3PDJA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase 1 (11b-hsd1) in complex with 4,4-disubstituted cyclohexylbenzamide inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
272
structure length
272
Chain Sequence
QQPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMDRFIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Optimization of Novel 4,4-Disubstituted Cyclohexylbenzamide Derivatives as Potent 11beta-HSD1 Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 101
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pdjA00
1EQUA 4QSMA 1O94A 2NUAA 2W2KB 1U2GA 5JY6A 2PR2A 4FQ8A 3RIHA 4FOOA 1E92A 3K2EA 5A5EA 4AJKA 4OOEA 2O7QA 3KB6A 4BO9A 4OXYA 2ZQZA 2LDBA 2YDYA 2QRJA 4J1NA 4E5NA 3FN4A 4NR0A 4IZIA 3RU9A 1PJ2A 4IUYA 4J2OA 1N2SA 1X1TA 4IXWA 4MVJM 4N5NA 1BDMA 3WR5A 1CQIA 2PGJA 3HNPA 3GK3A 4DTIA 4CMKA 2OFPA 3ZWBA 4MPDA 3UH1A 3HDYA 1PR3A 1DSSG 2DUUA 2J3IA 4JJFA 1YBMA 1B15A 1GY8A 4K28A 4EDFA 1Y7TA 2DFVA 1W6UA 4GLOA 4J1TA 2FZWA 3I9JA 1DC6A 2IYOA 1UAGA 3NV9A 4MOWA 1HYHA 2UUOA 5G0UA 4RF4A 5BR7A 4PG6A 5THQA 1HE2A 2Z1NA 3QQPA 4QX6A 5IJZA 1VKOA 1CDOA 5KKCA 1I3NA 2B4RO 4YWJA 4DA9A 2YFQA 4CMIB 4BNFA 3WX0A 4BNZA 1XLTA 1WPQA 1E1MA 5A3JA 3DAPA 3C24A 1LSOA 3B70A 5KJCA 1LBEA 4Z0TA 2W2LD 1DJNA 3BMCB 1U5CA 3BA1A 1JVBA 3WFJA 5LDHA 3FNHA 3FHLA 2JAPA 3QA9A 3QWAA 1LRLA 4WCFA 4U8GA 1UXIA 5G4KB 2D0IA 3W6UA 5JYDA 1G0NA 5C7OO 2B4TO 5EL0A 1ARZA 1Z6ZA 2Q3EA 3AOEA 3GZ4A 4PLZA 4BO4A 3F3SA 3UXYA 4NIMA 3HFGA 4YRBA 4GL4A 4X54A 2DU8A 4JK3A 4YA6A 2I5PO 4RO0A 1I24A 3PWSA 5JCXA 1LSUA 1NWCA 2BHLA 4OM8A 4O63O 5TT0A 3N74A 4B3IA 3TZCA 5HM8A 3DEYX 4GKVA 3D1LA 3U4IA 4ND1A 4GSLA 4URFA 1LXCA 1C1XA 2RCYA 3AI3A 2YYYA 1E0DA 3RCBA 4DLBA 3JQCA 1A7AA 1OC2A 2VWHA 1RKXA 5DBGA 2AQ8A 3DL2A 2B4QA 1FDTA 1KIFA 5DBFA 5JDCA 1M6WA 4WCDA 5CPFA 3ONFA 1K6JA 4NJOA 1D4FA 3TZ6A 3UUWA 3FR7A 5C37A 3RASA 1H2BA 1DRWA 2NVBA 1VJ1A 4MVJG 1CF2O 3IKTA 3BMNB 5L53A 2P4HX 3VPFA 3D5TA 3D7LA 4HNHA 2B69A 3S55A 1T4DA 2HMSA 2VHWA 3W4KA 3F1LA 1QYCA 4J0EA 3SLGA 5C3MA 3SVTA 3AUSA 3HADA 3INRA 4XGKA 1R0LA 5HBRA 3ZN2A 5T57A 3L4SO 3AI2A 4B8ZA 1K6XA 2Y1DA 2GLXA 3FTPA 4Q3AA 4PRLA 1A5ZA 3EC7A 3GEMA 4YJFB 3S2GA 4B4WA 4GMFA 4XB1A 1MA0A 1PZGA 1YKFA 1WDMA 3EDMA 3MOGA 3NKLA 4XB2A 4QTZA 5EERA 1GCUA 4CM7A 3L6OO 1DIBA 4GVLA 1GZ6A 4PLTA 1Q7CA 4ESOA 4BKRA 2X1HA 4HNGA 2WD7A 4I9HA 2BH9A 3I23A 3JD1A 4MO2A 4R3NA 4FR5A 5GY7A 4O6VA 3OP4A 3L6EA 3VH3A 2GN4A 5A4DA 3IUPA 1TT7A 4FPXA 5ENVA 5MGBA 1OI7A 3WIEA 3T4XA 3DMTA 3FSRA 1QYWA 4R5HA 3ZWNA 5L51A 2J3KA 4PLYA 1T1SA 2R2GA 1LDGA 3GMSA 4NMHA 4CM9A 2Q1UA 4Q3CA 2YV2A 5EMHA 1YH3A 2AEFA 2YQ4A 1K6IA 1NPTO 4L75A 2OP0A 1H93A 1P9LA 1GFSA 3GN1A 4XRRA 5TC4A 2C7VA 1LI4A 3DBHB 5JSFA 3UF0A 2D2IA 4FW8A 3WWZA 1EK6A 2PKQP 3ZWPA 4HFMA 5KVSA 5H83A 3KYBA 4XIJA 3E6AA 5AQ1A 3ITDA 4E5YA 2JD0A 2FSSA 4E3ZA 4XD2A 4WEQA 1LUAA 3C7CB 3MJEA 2NSDA 3C1OA 4RVUA 4FS3A 1ZZEA 3MJTA 4CLOB 3A14A 1PJTA 1H9BA 1DFGA 3H6KA 2C7GA 3QP9A 4CLOA 2GYYA 4BO6A 4DBVO 4XGNA 3LDHA 2OORA 4FFPA 4IM7A 4UEJA 1LDNA 3IS3A 4GKBA 4ID9A 3U4CA 3KHUA 1ZK1A 1E3WA 4EW6A 3WFIA 4ZHSA 1HDRA 1Y6JA 4CMCA 5FYDA 3OICA 1DLIA 4NU5A 1VL6A 4YRDA 2O2YA 3ENNA 1UXHA 1Y9EA 3DQPA 4NBWA 2X8LA 4D0SA 4MVJA 5AXBA 4BO7A 3KO8A 2AEMA 2B0JA 3AM5A 3WJAA 3VOSA 3NTOA 3ZWAA 3ROPA 2PTGA 1SEVA 2QHXA 1V0JA 3IIEA 1J49A 4P8RA 4W99A 3NTRA 4AJEA 4BNNA 1GYPA 4UVGA 5FF9A 2H1SA 1C0KA 1EUDA 2GCGA 3KEQA 1EVZA 4K9DA 3DOOA 3KXDA 1RPNA 3CZRA 1RM4A 4YJHB 2XOXA 1WVGA 5AXCA 5JDCC 1XR3A 4NNJA 3S2EA 2I76A 2O4CA 4NBTA 5DULA 4ZQEA 2E6UX 3I1JA 1Y8QB 3LF2A 2O2SA 3ZNQA 2DBQA 4GVXA 1PJLA 2PGLA 2WSBA 3D4NA 2CD9A 1C0LA 2CVOA 1KVUA 2EWMA 4CM1A 2QG4A 1T2DA 5JBIA 2VYNA 3PIDA 4I5FA 3U3XA 3ZNOA 4CJXA 2EERA 3OEWA 4XEHA 2VTDA 1SPXA 1D1TA 1BRMA 1O0SA 4R1SA 4PG4A 1IUKA 2VN8A 4KMSA 3HUDA 5L9AA 1YS4A 1TI7A 4JJIA 2C5EA 5THKA 3ZI0A 2J3HA 4FOSA 3Q2IA 1RM0A 4Z9XA 4TKLA 3ON5A 4WE3A 3PYXA 5IAAA 1J5PA 3JQGB 5L40A 4J7CA 1F12A 3AUUA 1NR1A 4S1VA 5IG2A 5KVVA 9LDBA 4WCFB 2OUIA 3AOEC 3F9IA 3DOJA 4BGEA 3UFXA 3LVFO 4R68A 1BSVA 5FWNA 1K2WA 3ROMA 1M76A 3E18A 3H9QA 4WCFC 2VT3A 4MKXA 2FOIA 1ZNQO 3T7CA 2VHYA 1ZSVA 2Y1GA 3VZPA 4E5PA 1GL3A 2RIRA 4PLFA 2ZATA 3VTFA 4L4RA 3OJ0A 4AL4A 1GUZA 3E9NA 4HADA 5CEFA 3VH1A 4B79A 1MXFA 2Y93A 2X9GA 2HO5A 3A9WA 1U7HA 4EBFA 2O3RA 4EUHA 1QORA 1ZKMA 3DR3A 3VKUA 4KTVE 3DBRA 4DREA 5F1KA 3GF4A 4N5MA 4OAQA 3TFQA 3VC7A 1HDYA 3DZIA 4IXTA 1E7SA 4OOFA 1WDLA 1CIVA 2IE0A 3RUDA 4E2YA 4BNHA 3K2BA 4BNIA 3RJ9A 3KVOA 5CDSA 4Q3DA 4CM8B 3ULKA 4XYGA 1LC0A 3PXXA 3SEFA 4DPMA 2VYVD 4C7KA 1T4BA 4CV0A 1R16A 2C29D 3B1FA 2XXBA 4W4TA 3KSZO 1ZSNA 1T2EA 3AY7A 3I3OA 3PQDA 3OQ6A 4CQMB 1IB6A 2VQ3A 5BNFA 3BXXA 2Y99A 5DP2A 4BKPA 2VWPA 1D1SA 1GQYA 1BVUA 1WXDA 4MVJE 5F21A 1KVRA 3C8MA 1HYGA 2B35A 2G76A 3VTZA 4G81A 1N5DA 4DRYA 4CPDA 2D59A 4BL5A 5MDHA 1HRDA 2F00A 3VPGA 1JA9A 1ONOA 5JO0A 2Q1WA 3VH4A 1IZ9A 4FGWA 1YGYA 1DRUA 4MIOA 1Y5MA 1T2AA 2FWMX 3HB4X 1PJ3A 3STHA 3ZWXA 2RHCA 1NHGA 1PQWA 1SOVA 3W4JA 1LEHA 3FPLA 4II3A 5EESA 4OXKA 3GT0A 1HSOA 3ASUA 4QQRA 4C7JA 2E82A 1ML3A 4O0LA 5T67A 4R3WA 2OL4A 3I9KA 3W8EA 3K31A 4RLHA 2FHSA 4BNLA 1B3BA 2QZ9A 1SMKA 2GN9A 3Q6IA 1PJCA 4FFMA 3ZHZA 3WOHA 4OSPA 3D3WB 3CKYA 1XA0A 3GDOA 4B8WA 1NR7A 2ET6A 3NGXA 4Q3EA 2GN6A 3BHIA 4D41A 3GOHA 2E37A 1T2CA 1KEVA 2W2KA 3C1AA 3H2SA 4PLCA 1ADBA 5HS6A 2DTDA 2X5KO 5G4KA 3RBXA 5A04A 3U4DA 4Q3BA 3DZGA 4WLNA 1B16A 3VPXA 2GSDA 4E2ZA 1O89A 1R4MA 2EKPA 1NASA 5TX7A 2ZB8A 3GFBA 4RVHA 1W4ZA 3ST7A 2NU7A 3PFWO 3PDJA 3L4BC 4WNIA 1KVSA 4LVUA 4P4GA 4ZVVA 3H7AA 4GI2A 2QRKA 5DF1A 2BRUA 8ADHA 3I9NA 3RROA 3UGKA 4QFDA 3D5QA 4YVFA 1W8DA 5U4QA 1UP4A 2O50A 3F46A 3HDHA 4G5HA 3C3XA 4OO3A 2WYVA 1T24A 4P38A 1YBVA 1YRLA 4NBRA 3AU8A 3VH2A 3WGZA 3JYQA 3CTMA 4AJJA 4DIBA 2ZTVA 4RZIA 1EE2A 4UVHA 4EEZA 4CLRA 1GZ4A 1IPFA 3QVTA 3RQSA 2HLPA 2R6JA 1XU9A 4U5QA 2O3SA 2PZJA 1P45A 1BHSA 3IP1A 3V2UA 4IIVA 4R5MA 1TXGA 2BGLA 4Z9YA 1UZMA 3EAGA 3BTSA 3V1UA 2Z95A 4J16A 4PCVA 1PS8A 3I9LA 4E0BA 1QP8A 4ZN6A 4RVGA 4GWKA 3DHYA 3SLKA 3I4FA 4A0SA 3JQ7B 3GGGA 3TZKA 3HG7A 4MIEA 1YJ8A 2NVUA 4YCAA 4BO8A 1OC4A 3WJ7A 4DL9A 3JTMA 4RPGA 4K6CA 3B1KA 5ENDA 4CV1A 4PZDA 2VYND 5K9ZA 2FPPA 3RFXA 1YOVA 3GNQA 3BIOA 3Q9UA 1LJ8A 3OJOA 3VHRA 4XYMA 2VYVA 3AY3A 3BYZA 4DGSA 1P1IA 2EIHA 2VUSA 4PLVA 5DNAA 3RI3A 3KYCA 3WTBA 4RZHA 4IPTA 4ZRNA 2HMVA 3NTQA 4WUVA 3IQDB 4CV3A 2ZK7A 5CEEA 4NI5A 4E4YA 2J5KA 1CQJA 3TF5A 3NRCA 1HZZA 2DBVO 4E32A 3LT4A 5G0TA 1UDCA 5A05A 5IN4A 3NYWA 5J23A 2VNAA 4A10A 1R0KA 1DJQA 2UVDA 2ZB3A 3H4VA 3X2EA 4XX0A 3RBZA 1YDWA 1ZO8A 3ICPA 4Z9FA 4F3YA 4JBIA 1YBAA 1SEPA 3LC2O 2BELA 2ZYGA 4NFSA 3LSYA 1PGQA 5CG1A 1VI2A 2TMGA 4OXNA 3AM3A 5A1TA 3RUEA 2QQ5A 3CIFA 1DBVO 1B0AA 1I8TA 4HV4A 1ZBQA 1C14A 1NFQA 1EVJA 1HEUA 5A03A 4Z6KA 5F5NA 2XPCA 3PK0A 1J0XO 4OJNA 1IHXA 2C0CA 1YXMA 3VZSA 2JFHA 3GDGA 2G1UA 5AYVA 1LLDA 3NUGA 3MCVA 1DOHA 4WNCA 1H6AA 1KEUA 3I5MA 3GQVA 4I08A 4YTEA 5DDIP 4HBGA 4J4HA 4DYDA 6LDHA 3GAZA 4TVOA 1QR6A 3RUAA 3H5RA 4J7UA 3K30A 2IXBA 2ZTUA 2NM0A 4HWKA 2EKQA 4AJLA 1EUCA 3TJRA 4L73A 4TRRA 4FFOA 1SCUA 1WNTA 1X0VA 5I9NA 4TZKA 4YAGA 1DEHA 5HS4A 3ZV5A 1JU9A 4Q3NA 3DAFA 4I5GA 4RPJA 1WP4A 4OGWA 3BMCA 2WDZA 3TOZA 4AJIA 1NVTA 4CQLA 2A9FA 4BNYA 2O3TA 3L0DA 3WSVA 1EBFA 4J49A 3JQAB 4AJ1A 4WOJA 3TSCA 3D64A 3PDUA 3HFSA 4BO5A 1HE5A 3GVPA 1ADFA 3W6ZA 5DCUA 2ZCVA 4F6CA 1HDGO 5TJ9A 4E21A 3OECA 2HCTA 3WIDA 3MWEB 3U9LA 1UUFA 2YW9A 5A9SA 3WLFA 2UUPA 3HZZA 4GSKA 3DBLA 4ZA2A 3RU7A 2NLOA 3PHIA 1B8VA 2PD3A 2GERA 4UVEA 1HE3A 4TQGA 3QWFA 2XAAA 4YAJA 1NPDA 3WYBA 4J2HA 3RKRA 5FEUA 4MP8A 3JYLA 3QWIA 3M1AA 1NBOA 1UP7A 3I9MA 1PR9A 4XR9A 3DMTC 3FBTA 5HWSA 5I8ZA 4B4OA 5ITVA 4J0FA 4YJFA 1Y5RA 5KWEA 3ZW8A 4ALMA 2DC1A 2YHIA 2W90A 4IINA 1UP6A 3L9WA 1QYVA 5DBIA 3FPCA 4Y6SA 1WMBA 1X7HA 2J5QA 4RL6A 3CMCO 3NJ4A 4IBOA 2GASA 4FCCA 2CDBA 3GUYA 5ICSA 1UXKA 1Q1NA 3E82A 5JDIA 2WE8A 4DIOA 5IF3A 2Y67A 2EG9A 4FC6A 1N9GB 4O1MA 5ES3A 2A4KA 3VAZA 3UCEA 4LMPA 2B36A 4GX1A 4PLPA 3JV7A 3GVIA 1B14A 2AEJA 5IZ4A 4CM9D 4BB6A 4XGIA 1ULUA 1FF9A 4R4JA 3FBGA 1I3MA 2XF8A 2DVMA 1B8UA 3LU1A 3O4RA 4II2A 1PEDA 4QO8A 4QFCA 4CMEC 4EITA 2P91A 1GEGA 3S2FA 2RH8A 3ZGYA 3NJ8A 2JD2A 3QE3A 3PFFA 3QSGA 3OSUA 3DO5A 3HDQA 5KJFA 4F6LA 3S2IA 2ZTMA 2HK7A 1NTOA 1PL8A 1Y9AA 2B5VA 2VUTA 1RYEA 1ZW1A 2G0TA 1X7GA 4Q9NA 4IMRA 1P1KA 1PS0A 3GRKA 5T5QA 3SX2A 2GR9A 3JQ8B 4BO2A 4W7IA 4TWRA 3GDFA 1PWZA 5KIAA 4EYEA 1LDEA 1N8KA 3GMDA 4RCVA 4KUEA 3TRIA 4B7CA 4TZTA 4M1QA 3TPCA 1ZIDA 4INAA 2P68A 2VWGA 2X86A 1LSSA 4UREA 3WNQA 3LF1A 5I7EA 4J4BA 4J4TA 3JQ9A 2NU6A 3IDSA 4Z0HO 2O3UA 4CLEA 2EF1A 1U8FO 4HKTA 1XQ1A 1I36A 3GA0A 1HLDA 3PWZA 1KVQA 5JCJD 4CM4B 3KV3O 2CMDA 3GPDG 5LCXA 4PVCA 1I32A 2F1KA 3V1YA 1OBFO 2FPGA 2O7SA 2DLDA 1SO8A 3H9UA 1KEPA 3Q11A 4WLFA 3PPIA 2P5UA 3DOCA 1U4SA 1CEQA 1A27A 1FDWA 5EPOA 1GUFA 4JP2A 4DYVA 2PV7A 5CFZA 5ER9A 5L7TA 4E5MA 5BSGA 2BFMA 4CUZA 3WB9A 2OO5A 3PWKA 5JAMA 1A4UA 4Y98A 1ZK2A 3ZU2A 2Y0CA 2DFDA 3Q9NA 4F46A 2HMWA 2J6IA 5G0SA 1GYRA 2ZCUA 1JW9B 3OQ1A 3ZV4A 3I83A 5CDGA 1T25A 1EFLA 1I3LA 3UCXA 4I9UA 1U3VA 3B6ZA 5IZCA 1A9ZA 1I2BA 1LA2A 3ONEA 1X1EA 4XYLA 1I33A 1I30A 1NQ5A 5I8WA 4BO1A 4EEXA 4XJSA 2X9NA 4LSWA 1K3TA 1YVEI 3MJ4A 1Q2XA 1ZEJA 2PGDA 3ENKA 5GMOA 3WGIA 3VZRA 1T26A 3MOIA 2C5AA 3ZWMA 4XYEA 2AG8A 1F0YA 2V7PA 4D45A 3H3FA 3GG2A 2NACA 1Z7BA 1PGJA 1EEHA 4RF2A 5T6BA 2E4AA 2VZ0A 3G1TA 4MIYA 3RC1A 1QKIA 1X15A 1GD1O 2P9CA 2Q45A 3ABIA 3BTUA 1LNQA 2W8ZA 5IFLA 1UXGA 1EVYA 1LRKA 1J4AA 3E8XA 4W82A 4YDRA 2I3AA 4DC1A 3KYDA 2NU9A 3WYCA 1N1EA 4UUMA 1E3LA 1VJ0A 4HFRA 5CG2A 2GPTA 3D3EA 4UEKA 1NFRA 4IDEA 5L4SA 3LT0A 3AI1A 3OHSX 1PL6A 2YQ5A 3CH6A 2FY8A 1P31A 3QVXA 2OHXA 3QVOA 3WWYA 5KVCA 2GUGA 1IZ0A 2DUWA 1HWYA 1IULA 5FI3A 4NK5A 1IYZA 1NVMB 3V1TC 4PG5A 3JQFC 4QEDA 1GQ2A 4XQEA 1BDBA 2BGMA 2BF7A 3FD8A 4NBVA 2X9VA 2JCYA 4BO0A 3JQEA 3CUKA 4ROSA 5T8KA 5DP1A 1HSZA 1GCOA 4AJOA 3HWRA 2CDAA 4IS3A 4WLOA 4A2CA 2NNLD 5JW6A 3RFVA 2CF5A 3VKVA 1CYDA 3AUTA 4BNKA 4CLDA 2HK9A 2VOEA 2I3GA 2EP7A 2RH4A 4A27A 1WDKA 4LCEA 1GV0A 1E1NA 4CM5A 1LX6A 3JQFA 2NADA 3M2TA 1VSVA 1JWAB 2P5YA 2ILTA 1YOVB 2HU2A 2Z1MA 1K5HA 2UDPA 4FFNA 4YAKA 3RSHA 2IYPA 2JCXA 3KRTA 4YJHA 4M89A 1PWXA 1BG6A 2NV6A 4TKMA 1NVGA 1VLLA 3DBLB 3N58A 6ADHA 5H81A 4DPKA 1KC3A 3ZU3A 1V3UA 3L07A 1V8BA 1E3SA 1DAPA 5JYEA 2TMDA 4GX5A 2Y1CA 3KBOA 5FI5A 1YL7A 4ZD6A 4QT0A 4D43A 2G82A 4ZQBA 4IDFA 2YDXA 4DBZA 1B8PA 2GD1O 1ID1A 1VE9A 1D8AA 3RC9A 1PZFA 5KCZA 4XDZA 5DZSA 4UEOA 5L7WA 1H5QA 1FK8A 4H16A 4DXHA 4NQZA 3F5QA 4BNXA 4XYBA 2HSDA 2PZMA 4OHUA 3VVBA 3JQ8A 1NX6A 5A9RA 1YB4A 2C07A 1ISFA 3OJLA 1CERA 2POQX 3BZUA 5K6AA 1WZEA 2VNSA 1H94A 4BV9A 1ZK3A 2HKIA 1UH5A 4XIYA 1Q7BA 1ENPA 2BGKA 3PIIA 3C1TA 1MFZA 3PHHA 1C1DB 1PJBA 1KY4A 1BWSA 3PHLA 4N18A 1KETA 5G0VA 3GG9A 3GGOA 1P3DA 1RYDA 1QV7A 2A92A 2BMAA 1EFKA 4Z0PA 1R12A 1AHIA 1BXZA 4OQZA 3G0OA 4KP7A 2FR0A 5G2OA 4DIFA 3AU9A 5LDGA 3GEGA 1P74A 1NQAO 4DWVA 3F4BA 2DM6A 3KLPX 1KYQA 3GNSA 1E6UA 3ROKA 3H9GA 1JKJA 1SC6A 8LDHA 2HDHA 3Q0EA 4DLAA 2RBEA 3FTNA 1W0CA 3M1LA 4Y6RA 1UZNA 4TRNA 3ANNA 2GNAA 5KJEA 1WAMA 4BGUA 5HRUA 1AGNA 1SB8A 3GZNA 3WGTA 2Q2QA 4IS2A 5CHEA 3TOXA 2ZKLA 5IXYA 1TT5A 1YQXA 4N5LA 4YJGA 1X7DA 4YT5A 2YHIB 4UULA 1EK5A 1HDOA 1XHLA 4XA8A 4YBZA 5GZ6A 1FDSA 1SNYA 2PNFA 1GUYA 2C2YA 1DFIA 3KLMX 4XKJA 2NQTA 4JN6B 4LRSB 2EHDA 3PJGA 1E3JA 2BD0A 1A72A 4PRKA 4JNKA 2QYTA 1RM5A 4C4OA 5CEJA 3DB2A 4ZRMA 1I2CA 4IQ0A 4KWHA 1I5RA 1WW8A 3WNVA 4BKOA 1IY8A 1EZ4A 2X23A 4B3HA 4RQTA 3PEFA 2Y1OA 3DHNA 4S3MA 4L4SA 4YT8A 2BLLA 4JP3A 4CL3A 1UZLA 2AXQA 1U7TA 3H3JA 3NX4A 1BVRA 3QRWA 3E1KA 3R1IA 5JCJA 3IC5A 3FWNA 4YT4A 3K92A 3O9ZA 3BTVA 1KY5A 4WECA 4FJ2A 5HA5A 2SCUA 1R15A 1DO8A 2PWZA 2CUKA 1OMOA 1IHYA 3SC6A 4GH5A 4GMGA 4OL9A 2V6GA 4BVAA 1PGPA 4MP6A 5JO9A 3U49A 1BTOA 1ZJZA 2IODA 2ZYDA 4BHTA 2C2XA 4IDBA 2W4QA 3PLNA 3GFGA 3PZBA 5BNTA 1U9JA 1IE3A 4UUNA 2DQ4A 2JHGA 1R37A 2ZIZA 1EMDA 1JN0A 3BTOA 3SBOA 4DQVA 1MP0A 2OMEA 3E48A 1E1KA 1HT0A 4BMNA 2RAFA 4BKUA 1QG6A 4XDYA 2YJZA 3A4VA 2NVWA 2D1YA 1EUZA 3ETDA 3Q1LA 4CLRB 3CINA 4YYZA 3WGQA 1ZEMA 2GGSA 1BW9B 4I9NA 3CSDA 2VHXA 3GPIA 4JGBA 4G2NA 4NJMA 4BNVA 4RVDA 4TMFA 3RBVA 2QZZA 5JC8A 2Y68A 1LDBA 2I9PA 3PYMA 1MC4A 1XU7A 1E6WA 3MJSA 4IY1A 3OM9A 3JD2A 1ORRA 1U3WA 4DPLA 1PL7A 4DQUA 3R0IA 3F6YA 2C59A 3PVZA 1AHHA 4IMPA 3FRJA 1FMCA 2DTXA 1MG5A 3ETEA 3OETA 2CF6A 4ZICA 5I7VA 5JS6A 3BMNA 2EXXA 3AFMA 3VPSA 1HTBA 3GH3A 3H9EO 3UKOA 4P22A 2C20A 3I9OA 2V6MA 5A3VA 4WGGA 5BT9A 1B7GO 1YWGO 5JMWA 2IRWA 3RUHA 5F3RA 4XRGA 4L76A 1FXSA 5IDWA 2CY0A 3JQDA 2PD4A 4YQZA 4U0JA 2IEBA 5TJHA 1B3RA 1L1FA 4D46A 2Y05A 5DOVA 3RFTA 2BI8A 1V35A 3TL3A 4CQLB 3U5TA 2GZ2A 2HJRA 3F1KA 2BFPA 4OQYA 4CMIA 1O95A 1W73A 4W9NA 3O8QA 4CUJA 3OF2A 5TT1A 1GYQA 2BFOA 1PGOA 1LSJA 1BXGB 1DIGA 3DDNA 1PQUA 1I10A 1JVSA 2WWRA 1Z82A 2G5CA 2GZ1A 3ITKA 4HX5A 4RJTA 4I5EA 4LSMA 3GUCA 1J6UA 4B7XA 4ZJUA 3BMQB 7MDHA 4F45A 3GLQA 1RWBA 1C0PA 3WMXA 1E6EA 4ND4A 4YR9A 2FMUA 3JQBC 3HN7A 1UXJA 1YJQA 4LMRA 4IGFA 3DTYA 5U1PA 4DMMA 1GADO 1FDUA 1R66A 1NAHA 2X4GA 3COSA 5L4LA 2W2LA 5ER6A 4MVJD 4D3FA 3TDKA 4D44A 3DZKA 4RLSA 4BMVA 4CQMD 2ZJ1A 1QXSA 2BFAA 4A5OA 4GBJA 2OGUA 1H2HA 1Y1PA 2X5JO 3ONDA 1KS9A 1TT5B 2WYUA 2YHUA 4DQXA 3QJ5A 2GRAA 1TLTA 1ZK4A 4IIUA 5G4LA 4AVYA 2WD7B 2R00C 2OZPA 3ORFA 1VRWA 3OIGA 3P2YA 4K1LA 4NFYA 4CM8A 2D4AA 3WTCA 3OJFA 4LW8A 4J43A 4CMBA 1Z75A 3W4IA 4JJGA 4Z3KA 3ZHYA 1DPGA 4YB8A 1E5LA 4Y9DA 5B12A 1SOWA 2I65A 1XWFA 5I7SA 3AOGA 5KVQA 1GR0A 2O48X 3WDSA 1QLJA 3JQBA 2JKVA 2D5AA 4BB5A 3ZWWA 1C0IA 3JSAA 4M55A 4Y8VA 1PIWA 3G79A 1JKIA 5C5IA 1AUPA 3NGLA 1LTHR 3GHHA 3CMMA 1GV1A 4J90A 1U8XX 4TRJA 3DC2A 1IPEA 2NTJA 4GLLA 3HE3A 4W7HA 1ISMA 1XKQA 1YB1A 4LISA 3F4LA 1MGOA 4R54A 1ZMOA 1XCBA 1EQ2A 1LLCA 1S7CA 3OIFA 3WGYA 4WLVA 5KJ1A 4XCVA 2PZLA 3DBVO 4MINA 3HSKA 1SZJG 4FBGA 1P33A 5JAIA 4AICA 1E7RA 5B4VA 4FN4A 5F1OA 2JCVA 1SBYA 4R16A 1MX3A 2IZ0A 2EW2A 1VPDA 1P77A 2J5RA 2AQIA 5DN9A 1BMDA 3INTA 1TA4A 3BMOB 2NWQA 3GN2A 3PJDA 4YJGB 3FCOA 5H82A 1PJQA 3GGPA 1GDHA 1LDMA 1M6HA 4AJHA 1H6CA 2QRLA 2WTBA 3PYLA 3GVCA 1VKNA 2EP5A 1NM5A 3CPSA 1H9AA 3ZWOA 2Z5LA 4ALIA 4DVJA 4QO7A 1DRVA 1AE1A 2EV9A 4YAIA 1V9LA 1KBZA 2P2SA 2A35A 1NAIA 3OJEA 5DCWA 2Q1TA 4PG7A 2UYYA 1EBUA 2EJVA 5JLAA 4J9VA 1I01A 2VRBA 1GTMA 4IQGA 1CJCA 4J9UE 5B37A 2OXIA 4RGBA 1BW9A 4NBUA 1P44A 3V5NA 3PHJA 4ZU3A 3PJFA 5T64A 4RDHA 3DXFA 3LK7A 3GNTA 4OKNA 2WJPA 4ND3A 3K96A 5JPIA 5AXAA 1V6AA 3IL2A 4BNJA 4N7RA 4GQAA 1QRRA 2FZEA 1GEEA 1ZMTA 1A9YA 3ANMA 1OFGA 4UAGA 4BQPA 2X6TA 4NG5A 3K9QO 4I5DA 5GZ1A 2ZB4A 2AE1A 1PSDA 4QECA 3TN7A 2AQKA 4JXKA 3TFOA 3JQGA 1CETA 2QYSA 3D0OA 1B2LA 1BGVA 3NDRA 3FNGA 1C1XB 1M67A 1MB4A 2D3TA 4D7AA 2YFHA 4BNTA 4KZPA 3P5SA 4KOAA 3LT1A 1YQDA 3PRJA 1OOEA 2NU8A 1O5IA 3I6IA 4DUPA 5IDYA 1KOLA 1LC3A 4RF3A 2E48A 2IDZA 3UW3A 4BGVA 1CRWG 1E5QA 1N9GA 1XGKA 4ZQHA 1TB4A 1PZHA 2DPHA 1MC5A 5T8KC 3R3SA 3BMQA 3INGA 2EJWA 3PJEA 1VSUA 4FB5A 1ENOA 2Q46A 1ONPA 1ZJYA 3L77A 1C1DA 4FDAA 1UJMA 3IUSA 1JDJA 1DC4A 2DKNA 4AFNA 5A9SB 2Q49A 4ALJA 3FI9A 3HN2A 3MJVA 1P1FA 1I2ZA 1F8FA 2Q99A 4BNGA 3ZWCA 3AM4A 2FR1A 3EVTA 4BV8A 4M49A 5B4TA 4U0KA 1Y8RA 4ND5A 4UVDA 2JAHA 2AQHA 1HETA 4PLGA 5JAZA 3QV1A 4IJVA 1IOLA 3ZCXA 1DHRA 1F17A 3C7DB 5I9LA 2NTVA 3VPHA 1K0UA 1P0FA 3ZH2A 1MG0A 1E7QA 2Q2WA 4XZ3A 4CUKA 5CDTA 1M66A 3NT2A 1IL0A 2O3QA 5TS3A 4MKRA 5EQFA 3UICA 4CL8A 1VC2A 2VWQA 4B4UA 2OP1A 4N54A 3GEDA 3L9XA 5BSHA 1HDXA 2WMDA 4ONEA 1CWUA 3SC4A 1R6DA 4IJKA 2YZ7A 4BNUA 4M87A 3RUCA 1OAAA 2B83A 4MJLA 1DHTA 4BIIA 4D42A 4PIVA 3SJ7A 4IDGA 4Y67A 3JYPA 1NPYA 5IZCC 4E12A 4EJMA 3UOGA 2QW8A 3KSDO 4K26A 5TGDA 4H3VA 2JFGA 4P4LA 2B37A 5JC1A 5A5FA 3FNFA 4WEOA 4A73A 3A06A 3O26A 2Q1SA 4WOKA 4LVCA 5A02A 3LYLA 4R01A 3EZYA 4B7UA 5JFOA 2HUNA 4OKIA 1ISHA 3PLRA 4BMSA 1U4OA 4H7PA 4YEDA 4PLWA 5A9TA 3U4HA 4BUCA 2X22A 1RM3A 4A26A 5KOIA 5ADHA 4RF5A 5KNLA 4WKGA 1G0OA 3QWBA 4JQCA 2I6TA 2VTEA 1KEWA 4XQGA 3O38A 3ZU4A 2RHRA 1NP3A 1RJWA 1E77A 1A71A 3LZ6A 2Y0EA 2WD8A 3JD4A 3ZW9A 5JXWA 2IZ1A 4CMJA 4ZQFA 2CVZA 1E3WB 4K6FA 1NNUA 3WQRA 1ONNA 3S1LA 1GZ3A 3I4CA 2DPGA 4RPHA 2C82A 3EK2A 2H9IA 3U09A 4U6QA 5ILOA 4UUOA 1YL5A 2CNBA 4PN3A 1AN9A 3EZLA 4NDNE 3HB5X 3JQ9C 4Y6PA 4B4VA 3W1VA 1F8GA 4NH4A 3WICA 2P4QA 1EVIA 3PI7A 2G17A 2HMTA 4ALNA 2AHRA 4MVJH 2Y1EA 1F14A 4CR6A 4W6ZA 2X0IA 4YQYA 1DFHA 1FJHA 1HE4A 4AJ4A 1VL0A 1UR5A 2VZ8A 4J3FA 3NAQA 5EN4A 4EJ6A 1PU2A 4RQUA 2UAGA 1E7MA 1LRJA 1ZFNA 1EE9A 4EGFA 2VRCA 1XDWA 1Q0QA 3JYOA 4M86A 4MKZA 1WZIA 2JL1A 1T1RA 4YRAA 4GPD1 2AMFA 4R69A 3BMOA 3MWDB 4JLWA 4G65A 4UVIA 2ZYAA 3ZDFA 3QW2A 2PK3A 3ZNNA 2X58A 5KJ6A 3H2ZA 4QXMA 3H8VA 3CXRA 4IDCA 1XQ6A 1PZEA 3C7AA 5AXDA 4J91A 3DONA 1GQQA 1MLDA 5IDQA 4GAEA 4GX0A 1HKUA 1D7OA 3G1UA 5HTOA 1M2WA 5AVOA 3DFZA 3L6DA 4GX2A 4CMGA 1GAEO 1M75A 1NWHA 3HHPA 2GN8A 1DIRA 2FPIA 2O23A 3EY4A 1HL3A 3GR6A 3MEQA 3RKUA 3VDRA 3DFUA 3NEPX 4E2WA 1XG5A 4PZEA 5JDIC 4R41A 1ENYA 3JCZA 4HUJA 3B20A 2P9EA 4O5OA 1U2DA 4NJMB 2D5CA 3M2PA 1I3KA 2CDCA 3O8QB 4TVBA 3RAJA 3KTDA 2E49A 4WASA 3QHAA 4R51A 1S6YA 1WMAA 3BHMA 4BQRA 2X0RA 1HZJA 4CM4A 3GRPA 3E9MA 9LDTA 4WPGA 3DBHA 3IKVA 3ZV3A 3ZHBA 3SJUA 4AJ2A 4CR8A 1R4MB 2X5OA 5CP8A 3AY6A 3LC1O 1U1IA 1O6ZA 2DAPA 4J7XA 3TL2A 4AG3A 5JE8A 5BQFA 1DB3A 4E31A 3QY9A 3AW9A 4IZHA 1UDAA 4QUKA 1ISIA 3ETGA 2GO1A 2QX7A 4H15A 4KQXA 1Y81A 3O03A 4IJWA 3DZHA 4JIGA 1L7DA 1AXEA 5JMPA 1ISJA 3OEYA 2V6FA 3GHYA 1V3VA 4E2XA 3EYWA 3OMLA 3M6IA 4FSHA 3RWBA 4WK6A 1QSGA 1XIVA 4U6SA 1O9BA 3D3WA 4A03A 3CE6A 1YDEA 2H63A 4OSOA 2CFCA 4IQ8A 1MUUA 4YACA 1OZAA 1ZCJA 1QMGA 3P19A 3PGJA 1P1RA 1DLJA 1L7EA 1YL6A 3QWHA 2XXJA 5C7IO 4CLHA 4CMAA 4CM6A 4NK4A 3QVWA 2HRZA 3LC7O 1HLPA 1WWKA 2AA3A 1NXQA 1YE3A 4RVFA 3R6DA 1A7KA 2HJSA 3RD5A 1E3EA 1U5AA 2C54A 2WYWA 3UVEA 5ITWA 1DC3A 2WE7A 4RDIA 3E03A 4D3DA 3TWOA 1PGNA 1TVEA 3DHEA 2VUUA 2FP4A 3V2GA 3LT2A 4GWGA 3IAHA 3LLVA 3LLSA 4TSKA 3OFSA 4EUEA 3PQEA 2I99A 1YQGA 3WSWA 3OBBA 5B4UA 4L8VA 1AXGA 2FN7A 2JJYA 3WG9A 1PTJA 2H6EA 4PLHA 4I1IA 3T4EA 2ZJ0A 1HDCA 5AOVA 3K73O 5EIOA 4KDEA 4GGOA 1JQBA 1NYTA 3G17A 4KUHA 3SXPA 3I52A 3PTZA 1EDOA 1UDBA 1R4NA 2GDZA 5CAEA 2R00A 4TRMA 1U3UA 5FFFA 4FJ1A 2WEKA 4LK3A 3IOYA 5TNXA 1U28A 1JLLA 1X0XA 2I67A 2PKQO 3FF4A 3MZ0A 3V2HA 3K5PA 2YY7A 2J3JA 3QVSA 4ND2A 5A06A 4JCOA 1NQOA 4CV2A 1QYDA 4FFRA 1DIAA 4P4NA 1A4IA 4XJTA 4DMLA 2X0JA 2O4UX 3DZBA 5KKAA 1DDOA 3U62A 3E5RA 3CZMA 2NVUB 4OIMA 1LQUA 4MVJI 4CMEA 1EDZA 4RORA 5TQVA 3WMWA 3UCFA 2Y0DA 3ZWVA 3JD3A 4RPLA 3VZQA 3ZU5A 5IN5A 3EGOA 4LN1A 3JQ6A 4IJUA 1XEAA 4FC7A 1LLUA 2HRBA 3D4PA 4RVSA 4XQ9A 1LLQA 4MP3A 2Y1FA 4CQMA 3GAFA 4L9RA 3WQSB 1PS9A 1ZVMA 3IP3A 4I8XA 2HMUA 3WGGA 3PZRA 1HDZA 3W8DA 4CM3A 3RVDA 4FJ0A 3B1JA 5COAA 3R3JA 4MDHA 3WGHA 3F47A 4KUGA 4OH1A 2X0NA 1BXKA 4W9NC 3T7EA 5CDUA 3JYNA 2J8ZA 4J1QA 4LRTB 3ZV6A 1XELA 2ZTLA 1ZSYA 2GZ3A 3OQBA 2WM3A 4DC0A 1N1GA 4HY3A 4ILKA 3KOUA 2FSVA 2W98A 4L74A 3KEOA 3G3EA 2OBNA 2YV3A 4AJPA 4IGEA 4ZGWA 4PFJA 1XSEA 1NQTA 1VJTA 3WBFA 3GVHA 5TSDA 4NFHA 1GPDG 1N7HA 3K6JA 1JTVA 2VOJA 4JBGA 3W8FA 3DWFA 1Z73A 3BHJA 4NPCA 1V3TA 3GC6A 2BKAA 5U9CA 3WBBA 3FNEA 3A28A 4WLEA 4ALKA 5F5LA 1B26A 2NQ8A 2ZQYA 4KQWA 2JFFA 2EGHA 2VRCD 2CSUA 4BS9A 2VT2A 1I0ZA 3RJ5A 5COQA 4E13A 5TIIA 4CODB 1DXYA 1H6BA 5CDYA 1FDVA 3KZVA 2IEDA 3GY0A 4R9SA 1Q7GA 1VM6A 4MVJF 1ENZA 1DIHA 2PFGA 1GU7A 1E7YA 4PZCA 1NHWA 2VHVA 3OH8A 4ZQGA 1QLHA 1PQPA 5BNIA 2PZKA 5I9MA 3OA2A 3UN1A 3MTGA 4XQCA 4A7PA 3ZNPA 3L4BA 4KTTE 2A94A 3KUXA 2QIOA 3DBRB 2JHFA 1JKFA 3D4OA 4R1TA 2FR8A 4JROA 1E1LA 5I7FA 3EUWA 3KM0A 1DC5A 2DT5A 5EJ2A 3RC2A 2AW5A 4YPOA 1ISGA 2Q2VA 4YAEA 4BKQA 3ASVA 3RC7A 2YUTA 4BOYA 2H5LA 5C7LO 2BI7A 1XYGA 1E3IA 1YB5A 3H9JA 4IDAA 3H5AA 1LU9A 4E5KA 1WLYA 2PH3A 4ITUA 4LGVA 1N7GA 5LC1A 3V8BA 1KVTA 3LQFA 4FFLA 3WXBA 3MTJA 5L4NA 5DOZA 4HXYA 1YONA 2IXAA 3Q2KA 3UAGA 2EW8A 5KTKA 3H5NA 1ADGA 2PH5A 3E9QA 5TRTA 3JQAA 3PQFA 4L4XA 2Q50A 5IXSA 7ADHA 4RV9A 1UAYA 3C85A 4R9RA 4BNWA 4OMUA 4NHEA 4LCJA 3WLEA 2X7HA 1ZXLA 3X2FA 3BAZA 3HJAA 1Z74A 3DMYA 3HDJA 5L3ZA 3ADPA 4EI2A 1TEHA 3NT4A 1ZXBA 5JY1A 2YV1A 5L45A 4CR7A 1N92A 2PD6A 3KYCB 3RUFA 3AK4A 2CZCA 3G49A 1VL8A 2LDXA 4EZBA 4U7WA 3N7UA 2O3JA 3GZNB 4EUFA 1HXHA 5F1PA 4RPKA 1Y8QA 5COBA 4HFJA 3KYDB 3JQAD 3OIDA 1LQTA 4PVDA 5ICMA 2VCYA 3H65A 5DCYA 3KETA 3E5MA 4NZ9A 3DTTA 3GVXA 2VHZA 1QV6A 5G0WA 3PP8A 4D3SA 2DBRA 3I6QA 3ZWYA 2HQ1A 1MFPA 1JAYA 4YT2A 1PJ4A 3NT5A 4YJDA 1ZK0A 3FWZA 3S8MA 2DTEA 4M54A 5TF4A 3WS7A 2FRDA 2OOSA 1Z7EA 1JWBB 1Z45A 1DAOA 3PHGA 4HP8A 4E6PA 3OA0A 1KC1A 4CLXA 3DAGA 2EEZA 3IMFA 4WJZA 4PG8A 5IDXA 3AWDA 5TLSA 2JD1A 1SB9A 5EQDA 2Q4EA 4Q39A 3A1NA 1R0SA 1E7WA 2I66A 4ALLA 1Y8RB 3ICCA 3WQQA 5K6AC 2Q4BA 1NFFA 3ZHXA 1KERA 1U3TA 1X13A 3TNLA 3EHEA 4DLLA 3IJRA 3ADOA 1GPJA 5CPBA 5L7YA 2B5WA 3HQ4O 3ZZNA 4OYRA 3VVCA 4M8SA 3CEAA 3ROQA 1QYXA 4B3JA 4FGSA 4WLUA 2EKLA 4E30A 4R1UA 3RUIA 4BO3A 1PX0A 4BGIA 5B1YA 2PKRA 1SAYA 2GF2A 2HK8A 3TQHA 4JX8A 1MV8A 3IJPA 4KWIA 1HF3A 3JQ7A 3EMKA 3TZQA 3AFNA 2VZ9A 4YXFA 5BSFA 3PGXA 1K89A 1YO6A 4PGFA 4HFNA 4Z3DA 3WGOA 1P0CA 2CVQA 4IDDA 1MXHA 4GGPA 5L95A 1ZUD1 2UV8A 1Q0LA 1G6KA 1P1HA 3ANLA 4D0RA 5JNLA 2IZZA 4JBHA 3K8ZA 3P2OA 2HAEA 2OBYA 4FIZA 1T2FA 4TROA 3EVNA 4CMHA 4E33A 2PLAA 4XWYA 5JAQA 1O8CA 3MJCA 1HYEA 2AE2A 1Q0HA 3P7MA 4BNMA 1LDYA 3QLJA 4UUPA 3NDIA 3KSUA 5DT9A 2P9GA 4MVJP 5K0ZA 2Y66A 4J6FA 2DBZA 3AJRA 3TZHA 4O59O 5ILGA 5BSEA 3U0BA 3NDJA 1R4NB 2PA3A 1H6DA 4D79A 3WYEA 5GZ3A 5EINA 3VDQA 2PY6A 4FD3A 1ULSA 4L0QA 1D3AA 3Q3CA 1PJSA 3JD0A 2AG5A 2V6BA 3F5SA 4AJNA 1JAXA 3AUAA 1H0KA 2EGGA 2D8AA 4XR4A 4R1NA 4J1SA 2V65A 1X14A 1BXGA 1P1JA 1ZH8A 2NTNA 3DZFA 4NU6A 3UHAA 3FR8A 1ADCA 4EJ0A 1G1AA 3DZJA 4KDFA 1F06A 3EW7A 1C3VA 2ZB7A 3QIVA
chains in the Genus database with same CATH superfamily
1DELA 1QFYA 3OOYA 1DCFA 2I3ZA 3RRNA 4KC0A 1AA9A 1AKNA 2NUAA 3S7TA 3BXFA 2PR2A 5CNJA 2JCSA 4YRKA 1B23P 3U40A 3K2EA 2RK6A 2Z43A 3UHPA 2VAMA 2QAGB 4RV5A 2VDWA 4DCUA 1L7MA 4BCCA 1E3DA 3P97A 3HXOA 1NR5A 2QA5A 2PKCA 3LO8A 2LDBA 3HCCA 3K0FA 4JUFA 5ALGA 3W0LB 4J1NA 3FN4A 1AZWA 3CUEF 3CUTA 5JALA 2OORC 4TTAA 3TCNA 5JXGA 3DMGA 1X1TA 4RH1A 1TYBE 4N5NA 3A4TA 3UAOA 1LCIA 1CQIA 1KI1A 3QUAA 4EHJA 4C43A 1H2AS 3K1YA 3S8YA 4EY5A 3VXKA 3HDYA 2AWNA 1ONBA 5H68A 1TM2A 3GLRA 2J3IA 4L5BA 3KR9A 1GY8A 4WZ6A 4EDFA 2Q3LA 2HA0A 3B9BA 4TQAA 4U4AA 2FZWA 3FZYA 3M5CA 1L4HA 1OIWA 5LQNA 4NZNA 5LZ2A 1UAGA 4ZCRA 4UZSA 1HYHA 2UUOA 1THMA 3KHSA 3OZAA 3OQJA 4QGBA 5IJZA 1VKOA 2GZSA 1SIBE 1ORTA 4JBWA 2G6BA 5AHKA 3SHOA 4DA9A 5ADUS 1HH4A 1RNLA 2M9MA 2YY5A 3HXTA 3WK5A 3KPJA 4CMIB 2HH9A 1I2MA 2V58A 2X1LA 1XLTA 5AKXA 3ZZTA 3PWTA 2QTGA 3TLAA 2IP2A 1CUBA 4HYEA 5H59A 2IY8A 1BYIA 2WSMA 1MZVA 2W2LD 3UJAA 1W5FA 1W4RA 5ARCA 4ZCMA 1DJNA 3EOBI 1U5CA 4QVIA 4CV0A 1SUWA 4MRSA 1JVBA 4TUYB 1RIFA 2WF6A 1B0UA 1UBMS 3UM9A 4MW5A 2IHTA 4WCFA 3QWAA 1JG4A 5G4KB 1UXIA 2Y27A 3L0YA 1LPSA 1UEXC 1V7QA 2DPLA 1F1JA 3NWOA 3OC6A 4LI0A 2X1VA 1F6WA 4DFDA 4DTCA 2ILVA 1G0NA 3RWMB 5BVHA 3KAJA 5JYDA 2WINI 5EL0A 5FTLA 4CEHA 5DISB 3Q6MA 1F38A 2Q9UA 3DOUA 1N2GA 1PR4A 1SPBS 1STOA 1V2GA 2R751 1PZMA 4R1MA 4RH0A 1FJ2A 2YOHA 3OCCA 3UXYA 4BO4A 2FPRA 4JXXA 3PEUA 1H8HD 2A9QA 2FSUA 4X54A 4EPYA 2W37A 1O9HA 3I04M 4YA6A 1NT2A 5CGZA 1XOIA 1I24A 1MEEA 3GXBA 3G5MA 3PWSA 4LAFA 4OXRA 2LKCA 5JCXA 1K9VF 3LL4A 2IBTA 4OM8A 4O4JB 4O63O 3VKFA 3N74A 1ZRSA 3AONB 2DETA 3E53A 3DEYX 2B2CA 1KF0A 1HTWA 1E0SA 2ZREA 3D1LA 3QHQA 3U4IA 5DGDA 2WKPA 4JJ6A 4URFA 4YJ2B 4CVNA 1U99A 2FMTA 2AI1A 1Q92A 2BFCB 1UM8A 3AI3A 3PDIA 4MW7A 1QUFA 4F71A 1Z36A 2XVAA 2YJNA 3LUDA 4CG3A 2ZG6A 3NHBA 4G4GA 3LUPA 4PSAA 2CC2A 2SKEA 2AJLI 3C7TA 4MMYB 4R1QA 3WMEA 4RZ3A 5JR3A 5IWAB 4JYMA 1Q1GA 3B2EA 1HNXB 3DL2A 3H1TA 3NOVA 4Y2JA 1JXMA 5FOWA 2CMHA 4XM2A 3CUVA 5DBFA 1FSZA 2ZE8A 2VXOA 3BE4A 1EGQA 3UV3A 1POXA 1FQOA 4QXAA 2XWBF 3RS3A 3UUWA 2OGWA 1JU4A 3DNFA 4G9BA 2P9FA 2OV6A 4YPFA 1WHSA 1QTRA 3A4IA 3QE2A 3TMYA 2NVBA 2QLFA 3WNBA 2HJGA 2VJMA 4MAAA 3A6EA 3BMNB 5T41A 3CB4A 3TRKA 3D5TA 3D7LA 4G5FA 2XYVA 4OHWA 1T4DA 4PIPA 4RHCA 3W4KA 2FUNB 1QYCA 3SVTA 4PQEA 2HDWA 2QL5A 2WVGA 2ATXA 1AY0A 1EE1A 1WXIA 1MR3F 4Q24A 2ERCA 3DGFC 3UUGA 3QXHA 1D6JA 2XUPA 3Q9LA 1KDVA 1W1WA 3GEMA 3AIOA 4B4WA 1DV2A 3HLTA 4XB1A 2VSNA 1YKFA 3EDMA 2L42A 5AIBA 3UV6A 1Q21A 3HR4A 4G37A 2FQYA 4LHYA 4M1MA 4R40A 5K8JB 5DASA 1GZ6A 3N1UA 4PSKA 4AYTA 1XTUA 2XT9A 3UWOA 1F3OA 1EXNA 1M6YA 1W5TA 4HNGA 4URYR 2FFHA 4QSHA 5JJIA 1UC8A 3F5DA 4Q5IA 4I9HA 4C5AA 4MO2A 4DCPA 2MWMA 3UAXA 4YUZA 4FR5A 5D86A 5AKYA 4QM7A 2B8JA 4RWEA 3KQPA 3S28A 3N2GB 4LQ4A 1Q1AA 3L6EA 5EJ8A 5E6UA 4TSFD 2GKOA 2PSSA 3IUPA 3N6VA 3TTUA 4TXNA 4LHSA 3A58B 4FPXA 2HLDD 3SSAA 1H3EA 4BP9A 2WMOB 1K88A 5HZKA 1KTVA 4R5HA 1SU7A 2ZIXB 4X7MA 5HOQA 5L51A 3CQ9A 2J3KA 4PLYA 1IY1A 1DI0A 1T1SA 3AEXA 3CEJA 3ZS8A 5CXXA 5LP6A 3ZD6A 5EMHA 3NWPA 2V0CA 3BXOA 3IOMA 2BCEA 2ARKA 1USVA 2VZEA 3GZTB 3ZH9B 4FE4A 5LZ9A 1SHTX 2XGSA 2GVDC 1K6IA 3QKUA 1XTQA 3F2IA 4B09A 4IOMA 2XNSA 1RXYA 3GN1A 4KI7A 5CVCA 2W0SA 5AJTA 5KWVA 3DBHB 5ALTA 2D2IA 3ELBA 3DTVB 1Z2DA 5FOUA 3ZJUA 2Y1KA 3ZWPA 5KSOA 2HCBA 2X14A 2Y2UA 1J2EA 2BWJA 5KQSA 2NSHA 2X2OA 4YMSA 2GWHA 1Y34E 1GVNB 3KYBA 3ECSA 4LY3A 5H83A 3NBZC 3DKKA 3JARA 4GPBA 4TYMA 3T7SA 2FSSA 4D9BA 1QB7A 3U1VA 4H7HA 2QTVA 5KYKA 1FRFS 2WUFA 1MVOA 3O4VA 4XD2A 3VBEA 2IYTA 1KQ3A 1W85A 2CJFA 1XRJA 2B4AA 2Z57A 4RE5A 1RXEA 4IRXA 4W1PA 2NSDA 4CM4A 2IH2A 1J0EA 3AF1A 3UT0A 4DRXA 5EE1A 5BYJA 2WP8J 4PHGA 3VYRB 3A14A 1H9BA 1EX7A 1DFGA 1QFJA 2P4UA 4DCSA 4X64B 3PVCA 4A6DA 4DBVO 3CVOA 3EZ6A 4FYXA 1JHQA 1KI9A 5BYAA 2PR7A 2A9OA 3LBFA 1FTGA 4NAVA 4GKBA 1WJGA 4C4YA 1CE8A 4ID9A 3LBAA 3U4CA 5CIYA 2BGWA 4RA6A 4I50F 4MI6A 1Y6JA 3OFNA 4MI9A 4B35A 4CMCA 2XDAA 1A2BA 2HBRA 4BYMA 1OAKA 3DE4X 3OICA 1DLIA 1XJ5A 2HI0A 4OI2A 4MB6A 1VL6A 3C3YA 4HPXB 3PD7A 2BEJA 5JXJA 4LC0A 1Y9EA 4NBWA 3DQPA 1OXKB 2X8LA 3DHVA 1GXSB 3QHPA 5BV8A 5AXBA 4NYJQ 1E60A 4OHYA 4M0UA 5FPQA 4KQKA 1OPRA 3VA7A 1V48A 2WAAA 5CW1A 1M3SA 3AM5A 2GWRA 3AXTA 4KQEA 4ON9A 2WB2A 1AQIA 4WXRA 4H7JA 3PXGA 5C53B 3DD1A 3IIEA 3QPUA 2PPLA 4PYLA 5D3MA 4D4LA 4E3WA 4F2PA 4FGJA 5JCZA 4QUDA 3NTRA 5LIRA 2VIIA 2JGFA 2PEYA 1GYPA 2VQDA 3T3GA 2P9TA 3GOQA 4L4UA 2TSYB 2EAUA 4N8EA 4Q4AA 1EUDA 2GCGA 3K05A 1EVZA 1XPUA 3KXDA 1Z35A 3ILXA 2CKMA 1SOAA 1Q95A 3GLHA 1M0SA 1YCFA 4IP0A 2D13A 4NNJA 2QTHA 4CF7A 1RJ9B 2QMOA 2BSQA 4NBTA 4ZQEA 2PM8A 3I1JA 4UAJA 3LF2A 2PGLA 2GCIA 4MK4A 1KK3A 2VPZA 3GXOA 1C0LA 4G1FA 1SQSA 2EWMA 4JUAA 5JBIA 5FCDA 3G8AA 2DLNA 5F35A 3OCYA 4HRVA 4JGIA 1YRWA 4G0OA 4Q7EA 4D6YA 3OEWA 4EAAA 2OM6A 1X42A 1L4FA 3IMCA 4RESA 4BLOA 2WIGA 5EHQA 3QQ5A 3IBSA 2FG6C 3UO8B 1BS2A 3QSYA 1QF7A 2F48A 5CTJA 2WABA 2HJVA 3CXUA 2MR6A 4PGMA 4TWAA 1TI7A 2C5EA 4ERNA 1T5OA 4ZEVA 1L5HA 4CXMA 2N42A 4YRJA 2C8KA 1BX0A 3ON5A 4FFBB 3RODA 3L8CA 4NZZA 4BQNA 3PYXA 3TIVA 1XTKA 5ED0A 3D54D 2FEXA 4OHMA 3CW9A 5KVVA 1QGUA 1H3NA 4ZKDA 2GA9A 1V7ZA 2VAXA 2AMJA 2GHTA 5FA8A 2HYDA 5IRCD 5ICEA 4YHBA 5IM5A 3DOFA 3ZY3A 4BGEA 2AZTA 4EY6A 4B71A 1PFUA 5E2AA 2IV3A 1RZUA 3UT5B 1HNWB 1N5KA 5FWNA 4PX9A 5KTYA 1K2WA 3E18A 3H9QA 4WMLA 2PU5A 5EE3A 2FOIA 3AI7A 2RHBA 2CKDA 2OFXA 2H57A 4BFUA 3AR9A 2YVQA 2P9ZA 2A88A 3T7CA 3OEED 2YL2A 3V00A 2VHYA 3PNKA 2GAIA 1ZSVA 5GAJA 2Y1GA 4L3VA 2PVSA 4EHFA 1QTNA 3I76A 1HYBA 2MMCA 4C01A 1VMAA 3BSYA 3OJ0A 3SF0A 1GUZA 2X3FA 4L8YA 3EUEA 1AO0A 2P78A 1XMXA 4DZRA 3NM5A 4DB4A 2J9GA 4EFNA 5DHPA 4E15A 5KX5B 4KO1S 1TU0A 2ZUSA 1XL1A 3BAFA 3IUBA 4D99A 1B6RA 1J9ZA 3DBRA 4DREA 1BS9A 1K4YA 3VC7A 2H2FA 4I7EA 3DZIA 2WAMA 4B3RB 1F2UA 1I3CA 1ZN7A 1CIVA 1ZHHA 2GN1A 3N05A 1U8ZA 2WVHA 4NS4A 1YFJA 4E2YA 5BSEA 3K2BA 4BNIA 2HSWA 3LGSA 4OQPA 3RJ9A 1QIGA 2CNLA 1Q91A 5DXFA 1W4LA 3ZKWA 2B3DA 3DKRA 5AM3A 5CDSA 2H07A 4MDYA 5HCIA 3T52A 5D8DA 3PFBA 2GXAA 2VYVD 3MBKA 2G63A 1S01A 2WAYA 2CHQA 4JQOA 4NULA 3MINA 2HA6A 2XXBA 1QFSA 2POCA 3E2PA 3EIHA 1KYYA 1DTSA 2PX2A 5C5CA 1Y6QA 3HJCA 4JBLA 1KJNA 3Q1KA 3VU3A 3HJGA 1KWGA 5M29A 3PQDA 2PUCA 3OI7A 3ETHA 1Y37A 1P7ZA 4Y1RB 2VQ3A 2PU7A 3BXXA 3IXMA 1XAGA 3KQMA 1YCHA 1Q0PA 2JLRA 4GEGA 5DGXA 3A1VA 1TC2A 1T3TA 1BVUA 2ORED 1I4OA 1AD2A 4MVJE 5BP7A 4HLCA 4X7PA 4UTZA 2G76A 5E7IA 4DRYA 4DWOA 2D59A 4BL5A 3SFTA 1HRDA 4L7VA 4OJKA 1JWLA 1P3JA 3EVDA 3NBYC 3VPGA 3VR1A 2OZKA 2XSZA 4GOMD 4ZZ1A 1R0XA 4KHPB 2QGFA 4XEUA 4X94A 3S44A 1YGYA 5JAOA 2QTLA 1T2AA 4AWXA 3L7CA 1Z6QA 3DE0X 3HB4X 4FQ7A 4NCKA 3STHA 3HCOA 1AKUA 3CLVA 1NHGA 1PQWA 3AIKA 5KYXB 2R7KA 3S5JA 1SOVA 1VSBA 3T9AA 1SUBA 1P4RA 1S2NA 1EA5A 3FPLA 4II3A 4NOKA 1V1MB 1O1YA 4OAPA 3QEOA 4G1EB 5CB4F 2BJVA 4C7JA 1QHSA 1LJUA 3F97A 2A0UA 1GA4A 5K8LA 1ML3A 2QR5A 3W8EA 2OL4A 5JCPA 1LGYA 1OT3A 3DXYA 4RLHA 1CVIA 4W5WA 4BNLA 2QX6A 1JH8A 3HGQA 1OR8A 2ANBA 1HT3A 2GN9A 3BK2A 3Q6IA 1ZD5A 4QHSA 5B1EA 3BQ9A 2BDUA 3C3WA 3CO0S 4RKRA 4XPIB 1XA0A 2PQ6A 1JFRA 2CXPA 3LY7A 5G53C 4B8WA 1OJLA 3AR7A 1Z4LA 2BTQB 3EDCA 3ORSA 4HTAA 2XYRA 4QFMA 1ZHOA 2RARA 1CU1A 5LB2A 2E37A 2V7WA 1RYBA 1OFTA 2AD1A 1S02A 2OILA 1IDOA 1T2CA 1Z5ZA 2W2KA 3G2NA 1K8XB 3L4KA 5G4KA 1TD1A 1QPZA 2BM1A 1XDUA 4ZEXA 1L7OA 2GETA 2JJ1A 3VHXB 3FH0A 3VR6A 4NONA 5SY4A 1N0UA 2OV4A 3S40A 2HF7A 1QHNA 4WLNA 5K09A 1XVVA 1NG9A 3THYA 1VLJA 3LLUA 3SXJA 2FR8C 1R4MA 2ZVQX 3FDFA 3QZUA 5EKDA 1ULHA 3GFBA 1W4ZA 5CB4A 2GHIA 4C87A 3WYGA 3ZHSA 2X0KA 1QG2A 3L4BC 4MKGA 3GT7A 3LOPA 4FYIA 1NIJA 3CEHA 4M7OA 4B3BA 3KQKA 2PZGA 4KR9A 3H7AA 4ER0A 1AS2A 2UZ4A 4OXQA 3T0IA 4DDWA 3ESCA 5EGSA 1DTWB 1PFGA 3EOZA 8ADHA 1E9AA 3R8FA 3I9NA 3RROA 3I61A 3BICA 3DDUA 1A77A 1SM4A 1IPHA 1UP4A 2FF5A 3LXMA 4G5HA 3TLEA 5K45A 1T24A 4QGGA 1PYOA 1ZMRA 3AUXA 3IO5A 3HBNA 3JYQA 3WIUA 1YV9A 4AP5A 4J8PA 4LOJA 1E9BA 4RZIA 5EHNA 4C3ZA 4EEZA 1T0UA 1II8A 1G9SA 3SMQA 3FFTA 1SQGA 1WEKA 4IIYA 1UIRA 1ORWA 1J1IA 2QOEA 2K7ZA 2WF7A 2ZAYA 4MA5A 3AKYA 2R6JA 2X6RA 3FYCA 1EWTA 4NV0A 5CW2A 4TN5A 3RUPA 1L5SA 2O3SA 3H5OA 1P45A 4R8MA 3WKDA 1BHSA 3PX2A 3HKBA 3ANYB 4LYJA 4IIVA 2JFVA 4R5MA 5FBHA 4ESEA 1TZMA 4TL8A 2QXYA 1L6RA 1E3QA 1GGVA 3AVOA 1UZMA 4R0VA 4DR1B 3Q7RA 2R65A 2Z95A 3V1UA 4JI8B 4WFQA 1PS8A 4G2TA 1IJFA 2IZ6A 3ZX5A 1QP8A 4ROTA 4RVGA 4E0BA 1WETA 1XP8A 2YHBA 3DHYA 4A0SA 1JDNA 2JFYA 2FPSA 1Q50A 1VMDA 3GGGA 1AHNA 4G85A 3TZKA 1YVPA 4L4YA 2LP4Y 3LA8A 1OH5A 5KDDA 4HWSA 3I5XA 4RPGA 2C83A 1ATZA 3RYTC 1CF4A 5ENDA 5B1DA 2FRDC 2VYND 2B61A 2FPPA 5B6PA 3KXKA 3GNQA 3ADBA 3L1IA 3ESXA 3OJOA 1N6RA 3AR2A 3Q2OA 4DRXB 2VYVA 2W11A 3AY3A 3LAWA 2Z9BA 4HYTA 4N82A 5TS2A 3SHQA 3TLGA 4L7QA 3FY4A 3NHSA 3OZFA 1XNGA 1MO6A 4PLVA 4I36A 2J3DA 5EXPA 1XAJA 1XEXB 3C3EA 4OFXA 2P40A 3WTBA 1JDPA 1QQ7A 3C6ZA 1P4AA 3EXHC 4RZHA 1TTHA 2YJ5A 2PXAA 3AY0A 4F96A 4CV3A 2P1RA 3QPCA 2GQ0A 2IPMA 5F3WB 2J5KA 3W3AA 1M6NA 1FS4A 3ES9A 3W7AA 1A76A 3UPUA 1GILA 4Q12A 3X1DA 5IH3A 5EE0A 4OHRA 2H4YA 2VNAA 1GRVA 4LFCB 1R0KA 3DMFA 4UTPA 4GUDA 2ZPTX 1TYCA 1WSWA 3WV5A 2P6OA 4CKEB 2JHCA 2NZ8A 3RBZA 1K08A 3ZCSA 1PCXA 4O8CA 1ZO8A 4Z9FA 1VI6A 4NCJA 4DJEC 2OHIA 1YMVA 4TXLA 1CD5A 1LJLA 2VTVA 3E2MA 2OXTA 1R0ZA 2BELA 2C4HA 4V3BA 4QOHA 3TCXB 3HKDB 1Z08A 3WL4A 2R1ZA 3JVUA 1C8KA 4LPSA 5E38A 3RUEA 1IBMB 3PD0A 2QQ5A 4HWPA 1N9KA 1DBVO 1B0AA 5A3RA 1WA5A 4FWBA 3TG8A 1ZBQA 4RMGA 4RZSA 2A9VA 1OF1A 1V5FA 3HJBA 5FOTA 1T5TA 4JASB 2JK0A 5HGJA 2BR3A 4EFMA 4YAFA 4JENA 5F5NA 3TQOA 2XCRB 3MPOA 4O8ZA 3TTTA 1J0XO 4IJ5A 4HB4A 5LM3A 1YXMA 1FU4A 2E7ZA 3CCBA 2JFHA 3ZLJA 3GDGA 4XVHA 4L6AA 2XZPA 1T6NA 3NUGA 1MB3A 3K9BA 3T3OA 1O54A 2C04A 2Y4NA 2E2WA 4HQ0A 3BL5A 5FL7D 5E1OA 4AURA 4B6JA 1I0LA 1PSWA 1YI0A 2OC4A 4YTEA 3GQVA 2Q2OA 1UBEA 2V74B 1XZKA 4HBGA 1PJRA 4L8WB 1GP2A 2F62A 1JF8A 4S24A 1QR6A 4TVSA 2VL7A 3RUAA 5KTRA 4NL4H 3K30A 4LVNA 4HWKA 1QIIA 3ACCA 2FRVA 4OQQA 3QMMA 4FGUA 3U37A 5DYGA 4X44A 3TJRA 5F9HA 5HF6A 2YASA 3PUVA 5HQ3B 1WNTA 2C98A 2D7JA 5KAMA 4B6GA 5JNVA 2B1GA 4KXMA 2CNKA 5JCOC 2XKBA 3GGJA 4INPA 5I8PA 2QXUA 4LXIA 4HGZA 2WU8A 3RK1A 2FW8A 2ZSHA 1HOXA 2PLFA 3M70A 3CNNA 3UGJA 2PBRA 3ME5A 5TGTA 5GIPE 3AC0A 4IJMA 4QPDA 3CF4A 4XLZA 1MT3A 2VPTA 5CK4A 4GKJB 2ZFUA 2O3TA 2ZRQA 2OCGA 3NIWA 3QU4A 1EBFA 2GPJA 3JQAB 3E7WA 2Q41A 4LDNA 4WOJA 3THRA 1LY1A 5EZQA 3PD1A 3H8JA 3TMKA 1AUVA 4ZHQB 4NE7A 3GVPA 5BR8B 2EW1A 1ADFA 3W6ZA 5MF6A 4ZI7B 4FEGA 3R9KA 2ZCVA 2IYYA 3FROA 4B6OA 1HDGO 4F6CA 2QZJA 4Q00A 2NU9B 3WLAA 4F4CA 4NBNA 3N53A 4XUDA 4EY7A 1H1LA 4HNTA 3CLKA 4LV6A 4R8KA 1BOOA 4Q02A 1SK8A 1V2HE 2HMAA 4DJDC 5BUSA 2BGTA 1ZBDA 3MSCA 1W1UA 5I51A 2NLOA 1UPTA 2PD3A 4XFJA 2J9RA 2GERA 4YDHB 1HE3A 1L5ZA 1S4MA 3AJDA 3QWFA 1GZUA 2XAAA 4EKGA 2XOKA 4J2HA 2JFBA 2F3UA 3JYLA 3PEEA 1K63A 3QWIA 1YGPA 3HL0A 1NBOA 1W2HA 3NHJA 3I9MA 1PLKA 3DO6A 2QQEA 3DKIA 3AKDA 3HO1A 3DMTC 1NKSA 3FBTA 4HLQB 2HA4A 3V1MA 1N0VC 3ANTA 3LKZA 3CZ9A 2YICA 4HQLA 4QUBA 4Q6BA 4B4OA 5ITVA 2Q2NA 5IW8A 3AHHA 4W8GA 1JHMA 1Z0FA 1EGVB 2FSVC 2REQB 2YHIA 1A5SB 3WA7A 4OQ4A 5I6DA 5I7OA 2FF7A 3DMHA 1XA3A 1RAIA 4XIGS 1V43A 4ASUA 5DBIA 3R5HA 4OREX 4B0PA 4XX0B 4C7OB 1X7HA 1P9OA 3B7WA 2P9BA 4GNKA 2RK4A 2CYBA 2QPOA 3CMCO 1FVXA 1L8QA 2CLFB 2PLRA 3NJ4A 3P2MA 4IBOA 4IUDS 3TR5A 4HEA1 4LEIA 1R5BA 4D97A 5ICSA 3HEMA 4I99A 1EJBA 4YV0A 1UXKA 1Z0IA 4LMAA 4LOKA 1BNCA 1NI3A 2WE8A 1IK4A 4GMKA 2B1QA 2EG9A 4FC6A 1FYDA 3UUEA 1G60A 1TGYA 3FFWA 5IULC 1Z2OX 1XKLA 3QKSB 4IFTA 3VAZA 3H75A 3D5EA 1GRCA 3JV7A 4EDHA 2YKGA 4CM9D 2AFIA 5A6SB 1PFWA 1P4HA 3G6KA 4MW0A 4FGZA 4QO8A 2GILA 4JEIA 3U7RA 1U8EA 2H1HA 4EITA 1K7YA 1GEGA 1AKWA 2JD2A 3QSGA 5KJFA 3OSUA 1MVLA 3DO5A 5B3JC 2CVFA 4AJ4A 1RRPA 1NTOA 2ZRMA 1PL8A 3G0GA 1QE5A 4AY3A 1Z7GA 4NJEA 1GKUB 4DCCA 2B5VA 4UCQA 5BSWA 1RYEA 4OGLA 3IHTA 4Q9NA 4DLXA 3ACDA 4GXNA 5DTEA 3PUHA 3ZKAA 4H0NA 4W7IA 4AKGA 2BL4A 4ZU6X 3CKLA 5KIAA 1L1EA 1LDEA 1H66A 1SURA 2YYZA 3BGWA 4RCVA 4KUEA 1UWCA 1NLUA 2I4MA 1TM7E 2YWXA 3RLFA 3S99A 1AKTA 1ZIDA 5DM70 2V7QD 5ELLA 3Q87B 3V80A 5FLKA 2RK3A 2EYUA 1I4WA 2VWGA 4OK5A 1BDIA 2CZGA 4POAA 2GJKA 2Z8XA 5FP0A 2XB9A 3SD7A 4V0ME 3EVGA 6REQA 2JHAA 1OB5A 3IJEB 1VIAA 2AK2A 2XMQA 4BMZA 1PNQA 3I62A 4HO1X 4ZVPA 2QYOA 2R47A 1PAUA 2CFRA 4R84A 2PUVA 4O2BF 3PX7A 1JXAA 5ALIA 3EXEB 5JCJD 1JQ3A 3B7GA 3F6SA 3M5DA 3DT8A 2Q29A 1EVQA 5J43A 3EGDA 1OBFO 5K03A 3WISA 1SO8A 4KH1A 3QVUA 2P2CA 2QRVA 1A8PA 2P5UA 1G19A 3OQVA 1Z7YA 3D3NA 2ZOSA 1A27A 3GLUA 1FDWA 2R44A 3BKXA 2J9XB 3EVEA 4JVSB 4US0R 5EPOA 2C3UA 1TZ2A 4JP2A 5EOVA 3NOOA 1JEYB 2CMGA 3N2ZB 4W1RA 4YV2A 3NVDA 1ND6A 3AVPA 2PEZA 4CUZA 1JP7A 2C57A 3WB9A 3W79A 1IBLB 4CETA 2XADA 3PWKA 4B3MB 1A4UA 3ZU2A 2J6CA 3FCSB 1X80A 2R60A 2DFDA 3Q9NA 1ZIXA 2I3BA 2XD4A 5E6SA 4CKYA 4F46A 4O2AA 2HMWA 5A2QA 3ZDEA 4A0FA 1GO2A 3CJRA 1YULA 2YCLA 3MT0A 3TSWA 3UY4A 3GP8A 2RGDA 2QVGA 2GSWA 3F6EX 1ZL0A 1LK5A 2P67A 3BSSA 3KJXA 3LBIA 3B6ZA 1P5ZB 3QW4B 4G01B 4JJAA 3WKEA 2AC4A 5AFSA 1WZCA 1I2BA 4BJ5A 3IDZA 3CISA 4M8NE 1EIZA 1TQDA 2JRCA 2YMQA 4MYCA 3V8RA 4CN8A 3ZHUA 5IJ9B 5EHXA 3DDSA 2QS9A 3C5WP 4OP2A 4R2LA 4PC7A 3IA7A 4V2IA 1T8RA 1ZEJA 3LX6A 5DMXA 3MG9A 4BFWA 3NLLA 3WGMA 2DXIA 3WGIA 3VZRA 3OUTA 5DI3B 1KFJB 1SVIA 2XB4A 5IU6A 1ZINA 2V7PA 4D45A 5EUMA 1U7ZA 1JIJA 3IAAA 1A9RA 2C4VA 1ZRNA 1O96A 1W35A 3GLHB 3G1TA 2VZ0A 4M21A 2RFLA 1JXQA 3LJKA 1KSJA 3ORHA 2O0MA 3WKCA 3ZWQA 2A0KA 5L3QA 4RHYA 1QKIA 1V1RA 3KQHA 2I87A 1LNQA 1MB9A 4PZZA 5I9IA 1EVYA 1LRKA 2R48A 4B4KA 3AJ8A 3C15C 4YDRA 4HGOA 3KG2A 2NU9A 3K4HA 4QOGA 4YAIA 5KO2A 4C07A 1Q1ZA 2XVMA 4LYAA 3DE7X 3HP7A 3KJHA 4PNZA 3UXHA 2Q8PA 4HFRA 2IYQA 1JQEA 5EWMA 4KKXB 1ODKA 3OHSX 4B73A 1TOAA 1TO2E 2FY8A 3KPWA 3R3XA 3KDSE 1F4VA 2GUGA 4EO4A 3F7NA 1HPLA 4IYRA 1WCIA 3FDZB 2PZEA 3OUUA 5BQOA 3HZRA 1ZUIA 1NBEA 3INYA 2QUBA 3JQFC 4QEDA 1JILA 4CIVA 4TLEA 1REQB 1G3IA 4XQEA 4C6SA 2BF7A 3A3NA 3FD8A 4MB0A 2CYCA 2L2QA 3KOYA 1KEEB 4BO0A 4K9MA 3CUKA 4ROSA 3FOZA 4B5LA 3OHPA 1NI5A 1C9YA 5BSVA 3HWRA 2HD4A 5JW6A 5D1HA 2NNLD 4M2LA 4RVNA 4EPRA 2B4KA 1YZNA 5GOZA 1YJ5A 2CF5A 3AUTA 1B1CA 2XKJE 4TSFA 4DR6B 1IM5A 3KTAA 4MEJA 4U5XA 2EP7A 1SKYB 3JZDA 3TR6A 1I1OA 3FIJA 3FLBA 4LJSA 4A27A 4F72A 2X2PA 1GV0A 4JVOA 2BP7B 3RTBA 4CM5A 2Q6OA 3HBFA 2XRFA 1QVRA 2WIKA 3OTIA 2NZYA 3QEJA 2Q5IA 2ILTA 3ETNA 4XSHA 4YJ2F 2Z1MA 4FFNA 1EP9A 4RHUA 4OMCA 1L4UA 5CNKA 4YAKA 5K3SA 3N76A 4AZ0B 2BC9A 4JLJA 3OAAA 1Z47A 4OJMX 2QM0A 3KJZA 3TQTA 1YKSA 1Y4SA 2W6MA 1AB5A 1PWXA 1BG6A 2NV6A 2ZT7A 3DBLB 4TKMA 4YJHA 3TTYA 3BK7A 2JGLA 1QGZA 3E2IA 1EVEA 4LHEA 3W5BA 2EGUA 4UHCA 3ZU3A 5EAIA 3U7JA 1V3UA 1XFDA 1KPIA 2HSGA 3LECA 3BQMB 1ETHA 2Y1CA 3KBOA 1TW2A 2A1UA 5I4BA 2XRZA 2G82A 1MABB 5KPJA 1FTWA 1ID1A 3H05A 3SR3A 4H1UA 4HQNA 1TE2A 3REQB 3BHNA 4HSEA 5KCZA 5DZSA 2OCBA 1R00A 4UEOA 4ZV4A 4AO6A 2Z58A 1P81A 1FK8A 2QD4A 3ZE0B 1QIFA 4H16A 1CZHA 4TLCA 4MVCA 4F4HA 3DZ8A 4EJFA 1NVFA 1FFXB 2YUIA 1II8B 2ZSBA 4OHUA 4WX2B 3VVBA 3WYFA 3JQ8A 1U1GA 1NX6A 1ZVJA 4OA8A 4X7RA 2IV2X 4BLWA 5A9RA 1YB4A 3OJLA 3U17A 3BZUA 5K6AA 2JARA 2ZAMA 5FUQA 2VNSA 3PC3A 1F5NA 4RNDB 2HXSA 2QM8A 2HKIA 2NNWB 4YRMA 1L5NA 1IWBB 3GT4A 1BD4A 1DINA 1G8MA 1Q7BA 3BFKA 4XIYA 2BGKA 3PHHA 1B6SA 4GDMA 1O03A 4FMDF 1FMLA 5LJLA 1O77A 2R11A 1KETA 3MM4A 1V11A 2FH5B 1QZUA 1TO1E 1M5RA 3BKWA 1R12A 1VB3A 3MRXA 1OX4A 1AHIA 4OHCA 5EJMA 1E9VA 4BZPA 3G0OA 4DIFA 2FR0A 4PAQA 5E7QA 4XD7D 4URWR 2V1XA 1XYVA 4HNAB 3M4ZA 3AW8A 3NP9A 3WLTA 4DWVA 3IAUA 2PO5A 2RI0A 3F4BA 1WV1A 1ZD8A 3KLPX 3NDPA 3GNSA 4Z4CA 4KSBA 3TD2A 4WK0B 1SC6A 4GZMA 3E4DA 1IXRC 3TZEA 2UYCA 4E94A 1W0CA 3M1LA 2C4KA 3RADC 1EP3B 2WRZA 4Q9IA 4LFBB 5H5JA 4N47A 1NN0A 4BGUA 5HRUA 2Z5FA 1USKA 1X1RA 2NVOA 4M53A 3WGTA 1DWOA 1GLGA 3WL5A 3EZFA 4ECEA 4CQNA 2YVAA 1ZCAA 3UFBA 2YHIB 1VMEA 4DHWA 4MWBA 4QYTA 2RAVA 1FDSA 3A6JA 1U9ZA 2PNFA 5GONB 2V5VA 1TAUA 4XXHA 1IEWA 3OE7A 2LKDA 3UMVA 5JZOA 2VSXA 1M2VB 1Q1QA 2QY6A 4H7IA 1U8AA 2QYTA 3ZXUB 5ALPA 2B34A 3MS4A 4FFBA 1GTSA 1BFKA 1JMKC 1GXSA 2O1WA 3DB2A 1C9JA 4FIDA 4UU1A 4ZRMA 5E3HA 1I2CA 5C7YA 4IQ0A 2ORVA 2EC5A 1PEAA 4KWHA 3CWZA 2YYSA 4EB6A 3U7FB 2GM9A 4BKOA 3R9WA 1IY8A 4EI7A 3GLIB 3D31A 2X23A 1IZ8A 3PR1A 4RQTA 4B3HA 3PEFA 3GUUA 2ZU6A 2AK3A 2AUMA 1NMSA 2EKBA 4N7JA 4RMIA 5BXYA 1U7TA 2IX9A 3NX4A 3KEFA 1KYXA 2XE7A 3DR5A 3R1IA 4FUTA 4O2BB 3DLAA 4FMPA 2WYIA 5DSZA 5EZYF 3PUXA 5JCJA 4N48A 2OCLA 4N76A 3I4LA 3ILYA 4S1OA 1Q83A 1HI9A 2PT6A 3G2MA 3VPBA 1DKOA 3NKVA 1R15A 1EVKA 1UQRA 3TLMA 2PWZA 3FUWA 2FJUA 1V4NA 1OMOA 1IY2A 2ZI7A 4G0XA 4B47A 2M6SA 3OQHA 4JLVA 2X7JA 3IAEA 3ZLUA 5B3JA 1FOEB 3G0BA 5JSKA 3U49A 3KQYA 3CW8X 1BTOA 1XNRB 1JS1X 1UBHS 2YHSA 4J0JA 4X6UA 2C2XA 4IDBA 1GFWA 3PLNA 3PZBA 3UQZA 3AEZA 1X9GA 3VV2A 5KB3A 4S04A 2DQ4A 2JHGA 3IE0A 2JASA 4NC9A 3K5WA 2H7CA 1KQGA 1UKZA 1FYXA 4YP0A 3BTOA 4MHTA 4HDCA 1QKJA 3E5HA 1H4TA 1E1KA 3E48A 4JI4B 2RAFA 3EPLA 4U00A 4UZFA 5TXGA 4BZQA 1JRLA 3U4AA 2QLBA 5F7XA 1XRPA 2HHCA 2A6PA 4E14A 1QG6A 4XDYA 1EUZA 2QTFA 3P1JA 2WTAA 3GD5A 2IOYA 3B51X 4IEEA 1TEZA 1UKEA 2FFJA 4MVYA 1S8AA 2WT4A 2QENA 4GOXA 2GGSA 4TWJA 4WZAB 5DRYA 3WGQA 3HCWA 1M6EX 4NPHA 5AJUA 4KQHA 4TMFA 2I4OA 3RBVA 1EHIA 1T0JB 1FP2A 2VS1A 1LDBA 2D1SA 1GPWB 1MC4A 2HLHA 2I9PA 3FPSA 1ORDA 1IU9A 3KV1A 2G77B 1Q7EA 1YDGA 4Y1EA 4IDQA 4O4LB 2NU8B 4C0XA 4EF5A 2QN9A 2GPYA 1ORRA 2WBLC 1U3WA 4DPLA 4DQUA 2AR0A 3R0IA 1YR7A 3F6YA 3FMGA 2XYHA 2I2WA 4AQDA 5E3IA 3T3MB 3FTCA 1D2EA 3PUJA 4I1SA 1AK1A 4QXPA 2FKNA 3FFXA 3FRJA 3ETEA 4KV7A 3OETA 4ZICA 1Z2CA 1ZM3A 3V4FA 4BJ3A 5EWLA 2WIAA 2WSSA 1FBNA 3DYBA 4L28A 1ZICA 2PS3A 3A9UA 2EXXA 1IQPA 3MWGA 1I6MA 1SA0B 4D8YA 3K8YA 3FOAA 2C61A 4G8BA 4A6EA 2C20A 3I9OA 4YPOA 1U0FA 1VHWA 3BULA 2P0YA 2OBMA 5A3VA 2CJXA 1YWGO 4OY3A 4Z9BA 3OZCA 5GWXA 1Z5WA 5JMWA 3DOIA 4QGSA 4NCNA 3RUHA 4YP5A 2RHTA 1XJ0A 2DQZA 2PJDA 4TOIA 3JQDA 2CE7A 1C7FA 3RS2A 1QIJA 7REQA 5TJHA 4W5HA 1B3RA 1L1FA 4XLLA 1PWYE 1F2UB 4DNFA 5A6VA 3KYJB 3RFTA 1K7FB 4HLNA 3C16C 1J2RA 3EG9A 4OK3A 3KT8A 2W6JD 4OQYA 1W73A 4W9NA 1VL2A 2QMUA 3O8OB 4OUKX 1NQWA 2IDMA 5TT1A 3KJIA 4CUJA 1HFJA 1PLLA 2ZIFA 3SY8A 2CNOA 1LSJA 3VO8A 4BV3A 5BWLA 4YMHA 2J67A 1DOAA 3EVAA 1I10A 1X7YA 4NCBA 3GUVA 4OLAA 2JGKA 1SQFA 2B5OA 2BFDA 1W93A 3KP1A 4BFTA 2GZ1A 4JD5A 4QOFA 3VOAA 4XGRA 4RJTA 2CGEA 3V7UA 1CUFA 2YNMD 7MDHA 4B7XA 1J6UA 3F9RA 3U3ZA 4ZJUA 5HNKA 1K66A 2D0DA 4BP1A 1EWYA 1Q7TA 2WSLA 1NMQA 2ZBFA 4HAIA 1E6EA 3VSBA 5BW4A 4H35A 1G6HA 2HN9A 4NPAA 2OLEA 3TX2A 1FSPA 1UPAA 1LVHA 4LMRA 3ZHTA 3W8NA 5KTTA 3C6KA 5K0FA 5L4LA 2LNDA 5DWVA 3GGDA 1TLFA 5GONA 5B1HA 1I2AA 4DDHA 3VDXA 1L7QA 2V0GA 4RLSA 4BMVA 3QMVA 1N75A 4X93A 1NF9A 2HGZA 4DSNA 2ZJ1A 4C78A 1ZH4A 4GBJA 1TIBA 4K6GA 2OGUA 2X5JO 1N4DA 1Y1PA 2DY0A 5AIAA 3QFCA 5EWLB 4EHLA 3EDOA 2HPVA 2WTUA 1N2HA 4LJ6A 3BGOS 3EQ8A 2CNNA 2O07A 4TL9A 1EXVA 3TSYA 3CNQS 5JRJA 5JZBA 2BEVA 3K09C 1E66A 1G5RA 2C2BA 3E23A 1CF9A 3P2YA 4FBMA 2J0EA 3UGQA 4C04A 1J8VA 2D4AA 4CM8A 4LW8A 4J43A 3H6GA 4WOCA 4CMBA 3K8QA 1N1MA 2A4MA 3OPVA 1T1JA 2HF2A 4MHSA 4X97A 4OMFG 3N86A 1DPGA 2MHCA 4YB8A 5EXXA 4C0QC 1XDGA 1ZZGA 2JJ2D 5DWQA 1AB6A 4PPNA 4ZYWA 1XWFA 3PDCA 1L5QA 3M33A 1GR0A 3R7BA 3ROGA 3WADA 4D6PA 4YIKA 3O7WA 4JV5B 3NATA 2JKVA 2D5AA 3EGVA 3DG9A 3NETA 1RU3A 1WHTA 1JL3A 1T4CA 1C0IA 3LV8A 5CJPA 5B1IA 3W9UA 3DH0A 1W85B 1ZLYA 3FB4A 4ZI5A 1X2EA 6PFKA 3IDQA 5DVZA 1GV1A 1M1NB 1K06A 4QNNA 4ZP1A 1L7XA 2GFHA 1IPEA 2JS7A 1GIAA 3GJ4A 3IOCA 4K46A 3PPVA 5FA5A 3CH5A 1XKQA 2QEQA 4LISA 4DN6A 3H2YA 1ILEA 4R54A 4OBBA 1VHJA 4BQOA 5DHTA 2YZGA 4ZPXA 5E4YA 1JLRA 4AKHA 4G5QA 1SZJG 4Y2QA 1UIMA 5EP4A 4D92A 1YS2X 1KI2A 3F9CA 3THWA 2PX5A 1NN3A 2SKCA 3O8LA 4QBIA 1QIDA 2JCVA 1XXHE 3EIWA