A 5LSAA 2IH2A 3FPFA 1PNOA 1Y9DA 1O96B 1T2VA 4M0MA 9MHTA 3T99A 1LBTA 1SO8A 2IQ5A 1YULA 2QMYA 5FFMA 3LVFO 3GOHA 4GXQA 4EA9A 1GQOA 1V5FA 2I34A 3KWJA 2JFXA 4B85A 5LL6P 1F8YA 3UAGA 4IGFA 4PONA 5JXJA 2A2ZA 2J48A 1YB4A 1OLUB 2HF8A 4UM8B 3Q3HA 4EHBA 1DGQA 3ZWKA 3FPJA 4BEVA 3I5AA 4BL5A 4QLOA 3G9XA 2I4LA 3L05A 5AVTA 4CIXA 4DRXA 5IS2A 1HYHA 1KDTA 3DT9A 3JYOA 4YACA 1L0BA 1WHSB 3QRWA 1U9YA 2EKZA 4I08A 2WU3A 3AW9A 4YMSA 2H1VA 3HGQA 5CM8B 4CXMA 4EHIA 4EUSA 1XWFA 4IV8A 4YR7A 3UZUA 1Z0IA 3KOUA 1H9CA 3IAAA 4LKOA 3X1MA 5FWAA 1DXQA 4FGJA 3JATB 3S2IA 4MRRA 3V4VB 3M70A 4KRYA 4HDKB 1GL6A 1HZJA 3CF4A 4AO8A 3FHOA 3NC4A 2B98A 3VVLA 1ZX1A 2ZAOA 4NL4H 3WYNA 2AMJA 3QELA 1GUDA 2VH2A 1EWQA 2YASA 2FQYA 1TMOA 1JEEA 2C84A 4HEA6 1OBCA 1O0SA 1G0NA 2WILA 4HNHA 4JAVC 3BD6A 4O0LA 1EFCA 4JEMA 4NG5A 5HFAA 5AJZA 3RF6A 2OFWA 1TT5B 3B1WA 4FHGA 1GN8A 3DHEA 1DFIA 3FCSB 5FO0A 1KPHA 2D2VA 1YZVA 1E1YA 2IP1A 1CNFA 2BF7A 4LJ5A 2AT1A 3BCRA 3H6KA 3N6XA 4ZVOA 2CJXA 4FKZA 2QPAA 1IPEA 1JTVA 1NJ8A 2CYBA 2MR5A 5E0OA 4B40A 4LHYA 1O95A 4Z8YA 1W29A 3W5IA 2Y8EA 1OFUA 3PQ6A 1NWHA 2H06A 2CHQA 1JIXA 5KREA 3TTSA 4GZLA 2Q6OA 3F96A 3SE7A 2PXXA 3KM0A 2X58A 3AH8A 4RH1A 5IAJA 1X7ZB 2JZOA 1FJ2A 2ZUVA 3T7KA 3AETB 4Q82A 2WUEA 4G0ZA 5CPFA 4BUJA 1GGEA 3DYBA 3DPIA 5EESA 3TEJA 4KRGA 3U3MA 3NHAA 1X87A 2XT6A 2QTRA 1NBMA 4I5FA 3L6CA 4LYEA 4WOKA 4F6RA 2C4UA 4HPXB 2AQIA 5BSKA 5JBQA 2ZIZA 3E82A 3K92A 4QUBA 4AZVA 4Q4JA 3GRUA 2ZYTX 1F1BA 1A69A 4OFWA 1IN5A 2GAAA 4ZPXA 4BNYA 5CRIA 2FMTA 3FYCA 4H17A 1ZAKA 1A0OA 3MJFA 3MM4A 1RPZA 4DQVA 4QNRA 1NBAA 3PUXA 1G21A 4CV3A 1E89A 1SUSA 3STWA 1N6IA 1L7XA 1QIHA 1TJPB 2XIJA 3T7AA 2V54A 4MV3A 4QM6A 2NU6B 2YBDA 3NEAA 4QDTA 3AEUA 1FX1A 2PZLA 2QLFA 1EZ1A 4HYTA 2C8VA 1R9JA 2YRXA 4R6WA 2PFGA 1HZZA 1XD2A 4GDFA 1CR0A 1XZ8A 2AG5A 4CKBA 5GV8A 2DHQA 4PC2A 2ZDHA 5JSZB 1HQCA 3NHBA 2H2FA 3O3NB 2PS3A 3KLBA 2JCXA 2AA3A 2AFHB 2WVGA 4HH0A 4JYCA 1W0JD 2VYQA 1QYXA 4ALMA 1X7YB 4XSVA 1I51A 5DCWA 3TNDA 3V2HA 2PBFA 2ZSFA 1M54A 5K05A 4QTTB 5ALDA 4EECA 4FOSA 3ZW9A 1N33B 2WVHA 1Z33A 5IDQA 5JNLA 5EKXA 1UBCA 3CT6A 3WI7A 3E0QA 4B6SA 5BW8A 4KE7A 5JT1A 4JBNA 1DJLA 3TINA 2H3HA 1L7DA 4B32A 2GPTA 4C4PA 1TLLA 1F12A 2XDWA 3SYRA 5KWEA 4HDSA 2CC2A 2QU7A 1WRBA 3WZ2A 4LUCA 2I8CA 1P45A 2O4UX 1L7OA 1Z6GA 1CUVA 2XVAA 2Q5FA 4OI4A 4BJ1A 4BQEA 1TFUA 5I3CA 4WMLA 3BXZA 1DAMA 3ZU4A 2XMRA 4ZKDA 5H02A 4CKXA 1ORWA 2OESA 3QE4A 1NJ6A 2JDID 2QIOA 3L6RA 4ME6A 4TTRA 1AUVA 2J0UA 1HV8A 2ZJYA 4N9QA 3DV0A 4E5VA 2C3UA 2J5QA 3KPJA 5B55A 2UYHA 5LB4A 3R44A 4HAIA 1TU0A 3ZHYA 1EJBA 3KWMA 2BJWA 4ITRC 1CY0A 5IH7A 4Y0NA 3IKTA 1P62B 2IYZA 2G7ZA 3QHAA 1XX6A 3EVBA 3NNSA 1SR8A 3SEFA 4XVCA 1J6UA 1PDVA 3DCJA 4PLFA 1H2FA 1PJ4A 3VNVA 3VNRA 2EOAA 5CBPB 1P4GA 1S2OA 1I5RA 3E5NA 4RLSA 1PZNA 1RRMA 4TXJA 3QLTA 1E2GA 2QN3A 4CLOB 2E82A 2FFBA 2LDBA 3NC1C 3U13A 3CB4A 3NS7A 2G1UA 3ZCXA 3V6LA 4C21A 4PGMA 4DLTA 4YH1A 4XQEA 1KHHA 4K0KB 1FX0B 3W04A 5E3IA 1DRKA 4D5EA 5IBCA 3ND5A 4OFBA 3CTPA 2UKDA 2A0UA 4FP9A 2J6HA 2YS7A 2AZ4A 4II3A 4UAGA 1TM4E 2YH2A 1Y4ZA 4GG1A 3UVEA 1B6SA 1FW6A 2A92A 3FIJA 1TVMA 1JAIA 4B8WA 1SBZA 2F8MA 2BGRA 1G6HA 3O8OA 1C8KA 1GAXA 1FMCA 5A02A 1GGKA 3A6KA 3HU1A 3Q7TA 2N1BA 3KBBA 3T7DA 4Y7DA 3WLQA 3Q98A 1C3LA 3MCAA 1R4MB 3N07A 4FE4A 4D46A 1UMCA 4N9WA 5SZJA 4G5GA 2LTAA 4DM3A 4WCDA 2EZTA 1OW3B 4LBZA 2CFSA 1J0BA 3OC6A 4I9NA 2WYHA 3BYZA 2YXBA 5DASA 2HIGA 2XRFA 1JAXA 1U4OA 2WOJA 2CJPA 3COSA 2CV2A 2HNKA 1G5PA 1T0UA 2R7MA 1R6XA 1JLKA 1QKKA 4R68A 5JMTA 1G4AE 5AT1A 4K7JA 4DV4B 2IZ5A 5CX1A 3RYCB 3BILA 2WF9A 3AVTA 1NG1A 1D5CA 3T9BA 3A4MA 3I37X 4RVOA 4YV0A 1YJXA 3N0XA 1NWCA 2GNAA 3O31A 4GX0A 2X0JA 4QGBA 5A06A 2C0CA 3Q9NA 1R8JA 1SU8A 3THXA 3V42A 3EDQA 2QRGA 1IVYA 1GPMA 1TO6A 4B3JA 2XBMA 2PS0A 3O1HB 4HGPA 4PICA 5JSKA 3VKVA 4N7JA 2Q28A 1RAGA 5T57A 2E1RA 3H2GA 5IUJC 5BV2P 1H6DA 3TBKA 2PSDA 3RFTA 3DMRA 3O7WA 4L72A 4E4RA 1L1EA 3LRXA 5JTTA 1U2GC 2RGRA 2O8EB 5FPHA 4O0MA 3T9FA 1KIAA 4EY7A 1FTNA 2Z5LA 4OB6A 1CRWG 5CX1B 5BR7A 1JIKA 2ZI4A 3Q15C 3B6MA 3HY3A 4S1WA 2XTMA 3D8SA 3IIJA 4LZJA 5JSYA 4A92A 1HDRA 1QZUA 1SMKA 1CVRA 2X0RA 1XROA 3AP1A 1L1QA 1XZCA 3AQIA 3KBOA 3OPVA 3PIRA 4WLUA 1Q74A 3N53A 4OO3A 1JHPA 4YREA 1QP0A 4PINA 3SHOA 2H2WA 4R0NA 1EINA 3KYJB 3MT9A 1E4OA 2FZEA 3CWCA 1ZSYA 1MB0A 4RZ2A 3WQBA 5FA5A 1UKEA 3DHNA 3Q5GA 2ZWIA 2TSYB 5F3WB 1QANA 3G3EA 3QV2A 1JEJA 2FPKA 1TGYA 4R2MA 3UWKA 5HZHA 4GXNA 1C3OB 1C81A 3AGQA 1J00A 4NTZA 1IXRC 1UK6A 4G9BA 5FNZA 5ALKA 1E66A 2WBLC 3PHBE 3UK1A 1UOEA 2DF8A 1CLEA 3U40A 1ZGAA 4B3SB 3ANLA 4IVRA 1PWEA 1GGNA 2ZIXB 3JQPA 3S8EA 3HKCA 2HRQA 3F4BA 4M0EA 4QDKA 4R3NA 2PUCA 5GADl 3CH7A 2VQEB 4O1IA 1B43A 3MUFA 4JUIA 3GCXA 1Q0RA 2DBRA 2PZAA 4TT3D 3SS9X 5DNYB 3P9IA 4HVAA 4OLFA 1R0RE 1GWNA 1VPVA 1KAMA 2XECA 4MS4A 2TRSB 3DZGA 2XZPA 2P1DA 3R23A 2NVWA 3HEMA 4JVNA 4MRSA 2Q5EA 4Q7LA 4ZI7B 1IATA 1U5BB 4DLSA 3FBTA 3I0MA 2HA7A 4WXRA 4JDUA 4F6RB 1WETA 4CKZA 1ORVA 1KI4A 1NNEA 4FMPA 3ZQJA 2Y67A 3VVMA 1FUKA 4MW4A 5DTQA 3K32A 3NKVA 4IGAA 5DB4A 2G80A 3HUFA 2WINI 5MGBA 2XUKA 3G9ZA 3KDAA 3R0JA 1HT3A 1Y8ZA 3PLNA 3DFFA 4RVCA 3E84A 3N39C 4QQKA 3EZNA 3F1KA 1Y33E 4LAFA 1RLTA 4II7A 4WCFC 2ADMA 2VPYA 3NBQA 5PNTA 4BTVA 4CN8A 4N41A 1W93A 4XA8A 4KSYA 1GNPA 3K05A 5K3EA 1HEUA 2R8YA 4OAPA 1RI2A 4EDFA 1PGNA 4JEHA 5KKNB 1I6MA 2DUWA 1ENPA 1YZHA 4IEIA 3GVPA 3MAAC 3HUDA 4J2HA 4IYRA 3TLJA 3OQIA 1DOHA 1T25A 4BFTA 1GZSA 4M55A 5CA0B 2Q6VA 1NYRA 2YZGA 3GGPA 3TIFA 5JOQA 1BDHA 1CDOA 5JNSA 1R8YA 4DJJA 1X7YA 1G8HA 2FEMA 2ZJ7A 4C3ZA 3WQQA 4PLCA 4Y7CA 1XEWY 1NAHA 3TO5A 2NMVA 1PFKA 3N0WA 1SCAA 5F33A 1IPHA 1IAVA 1X8JA 1G0OA 1JR2A 4LJ6A 2IPXA 2A5JA 3PC4A 4RYDA 1IJFA 4UZEA 5FQNA 5TJHA 3LT5A 1S3GA 4E31A 5GTDA 1NY6A 2QPOA 1Y1TA 3R7DA 1WPQA 1YB5A 3OM9A 5GAJA 3RT7A 3SF0A 1W6RA 4P7GA 3H9BA 1NT2A 4K8RB 1JJIA 1CV2A 2C2KA 3HWX1 4WFJA 2JGKA 2DZDA 4WH0A 4QULA 5LQDA 4UHFA 2GN1A 1VPEA 5BXQC 4LFAB 1XVLA 2H1OA 3L4KA 3RWBA 3H5WA 3IPLA 4LJKA 5I47A 4Q1EA 3UH1A 3VISA 3JYLA 4XJXA 5EJAA 1E7RA 2O0MA 5I9TA 3PQ7A 1LRLA 3W34A 4B3XA 2I7CA 5DHFA 4GO1A 4N0EA 2BR4A 4MR8B 4Q1AA 4E2YA 3AJ8A 4ZXFA 1U2DA 2I3BA 3I73A 1E3MA 1XCOA 3JRWA 2H6EA 4R2IA 4JBXA 5LZ7A 2IOFA 3WYCA 1M34B 3BJMA 1T4GA 3DXYA 3VI3B 4W5TA 2BR5A 1U3TA 5JJBA 4N01A 1EZZA 4Z3DA 3TAUA 4PFQA 1XLUA 4LYJA 4QC2A 3I0NA 1N2CB 1OT5A 2PT6A 4DWVA 4H6PA 1IRIA 1FC0A 1SY7A 3DC2A 1QONA 4WCFA 3VO8A 1NMXA 1UKBA 1D0IA 3OAAA 4JXZA 2HTEA 3P9XA 2BEUA 1UM9A 1Z7BA 2EQAA 4M8IA 1JJBA 1PLJA 4KLRA 2EJBA 1UZMA 3LF2A 5H70A 3EVAA 4CM3A