3PDJA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with 4,4-disubstituted cyclohexylbenzamide inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
272
structure length
272
Chain Sequence
QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Optimization of Novel 4,4-Disubstituted Cyclohexylbenzamide Derivatives as Potent 11beta-HSD1 Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 101
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pdjA00
1BDBA 1C1DB 1Q7GA 2BH9A 2AE2A 4E2YA 2I66A 1OFGA 4XEHA 5GZ1A 3KBOA 1LLCA 4AG3A 4WOKA 4NG5A 4FS3A 3TRIA 3ZHXA 2D2IA 3GC6A 4YWJA 3DTYA 4MIYA 3NTQA 1PGPA 4AJNA 3BTSA 1CDOA 3OEYA 3CZMA 1Z45A 1M66A 4RVGA 3U49A 1I24A 1ZK4A 4MDHA 2QHXA 2YDYA 3GAFA 3KB6A 4WEQA 4EJ6A 3T7CA 4FC6A 3GDOA 4R4JA 4I9UA 1SBYA 1PJ2A 1LQTA 1ZMOA 3I9KA 4TRJA 3WJ7A 1HETA 4NH4A 3LC7O 2EIHA 1YL7A 4PLYA 4BNFA 4E31A 3DDNA 5AQ1A 5CDGA 4CQLB 4TVOA 3ZU5A 3ZNNA 1JVBA 1NM5A 1R15A 3NAQA 4LMPA 3WGYA 3KV3O 4XB1A 4B8ZA 4UAGA 3PLNA 1H6DA 3DWFA 4B8WA 1KERA 1NTOA 3QWIA 3JQAA 4WCFB 3HADA 1GTMA 4UEJA 5TLSA 2O2YA 4QO7A 3EVNA 2G76A 3OEWA 4D3FA 2NU6A 1F17A 1C0KA 4EUEA 4PLWA 2I76A 1PWXA 2OP0A 4M87A 3MJEA 5JDIC 4OYRA 1MG5A 1B7GO 1L1FA 1PWZA 2Y1FA 4S1VA 4B7UA 4DMLA 3FCOA 1YE3A 2VHXA 1ENYA 3GUYA 3L9WA 1B3BA 3HDQA 2CVZA 3JQGA 2VT3A 2ZTLA 4D43A 1U7TA 1GYQA 3H5NA 4PVDA 3CEAA 1QP8A 2FN7A 4F45A 4F46A 4E0BA 1E7YA 2QRKA 2D59A 5CDSA 4E5PA 4PRLA 4FDAA 5BR7A 3ICCA 2B5WA 2RH8A 1QV7A 4Y6PA 1J5PA 4JXKA 3UFXA 4W4TA 5IF3A 2DBQA 3OSUA 2FP4A 3AM5A 5JPIA 4NR0A 3RUFA 2OZPA 2V6MA 3AUUA 1ENPA 2JAHA 1HYHA 1Q0QA 2W2KB 4EBFA 1H6AA 3QIVA 1EFLA 4H15A 3WNVA 3G1TA 1NAIA 3SJUA 1IZ9A 3C7DB 5KJEA 2ZTVA 1Q0HA 4PG6A 4KTVE 3UCFA 4WK6A 3VDQA 1YDEA 1Q1NA 3ITDA 4G5HA 1K6IA 4KMSA 4LCEA 3UF0A 4B79A 3WTBA 1SB9A 4CMGA 1N92A 1W73A 1Q2XA 3CH6A 1UXHA 2UUPA 4BQRA 4YXFA 3GMSA 2OL4A 3RJ5A 4AJJA 2X1HA 2O3SA 1JWAB 1I36A 2E6UX 1I30A 2Z5LA 1ZSNA 3EHEA 2JCVA 1YS4A 4KWHA 3I1JA 3RBXA 5ITWA 4ZHSA 3SC4A 1IY8A 5CPFA 3U4DA 4P4NA 3E6AA 1PZFA 4XYGA 4URFA 3EZYA 4ITUA 1JAYA 3C8MA 1LNQA 1GAEO 3FBTA 4ND4A 3V1UA 5I7SA 4P4LA 4AJ4A 1IHYA 4HFNA 1KOLA 4PFJA 2Y1CA 4MVJP 4BVAA 1DAPA 2AW5A 3PHIA 1ZK1A 3OJEA 3IUSA 4KTTE 1UZMA 3GNQA 3WBBA 4CM4A 1SNYA 3JQAD 4YB8A 4RQTA 4IDBA 3FI9A 4TZTA 1TEHA 5T5QA 2D1YA 2YY7A 3TL3A 4CM9A 4DLLA 4RV9A 3OJOA 1I3MA 3WJAA 1H0KA 4DPMA 3GGGA 1YDWA 5B4TA 3ZV5A 3AOGA 3DMTA 3MTGA 3L4BC 4XJSA 3RBVA 1E3SA 5JBIA 1RYEA 4DRYA 1YH3A 4IJUA 5HWSA 4ZN6A 1WLYA 3PZRA 1UDCA 1LSJA 4RLHA 2AEFA 3QLJA 4OXNA 4XQCA 3ZCXA 2PFGA 2PWZA 1IUKA 2JKVA 1F8GA 3LK7A 3DAFA 4WKGA 4KZPA 4OSOA 1B8VA 2Q4EA 3JD4A 3OIFA 3D0OA 4R1NA 3HB5X 4D41A 3MJ4A 3RKRA 2PNFA 2VUSA 4KUGA 5CDTA 3N74A 4CV3A 4R1SA 4CMJA 2NSDA 1X0XA 4D3SA 3U5TA 3EYWA 4TMFA 4A26A 4G65A 2OHXA 1QG6A 1X0VA 4YJFA 4IY1A 4J0EA 3BXXA 1ISGA 2GZ1A 4J7XA 1J4AA 2GD1O 2P4QA 3MJSA 1GCOA 1MFZA 4PLPA 1NAHA 2GSDA 5I7VA 3HHPA 1UUFA 4U6SA 1R6DA 2H6EA 2YW9A 3LLVA 1V3TA 4MJLA 4K6CA 1ARZA 3VPSA 3JQAB 5IN5A 2GNAA 5C3MA 1U5AA 3IIEA 1KY4A 3ENNA 4IINA 3KYDA 4HWKA 1PR3A 1T4BA 3GMDA 4JX8A 2NTNA 4R01A 4M1QA 4KWIA 4BNGA 3PLRA 5BSEA 2JHGA 1DC5A 3KYDB 3A28A 4J6FA 1H9BA 2AXQA 3PPIA 1YVEI 3GVXA 1FF9A 1R12A 2BI8A 3BMQB 3RROA 3ZNQA 3JYQA 4BGIA 3WNQA 1AXEA 2HK8A 5JC8A 3ANLA 4O6VA 4Z6KA 4XGIA 3TFQA 1VSVA 5I8WA 3DZJA 1YL6A 4QO8A 2WD8A 4CLEA 1LC0A 2Q1WA 4I5GA 3GG9A 3SEFA 4BO4A 2VOJA 5AYVA 4E33A 5DZSA 4M49A 2POQX 4CMBA 1D1SA 1NXQA 4CMEC 1NQAO 2IEBA 3GN2A 3K2BA 4YPOA 1E6UA 1WP4A 4FPXA 4MKXA 3EY4A 4IPTA 2C82A 3K30A 4BNIA 3I52A 1NQ5A 3C7AA 4OHUA 2WDZA 4WE3A 1IYZA 5A9SA 3IMFA 2ZB8A 1MUUA 4DL9A 2EKQA 4BNNA 5KCZA 2RBEA 3OBBA 3HG7A 3ICPA 4LRTB 4CL3A 1HDXA 4AJ2A 1HDCA 1YJQA 3OQ1A 2C20A 4NIMA 1XU7A 3VVBA 1RM4A 5JMPA 2FPGA 3F1KA 3RCBA 5IXSA 5KJCA 3GVCA 1HL3A 4ND3A 4B7XA 3H9UA 6LDHA 3WGIA 4LVUA 2VOEA 4RJTA 1IPEA 4L4SA 1JKIA 1A4IA 1UDBA 2FPPA 2BGLA 3DHEA 4J1QA 2X6TA 4NQZA 1DFGA 1DFHA 3PDUA 1MG0A 1NWCA 4L8VA 4WNIA 4YTEA 3LLSA 4PVCA 1E7QA 1XHLA 3WFIA 8LDHA 3JQ7A 2G1UA 3DONA 2ILTA 2GF2A 3NDIA 4YAJA 1X13A 4OL9A 4R51A 3BMNA 1SOWA 3PQFA 1AHIA 3JD3A 4DA9A 1ULUA 5JSFA 1B8PA 1V8BA 1A4UA 1GQQA 4M55A 4MKZA 2VYNA 1YL5A 4JCOA 2CF6A 3GN1A 4RVHA 4BNXA 3ZWCA 3SC6A 1MGOA 3E9NA 4A0SA 4XYLA 5L4NA 4OIMA 2DAPA 3PJEA 4NBWA 3QHAA 4AJEA 2CY0A 1I2CA 3JQ9A 3VHRA 4R5MA 3SVTA 1X7HA 4XR9A 4M54A 1JLLA 4TQGA 4F6LA 1ADCA 3ZHYA 1FDWA 3K5PA 3P19A 4G81A 3E48A 1PSDA 1I3LA 4TSKA 1ISHA 3IUPA 1CF2O 2Y99A 2C59A 5G0VA 5J23A 2NLOA 2YV1A 1MP0A 2PD3A 1P1KA 1E7MA 3AU9A 1O0SA 4TZKA 1Y81A 3K9QO 3RUEA 1E5LA 3FTPA 3NT5A 5EERA 1GADO 1SZJG 1M2WA 1Y7TA 1GPDG 4DIOA 3MWEB 1E3EA 1FMCA 3KHUA 4E5KA 1Z73A 2EHDA 3GA0A 4R16A 4WNCA 3WFJA 3F4BA 3ZV4A 4LW8A 2B4QA 1XSEA 3DBVO 4XR4A 3AK4A 4R1UA 1E1MA 2EG9A 3LDHA 3PVZA 4RPLA 1GV1A 2YFQA 4TWRA 4JLWA 1YRLA 3AI2A 4RPKA 5IDWA 4LK3A 4I1IA 1UR5A 3N58A 2AEMA 4KQWA 5A5EA 2VTDA 4JGBA 2CDCA 3ZWOA 1YBVA 4I08A 4JN6B 1JQBA 4OXYA 2GZ3A 4D3DA 1DC4A 3LT2A 4JBGA 2BGMA 5F1OA 4YRAA 5CEJA 3JYNA 1SEVA 2YJZA 1D1TA 1JVSA 3WOHA 1Z6ZA 3GT0A 2EF1A 4ND2A 3DTTA 5KJ1A 3F1LA 2GN4A 2C2YA 3B6ZA 3UKOA 4TRRA 1JAXA 3BMQA 1R0SA 1KIFA 3HSKA 4PG7A 5IDYA 2IXAA 1GUZA 3LC1O 1CETA 1ISIA 2GLXA 3R3JA 5T8KC 2AE1A 3QWBA 4QQRA 1PL6A 3DEYX 1GY8A 1AUPA 2VYND 1LDMA 3FRJA 4D46A 5FF9A 3RJ9A 3N7UA 2VWQA 3GGOA 3I9MA 5G4LA 3FTNA 4WCFA 1R0KA 4CV0A 3OFSA 3ZV6A 3K6JA 3WLEA 1HDYA 1PJCA 3WYCA 1Q7BA 3ZWVA 5GMOA 4UUNA 4OMUA 4MP3A 2CFCA 4DPLA 1U2DA 2OBNA 3HUDA 3WGQA 2DTDA 5I9NA 2EJVA 4KQXA 5L7TA 2XAAA 1KVTA 4OO3A 1EVJA 3ULKA 1ZXLA 1O6ZA 1AHHA 1E77A 3U09A 1KVSA 4S3MA 2D4AA 1QYWA 3SJ7A 1MFPA 1MV8A 1UP7A 4CLRA 2NU7A 2F1KA 4R3NA 5I9LA 1V3VA 4O5OA 3KYBA 1U3VA 5HM8A 4RPGA 1AE1A 1E7SA 5TJHA 4PLVA 4WLUA 1NHGA 1DJNA 5DCUA 3WG9A 3GH3A 3RC9A 3D3WA 3JQFC 4RORA 3V5NA 2QG4A 4DLBA 3FWZA 1DSSG 4FFPA 4A73A 1E5QA 1BVRA 4PGFA 4K28A 4Y6RA 4E2ZA 4M89A 3NJ4A 2CNBA 1QXSA 2JD2A 5K0ZA 5L4LA 3C1AA 3G3EA 3JSAA 5FYDA 1OI7A 5G2OA 2WSBA 3S55A 1ZZEA 2E37A 3KXDA 1Z74A 1VKOA 1VPDA 4NPCA 2LDBA 1ONNA 4JP3A 3ZWXA 1XGKA 3DZBA 3DFUA 2EWMA 5L45A 4HADA 3ROKA 2DFDA 2ZB7A 1PGNA 1VM6A 5G4KA 3DBLB 3IJRA 3PGXA 5F21A 3BHMA 1NQOA 1PEDA 3WMWA 2O23A 2VWPA 1C0PA 4IIVA 1DRVA 4XDYA 3KUXA 3PJDA 4ZQFA 2HMUA 3UN1A 1ONPA 3VDRA 3BTOA 4BNTA 3KLPX 4X54A 2X7HA 1U9JA 4B3JA 4FW8A 4BO0A 4J7CA 4CM4B 5A05A 3AFNA 4ALIA 3UICA 4IUYA 3GGPA 3QY9A 3NGXA 2I3AA 1XIVA 2XXJA 3OA0A 4B4VA 2GPTA 1P1FA 2Y1GA 1UH5A 1HDGO 1CRWG 1Q7CA 3S2GA 1P0FA 1CERA 4II2A 1PQPA 1LUAA 2D3TA 3FNFA 2I65A 1ISJA 2HMSA 2B0JA 3JQBC 7ADHA 2QX7A 3BTUA 4FGWA 1PZHA 4FR5A 3UCXA 4E5YA 3NYWA 2UDPA 4ALNA 1K6XA 2X23A 3Q2KA 1DRWA 2B35A 4UREA 1QMGA 4A5OA 5C7OO 5CHEA 3KLMX 1LX6A 2QZZA 2JFHA 2PK3A 3PGJA 4CMHA 5JDCA 2J5KA 4FC7A 5COAA 3W1VA 5A5FA 4JJIA 3C1TA 5A9TA 4XQGA 3WMXA 1EZ4A 3SX2A 1QLHA 1HSOA 3DL2A 1K89A 3P7MA 3QE3A 4J91A 5JO0A 2VUTA 5IZCC 4C7JA 2WE8A 4GBJA 3U62A 3GZNA 5ITVA 1ENZA 2X0NA 1WDLA 2AQ8A 2QW8A 2UAGA 2HMWA 4WLFA 4EUFA 3PWSA 3HZZA 2O3QA 2ZYAA 3EC7A 1Y1PA 3OA2A 2O3UA 1A5ZA 3ZH2A 5JAQA 1Y6JA 3BHJA 3TF5A 5TQVA 1ZIDA 1UAGA 2DU8A 3TZQA 3GZNB 4Y67A 2V6BA 5HS6A 4YT4A 2X9NA 4UULA 4BV9A 1EQ2A 3UHAA 4LN1A 1H93A 5DBGA 3NDRA 4L75A 1KC1A 1YOVA 4BNLA 1U7HA 1DRUA 3ZGYA 2G5CA 3I83A 3QVXA 1WMBA 4CM8B 4KDEA 1EVZA 4PLTA 5BSGA 1LQUA 4GAEA 3L0DA 4YAGA 1EMDA 1N5DA 1X7GA 5L53A 4IIUA 2VCYA 1N8KA 1X14A 4ZQBA 3DB2A 4MVJD 3ZV3A 3INRA 4XWYA 1GFSA 2A4KA 3H7AA 4IMRA 2YV3A 4Q3AA 3O8QB 3GPIA 3W4KA 1C14A 3WGGA 1FDVA 2WD7B 3IAHA 1XKQA 2Q2VA 4RDHA 1HEUA 1PJLA 2GR9A 3GLQA 3QWAA 4Z3KA 4MKRA 1ZEMA 1ZXBA 4MVJF 4HXYA 3VZPA 4FJ2A 5A02A 2EKLA 4F6CA 1ZH8A 5KVQA 1DIGA 2VZ0A 4CUKA 2D8AA 4Z9YA 4GKBA 4NMHA 5ENDA 3RASA 2IXBA 4FOSA 5MDHA 2PZKA 1NWHA 4MP8A 5KIAA 2FRDA 4YDRA 1YKFA 3CIFA 2Y05A 4CMIB 1NX6A 4IS2A 1I0ZA 4GX1A 1G6KA 3FNEA 4RF4A 4R54A 4B4OA 1KEWA 3JD1A 4LMRA 1WXDA 1DBVO 4A2CA 3KETA 1LRKA 3KYCB 1ZNQO 1DC3A 4WASA 2WYWA 1CWUA 3DBRA 1BMDA 3JQBA 3PYXA 1U8FO 1FDUA 2NM0A 3RFTA 1ZMTA 2B69A 3DOCA 2DC1A 4ZVVA 5LC1A 1D7OA 5ES3A 1HYEA 3ZWYA 2DPGA 4O0LA 3WIEA 2GDZA 4XYEA 5TX7A 3GF4A 1U28A 3NKLA 5I9MA 4MINA 3E5MA 3JQ6A 1W8DA 4JIGA 4YYZA 1XA0A 2NADA 3W8FA 3ANMA 3PHHA 2EGHA 3HDYA 3JV7A 4NFHA 1MXFA 2EP7A 4BNJA 3KZVA 1O5IA 3HN2A 1Z7BA 2WEKA 1TT5B 3QA9A 2I67A 3ROPA 5EQDA 4RLSA 4RVUA 4PLZA 4CM5A 1T1SA 4FFMA 4O59O 5CPBA 2Z95A 3NRCA 3T4EA 1HE3A 4FB5A 1YB1A 2Q50A 2X5JO 4IBOA 4MIEA 1P31A 1W4ZA 4ZQEA 4EEXA 5T6BA 1RKXA 3JQ8B 2HCTA 1FXSA 3C3XA 3AJRA 2YZ7A 3VPFA 5C5IA 1DXYA 5JW6A 1JU9A 3OJLA 4P4GA 5JDIA 3O4RA 2H5LA 1CQJA 2ZYDA 4YEDA 4PLCA 2IEDA 1ULSA 2HRZA 3L4SO 4CMCA 1IB6A 3H9JA 5L4SA 3X2FA 5JAIA 3M1LA 4LSMA 4FGSA 3TDKA 3RUHA 1LDNA 1T2AA 4BNKA 3LT0A 4FIZA 4CV1A 4CMAA 4JQCA 4E21A 3PFWO 3PFFA 1P74A 4MP6A 4ZA2A 3JQ7B 2VUUA 3GAZA 5TIIA 1CIVA 1R16A 1U4OA 5LCXA 2ZB3A 3NDJA 1MX3A 4BNYA 4Y98A 2VYVD 2CDBA 1KVUA 4BO3A 3GDGA 4BNUA 3UUWA 1Z75A 2VWHA 1Y8QA 4U6QA 4BO5A 5A3VA 1K2WA 4XX0A 1TA4A 2YQ4A 4CL8A 4DWVA 4CJXA 4LSWA 2HUNA 1GEEA 2X22A 3ST7A 3WGOA 1F06A 2BRUA 2A35A 4PIVA 5B1YA 3DO5A 3GUCA 3I9NA 1UAYA 4HFJA 1T1RA 2EW8A 2FHSA 1DOHA 2FZWA 3VTZA 3ASVA 3D5QA 3ZZNA 1NBOA 1BHSA 2NV6A 4NNJA 1TI7A 2O4UX 4GVLA 4IXWA 3PP8A 1MLDA 1PS0A 4WCFC 5BNTA 1WDKA 1EE2A 3TZ6A 1BXKA 1RWBA 4DYVA 4J0FA 4CQMA 2C07A 5IG2A 5F3RA 3OHSX 2DBRA 1I3KA 4GVXA 5F5LA 1YQXA 2SCUA 4GLLA 2B5VA 2EV9A 5ADHA 2NVUA 1QYCA 1M76A 3SLGA 4AJPA 1GR0A 1YXMA 1SAYA 3DFZA 5KKCA 5CG2A 1QORA 1U5CA 4NBVA 4DC1A 2OORA 3FD8A 3WS7A 3JYLA 2NTVA 2DPHA 1W0CA 4J49A 4FJ1A 1WPQA 4QSMA 1XDWA 4BGEA 4HFRA 4JP2A 2UUOA 3H3FA 5CG1A 2HDHA 2IZZA 3BAZA 1DO8A 3G1UA 4XB2A 3H2SA 1QKIA 2B4RO 2P91A 3AUSA 4RCVA 5B4UA 2TMDA 1MA0A 1YQGA 3QSGA 5BNIA 3ONEA 4AJIA 3M6IA 5DULA 3S2FA 2QYTA 3L9XA 4OM8A 4QECA 4ZD6A 2X0IA 1PZEA 1LEHA 5KVVA 2BHLA 1T24A 2OO5A 4BKUA 1DPGA 3WX0A 1A27A 1BXGA 2B4TO 3UVEA 1DHTA 4RQUA 1V9LA 4XDZA 1PQWA 1HXHA 1BWSA 3LYLA 4PLFA 5EINA 3INGA 1F14A 3BA1A 3CSDA 3GR6A 4RGBA 2BLLA 1YBAA 8ADHA 4HX5A 2I99A 9LDTA 4AJOA 3FSRA 2DFVA 3M2TA 2X8LA 3QV1A 1ZSVA 2O48X 1FJHA 1F8FA 3RU7A 1A71A 2AHRA 3U9LA 1P1IA 1ML3A 4D0SA 5G4KB 3E8XA 5G0SA 1GPJA 1HSZA 2BFMA 3CE6A 5IN4A 5IDXA 3WYEA 4DYDA 4GSLA 4J3FA 4M8SA 3OIGA 4NJMB 4OSPA 5H83A 4PCVA 1K6JA 3MJCA 5FFFA 1E1KA 3Q9UA 5THQA 3AM3A 3BMCB 3FNGA 4WPGA 1TXGA 4DTIA 2FY8A 3DHNA 4EDFA 4RF3A 2J5QA 3U3XA 3MEQA 1N7GA 1IE3A 4J1TA 3BMCA 5A04A 1O95A 2B36A 2GASA 3G0OA 3G49A 2DBVO 5TRTA 4CLXA 1LDBA 3KYCA 1HT0A 1E3LA 2IE0A 3E1KA 1KVRA 4RO0A 3ZU2A 2EJWA 1BTOA 3TFOA 3K73O 3IP1A 1EBUA 3OQ6A 1LLQA 1GUYA 2YUTA 3VZSA 4CLRB 1WNTA 3CZRA 4DQUA 4ALKA 3H9EO 4OH1A 2JAPA 3KVOA 2CD9A 1YQDA 3CKYA 4OXKA 4MO2A 1UDAA 4DC0A 5JLAA 1B14A 1DFIA 4DBVO 2P9CA 1YGYA 2EP5A 3MJTA 4DGSA 1PJTA 4ND5A 4UVIA 1B2LA 1GL3A 1E3WB 4WECA 3WQQA 4FOOA 4AJ1A 1HE5A 2W2LD 4RDIA 4NU6A 1EDOA 1TLTA 4XGNA 5BSHA 2OOSA 4N5MA 5COBA 4BUCA 4CQMB 4H16A 5JNLA 5BQFA 1G0NA 4O63O 1DHRA 2CVQA 3L07A 4XGKA 3V2GA 1A9YA 1XQ1A 3W6ZA 4I8XA 5ILOA 1D4FA 4K9DA 1NASA 3A06A 3WICA 1T2CA 3LZ6A 4JNKA 5THKA 3AM4A 1T2EA 3KSDO 4J1NA 4F3YA 1B3RA 3VH2A 4GWKA 2ZCVA 1M67A 2J3KA 3WGHA 4GGOA 1RJWA 2J5RA 1DIRA 3DZGA 4XQ9A 5A03A 4HUJA 4J4HA 3A9WA 2Z1MA 3SBOA 5JY1A 1A7KA 1V6AA 2Y67A 3GVPA 1HLPA 2OP1A 4HP8A 5ER6A 2O7SA 5T8KA 5L9AA 1K5HA 2HMVA 2Q4BA 4BO2A 4XA8A 4E4YA 3PIDA 4R69A 2E48A 2RHCA 1VL6A 1H2HA 1O89A 4GH5A 5JYEA 4IGEA 5CAEA 1ZUD1 3WSVA 3GNSA 2Y68A 4NFYA 4CLOB 3F4LA 3EAGA 3RWBA 3D1LA 2HSDA 1LC3A 2JJYA 1BDMA 2VRBA 3ZNOA 1DEHA 3OM9A 4EITA 2HO5A 1G0OA 3FBGA 4DBZA 3P2YA 2EEZA 1KBZA 1P77A 4BO9A 4BO7A 1BXGB 4QTZA 1X7DA 3NUGA 2AMFA 2UV8A 3GHYA 1HE2A 3GDFA 4PZDA 5AVOA 4NJOA 4GGPA 4IXTA 3ADOA 1QSGA 4YQZA 3C24A 4CM1A 5JS6A 2C7VA 4IJWA 5HS4A 3WSWA 3F5QA 4CR6A 2D0IA 3ON5A 4IS3A 2CZCA 4J4BA 2A9FA 4R5HA 1MB4A 1DIHA 5IDQA 4U0JA 5JC1A 3IQDB 3COSA 1XU9A 1IULA 2WM3A 3C85A 4ALLA 1GZ3A 2RHRA 1B26A 4U5QA 4YJFB 1ZVMA 2Y0EA 2JD0A 1ENOA 3E5RA 3HDJA 2LDXA 3DZFA 1FDTA 3ONDA 3WB9A 3U0BA 1UP6A 2VTEA 1G1AA 1NPYA 2YHUA 1N7HA 1LTHR 3DQPA 4NZ9A 3AY7A 1ISFA 2GUGA 1WWKA 1HYGA 2NQ8A 3Q3CA 1K3TA 4UUMA 4UVHA 4CMEA 3Q0EA 2AA3A 3D5TA 3WWYA 4ZGWA 6ADHA 3AUTA 5I7EA 2WYUA 2VWGA 2JD1A 3QQPA 4IZHA 1S6YA 3V1TC 3CPSA 1KY5A 3TZCA 2Y66A 2ZATA 4OQZA 3Q1LA 1A9ZA 1HWYA 2HMTA 4WEOA 4IDAA 5I8ZA 4INAA 5A06A 4N5LA 3FPCA 3E9MA 4FD3A 2F00A 2PA3A 4BKQA 3UAGA 2W8ZA 2FWMX 1VSUA 2B83A 1B16A 1LDGA 4RPJA 4DQVA 3NGLA 4QFCA 1P1JA 1BW9B 3GEDA 2AG8A 2PKRA 1NVGA 2JHFA 4Q3CA 1BSVA 4LRSB 1TB4A 4CLDA 4FFRA 1KEPA 5EIOA 1KEUA 4YJDA 3PEFA 3K92A 4P8RA 4Z9FA 1J49A 2CDAA 3GVHA 3DZHA 3H5RA 2DUUA 3U4HA 2VT2A 4BNZA 5GZ3A 1EK5A 3EMKA 2OFPA 2C5AA 3UOGA 4Y9DA 1SEPA 4A10A 3I9LA 5IZCA 1NPTO 2QZ9A 1MXHA 2PGDA 2ZK7A 4J1SA 2AG5A 4IZIA 5TF4A 4MVJE 3OH8A 2VN8A 3WYBA 1DC6A 3Q11A 1PJ3A 1DDOA 2NVWA 3ZWBA 1E1NA 3HNPA 4YCAA 2HLPA 1XYGA 4IJVA 5AXAA 4PG8A 1XG5A 2IODA 4IQ8A 4CM8A 5H82A 1H6CA 2IRWA 2ZIZA 4EYEA 3TNLA 3D4PA 3DZIA 1E92A 2IYOA 5DN9A 2FR8A 2C0CA 4RVSA 3F46A 1CEQA 3TZHA 1I32A 3BYZA 3L6EA 2GN8A 4GPD1 2X5OA 4UVDA 1ADFA 3WDSA 2ZTUA 4AICA 2BELA 5BNFA 4AVYA 1I33A 1I3NA 4GWGA 2NVUB 1VKNA 4A03A 4BKOA 1J6UA 5L40A 4KOAA 3LVFO 1U3TA 1GUFA 1EE9A 1P9LA 2C5EA 3OIDA 4BQPA 3CTMA 1T26A 4JROA 1VL8A 4BOYA 3U4IA 4E32A 2BF7A 3FPLA 5KTKA 4G2NA 4ILKA 1HDOA 5A4DA 4J2HA 3Q2IA 4L76A 4W9NC 1IPFA 1Z82A 1EUZA 1KVQA 3LT1A 4MPDA 5L3ZA 3TL2A 1FDSA 4CQLA 4W7IA 2EERA 7MDHA 2WTBA 1GYPA 3QW2A 3GOHA 4ZQHA 1AN9A 1RM3A 5COQA 4YJHA 4MVJG 1KS9A 3O03A 3L77A 3ZNPA 2YHIB 3ADPA 3TSCA 5K6AA 4YR9A 3TOXA 3AI3A 3R0IA 3ZWAA 3NT2A 1XQ6A 3LF1A 2Q3EA 4GLOA 4GSKA 1Y5RA 1TVEA 3DOOA 3OQBA 5FWNA 3MJVA 3GY0A 3AUAA 2P68A 4MOWA 1CJCA 4NFSA 2CUKA 1TT5A 3MWDB 1SMKA 1Y9AA 4ZJUA 1I2BA 2PGLA 5C37A 4DMMA 3I23A 4KP7A 1ZCJA 2Y93A 4YVFA 3VPHA 4PZEA 2AEJA 2HRBA 4LISA 2ZQYA 2A92A 1CQIA 4CR7A 2DLDA 2X9GA 3S2EA 4GMFA 4BIIA 2P5UA 1VRWA 5AOVA 3GHHA 4XZ3A 1GQYA 4J7UA 1PU2A 1ZK3A 1LSOA 5IAAA 3DBLA 2H63A 3ROMA 2W98A 1ADBA 1RM5A 2E49A 2Q1SA 4RF2A 3NV9A 4Z3DA 1XELA 2W4QA 1XEAA 4E2XA 2JFFA 4OGWA 1HLDA 1QYXA 3AY6A 2VHWA 3TZKA 2GYYA 3K8ZA 2HAEA 1X15A 1H6BA 2GN6A 3AI1A 4FFNA 3UGKA 5CFZA 4BNHA 2X0RA 4Q3BA 3ZU4A 3PJFA 2UYYA 4L73A 4NJMA 1E6WA 1C1XA 1XWFA 1WVGA 5A9SB 4L74A 3IJPA 5K9ZA 4NBRA 3R6DA 1UXIA 4MVJI 2Z1NA 3JQCA 1WAMA 1VL0A 2OXIA 2RCYA 4QUKA 5CEEA 4P38A 1O9BA 2VNAA 3ABIA 4E3ZA 3RC7A 4DVJA 3ENKA 2R00A 5LDHA 3L6OO 3RUDA 3JYPA 3F9IA 3HN7A 4CMKA 2GCGA 2R6JA 3CMCO 1ZFNA 3V8BA 2J3IA 1UZNA 1WMAA 5CP8A 2IDZA 1H2BA 1BVUA 3NT4A 2HKIA 4ND1A 1U1IA 3ITKA 1N9GA 2FMUA 1KETA 5KOIA 5HTOA 4GKVA 4PG5A 3B1JA 4ZRMA 2A94A 1IL0A 2BD0A 2OMEA 1VJ1A 1RPNA 3E82A 3PQDA 1JKFA 3RD5A 2Q1UA 3LU1A 1NQTA 2BFPA 3T7EA 4PLGA 4E5MA 3GNTA 3VTFA 1QRRA 2FOIA 2XPCA 1PJ4A 1EUDA 2Y1EA 5KKAA 2HJRA 2DTXA 5DF1A 1BGVA 3KSZO 2C2XA 4Q3NA 5T64A 1JKJA 3RI3A 5HRUA 2GO1A 5EN4A 1QV6A 4TKMA 4XYMA 4YBZA 4PN3A 2FSVA 4FSHA 3OETA 1OZAA 3O9ZA 4J2OA 3AWDA 4UVEA 3EGOA 1PGOA 1BW9A 4E2WA 1XLTA 1NNUA 2BI7A 4W82A 1D8AA 5TC4A 3GEGA 4YAEA 3I3OA 4ZU3A 1YOVB 2GRAA 4PZCA 3DMTC 3HQ4O 3OECA 4AJHA 5BSFA 3LF2A 2EGGA 4BNVA 3VPXA 3DHYA 1ZK2A 1LLUA 4J90A 1SCUA 3R1IA 1SC6A 3RAJA 2FPIA 1F0YA 4K26A 3B1FA 4ZQGA 1NFRA 4Z0PA 4ESOA 3GZ4A 1LDYA 1HF3A 5IXYA 3MTJA 3P5SA 3P2OA 1H94A 1H9AA 1Y8QB 1LA2A 4W6ZA 2HQ1A 4YJHB 2YYYA 2P2SA 2BFOA 3PTZA 3D4OA 1OBFO 3BZUA 5F5NA 5T57A 1VE9A 3ZI0A 3BTVA 3FF4A 5L51A 3T4XA 1C0IA 1E1LA 2Q2QA 2DKNA 4N54A 2WD7A 1OMOA 5FEUA 1KYQA 3FNHA 4RVDA 3I4FA 3WQSB 5A3JA 4HNHA 3WGTA 3PYLA 1M75A 2ZJ0A 5DOZA 3VH4A 2IYPA 4KDFA 4B4WA 4R3WA 4UEKA 2DVMA 3H5AA 3KSUA 4DQXA 4IDFA 4II3A 5HBRA 4NBTA 2O50A 2GGSA 3H4VA 2QRLA 4ID9A 4TROA 3H65A 3AOEC 4MVJH 3VAZA 4OQYA 3D64A 1LI4A 1NP3A 4RVFA 4CV2A 2QQ5A 1ONOA 3MOIA 1V35A 3HDHA 4HNGA 1R4NB 3QVOA 4L4RA 2QYSA 3JYOA 3G17A 5DBIA 3DBHA 3ZWMA 2PH3A 1C0LA 2C29D 1DIAA 3SXPA 4HBGA 4BO8A 3M2PA 3F6YA 3FHLA 3QJ5A 4R68A 4BHTA 5ICMA 1W6UA 2V6GA 1EDZA 4PRKA 4IDCA 3WXBA 2PKQP 1PQUA 4TKLA 2Y0DA 4GI2A 1ZBQA 4ONEA 1HE4A 1DLJA 1HKUA 4FFLA 3RVDA 1ZW1A 3CMMA 4CUJA 3JQDA 4EUHA 4W9NA 4WCDA 3ZDFA 1E7WA 2I6TA 4BB5A 3I5MA 2VZ9A 4GX0A 4EEZA 1NR7A 5KVSA 2X0JA 5C7IO 1GEGA 1UXGA 1GZ4A 5A9RA 1AGNA 2HK7A 3KM0A 3I6IA 2WYVA 3NTOA 1FK8A 4Q3EA 2BMAA 3ROQA 3ZU3A 3RUIA 4AFNA 5ER9A 2ZCUA 3O38A 4PG4A 2Y0CA 3PWZA 3HB4X 1U8XX 4YT5A 1A7AA 1X1TA 2O3TA 3WGZA 5JMWA 1LLDA 3VH3A 2YDXA 1QYDA 3HE3A 2G0TA 3GVIA 2ZB4A 5EJ2A 3OF2A 3ONFA 4NK4A 3I6QA 1U4SA 3DOJA 3TWOA 5KNLA 3JCZA 4EJMA 3PHGA 2P9GA 2EKPA 4ZICA 1RYDA 1ZJYA 4ALJA 1NVMB 4K1LA 1N1GA 1YB5A 2V6FA 4U0KA 3D4NA 4L0QA 3ANNA 4EZBA 1JN0A 4IDEA 2TMGA 4WJZA 4BO1A 3PHLA 2NQTA 1QYVA 1ZEJA 2C7GA 3PRJA 5F1PA 3RC1A 4GMGA 1KC3A 5DT9A 2I5PO 3RIHA 3E18A 4EI2A 4JJFA 3JQFA 5B37A 3WTCA 4IMPA 4HFMA 2J8ZA 4R41A 4DUPA 3LT4A 1M6WA 2VNSA 3FR8A 4I9HA 1E6EA 4I9NA 2O2SA 1JDJA 4J9VA 3UCEA 3CINA 2DT5A 4WOJA 5C7LO 3BMNB 1PZGA 1Q0LA 1QR6A 2VHZA 2ZQZA 4C7KA 4KUHA 1HDRA 3JQ9C 4OOEA 3ZHBA 3AOEA 2VHYA 3SLKA 4WLEA 4AJLA 2I3GA 4E6PA 3VKVA 5H81A 4BKPA 1LDEA 1OAAA 5JCJA 2C54A 4IDDA 4XQEA 1O94A 3GG2A 1ZSYA 3IOYA 4YAIA 1PJSA 3H3JA 3PWKA 3DZKA 2XF8A 4GX2A 1V0JA 1EEHA 1EFKA 1N2SA 2PD6A 3VVCA 1I8TA 3V2UA 3C7CB 4CR8A 1ZK0A 4CM6A 2DUWA 3DMYA 1UXJA 1EBFA 4XRGA 2Q46A 2RH4A 5F1KA 5EL0A 4CLHA 2CF5A 2PTGA 3H8VA 3DC2A 3ASUA 4DLAA 3G79A 3ZWWA 5L7WA 1PTJA 1LXCA 2Q2WA 3RKUA 4IM7A 5IFLA 3OP4A 1UJMA 2X58A 3RUCA 3NEPX 5B4VA 2BFAA 4M86A 1Y8RA 1P33A 1BG6A 5HA5A 1AXGA 1OC4A 1ZO8A 4R9RA 1XCBA 1Z7EA 3ZW8A 2YFHA 2JCYA 3AFMA 4OOFA 5DBFA 1C1XB 1U3UA 5CEFA 2I9PA 5TGDA 1PGQA 3NJ8A 2VZ8A 1GQ2A 2HJSA 3DBRB 3PJGA 4GX5A 4Y8VA 2NVBA 1GZ6A 4FCCA 4N18A 1JW9B 4W7HA 5L95A 1P44A 3S2IA 4RF5A 1JWBB 2QRJA 1LJ8A 1ISMA 2NNLD 4J4TA 1UXKA 3TPCA 3MOGA 1YJ8A 2B37A 3PK0A 5DP2A 1OC2A 4FQ8A 2DM6A 2J6IA 4BMSA 2DTEA 1NFQA 3HWRA 2NU9A 1L7EA 2AQIA 3K2EA 4HY3A 5DCWA 9LDBA 3VKUA 4BV8A 5TT0A 3PIIA 3E03A 3WQRA 4JJGA 1I5RA 5LDGA 3W4IA 1P1HA 3NX4A 3WBFA 2NWQA 4GQAA 5CDYA 2QIOA 4H3VA 1VJTA 2PH5A 4YQYA 3ZHZA 4BGVA 1J0XO 5FI3A 4J9UE 5JCJD 2X4GA 4CLOA 1R37A 4CODB 2OUIA 5KWEA 1T25A 3GPDG 5EMHA 2JL1A 3O8QA 3K31A 3JQ8A 4Y6SA 1LRJA 1MC5A 2AQKA 1U3WA 4OJNA 5ENVA 2AQHA 3WIDA 2WMDA 2G17A 5TNXA 4BNWA 1E3JA 3OJFA 1B15A 4DIBA 3EDMA 3JQEA 3I9OA 4J43A 4Z9XA 5AXBA 1ZKMA 3QRWA 2OGUA 4UUOA 4NI5A 3D3EA 5I7FA 4A7PA 2ZJ1A 2Q45A 3NTRA 4EGFA 2YHIA 3FR7A 3S1LA 4XJTA 3WWZA 4HV4A 2P9EA 3KEOA 3VH1A 1YONA 1E0DA 3OMLA 4XIYA 3F47A 4Q3DA 1A72A 3RUAA 5IJZA 5EESA 3RFXA 4HKTA 5JO9A 2PR2A 3KRTA 4L9RA 1PIWA 1SOVA 5G0TA 3QVSA 4WUVA 4WGGA 1HTBA 1PL7A 4D7AA 1IOLA 5EQFA 2ZYGA 3U4CA 5JCXA 3TOZA 4EW6A 4FJ0A 3DR3A 4NDNE 3C1OA 1IHXA 1SPXA 2NTJA 4XRRA 4LCJA 3VZQA 1U2GA 3JTMA 4ZRNA 3STHA 4RZHA 3H2ZA 2D5CA 1I01A 2XXBA 2H1SA 4P22A 4W99A 4YRDA 4D44A 2Q99A 1GD1O 2PD4A 2W2KA 5TSDA 3VZRA 1NFFA 3QVWA 2H9IA 4QXMA 1KEVA 2Q1TA 1DB3A 4CM7A 3W6UA 1ZJZA 2P4HX 4QFDA 1LBEA 3B70A 4QT0A 4RPHA 4XYBA 2EXXA 3UH1A 2GZ2A 3ETEA 3RQSA 5BT9A 4QX6A 4DREA 4LGVA 5T67A 3TN7A 3RBZA 2YV2A 1S7CA 5L7YA 4E30A 5ILGA 3I9JA 4L4XA 1HZJA 4NK5A 3IL2A 2GERA 2VHVA 4H7PA 4A27A 3RFVA 3LC2O 5JE8A 4WLVA 2O4CA 2X9VA 3OICA 3QP9A 4ROSA 1F12A 3A1NA 3ZN2A 5DCYA 1PJBA 4UVGA 2D5AA 1DAOA 3A4VA 1T2DA 3AY3A 5JXWA 3IDSA 2FR0A 3L6DA 4Q39A 3L4BA 4I5EA 1EVYA 4TRMA 1B8UA 1NYTA 2DQ4A 1UZLA 1XR3A 2CMDA 3GK3A 5U1PA 4CM9D 1LSSA 4BMVA 4NBUA 3INTA 3MCVA 3IS3A 2XOXA 4FBGA 1R4MB 1V3UA 1H5QA 1VJ0A 2P5YA 1HZZA 2PY6A 3X2EA 2NUAA 4BKRA 4BGUA 4FN4A 3IKVA 3GQVA 4OKNA 3DXFA 3RU9A 2RAFA 2R2GA 3JQGB 3VPGA 3BMOB 3Q9NA 4IJKA 3W8EA 4ALMA 3TQHA 1SB8A 4I5DA 4YT8A 5FI5A 1PJQA 3BHIA 5EPOA 3CXRA 1EK6A 1WDMA 1T2FA 3CUKA 2PZMA 1LSUA 5CDUA 1EUCA 1HRDA 3H6KA 2HU2A 3B1KA 3BMOA 1RM0A 1R66A 2OBYA 4E12A 4N7RA 4U8GA 4XD2A 5IZ4A 1GCUA 1GYRA 2PGJA 3VOSA 4BB6A 4CM3A 1R0LA 2YQ5A 2W2LA 3LQFA 3JD0A 3H9GA 3K96A 4XIJA 4OAQA 1BXZA 4PLHA 1O8CA 1WW8A 1NHWA 4Z0HO 4DPKA 4TRNA 2VQ3A 2ZKLA 4D45A 1YWGO 3A14A 1PR9A 1Y8RB 2GN9A 2W90A 2ZTMA 3QWHA 4R9SA 1SO8A 4CMIA 5U9CA 3ORFA 4N5NA 4BMNA 1R4NA 3FN4A 2VYVA 5JAZA 3JD2A 2G82A 1VC2A 1EQUA 2Q49A 4BO6A 2NU8A 4K6FA 4D42A 5MGBA 4YJGA 1N1EA 5JY6A 3RSHA 3V2HA 1I10A 3B20A 1NR1A 3DAGA 2CVOA 4J16A 3EK2A 2NACA 1P1RA 1B0AA 5KJFA 1L7DA 3GFGA 2UVDA 2Y1OA 4IQ0A 1PS8A 1M6HA 3DAPA 1D3AA 1HDZA 3D7LA 4IGFA 5AXDA 1GDHA 4D79A 2O3JA 3PXXA 1P45A 2J3JA 2PZLA 1PGJA 4RL6A 3R3SA 1DIBA 3EZLA 3S8MA 5ICSA 4CPDA 3GFBA 5B12A 2WE7A 2PKQO 2E4AA 2V7PA 1MC4A 3GRKA 1Y5MA 3RC2A 4OKIA 4MIOA 4RZIA 1TT7A 2X5KO 1VLLA 4TVBA 4LVCA 1ADGA 3WLFA 3KEQA 2FR1A 3D3WB 2HK9A 3AU8A 4JBIA 2FZEA 4JBHA 4I5FA 1WZIA 1GU7A 5JAMA 5TT1A 3W8DA 3WR5A 2R00C 4KUEA 4NHEA 3HFGA 1OOEA 2BKAA 1UP4A 2JFGA 2E82A 4O1MA 2X86A 1E3IA 5JFOA 3PYMA 5U4QA 5G0WA 4BS9A 1DJQA 1P3DA 2VRCA 3GRPA 4FFOA 4MVJM 4U7WA 2IZ1A 3EVTA 1I2ZA 1NVTA 3VC7A 3E9QA 5DDIP 4YA6A 5DOVA 3ZWNA 5GY7A 4XCVA 1IZ0A 2IZ0A 2ET6A 4NU5A 4UUPA 5KVCA 2EW2A 4WLOA 1R4MA 1Y9EA 4D0RA 3BIOA 1YB4A 2WWRA 4B3HA 1ORRA 4GL4A 2O7QA 1PX0A 3W4JA 3IP3A 3QWFA 5TJ9A 4DXHA 3FWNA 3LSYA 1K0UA 1VI2A 3KO8A 1QLJA 1PS9A 2JCXA 3ZW9A 3PQEA 2CSUA 1YO6A 1JTVA 5JYDA 5JDCC 3HJAA 1ID1A 1N9GB 1LU9A 2FSSA 4YT2A 4BNMA 4B7CA 5TS3A 1DLIA 4Z0TA 3GEMA 1GV0A 2Y1DA 1CYDA 4AJKA 4CQMD 5DNAA 3PHJA 1E3WA 1BRMA 2O3RA 2VRCD 5KJ6A 1P0CA 3ETGA 3UW3A 3MZ0A 3TJRA 4B4UA 4CUZA 4YACA 4IDGA 3F3SA 3KOUA 3ZWPA 4B3IA 1YBMA 3F5SA 1T4DA 3OJ0A 5GZ6A 5G0UA 4Q9NA 4QEDA 3UXYA 1E7RA 4YRBA 5K6AC 1X1EA 1EVIA 2BGKA 1NPDA 2PLAA 4MVJA 3DBHB 3H9QA 3IC5A 2DBZA 4R1TA 4IQGA 3ETDA 3O26A 3PDJA 3HFSA 4E13A 2PV7A 1JA9A 1PL8A 2PZJA 5AXCA 3EW7A 3PI7A 5DP1A 4YAKA 4WLNA 4YJGB 4EJ0A 4UEOA 4DIFA 3AW9A 3V1YA 1C3VA 1C1DA 3EUWA 4E5NA 3KTDA 3Q6IA 3QVTA 1WZEA 3PZBA 4JK3A 4BL5A 5A1TA 2J3HA 1LRLA 2RIRA 3I4CA 3M1AA 4XKJA 2WJPA 4AL4A 3IKTA 4C4OA 2V65A
chains in the Genus database with same CATH superfamily
1C1DB 2BH9A 1Q7GA 1Z5PA 2AE2A 2L18A 4UMVA 2D1RA 4YS6A 3V3KA 2Y1LA 3ZHSA 4KO1S 2WJHA 3UC9A 5GZ1A 2GCOA 3KBOA 2K87A 5ALSA 3N2NA 2CVPA 5AMXA 4C06A 4NG5A 2OKCA 1Z3CA 3KQSA 4G8BA 4G1EB 1ZOIA 1VE3A 3GT4A 1QB8A 4ZEXA 2XH8A 3RFCA 5EHQA 4MIYA 2FE4A 4N0DA 1J8VA 1RXUA 2Z4TA 3BA6A 5HF8A 3L8DA 1G41A 3BTSA 3CPJB 3K2IA 2I2DA 2WZCA 4BBAA 1JG7A 1AK1A 2C92A 2FE1A 4GEGA 2H57A 2OYCA 3HO1A 1BEUB 2PKWA 4IVRA 4NDZA 2QHXA 3OPQA 3OM1A 1YU6A 2CYCA 4KQKA 2P2ZA 2VPIA 5BNWA 1B42A 2ZJ2A 3GDOA 1P7ZA 1INLA 3A70A 4X65B 3NBXX 5JANA 1LQTA 1ZMOA 4TRJA 2VDMB 1E1CA 4PZYA 4DMUB 4NH4A 5HXAA 3R4VA 3G9XA 3WL4A 4AY2A 3S1AB 3SE0A 4PLYA 3RO7A 4ZZ2A 1XKLA 4KVZA 1TM4E 4XFKA 4E5UA 4E31A 3ADBA 5CDGA 1D6NA 3MGCA 4TYWA 1NVVR 3IDAA 1Z7YA 3OWHA 4FBLA 1SUEA 1ZLYA 1XD8A 3KV3O 1KRXA 1TLLA 4UAGA 1H6DA 1T6NA 3PCTA 2QRVA 4ZGGA 2Z98A 4DNOA 4EUNA 5LLTA 2QA5A 1W4LA 1KERA 1L1QA 1SH7A 1JSLA 3KJFA 4UEJA 4KVAA 4RL4A 4L8WB 2QRVB 4JL8A 2HOQA 2AFIE 1XB2A 2V0CA 5AOBA 4ZC1A 4HH4A 1R6UA 1F17A 5E1DA 4TM7A 1LK0A 3HXOA 3S40A 2I76A 3B1ZA 4PXYA 3LX6A 1W76A 2SKEA 3E81A 2FR8C 5KHLB 4H1TA 4LNUB 2BKLA 3BSSA 2JATA 4KOEC 5HYVA 5I8PA 1YA6A 4GR5A 1R8JA 3FCOA 3FYUA 2XLCA 3ZHCA 1N7IA 2BZ1A 4LBYA 4AYXA 1ENYA 5AKHA 2CNDA 4KQFA 2P78A 4DIMA 3H5LA 1Q12A 1NC1A 2OXRA 1NVEA 2RH5A 2VT3A 2WAOA 1U7TA 4WJKB 3H5NA 4EB0A 4GYKA 5IANA 2ANCA 1KZ6A 1QP8A 4PGMA 5AK6A 4E0BA 1E7YA 4CGZA 1JI0A 2FP4B 3MPOA 4ESEA 1QGYA 4PRLA 4U7TB 2WMOB 2RH8A 1QV7A 4Y6PA 1ESNA 2JDIA 3MMPA 4DNXA 1GKKA 3L8ZA 3QF7A 3HEBA 3ILVA 2YXNA 5HZGA 3AM5A 3QW4B 4RA9B 4NOMA 3RUFA 2OZPA 1K98A 2Y92A 3HA5A 4LXQA 3VZBA 1HYHA 5F7JA 2W2KB 5DN6A 4EBFA 4A8HA 1JV2B 2J7KA 1G7RA 1EFLA 3AR8A 2GFIA 2Q4DA 3FYDA 1NAIA 1W0KD 2HEGA 1P75A 3G1TA 3IQEA 3OD1A 2I2BA 5FKJA 5KJEA 4RELA 1Q0HA 2RJOA 4AF8A 4B48A 3PDWA 3VDQA 2WAYA 3A1FA 4MV0A 3U44A 1TJNA 4V0LA 1S8NA 5P8WA 1FQJA 5IJ0A 3AHDA 1EU1A 4ND7A 3TW4A 5M7EA 2QENA 4KMSA 1A0OA 3ONNA 3U6KA 4YUWA 4GI5A 1HLFA 1MZVA 4NYMQ 5FBKA 3WTBA 4D0LB 3NIFB 4JA0A 3GYBA 3CH6A 1UXHA 1EX6A 2UUPA 4BQRA 2Z57A 3DD1A 4EW1A 1NUUA 3GP8A 3RJ5A 1PQ4A 2ETVA 1M72A 2OBMA 2X1HA 3NC0C 3NYQA 2E6UX 1ZSNA 2AYZA 1FNMA 2O0JA 1EK2A 1G3MA 2HZ7A 2LIVA 4JKYA 3R7WA 1J70A 2I0FA 3MQ4A 3T94A 5KNDH 4ZHSA 2F8MA 3SC4A 3QI7A 3QUSA 1W0JD 3JWGA 1T0PA 4EPWA 4EY6A 1C0EA 3K09A 1PZFA 3MT8A 4J3JA 2HA4A 2L2QA 2H2FA 1GAEO 4ZZIA 1XEWX 4P4LA 4I9GA 4ZYYA 1YIOA 2V03A 1IHYA 2OCLA 4HFNA 5D51S 3WKAA 4AJ4A 2QPOA 2GBPA 4HVTA 1NJ2A 4D1YA 5EJ9A 4QRIA 4G0ZA 4MVWA 3TSOA 1ZK1A 5K8CA 3PQ7A 5K0GA 3GNQA 3WBBA 2ETXA 2UKDA 3EZXA 3JQAD 3W04A 3WWPA 4INZA 5IYZA 2HC9A 3FI9A 2ZI7A 1OXUA 1NSFA 4TZTA 2YY7A 4CM9A 8GPBA 4HBZA 5CK5A 3OJOA 4OXRA 4QOSA 1I3MA 3LX8A 2JF0A 3WJAA 4C5CA 1RPTA 3ZUGA 4BQNA 3DWGA 1K3UB 1V37A 1XAIA 2J07A 2C31A 5INTA 3S81A 4JGIA 3RBVA 1HBJA 1N0HA 2FG5A 1DZIA 3VI3B 2P30A 1RJGA 1W25A 2GB4A 3HU1A 2XTAA 3BDVA 5HWSA 3EFBA 4AMGA 5HFAA 4ZN6A 3C3KA 1JT9A 5BMVA 1P1CA 2ZUWA 3M3DA 2AEFA 3QLJA 4O25A 3K8QA 4JLKA 4GXTA 2FSFA 5D1HA 3FWHA 4B80A 3GU3A 5DX0A 3L7YA 4ZAFA 1CLEA 2QZ4A 3DVRX 3LK7A 4G56A 1JR6A 3DAFA 4FDUA 4K40A 1ZC3A 5E2AA 6PFKA 4BLSA 4OSOA 3VU1A 1B8VA 1SXJE 3C98A 3JD4A 4IIJA 4ITVA 2OHGA 1QUFA 1DP4A 3MJ4A 3NALA 5FUYA 3RIGA 2PNFA 4D41A 4D74A 4HEHA 1G9SA 1XRQA 1AD2A 1N2IA 1W5BA 2HWXA 4MI3A 1IN8A 4KUGA 3N74A 3R8CA 4R1SA 3K70B 3B6KA 4CMJA 2NSDA 3M3PA 4B3CA 3U5TA 1G4HA 1OLOA 1R4ZA 3PFBA 4G65A 2OHXA 1QG6A 1RQNA 1X0VA 4J0EA 3JX9A 1ISGA 4QBHA 2GZ1A 3QMMA 5EMMA 3SYLA 2GD1O 4GHWA 3OPMA 4QPZA 3HL0A 1KWGA 2FGJA 1I3OA 1P9WA 1UUFA 3ZGVA 1WP9A 1SKUA 2BFDA 2H6EA 3QTTA 3QU7A 4MJLA 5IJAA 3ZCTA 4UOZA 3U61B 1P4GA 3WZLA 3T3PB 2W6IA 3AP2A 2NZYA 3U4AA 5CCDA 1SQ5A 4G23A 4I6GA 4PAWA 5IVHA 1U5AA 3KSAC 1ODTC 2BCEA 3IEIA 2AW3A 2HQOA 4P84A 4URHA 2NUAB 3TRFA 3UOAB 1SKMA 5IT4A 4JX8A 1Z5WA 1JXQA 4M1QA 3FNRA 3YASA 4G3XA 4BNGA 2C4HA 2PLNA 1N2BA 3PLRA 2DUJA 2EX4A 3UWOA 3KT3A 2RGNA 1YCGA 1QX3A 4BWGA 4F4IA 5K8UA 3RHTA 4J6FA 1ORDA 4RK7A 1E79A 2AXQA 5DWDA 4DGQA 1JTEA 1YJCA 5BOSA 3PPIA 5AKIA 3GVXA 1E9EA 1R12A 1Y8AA 2BI8A 3OUTA 4FN5A 1XDBA 3LS2A 2V7TA 2PA0A 4QWMA 2X8JB 3EIEA 1AXEA 3JVIA 1NIJA 2HK8A 1BX1A 4BGIA 5JC8A 1P72A 5JUWA 2ZSAA 4Z4HA 3I2YX 4G0OA 1J42A 4EI8A 3R8XA 3NR2A 5E7IA 4QO8A 1TA0A 1FXUA 3R7DA 1LC0A 1V1MA 2Q1WA 3H1FA 3OKCA 1IJFA 1KFCB 3HP7A 4PWZA 3K0BA 5AYVA 4HLDA 4M49A 4H4CA 5ERGB 4CMBA 1NXQA 5DGCA 1SUIA 1JXMA 1R74A 1U7OA 3GN2A 3K2BA 3KKNA 3TTXA 1NG9A 1K68A 4JOCA 2UXDB 2JAXA 3K30A 4F71A 3JATB 4G8JA 4TKVA 1L8XA 4RGQA 4MVYA 3WLMA 4MMYB 1M8JA 1Y33E 4FNAA 1GG8A 3QEMA 3R5TA 1UK8A 4FZJA 2OECA 2ZWOA 1VHQA 2BFBA 4E1VA 2HPAA 1SVSA 3EG9A 2WU8A 4LRTB 4WINA 3ICPA 4AJ2A 1YHNA 1UWKA 3ZKWA 5EP4A 4EENA 2RGCA 4ZDJA 5K0LA 1WV1A 1RM4A 4P3NA 3VJLA 3UMYA 3F1KA 1V6CA 3VU0A 3RCBA 3KNZA 2XDWA 1T5TA 4I50F 1J1ZA 1HL3A 1A7UA 5KJCA 6LDHA 3AC0A 3WGIA 2ZJ8A 1NI4A 2I2WA 2W22A 2YXDA 1UK9A 1KKUA 1XF9A 1JKIA 1A4IA 1UDBA 4X97A 4EGJA 1B74A 3VV2A 3R4CA 2XECA 4BN0A 1D03A 2Y1WA 1FLVA 2VUIB 3KZOA 4E08A 3P9SA 1L5GB 5EMJA 1J0DA 5ICCA 2GCOB 2A1TR 3ZG6A 2JAQA 3TCKA 3KCNA 4KQ9A 4PR3A 5KSYA 2OV6A 1XTBA 4PVCA 4YTEA 1E7QA 1XHLA 4RWEA 8LDHA 4CKEB 2G1UA 3IXLA 2X9QA 4YAJA 4F12A 4R1PA 1FS5A 5EXTA 4QOEA 1UPCA 4RTRA 1P4SA 1PFUA 3OZIA 1V8BA 1GQQA 4M55A 4YJ3B 4JCOA 4RVHA 3V80A 4IIGA 4BNXA 3DZDA 4C0BA 2B1GA 2G71A 5GM1A 1SG0A 3SC6A 3B13B 3DDZX 2QUZA 3UPTA 2Q3BA 3GLGE 1RQXA 1L5RA 3U7QA 4OIMA 4DJDC 5JYBA 2NT4A 3PJEA 5CH3A 3QHAA 1ULTA 4MRNA 3RW9A 3WMFA 4HDNB 4CETA 4WDQA 3DFMA 4JR0A 4RV4A 2CWWA 1JILA 2HLDD 3JQ9A 4R5MA 5UKDA 1S89A 1X7HA 1T5DX 3ZI7A 2FFBA 3HLYA 4B9AA 1GZVA 3A6PC 1AZLA 4RAOA 4HDNA 3KTOA 1AZWA 1IRXA 2QMYA 3PC7A 3WGUA 4L8LA 3HJTA 4XWWA 3P19A 2O8BA 3GLTA 3MD0A 1COZA 1YAJA 2E55A 5DM70 3HHEA 3D4LA 3WB0A 2QJFA 1US8A 3QFTA 1V8PA 2IYYA 5DM60 4ZI2A 1V7ZA 1RI1A 2MYTA 2R60A 4RKWA 1VI5A 4XCXA 4LFBB 2IYZA 1U6JA 3MINA 3B2NA 1P39A 2VAXA 2VXBA 1TEXA 3K9QO 3FNQA 3P9YA 4GQBA 4TUYF 1WXGA 2R1VA 4MDYA 3RUEA 4E2FA 1G38A 4O4HA 2RJNA 2FZLA 1C50A 4UHHA 1M2WA 4UASA 4RKFA 4G09A 3KHUA 1YZFA 1T4GA 3A9TA 4N0EA 3F4BA 2B1JA 4C4ZA 1Y37A 3O1HB 1RHRA 1M3SA 3HPQA 3AV3A 3AVTA 1UPTA 1YMVA 3BE6A 3DBVO 2J6HA 1BJTA 3E5NA 3LDHA 1DIOB 2GEUA 1RLJA 4RPLA 2IXFA 2R84A 4U6NA 4XAQA 5KYKA 1S96A 5IDWA 5EJ4A 4QQNA 1AG9A 2FSPA 3N58A 1EHCA 1WD5A 4LOHA 3T5GA 5A5EA 4Y1EA 2IGBA 3HYTA 4ZARA 1EUCB 5IT9A 1O97C 3OZDA 1L4BA 2FOLA 2ZP1A 2IY9A 4LJ9A 4PZLA 3ZQJA 1CKEA 4LHVA 5CEJA 3SKXA 3O82A 1OIXA 4LRQA 3R6TA 4AKEA 1OLXA 2WNIA 3LKVA 2YJZA 1W4CA 1V43A 4MR7B 2WVGA 1FMJA 4G5SA 4RPIA 4TUYA 4TTSA 3WOHA 3BUSA 2Z2XA 4IMIB 4G36A 1YZYA 4TMZA 1NN5A 5HJ5A 3DE1X 4FYYA 3NYIA 2OD2A 3MAJA 2C2YA 3S2UA 2ZJZA 3NIBA 4RQAA 1TKRA 4TRRA 1RKQA 3OZAA 2VAPA 4AY5A 4WKNA 1I4OA 1IM5A 5LA6F 2FVXA 1FE8A 3QWBA 4P31A 4B17A 3DEYX 4F97A 3FRJA 1P6UA 2R6R1 5LPNA 1MVLA 2ZUVA 1IY9A 3D3KA 2J45A 1Y6ZA 3N7UA 4JP5A 4PCLA 3I3SR 4KQIA 5C3UA 3UMCA 4BE7B 2F55A 3I9MA 3DV0A 3SR0A 2H8KA 3VYTB 1R0KA 3W2HA 4CV0A 4DSZA 1JA0A 3DEZA 1Z15A 4GM4A 1Q7BA 2J33A 2FWBA 3DL0A 4EA9A 4Q19A 4UUNA 2PYDA 4DPLA 3UMJA 2FWJA 4RYLA 1XAHA 2OBNA 3WGQA 3LDGA 4BV2A 3MINB 3R3XA 2BN4A 1VLVA 1RJFA 5FAKA 2CCGA 4HN9A 4KQXA 2J4FA 4FI3C 5L7TA 1NUSA 4OO3A 3TLAA 1EVJA 4QFMA 3ULKA 1JYEA 1ZXLA 4DR7B 3PL1A 1AS0A 1E77A 1XAJA 2AN9A 1H4VB 1V8FA 4HH3C 1OX4B 1MV8A 1ZIYA 2H51A 2PAAA 2Z30A 4MAMA 3GAAA 3DGFC 3RS0A 1GNTA 1V3VA 1V3QE 1Z0JA 1OYOA 1CFZA 4QXAA 3KYBA 3PT9A 1RRKA 2V96A 3DT8A 2BUCA 4UFOA 1X7WA 2CLCX 4JLDA 1ODFA 3VHXB 5TJHA 1JALA 3VR2A 4P7FA 2V9ZA 4WGFA 4IKOA 4M83A 1NHGA 1SC4A 4Z9BA 3M6FA 3U9SA 3WG9A 3RC9A 1WV0A 1H0RA 1E9SA 1G21E 1X7YB 2C97A 2V4MA 3JQFC 3TD9A 2QG4A 2XB4A 1D09A 2CXUA 1NT2A 4X61A 1JIUA 4CDGA 1KQPA 1BVRA 4PQRA 3PRKE 2F62A 4FLMA 2WG2A 5H80A 3KQNA 2ZU6A 2CNBA 2J4CA 2GM5A 2JD2A 3LECA 5GV7A 4ARSA 3E3LA 4QYWA 5FYDA 2AOXA 2ZSIA 3S55A 1ZZEA 4UU7A 1FRQA 2VP5A 2ZVQX 4FEYA 3UWSA 3BCHA 4GVPA 5C7YA 1HNZB 3UXHA 4NPCA 1ONNA 4JP3A 1Q3KA 1KO8A 4U2CA 1SQ6A 1X70A 3ZWXA 4ZCSA 5BYJA 2CDRA 5CFRA 1N2CB 5KO2A 3DFUA 3UKJA 1I4DD 2WSLA 5D6OA 1E3MA 3ROKA 3WNCA 3MS2A 3ZXYA 4IDOA 2RHOA 1UT6A 2ZPUA 4W5OA 5G4KA 4F04A 1U3DA 1NQOA 5D3KA 5DLYA 4CF7A 3NC4A 2VWPA 1C0PA 4R1MA 5HKLA 3UN1A 3BQ9A 3RDPA 3FPGA 1V1RA 1UF9A 3BTOA 1UC9A 4Y2RA 4EFKA 4QFBA 2VJNA 3KCQA 1GVHA 1PDOA 1ZNZA 4L5AA 4XOIA 3NHUA 3ZDDA 3PI6A 1YZKA 2DHEA 4FW8A 1CW2B 1QHSA 3PUJA 1Y34E 3VR5H 1P60A 3ISTA 4DHWA 4P7BA 1VGRA 1SXJA 1LBTA 2BR5A 1VA5A 2HWYA 1ECFA 2Y8EA 3LRXA 3QY9A 2XXJA 4EHIA 3OA0A 3UK2A 3SBEA 4EWLA 2GPTA 5IYZB 2E9SA 1P1FA 2CXPA 1UH5A 4H7EA 4X41A 3C8HA 3LUGA 3GLUA 5KI6A 1PQPA 2D3TA 4QXQA 3KHKA 4FFDA 3D81A 3WMRA 4WK4B 3JQBC 4R7ZA 7ADHA 2C2GA 1U2ZA 3BBPA 4ZHQF 3GD5A 4WK2B 3RC8A 2WHXA 2XB2A 1ESEA 2UDPA 2WF8A 4FXOA 4G1CA 4UD6A 4ENWA 1DRWA 3ZLUA 3QE0A 1UANA 1SVKA 4GBGA 2WB4A 5EZSA 4RFVA 1YZUA 4MUAA 3AHEA 4Y2SA 4X1IA 5IVDA 1K0FA 2JFHA 2QGFA 5AVQA 2PK3A 2WWHA 3LCRA 3DOFA 5DHQA 5G53C 4CMHA 2XD9A 2AHOA 4H60A 4Q6WA 1YR3A 2C57A 3GFOA 1E98A 4I5IA 1Q92A 2HK6A 3N05A 4JB8A 1EZ4A 2QD3A 3ME5A 2E89A 5ALWA 2QTLA 4GBED 3DL2A 4KAFA 2Q1YA 3E22A 4P5PA 3QE3A 2A3RA 4GZ5A 3CLKA 4J91A 2VUTA 1VE6A 4BEJA 1EGMB 1GGEA 4B09A 4MA4A 1OPXA 5CW2A 2WE8A 1J5EB 1QIHA 3U62A 3MHPA 2X0NA 3K5IA 4HPJB 4OTZA 1WDLA 3B7GA 4DMKA 4OLAA 2DFLA 2AQ8A 1BIFA 1P18A 2HMWA 5BSKA 2XQGA 1JIXA 1YB6A 3JQQA 1EA7A 5HIKA 1IZ8A 2X1MA 3OA2A 2GYVA 1RJ9A 2PGAA 2IJGX 3B8HA 5JAQA 1KI1A 4FSDA 4LJ7A 3TF5A 3KSBC 1EE1A 4R2KA 2F9LA 1NVKA 1OGJA 1W88B 3O73A 3TZQA 4Y67A 2Q7DA 3PX2A 1FRZA 2X9NA 1GUAA 2OTCA 4OYLA 1W96A 2NG1A 1EQ2A 4RSRA 3IURA 1Q1ZA 4YMSA 1T5SA 1AMOA 5DBGA 3NDRA 1SR8A 1T36B 1MW9X 1N5IA 1Q19A 1SCAA 1U7HA 1YOVA 4BNLA 1MIHA 1OFIA 3I8OA 4K6HA 4IIEA 4QPDA 4Y2TA 1XHEA 3I83A 3QVXA 2NAFA 3BFKA 1WMBA 3AERA 1YD7A 2KJQA 1IU9A 3O47A 3ODGA 4MROA 4BMDA 4DJEC 4EW2A 1QONA 5BSGA 3H2IA 4B84A 1F1JA 1RHMA 3DE6X 3MTDA 2FJUA 1C9MA 3C45A 4IIUA 5HMMA 1KDZA 1QKJA 3U4GA 1RBZA 4EGQA 2IZ6A 4RH0A 5AM4A 1QUEA 3TIVA 1BWQA 3DB2A 3IHLA 1ULZA 5KNBA 1MIOB 3EXFB 3M9LA 2JIOA 4MLDA 1V5WA 1GFSA 2A4KA 2VDWB 4IO0A 1ZRNA 3GPIA 5ALKA 3KQOA 1ACMA 4AZ0B 3SPXA 3WGGA 1TTHA 3FOZA 4W5NA 3A6FA 3NHPA 4PONA 2GTPA 1PG0A 4L9SA 4M1WA 5EKDA 2QN9A 3RREA 1PJLA 2B4YA 5BR4A 5D3MA 3MJFA 5BR8B 1OPRA 3AEXA 1M33A 4XSGA 3LUBA 4P98A 5LYJA 4QU0A 5C5DA 4MHTA 4BVJA 5DGHA 3WLNA 1LVUA 4Q4HA 2EKLA 3HUUA 1U2GC 4RXTA 3W5JA 5BN5B 1XE3A 5KVQA 4JGGA 1S2GA 4BLOA 1RCUA 2QTFA 4P86A 3WYDA 5LQNA 4X7RA 4NMHA 4TX1A 3RASA 3WL8A 1J22A 4FOSA 3THWB 1QM5A 3MTIA 2PL3A 3KXKA 4MP8A 2OFFA 3I5XA 2W6JA 2BUBA 2XWBF 2G06A 1YA8A 1CQPA 2Z1DA 4IS2A 1GTZA 1RJ9B 1T9DA 4R54A 1G8YA 3EQ7A 4LMRA 5K0JA 4E14A 4C29A 1LRKA 3HUEA 2VSNA 2OKGA 1OB5A 3EVEA 1JJBA 2WQZA 2C58A 2WYWA 1GAJA 1M83A 2HD4A 3DBRA 3I73A 3MLAA 4NJEA 3RRXA 3C16C 3SQMA 2QT0A 1MAUA 1TKCA 1Y98A 2EKBA 3ZI4A 3GLIE 1C3OA 1TGYA 4FYPA 4GM1A 1GZUA 3TTUA 2B69A 2HWUA 3A7DA 3IQGX 1SC3A 1HYEA 1K1EA 2XGOA 4O0LA 3PKZA 4W8GA 1ORTA 3NKLA 1U28A 2Y0BA 2FPUA 4MINA 3ZCSA 2ZRMA 1PX2A 1IQRA 2NADA 3EUFA 3ANMA 2Z04A 3PHHA 3WHPA 2EGHA 2QGZA 3JV7A 3UIEA 1NF8A 3ET5A 2JARA 2QZPA 3P5BA 4WXHA 3VHQA 4F3CA 1O5IA 3HN2A 3QGMA 1VJCA 2Q0XA 3FRHA 3K0AA 3OEHD 4IEEA 4A3SA 3H05A 3QF4B 2A0FA 3ZVRA 1DQYA 2Q2OA 3QA9A 2I67A 4I4CA 5KWIA 2B1IA 1Z35A 2EZ9A 2Z2IA 1T29A 4CM5A 2QI9F 1N36B 1GNVA 3ENWA 1G5RA 1KR5A 2CBZA 5CBKA 2BHNA 1Y4AE 5H16A 3EA4A 3V7YA 1LPOA 3RVRA 2HCTA 3C3XA 3N2KB 2F1HA 4QHTA 5C5IA 1DXYA 2VA8A 1JU9A 4DDMA 4WBNB 1QJCA 1L5HA 3DD5A 3IMGA 4YEDA 1JDZA 3IUYA 2G9NA 5FV4A 1SBCA 3BJRA 5P21A 1FDRA 1V4NA 4P0TA 5K51A 3H9JA 5L4SA 2XV1A 1Y80A 5JAIA 2P8SA 3EIQA 4FGSA 3R3VA 4BN5A 2FKNA 4CV1A 2OBXA 3LT0A 1OBVA 4FIZA 3SCZA 4AUNA 3QPUA 1Q5PA 4YMLA 2QLFA 2ZJBA 3DUFA 2P62A 4MP6A 1QHFA 1U0LA 3HZRA 3JQ7B 3S0JA 1QIEA 4TOIA 5LCXA 2C7PA 2ZB3A 3HCEA 2WKPA 3OT1B 5G02A 4AI6A 5ESWA 4A92A 4Q21A 1E2JA 1MRZA 1KVUA 1SWWA 2ORED 2X5XA 2XIQA 4KN5A 5A3SA 4CKCA 2VWHA 1Y8QA 3OTQA 1O6FA 3GRVA 1FCJA 5A0VA 4HAWA 4MGKR 1TA4A 3UT5B 1AGYA 5DTIA 3EDQA 1PFKA 1DV2A 1RIIA 1ZD3A 1BCSA 2X22A 3A04A 3TBHA 1E8NA 1RWXA 1VPVA 1XZHA 2ODAA 4POAA 1NVBA 5LLSA 1GT6A 5B1YA 1LPMA 1T1RA 1Z2PX 3I45A 4RADA 4IEFB 4P0QB 3D5QA 2PBLA 1EWTA 4B81A 4ZIRA 3ZZNA 4DLZA 2AIRA 3KR0A 3OP1A 1S02A 4OIFA 2AZ4A 3BFVA 4BNDA 2WNSA 1L7BA 4MS1A 5F23A 4QDKA 1PS0A 1CS0A 1Z2CA 3TM4A 4H17A 5EE3A 3BIJA 1ZINA 2ZYUX 1RWBA 1QGAA 2NYUA 3BBLA 4J0FA 3NZEA 4QUGA 3RAGA 4CQMA 4PICA 1Y3FE 1WUHS 2ISSD 5F3RA 4FDTA 4JELA 1A1SA 1I3KA 4GVXA 4KIJA 1LX7A 1YQXA 4RY2A 4D4KA 1MO5A 4PYJA 2NVUA 1IATA 2PSDA 1V25A 4LRXA 2FN3A 2XUPA 3Q87B 4G2TA 3QVUA 4QGAA 4R2XA 1QORA 5CG2A 5EKXA 4NONA 2QMEA 1XCLA 5FA6A 4DC1A 3WS7A 1N33B 4B8YA 4F3NA 1YI8A 2ZI6A 2PH7A 2ZYHA 3JARA 1F51E 5GV8A 2JG3A 2DPHA 3BB4A 1R5OA 2O2ZA 4J49A 4R9NA 3VSDA 2RKBA 1XDWA 1PYOA 3AUYA 3MTEA 3QKSB 4BGEA 4W9MC 3KQLA 5H1YA 2OGSA 2BTQB 4QULA 2FQYA 2ID7A 5I45A 1QO0D 2WIFA 4FDMA 2IZZA 4X1OA 4XB2A 1W93A 1TM2A 2B94A 3NWJA 5FJJA 4RCVA 4D96A 1GAWA 1HPLA 1IDOA 1YQTA 5SZIA 3R6LA 2X14A 5IVKA 4NDAA 3L0BA 4G86A 5LZ5A 3EISA 4EW3A 1EP9A 1XZIA 2GD2A 1N8SA 4Q9IA 2BE9A 1V45E 2VL7A 4UNQA 3S2FA 5AVJA 4QZVA 5AK0A 3JZIA 1FSSA 2ZAOA 3IMKA 4OM8A 1MC1A 3I64A 3R41A 1T91A 2OO5A 3AUFA 3FLEA 1VBKA 3WX0A 2JJQA 2EFHB 2I78A 4TYYA 5J5VA 4RQUA 1FL9A 2ZEJA 5DWQA 3VMFA 5KNCA 1V9LA 4KXQA 1FA9A 1PQWA 1XV5A 1GVNB 1WW2A 2PWAA 1TDJA 4OP1A 1HXHA 4JLUA 2WKWA 4X6UA 3R9IA 1F14A 2PRIA 3A6HA 3MELA 3CSDA 1RD4A 4G1UC 4RGBA 4C78A 4FX2A 1YBAA 4KZKA 4YHHB 2FPMA 9LDTA 3ED1A 2X5NA 1Z16A 3CRW1 4Y30A 1M6VB 3NASA 2BOVA 2DCMA 5FHQA 2XT9A 4C2BA 5G4KB 1PI3A 3RS4A 2YICA 4EKIA 1GPJA 1ZM4A 5IN4A 3J80A 3AGQA 3P20A 1GU1A 4FR0A 2YRFA 3LKDA 4KVGA 4XIIA 3WYEA 5KMGB 3WAGA 4NJMB 1QIMA 2EG5A 3BGWA 5FFFA 3RG8A 2R86A 2OXFA 3T3OA 1L8QA 1ZCFA 1D4AA 3AM3A 1EFHA 5LJIA 1TXGA 4DM4A 2JIZA 4E4TA 4NCJA 3DHNA 4NP6A 3OJWA 2J5QA 2PMFA 4M76B 3ZBPA 4EDFA 1N7GA 4GKJB 3AETA 1O95A 1TCUA 1XRPA 2WIDA 4TWAA 4J0GA 4HTFB 5K01A 3KYCA 4NV3A 3H2YA 1HT0A 4H6PA 4BMXA 1E3LA 1HNNA 3CUWA 4YCNA 5J5CA 3P9RA 3RNOA 3K1ZA 3ZLBA 1NDQA 3QMWA 3IP1A 4JMLA 3CCCA 3KQYA 1X8LA 4RUKA 5JXGA 3EH2A 3VZSA 3LHSA 8ABPA 3SFVA 3CZRA 3CW9A 1XWWA 3E61A 4ALKA 1HYBA 4OH1A 1HM5A 2DWUA 2C3OA 3C6ZA 1XMVA 5ILQA 2CD9A 3CKYA 3X44A 4PQGA 4QNRA 5IASA 4U3JA 4DC0A 1B14A 5AW3A 1FXWF 4ZYTA 1YGYA 4FWTA 1D6SA 3IA2A 4A9AA 4MA0A 1E3WB 2QNBA 1QVWA 1ORHA 3WLIA 4NU6A 1E2MA 3C3MA 3OZCA 4IRMA 2IUUA 3RYTC 5BSHA 3GX1A 4PC6A 4NHOA 3RSZA 4P34A 1GGNA 3QBTA 5BYBA 4ZV9A 4BVLA 3OCZA 1RWOA 5M04A 3CJRA 5C8YF 1DTSA 4U4AA 1DHRA 2CVQA 3RHFA 2GOYA 1U2RA 4CKZA 1JGTA 4KAAA 2ZJ6A 3KC2A 3B3AA 1W9MA 3EN0A 1ZRMA 3W6ZA 2G4LA 2AXPA 1JF8A 2OZLA 2PUAA 4R0VA 5JNUA 5GAJA 2NZ2A 3RARA 4RX1A 3S7ZA 4BJ1A 1CZRA 3ABOB 1GFZA 1ONSA 1NI5A 3DF7A 2XA2A 3EMBA 1WMDA 3O3CA 5DPMA 3MYYA 3VH2A 3WWCA 4BQEA 4RD2A 4HDMA 5HUJA 1AGRA 1GNSA 1RWVA 1TVCA 1RJWA 4X20B 4BYMA 5G1OA 1VGQA 3DZGA 4HUJA 2DQSA 5HVNA 2AKEA 5CDFA 4Q1BA 2I8AA 3S3TA 3UM9A 4UAJA 3BQNB 2Z1MA 3IRVA 5IJ9B 2BGTA 1AMNA 1A7KA 1N5RA 2XGJA 1ZA2A 1PW5A 5ICFA 5LP6B 3T99A 4QKQA 3D0RA 3QA3E 2GTHA 1R5JA 5T4EA 4A8TA 5E3HA 4GT1A 2JFWA 2CXQA 1WMSA 2O2EA 2NUPA 3H1BA 1E9AA 1GL9B 3MA0A 1AOXA 1JDTA 4G67A 4UBMA 1D2CA 3V8RA 4C0KA 4BRWA 5L9AA 2HSWA 3NHYA 3O83A 4E4YA 1KU0A 5JSZB 2C2KA 3H0KA 3U16A 2PBZA 2YZGA 4UM8B 1VL6A 5JIBA 5I3ZA 1LKZA 1WMEA 3ZTWA 1NW4A 4PYRA 1L9KA 3ZE0B 4GH5A 2YHAA 4YP0A 3UG7A 1QDLB 1NURA 3EH1A 3U7HB 2H7YA 4IGEA 3A25A 4OFWA 1XFAA 2QLMA 5DLQC 5CVCA 1ZUD1 1ZBDA 3OC0A 3TKAA 4CLOB 4IYRA 2C9OA 4JLVA 2GD0A 2OCYC 3D1LA 2QR5A 2I4OA 3OZWA 4QGHA 4RVNA 5GOZA 3NBZC 1UADA 2KX7A 4RVOA 2FMTA 3OFJA 5KWVA 2JJYA 1CB7A 1XJ5A 3RRNA 2VRBA 1JKMA 3LQQA 4OA8A 3RIXA 4B3XA 1OV4A 1Z0KA 3BL6A 3JALB 3NRBA 3OM9A 4EITA 3ZVNA 1G0OA 2ZJYA 3IP8A 2YZKA 1UKCA 3DNMA 3LHDA 3F3YA 4BO7A 4CHTA 3D43A 1X7DA 2AMFA 1IC6A 1FNNA 3ZJ5A 5D5PA 4I3HA 4Q18A 2ZBGA 3SYTA 2Z3ZA 4ED9A 1C8KA 4NJOA 4QYTA 4IXTA 3AL3A 1QSGA 4YQZA 4RA6B 1CJBA 3C24A 2P9FA 2OVBA 3VBCA 5HOEA 1E6LA 3ON5A 3PU6A 2A9KA 1AH2A 4Q05A 421PA 1FP4B 4I1VA 5IDQA 4RE6A 2BBSA 5HIMA 3PXGA 3C85A 1KRHA 2RHRA 1X9HA 4ER3A 4MYRA 2FRDC 4J0IA 1ODCA 4GBMA 3CVVA 1ENOA 4JJKA 4DM7A 4I4TB 4YDSA 3DZFA 2GK6A 2OQIA 4LAFA 1BZYA 2FI1A 3INNA 4OY3A 4O33A 4UCQA 1WCIB 3U0BA 1L3BA 1OH8A 2JB9A 4JC4A 1RPZA 2IOFK 2IPMA 3MWGA 3UT5A 3I5YA 5JJKA 1J2EA 1V1JA 3HI6A 4AW9A 4YCSA 1ISFA 1W9HA 4D9BA 1J8QA 1WWKA 4OD0A 3JVEA 1HYGA 3Q3CA 4KYIB 2FPLA 2LNDA 3G8YA 4LYFA 4YRRA 3TSZA 1SUFA 1KAEA 2AA3A 3ABZA 3Q0EA 3RGWS 3WWYA 1J23A 1ZVVA 5FBLB 2FWPA 2X8WA 5I7EA 3R9KA 2WYUA 1ORVA 5CB4F 2VWGA 2VBCA 2G72A 1AO0A 1ZQ9A 2H4HA 2QTWB 1CUUA 3IX7A 3JWEA 3GPCA 3I0ZA 3IOCA 3MS4A 3R5FA 3PGKA 3ZTYA 1CJTC 2Y66A 4HNRA 1M2OA 2E2WA 3A32A 2UYOA 1WF6A 1S5PA 3QPAA 3OPYA 4ZI3A 4ZU1X 1H66A 1SHUX 4ARAA 3GGDA 3Q1LA 1ECLA 2PH1A 3NBFA 4AKSA 5BN4A 2QUAA 2HMTA 3R5KA 1Y63A 2H1CA 2Q5JA 1OWNA 3CR8A 4G4SO 4IDAA 3EG9B 2QQEA 1WA5A 2JIRA 3K8OE 1MT3A 3IUBA 2ORIA 3FPCA 3EFOB 2F00A 3NHFA 1IHOA 2PA3A 4BKQA 1BXRB 4E5SA 1J25A 2I7TA 2W8ZA 1CPYA 4US1R 4BRSA 2JIMA 1GPKA 4GRDA 1LDGA 4BQQA 4EMTA 3JWPA 1SXHA 1TMKA 1BW9B 1AURA 1QFSA 2PKRA 2XOEA 4H1HA 2ISQA 1L7MA 4IHJA 1JQ3A 1JDVA 1EFVA 4LRSB 4CLDA 4FFRA 4D6PA 3ACDA 4JITA 4Z4QA 4CQJA 4HQ6A 3L3BA 1UQRA 1RCTE 3WDKA 2CDAA 3OOHA 2WT4A 1T8UA 3U4HA 2DUUA 2Y2UA 3D6JA 5DLEA 5I9BA 2XBUA 4XFJA 3WQRA 4BNZA 1L4UA 4MCJA 8MHTA 4HTAA 5AM3A 2QBYB 2WJ6A 2WJ4A 1BN6A 4JVOA 3NBMA 1KMIY 4HQKA 4TMKA 4Y9DA 2PUEA 2O5VA 4A10A 4MAFA 2QZ9A 1MXHA 2PGDA 3AHGA 4J1SA 2HU7A 2C3UA 1DC6A 3Q11A 3IEMA 4FNMA 4HRXA 3KQPA 3ZWBA 4KE9A 2OZEA 4MMXB 3T3EA 5JQGF 5H0IA 2HLPA 1E3DA 4I9FA 1P8JA 3RG2A 3SBDA 3ILSA 3T5AA 5FUWA 3WLLA 5H82A 1SCIA 1BVHA 3AW8A 2P1RA 1COWA 3TNLA 3WA7A 1E92A 5HE8A 3M4NA 2A5LA 1TK3A 1TJ5A 4JLSA 4TQ9A 2C0CA 4ENQA 2HV9A 3SOZA 3CNLA 4UU8A 3NONA 4DY6A 3L6EA 1A8QA 3MBKA 4NRDA 2HFKA 5JD4A 2X5OA 4UVDA 3C14C 3CKMA 4ADSG 3ZK8A 4Y1RA 1YI0A 2BELA 4YUVA 1I3NA 4GWGA 1J20A 1VKNA 4JI3B 2DRIA 1VP9A 4MR7A 1VIDA 3ZHVA 4MYUA 5EP2A 1FTWA 4URZR 3NP7A 1XPOA 1EE9A 2C5EA 3UK1A 3R0XA 4N6GA 5BN4B 3SJCA 1O77A 3CTMA 1T26A 3SJAA 4AZTA 3FBWA 4XGRA 1R1DA 3O75A 3T7DA 1GZHB 1PYGA 3U4IA 2WV7A 3N2LA 3E53A 1GG2A 1RPAA 1C9EA 4TYPA 2A9QA 3SI7A 3QEAZ 3L92A 4J2HA 5BORA 4L76A 3C41J 3GEHA 1Z82A 2OCAA 2ZE5A 2MR6A 4GIBA 4LX8A 1I7PA 5AJTA 1KGSA 4LA4A 3EDOA 1NNI1 4R0MA 3V4LA 1FVOA 2F6RA 4DCNA 2J46A 2H00A 5B7QA 5CCXA 2C4WA 4MB2A 1VL1A 5IKPA 2ZAGA 4LC0A 4LJKA 4UZEA 4IHJB 1SUAA 4ZAXA 3EIOA 1CUWA 4W7IA 1OJLA 1JEJA 2WTBA 1NZFA 3EQZA 3Q7EA 2EYQA 1ZZGA 4LXTA 5T41A 2FX3A 3SIRA 5KNDD 2P6UA 3GOHA 4G0PA 4ZQHA 1J00A 3MRTA 2QMUA 3EUEA 4YJHA 4ZAYA 1OHHA 2AS0A 4MVJG 3TMAA 3TR0A 4UTNA 2ZAYA 1VBFA 2XUFA 3GQBA 1HURA 4NE2A 5TEWA 4F85A 3ZNPA 4DLRA 2OGZA 3UJBA 4HN2A 2R1TA 2JIDA 4HCJA 4CT4B 3OU2A 3AI3A 3IIMA 5DMHA 3R0IA 1RRPA 3OTGA 3FFWA 1SCUB 3PC6A 1SRQA 4INJA 4I1YA 4OUDB 4BMPB 4C89A 4DUZB 4Z4FA 1PJRA 5A4FS 5ALJA 2RGBA 3DOOA 1XTTA 1II9A 3OQBA 1ES9A 2BFEA 3NQ41 1ZJWA 5DHTA 1KYVA 2VJAA 3UAYA 1CJCA 1I2MA 3VJKA 3WKCA 1VL5A 4NE7A 4Q7MB 3I23A 3PHCA 1DJLA 3IBCA 5AVVA 4KQMA 3UQYS 4PZEA 2AEJA 1W94A 1OXVA 3LDUA 3PB3A 4YCJA 4NS1A 1YR9A 4IFBA 1CQIA 4DSUA 2DLDA 3NH6A 4BIIA 5JBQA 2GWRA 4YY3B 4NMXB 5AOVA 1VSQA 3H97A 1NXOA 3PNBA 1NMZA 4UNPA 5EP1A 4XZ3A 3TIIA 3U26A 4B5LA 3GFQA 2GBLC 3A1WA 1PU2A 2BKVA 2FLVA 4J7UA 5EJIA 4BAUA 2H63A 1FBNA 5H68A 1Q15A 2WAAA 1ADBA 3NBQA 2WP8J 2DFNA 2MSLA 2Q1SA 5KCMA 4LHZA 1YQQA 3DUWA 3C15C 1AK2A 2G1KA 4E2XA 3RTGA 2Q6KA 3IEKA 5LL6P 4MHSA 3BCUA 4JSRA 3TZKA 3DE7X 2XYPA 3BFXA 4K03A 4FFNA 2GN6A 2WVJA 3AI1A 4C4YA 3Q7SA 1QGOA 2DOKA 3G85A 3U3MA 1POWA 1XEFA 3WRXC 4G6ZA 4E46A