3PDOB

Crystal structure of hla-dr1 with clip102-120
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
191
structure length
191
Chain Sequence
b'MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Bidirectional binding of invariant chain peptides to an MHC class II molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2010-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pdoB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3pdoB01
4F33B 4S1SH 1GGBH 3M1BA 5IMKB 2JJWA 2P4AB 4MJ5B 3UAJC 2H8PB 2FLBT 4HEME 5B22A 4XPAH 1MHEB 1FL6B 4GOSA 3WD5H 4U7KA 4POUB 2QQKL 4PV8A 4JM2D 2Q7NA 2Z91A 4DQOL 3P4OB 3NOIA 2FH8A 1KCRL 4WI2A 5DJZB 4GRLA 3IJSA 3U0PB 5GGRY 4TNWF 1HH6B 1I7ZB 5TQ2L 3UDWC 4E41E 5JO5B 4PJCE 2OL3H 1QR4A 4HXBL 4AM0A 4NQSA 3AU1A 5F3BA 1CFTA 2IPUG 4XNYL 4JKMA 5LQBH 3MCLH 1RI8A 2OXHA 5C0BD 3KYNA 1HI6A 2R9HC 1ZHLA 3EO9L 2DLGA 4E42A 5ALCH 4NJAH 4XMKH 4PIRF 2LFGA 1QFUH 2W0PA 4NKDA 4GAYB 2I5YL 1U3YA 3O4OC 3U9UB 2LAGB 3KPTA 5GISH 5KSAB 5F7MC 4MNQB 4NQDE 3LY6A 2M26A 3FTGB 1JHLL 1T83A 3RBSA 4G6FD 4IM8A 4PJ7F 3OAYK 2JB6B 5BV7B 3UJTH 1J86A 3HAEB 1Z9LA 4NFCA 1BBJB 4F33A 1A5FL 4FFYH 2VQ1B 3VGEA 5JXEC 2F54E 4OT1H 4Y16B 2H8PA 1GIGH 2GUOA 3T2NH 3H9ZA 5I16A 1FL6A 4G3YL 3FB8A 1TXKA 2UVFA 4YDJA 4I5BB 5KSUA 2HT3C 5DMKB 3HRZB 1MIEH 4JPVL 4M3KB 4R26H 1X5ZA 2AK4B 3C60A 5C7XH 3PWNB 1WITA 4M9OA 2J2ZA 2C4FT 4MSWB 3HB3C 5GSRB 5HI3C 4ERSH 4LSTL 3F62A 4HAFA 2PYEA 2DTML 4RAUA 1U2CA 3GJFH 3PG2A 3W0WD 1F6AA 4I9WE 2BSTA 1TVBB 3FQNA 1HH6A 4L9LC 4PRIB 5JO5A 2J8HA 2XFXB 3LN4B 4M7JH 1U3JA 3VXRB 4KKBC 4MJ6B 3JWOH 1M05B 3EIFA 4HK0A 3QJHA 4P23D 5DXWA 3RUGA 5CJ5A 1A6TB 5I0DA 4KAQH 3WIFB 2PO6C 3A6CL 4QHMB 2FHCA 2YRLA 4QHKI 4XWOD 4GAYA 1KB9K 5T5NF 4PJFF 2F8OA 1DDHB 2JK5B 1U8HB 3D85B 5ALBL 3U9UA 5I8CB 2BMKA 3MYJB 4GMTL 3R1GH 4MNQA 4AEIL 3IETB 3FTGA 5EOQH 3S34L 1QSFA 2DKMA 3B9KA 1EEZB 4OLWH 1JCKA 4JVWA 3RVXD 5JW4M 5FAAA 3HAEA 1BBJA 1T1ZA 2AJUH 3ILQD 3IFPA 3TN0B 4OGYL 5IQ9B 3GDBA 1U36A 1M7XA 1KLUA 2DQEH 1QBAA 5EOCH 4LEXL 4W4OC 2NY7L 3ZTNL 3GSNH 3V5KA 3HRZA 4TPRL 2F9BT 5F6HJ 3PWLB 2AK4A 5CKAA 4R90H 3RWHB 5BQ7B 2VLRE 3LS4L 1B4RA 4YBLB 1FIGH 2R23A 3IVKB 4MSWA 4HS8L 1RUML 5GSRA 3MV01 1ZHBB 5F7EH 2J6EA 2YD1A 3GSOB 2P47B 3BH9B 4Z77B 1B0GB 2ADIB 4KK5D 2NY5L 3CVIH 3D39A 1NCBL 4PRIA 4PJBB 2OR8A 5E1HB 5D72H 4WFGE 1MF2L 4LSPH 4NKMB 4P2CG 4ELKB 1DFBH 2H26A 5I74B 1M05A 4DEPB 4OD1L 2BHZA 1RZFH 1OAUH 2HJFB 1JZ2A 5DSCB 3WIFA 3GMNB 4QHMA 2K1MA 3HS0B 1LO4L 3QAZB 4ZOCA 1R3JB 1U8HA 1WIOA 1DBKL 4KVNL 2YHGA 2QQNL 1Q0XL 3MYJA 4Y8DC 4F9LC 1I1AD 3IETA 1MHPH 4YDLC 3BN3B 2VXTL 1EEZA 1MJUL 4NKOB 3GSQB 3C2AH 1LQSR 2Q6WB 2WQ8A 4DK6A 3T0BA 3MLTA 4J3TA 3B2UC 1CF8L 1DLFH 4HX1B 5CD5C 3IB4A 4M6OH 3KJ4C 5IQ9A 5B8CB 5E95B 1R3KB 3GIZH 4AMKL 3TIEB 2IQAA 4G42B 4Y5XB 4JPWL 3C5JB 4WO4A 4JN2B 2AKRB 3PWLA 4R4FH 4OFIA 2CSPA 4R4BA 3RWHA 1T4KB 5BQ7A 5JXAL 3ROOB 3IVKA 4EN3D 1K2DB 1ZHBA 3QUYD 5I1AA 3GSOA 1T1YB 1QBLH 1JPFA 3BH9A 1KJ3L 2H1PH 4Z77A 1B0GA 5CILL 1AQKH 2ADIA 4J6RL 2BNQD 2A9MH 4PJBA 1YZZA 4ELME 1Q72L 4ODUB 1NPUA 2A73B 4HCRA 1PGRB 3O8XC 4NKMA 1OGAD 1R24A 3LKRA 3I3EA 3CC5B 4ZPVB 1C1EL 2HJFA 1KACB 5DSCA 4XBGB 4DKDC 1Q9OB 3RI5K 3HS0A 4LF3B 1NFDE 5C0AA 4X6DB 1R3JA 3MZGB 2YUZA 3H7LA 2R1WA 4ZPTA 5F7LB 4BM7A 5HYSG 2AQ3A 2ERJC 1UWGH 3GSQA 1H3UA 4NM4L 1UWEH 3DI3B 2Q6WA 1KN4H 1NBVL 3WFHA 3TVMC 3LH2H 5MP6H 3QCUH 3BKJL 3RWIB 1NC4B 1OL0A 4RA3A 4CVWA 1TJGL 3D0VA 2NY6B 2W0KA 4HJ0D 5B8CA 4Z7WE 1A6VL 2YZ8A 1ND0B 1R3KA 2AVGA 1AJ7L 3HMXA 4G42A 3C5JA 1RJZA 2HVKA 4NM8L 4URTB 2EDNA 3WN5B 3HC0B 3ROOA 3O4LB 3O3EB 4IDJL 4OZFH 4P4KD 4CDGC 2AJZB 3GSNA 1F3DH 4JFDE 4GG6F 1RZ7H 1Q38A 4QTHB 2NZ9D 3VXNB 1UCBH 2A73A 5I1GH 1PW3A 2XKNB 4AJ0A 3IU4L 1JNNL 4LIQL 4OD3H 1WT5A 4Z0XB 1CGSL 3CC5A 2DQFB 4ZPVA 3B6SA 3L3HB 4JZNB 4O2EB 1AI1H 4LSQH 2IPKB 1Q9OA 1KN2H 3RDTB 4JN1L 5JW3H 3L3IA 4LF3A 2HLFC 4D3CL 5CP3H 1I3GL 2E8ZA 4LAJH 4X6DA 1Y18B 3SJVD 2E7LA 3TA3A 1MFBL 5CGTA 1U8IB 1EK3A 2FX9L 4XP1H 5D7IE 2O5XL 5I1IL 3MLYH 4YDVB 1TJHL 4JZJB 4GKNB 5EU3B 3VU2A 2KUTA 5DLML 2DYPB 3GHEH 3RWIA 5ETUB 1H8SA 4XRCB 1EBAA 2W9EL 1L0QA 2GQHA 3HFML 1UJ3C 3RVUC 5FYKD 1FYTD 2A6JB 1ND0A 4RMQA 1ORQB 3UTQB 3V4UL 2J5LC 3OMZA 1MCCA 2X1PA 5HHQA 3WN5A 4MQXD 2FO4A 1RZKL 2B5IC 4HUUB 1NGZB 1AH1A 3O4LA 2AEPH 2FBJH 4R2GD 1XF3A 4Z7QF 3RY4A 3Q6GH 1D5MB 4AEHL 1FNSH 1MH5B 4HK3J 3BESR 1IGJA 5ITFB 3U1SL 4B7IA 1MJ8L 3KPRD 3VA6A 4A2LA 2PXYB 3O3DB 4JO2H 4Y4FA 4OLVH 1HHIB 1ZE3C 3RPKA 1JL8A 3GSWA 3TV3H 5F93C 1YQVH 4PJ8C 1OAXH 1N7MH 1SJEB 15C8L 1NDGA 4JZNA 1IFHL 3L3HA 4HIXH 3Q1SH 5BOPA 2RAMA 1GZPB 1BJMA 2GI7A 2IPKA 2LVEA 1P5VA 3RDTA 3CAFA 1BIIB 2XA3A 1KTRL 2V17H 5DC9B 5C0IA 1Y18A 5E8DL 3VXSB 4JM2A 2FJFB 4UT6L 1DTUA 5A40E 4M9PA 1S7UB 1WCBA 4YDVA 2AEWA 3LQAC 4JZJA 3DURB 5TF1L 5EU3A 3OQ3B 3DX8A 4D94A 5IVXB 3S97C 5F97E 2DYPA 4IOIA 5DJXB 4H25B 4U6HB 5JQ6H 4XRCA 2NQCA 1WISA 2R56L 3GBML 3UBXG 4O51A 2GAZA 1FO0A 1ORQA 2MOVA 4I0CC 1LMKA 3N85L 3C2SA 4M5YL 3UTQA 4C4KT 3G9VA 4UTAL 2BRRL 3O0RL 4I18A 3NN8B 4KKLD 3RI5F 2DL2A 1NGZA 4G5ZH 5B3JF 1F6LL 1YEHH 2IPUK 3KPSB 4Q9CA 3RGHA 2X10A 4QOKD 1MH5A 1ZSDB 2IBBA 2I9TB 1QBML 3QUXD 1YMMD 3O3DA 5F7WC 3NH7H 3RKDC 4Z5RA 4LSRL 1MI5B 4GAJH 5FF6B 5ITBL 2C3VB 3LKSB 4YZFE 2HAZA 4TSAL 3QCVH 3CFBA 5J0BA 1SJEA 3DXAD 3SDXF 3TJHD 1LP9B 3E6HB 3BRGC 4KV5E 3V4PH 4ODBD 2FR4B 5FDWA 5E5RB 3MUGA 1FZJB 1BIIA 4YNYB 5E1AA 5GJSH 4PJHF 1FAIL 1LEGB 1AGDB 5BZWB 2AJSL 3VXSA 3QWQB 2Q8AL 3BKMH 3BP6B 3O6LL 1J8HB 4HT1H 3AFLA 5H35A 1JN6A 2H2SC 1S7UA 2OXGA 1NCTA 3UO1L 2V9QA 3DURA 1WAAA 2Q1EA 5IVXA 1KPVB 4MB5A 4XP4H 4XP5L 5EU6E 5LBSL 1H5BC 1JV5B 5DJXA 5KS9B 4H25A 4U6HA 1T0MB 3MLPA 4P9MH 3VFOB 1GCFA 1K5NB 4OAWA 4ZD3L 3GMLA 3KR3H 3LHPL 5EO9B 1NLBL 3MBXH 1MCOL 1QKZL 3BVNB 1IGYB 4P23A 3JZ7A 2F5AL 1N64L 3DTXA 3NN8A 2DL9A 4E9LA 4XVUC 5DD5L 4HUVA 2Z4QB 1J0YA 2BVEA 3FT2B 3KPSA 3AM8A 3ARQA 4N8VB 4HWEL 3H9SD 5AAWA 2HH0H 1ZSDA 3VI4F 5EUOB 5F7UA 2I9TA 2ITDA 1EA9C 5DEGB 4NQEE 1FORH 2CH8A 4HUMB 1GSMA 3D1MC 5HHMD 2C3VA 2R29H 4P2RD 2GHWB 3LKSA 4JQIL 4IS6B 1LP9A 2GIYA 5KVEL 3E6HA 4P3WA 2F53E 5GRJH 4NQCD 1FFOB 2BDNH 1UM5H 1FZJA 2XNAA 2K7PA 4YNYA 1QP1A 3NCYP 4LCYA 1LEGA 4NC1E 5D96C 5FB8B 1GH7A 5DQ9B 1NSNH 3BP6A 1J8HA 5LJYH 4TUKL 2VL5A 4JRXD 5JR1H 4Q58C 5AEAA 5K59F 3Q0HA 4WTWA 3W9EB 5A2JH 4L4VB 1F45A 1VEMA 1NCAL 2EH7L 2WM0A 3W2DH 1KPVA 5MI0B 3VFNB 1JV5A 4WWKD 4K9EC 5CEZD 4XXCC 5E4IA 4EXKA 3VFOA 4ZS7H 1AP2A 3MRKA 1OQOA 3L9RA 2G60H 3QFDB 5EO9A 1BFOA 3MUY1 2WWKT 2NY1C 1MFCH 3BVNA 1IGYA 4LSVL 4X4XB 1JWSA 4WWID 4JO3H 3UAJD 3RFZC 4PJIE 3N1PC 4QTIL 1NJ9B 2Z4QA 3FT2A 3BUTA 1S5IH 3GEWB 4JY6B 4N8VA 5IB2B 4YHOL 2ICWI 4WRLA 4WW2F 5EUOA 3ARDC 1I1AA 4W6XB 5FHAH 1T03H 1U8NB 4ZOAA 3MJ8A 4JDTH 3RWDB 3MRJB 4LRNH 4RQQA 3I6KB 5JMRA 2D31A 3WNNA 3D3VD 5KOMC 4FQXB 4OQTA 4IS6A 1CQYA 2HFGH 2C1OB 4MNQE 1CXLA 1I7RB 4FABH 3WHE1 3RGVC 5GS1B 1FFOA 3SKNA 2WBJB 1R0AH 3WYRA 3OGOE 4LSUH 5MENB 5DQ9A 1FYHB 5I9QB 1NAML 1E6JH 3MRHB 4U2YA 3P4NB 4FQ2L 1KCUL 4S11A 3W9EA 1D9KD 5I76B 4EN3A 1JI2A 3PWPB 3ZMRA 4H0HB 2D03L 4KUCF 4LPVA 3TCXA 2ICWJ 5D6DA 3LD8C 4QRTB 2BNQA 4K2UL 2YA2A 4WI8A 2A38A 1V3LA 3TJEL 2UWEB 3OJ2C 3L3GB 3MNWB 4TULL 1OF2A 3QFDA 4CW1B 3GUTB 1U8OB 3VFRB 3WHE0 4HIIB 1SMAA 4ODHH 4NZUL 3O6FB 4EI5C 5ADOL 4CADB 3QUKB 1TPXC 2ZSWB 4X9BA 3L3JA 4Q9RH 3AROA 4LVHC 1RUPL 2HT3D 1UB6B 3VXRE 5IB2A 3P9WB 3U0WL 3WHXB 1I1RA 4KK9C 2J8UE 5GHWL 3G6DL 2VDMH 3HB3D 5HI3D 4EQ3A 1B3JA 3I6KA 3FO0H 4XAKE 2Q7YB 1KELL 3QRGH 4ODXB 5DJ6B 3REVB 1FH5H 5IKCB 5TPWH 1G9NH 4KI5E 4XPTL 4UINL 1AO7B 4KXZI 4P99A 4Q2ZB 2OR9H 2VDNH 2DWDA 3D9AL 4C56D 5DUBB 3T8XA 1RUQH 4MAYC 3E2HB 2IG2H 4IRZH 1I8LC 5I76A 5L88H 4FTVE 4Q9BA 1RJYB 3PWPA 1BQHA 3QI9C 4Y1AB 1C7TA 4ZFOB 4Y7MA 1MCWM 3MA9L 5GS3A 1VGKB 2CLVB 1A02N 2HT2C 3MNWA 3WFDH 3JBG7 4CW1A 1KPUA 2IAMD 3HUJB 2FEEL 3HMWL 1U8OA 1OP3H 5DD3L 2ZSWA 4PD4J 4UOJA 4Z7UE 5E2WH 4CNIB 5CZXC 3DV4B 3R4DA 3IFLL 4NIKB 4PJEB 2SEBB 1CT8A 1BFVH 1LO5B 4P5TB 3SJVA 3MA7B 5HHPA 3WHXA 4U1MB 2VITB 3RTQC 4LFHD 1OW0A 4P2QD 4ETQA 4DUWA 4NZJA 4ODVL 4K3DH 3EZ8A 3SKMB 5CUSL 1KEMH 1KC5H 4ODXA 5DJ6A 5CGMA 1SYVA 5IKCA 3CFCH 1G7HB 1QLRB 3O2VH 1FYTA 3X3FH 2F8VA 1RJCA 3LB6D 2FRGP 5IVZB 4LARH 5HGDA 4OZ4A 4HLJA 1G9MH 1WBZB 5D5MB 4HJGA 4DKAA 1N2RB 1A6AB 1S7SB 1JPSL 2P7TB 4UV7L 3BD4A 4HWBA 4UAOB 3TNNA 4YXLL 4M48H 4PJXB 3ZE1E 3NFSL 4U1GC 4PRPD 4U1NB 3KLSA 3NFNB 5T33H 1RFDL 3EDDA 4XWGL 3QZWB 4ZFOA 3EFDL 3T1WA 4H1LB 4GBXB 3BE1H 4ZODA 1EGJA 2EDHA 4MA3A 1VGKA 2CLVA 4PJDB 5FO9A 4U1KB 4U3CA 3B2UD 4PJAB 3NA9H 4AEFA 2VLLB 3HUJA 1N3NB 2EIZA 4MDJA 3ULUE 3C5ZC 3GI9H 3MTRA 4GG8B 4O00A 4WUUE 5HHNB 3X17A 4CNIA 3DV4A 4MA1B 4LASL 1ZTXL 3CH1B 3MA7A 2VITA 5D2NC 3HE7C 4FS0A 3TYGH 5CEZH 3L95A 4U2ZA 3SKMA 4OCXL 4NC0B 4PRBA 5HDQL 5C09E 4X6DE 1T7YA 1M6OB 3GMQB 2DLHA 5J1AB 1LK3H 4J2XA 3HR5B 5AYUL 2DD8H 3BSZH 1G7HA 1NAKH 4ODWB 3KPNB 4I77H 2XWJA 4QY8B 3T4YA 3B43A 5HVHB 5IVZA 2VLMD 4OZIB 1XMWA 1PKQB 1A6AA 1L7TH 5H37G 3BISA 2Z35A 2XN9D 5LG1A 5I1HL 3NGBB 4U1NA 4I3SH 1T80A 4LNRB 5FV2A 3HR6A 5IIEB 5T3XD 4Z7VB 2EC8A 5JPMB 3P0YL 3QHTC 4Z95L 3QUXA 3P30H 4KKCD 5FDYA 3BKCH 2NY5C 1GGIL 1N0LA 3O4LE 5GGVH 4PJDA 3OXSB 4L8DB 4U1KA 1A1OA 2VLLA 3MQIA 4UOW1 4DUVA 1QFHA 3UTZB 4JG1H 4DW2L 4YHZL 5HSFA 3VGAC 4IOFC 1YPZF 1CLZH 3PL6C 4AIZB 1U58A 3GO1H 4GG8A 3VXQA 1UACH 1DEEB 2PCPB 3GB7B 1HCFX 5FOJA 1V7MH 1XIWD 4X5WA 3TO2B 1NL0H 4MCYB 1P6FA 3X11B 4Y5VB 2BJML 1CGUA 3KYKL 1JZ8A 2Z8SA 3FCTB 4KQ3H 1IC7L 5EZJA 4YUEL 3VDAA 3QEGH 1Z9OA 3FQWB 5J1AA 3CFDB 1TDQA 3AS1A 4Q6IB 4ODWA 3WBDA 3DVNA 3KPNA 5E8PB 3IGAB 4X7TA 1DSFL 5CCKH 1UXWB 4XMPH 2R4SH 4OZIA 3MV8E 4UOW0 5JUEL 4ZNEA 2OR7A 3RAJH 4DZBB 4ZMAT 5DDHB 2HLFD 1KPRB 3NFPB 3PDOB 5IIEA 3PGCB 4Z7VA 5JPMA 3IDXH 2EXYC 3QUMB 3R0NA 5DT1L 4BFEA 3PP4L 1XGPB 1U8JA 2YXFA 2YXMA 1ADQH 1ZV5A 4KTEL 4NO2A 2Y72A 3UTZA 5L8LB 3MJGX 3OX8B 2JTDA 3M17B 1YN6B 4JO1H 4LOUC 3T0EE 2YK1H 1DVFC 3JSSA 2GJ6B 4JREC 1TVHB 1F8TL 4FP8H 4AL8L 1UA6H 4JM4H 4MCYA 4UZGA 3WS3B 5TDPB 4JY4A 5IF0A 1YEJH 1ZKAA 2ATPB 4JRXA 3K74B 1FVDB 2DQJL 4U7SA 2Z8VC 1PKOA 1MJ7L 2VDQL 2VISB 1WVZA 4QO1A 3FQWA 3VXSE 4JFYA 3C9NA 3OKLB 4WEMB 5D2LE 1R5IA 3V0AC 2MCPH 4Q6IA 1YC8A 1TITA 3MLSL 3PABB 1ZAGA 3HCVB 3GIVA 4R7NB 3IGAA 2E7HA 2DLFH 4YK4C 3CDGB 5KSBE 3MBEB 5IJKC 3HHRB 2AJXL 4LRIC 4ONHA 5JW4Q 1NKRA 3FFDA 5F96H 5DUMH 2XXCB 5DDHA 1KPRA 2OK0L 5MEQA 2HP4A 5EC1B 4EOWH 3NFPA 3VRJB 1U95B 2HT4D 3D69B 3PDOA 3PGCA 3RWJB 1QD0A 3IAPA 4J12A 5C08B 3NCJL 4X4MA 1RURL 5D7LB 3L3KB 4FXKB 1ZLUH 4OB5H 3QUMA 4HFWA 1NGQL 1XGPA 1INEL 1F3JB 4LCUB 3UDWA 1X4ZA 3QDHA 3S37H 5LGJA 2HJKB 3MRQB 5IM7A 4XNUH 5J11B 1RIVL 4BA8A 3NZHL 1MI5E 3VWJD 3EYFB 4OQ1A 4X6FB 5IT2H 5CD3A 1LP9E 2PO6B 3WS3A 3FQTB 3GSXB 2H32B 3OKOB 1TQBC 4MNHB 1VKXA 2ATPA 3MACH 3DIFA 1CLOL 4PLJC 4UQ3B 3F7VB 5H94B 1BGXL 2WINB 4O02H 3JTSB 2E6JA 1LVEA 2VISA 4P9HC 5ACZA 1IEBB 1E4WL 5DHVB 4KFZC 3U4EB 3EOTL 3X3GL 4XPFH 3JWDH 1Q9KA 3PABA 4S10A 2YA1A 4L1DA 4P2OB 2ADFL 5KZCB 4WI4A 2A77L 3MROA 3F5WA 1OM3H 4DUXA 3CX2A 4NHCL 3EJZC 1S9YA 5JXEA 5KS9E 4HUXB 1V3KA 4RGNE 1RZKC 1F58H 3K4ZA 5ECJE 5AYQA 1QSEB 1UEYA 4KZEL 1L6XA 1U95A 5E9DE 1AGBB 4XNZC 1T66C 5EH1A 3RWJA 1H3PH 4CVXB 5C08A 5D7LA 1IGIH 4FXKA 2CMRH 4KQ4L 4L8SB 4QGTA 2AABL 1HINL 2ZUQC 3VXUB 1TTGA 2Y06L 3TBVB 1B6DA 3L7EB 1RZ8A 1F3JA 2EIDA 4L9LA 5BV7L 3VD4A 4HKBB 1YNLL 2HJKA 3MRQA 4Z78A 3HAEG 2GY7B 2XPGB 1L4IA 4PGDA 3IYLW 5A1AA 3FONB 4JPIB 1AD0A 3EYFA 5A2LH 4X6FA 1EO8H 2MPAH 2DQTH 4L3ED 4C56A 5T3XH 1JRHL 1SMOA 2PO6A 5AZ2L 5C0RL 3GSXA 3OKOA 4XVUD 4XZUB 2I9LB 1IL1A 3VXMD 2AJ3B 3F7VA 2WINA 4PB9L 1HHGA 1YEFL 1QYGH 1EMTH 3ZDZE 1IEBA 3UTSD 5CJQL 5DHVA 1GC1H 3BZFA 3U4EA 5C0JA 1MFEL 2DKSA 5IV2B 2ZCKL 4L4VE 1UCTA 1KJ2H 1QFOA 2ZWLT 1AHWB 1Q8MA 3NCEB 3S3SA 1CE6B 3KJ4B 4PJGA 4PV9A 4WDIB 4OCWH 1YNKL 2CGRH 4NGHL 4W4OA 1WFNA 1BAFH 3U9PH 1QSEA 2HTLC 4NPYB 2DMKA 1VFOA 4KK6C 3T2PA 1AGBA 3FZUC 3PQYD 5L7XH 4CVXA 3IRPX 1IC4L 5IW3A 4P2QA 5D1ZC 5HY9A 4BH7A 4KGLA 3E6FB 2ED7A 2F19H 4WW1B 3LIZH 3IF1A 1E6OL 2VZOA 5E99H 5J13C 3AMKA 4M1CC 5J3HD 1MRFH 5C86A 3OAYH 4JG0L 1A7BA 5FYLE 5BOZG 2P43B 4C58B 1DLHA 3O8XB 3ARBD 2A9NH 3T3ME 2YWZA 3KPOB 3FONA 4EKXA 5IWLC 3PV6B 4ESKA 2WSKA 4FFWD 1E4XL 1R3LA 3S9DB 2X4RB 3VDBA 1NLDL 2I9LA 2OZ4A 4ZFFA 5I30H 1K6QL 4PRPA 3WXVL 2X6MA 4G6JH 2AJ3A 3QUZC 2HVJA 3S36X 2WBWB 2FDBP 4F9LA 5F72S 2HRPL 4GKSB 4AIOA 4OKVB 3ZKQD 5MENE 4NO0B 2O93L 4MD5B 1OAQL 3F58L 4JO4L 5C0CD 5HHOB 3KXFD 3P73A 5IV2A 3V6OE 4NWUH 3TVMB 2A0LC 3DBXA 4HCRL 1AHWA 1CE6A 2X1QA 1XH3B 1UKQA 4ONOA 1W72H 2UWEE 3TT3L 1KXTB 4HK3N 4DKEH 4NPYA 2XT1B 5ENWB 2Y9RT 5MEPB 4AZ8A 2CKNA 3QDJB 2FX8H 1NMAH 2VIRA 3T2OA 2RHEA 4GRWF 4LSDA 2R69L 2VDOL 5DJ0A 2DBLL 4WENB 4HV8A 5CJOL 1HEZB 2PYFB 4F37K 1EIBA 4JY5H 4OM1L 5DRWA 1T6WA 2MTPA 3KLDA 5FM8A 3OKKA 3MRGB 1TNNA 1WEJL 2VDKL 2ZKHH 5F9OH 4QRPD 5I71B 2Y5TB 1VSCA 2FZ3B 3QFJE 3LPFA 3O8XA 2R0ZL 1IAMA 2CKBA 3KPOA 3SBWC 3RA7L 1KXQE 1O7SA 1RULL 3PV6A 4YEFA 1KT2B 5FA4B 4XXDB 2R8SL 5DEFA 2JIXB 4M7KH 2XN9A 4OM0L 4UTBH 1AO7E 1SM3L 1QFWM 4FXGB 4OZHE 3C09B 1XR9B 1F11B 1HXYB 4NWTL 5HBBA 5J56B 3V7AE 2AS5M 1WZMA 1A14H 4GKSA 4OKVA 4KK9D 4NBYB 1AFVL 4KZDH 4NO0A 4S1DC 4MD5A 4F7TB 4PG9A 5DS8B 3IU3B 4KRPC 5BO1H 4K8RD 2CIKB 5HHOA 2BVQA 2DIJA 3ULUL 1QRND 2BFVH 3TVMA 2F58H 5TE6H 4NNYA 2DI7A 4NQVA 5DURB 3JUYA 5JDSB 4Y1AE 4R3SB 3S35X 1UJ3B 3DX7B 4ZG1A 3QWRA 4LCWB 3IJHB 3QHFH 5C0EB 1G84A 1JWMB 5ENWA 1KJ2A 2J5LB 5FFLA 3QDJA 2NYYC 5L2KE 2R2EA 1MPAH 4MAYD 4YHPB 2V9TA 1A3LH 2B5IB 4JRYE 4N0YH 5BS0E 1TQCB 5ID1B 2PYFA 3RY6C 1SEBA 4FZEL 1QO3B 3BW9B 4M93C 4ONGL 4H8WL 4PJEE 3QYCA 5FYJE 4RWYL 3ISWA 4D0BB 3MCKA 2ICWB 4U6XB 1DBAH 4IEFB 3QDMD 2Y5TA 3UXFA 5K93A 3K0WA 3PHSA 4RIRB 4PJ8B 3V2AR 4KUCD 3B9EA 4LCCC 4JFFD 2EDYA 4XXDA 2JIXA 25C8H 3STLB 3WNLA 3ZKMC 5M95B 2E27H 2VE6A 3AC0A 4IOSD 4O9HL 2XZQH 5CZXD 5B21A 4C59B 1XR9A 1HXYA 3H6JA 2M1KA 4KUZH 1JZ5A 1PLGL 3N0PB 5D5ME 3L1OL 1NMBH 3PV7A 3HE6C 5EWIL 4F7TA 5KW9H 4NUGH 4PJXE 4QKXB 1MRDH 4HFUH 1CQKA 1P4LB 1RUKL 4UQ2A 3NABL 2R39A 1LO2L 2CDGA 3O2WH 4R3SA 5D1XC 5DQDH 1UJ3A 3DX7A 1F4YL 5DEZA 3BGMB 4LCWA 4K3JL 1PAMA 3H9HB 3IJHA 4HBQA 2Z92B 3OHXA 1H3TA 2IFGA 4PJDE 3BP4B 1U8PB 5GS0C 5L2JA 4PJAE 3VRLE 3BXNA 1OSZA 2IC2A 1MLBB 3N9GH 3CJJA 1YJDL 4QYOB 3SDCB 5ID1A 5J1SC 1AR1C 3BW9A 3RQ3A 4UB0H 1IAIH 4D2NA 1FL3A 4D0BA 2ICWA 3QG6B 1VGEH 1KIPA 4KJYB 4XNMB 4N0RA 3NAAL 4E0RB 1DBML 3ZZ1A 5T1MB 4RIRA 4PJ8A 2ZPKL 5C3LD 1G6RA 1Q1JL 4PJ5B 4G8GE 2EEAA 5GIRA 3ZE2F 5I19L 2JELL 3CFEB 2XY1A 2XA8L 1OARH 2D2OA 3FFCE 4WI5A 4OZIE 5I6XB 1VB9A 4ZNEE 1PKQE 3BZEB 2CUMA 4XVSL 2YPLD 3W9DA 4GRMB 2V5TA 1J0HA 4F37F 3DX9A 2ZNXA 1EUUA 2YUVA 3RBGA 3UROR 5IEHB 1AKJB 5A3IC 4OCRH 1H5BB 1MSPA 1ERNA 3KJ6L 1H9VA 2HJLA 4AEEA 1Q9WA 4N5EC 3H9HA 3S3PA 2Z92A 5KVGL 2FX7H 1FBIH 5HDBE 3ZYZA 4QCIA 4RAVB 3BP4A 4Q0XH 2WUBH 1TZIA 4YH6A 1JGUL 4WCYH 1BBDL 2AP2A 2FJGB 1MLBA 3CUPB 5FK9B 5F1IB 5IK3B 3I9GL 1XGRB 4JHAH 4QYOA 5JIPA 3WLBA 2WIIB 1ZMYA 5ACLA 4IRJD 3RZWA 4IBLT 2WK2A 1A8JH 1CFSB 1PJ9A 5JOPD 4HW6A 5ACMA 1BZ9B 2V7HB 4N0CC 1QLEL 2R15A 3QG6A 4KK8C 4XNMA 3KAAA 5DWUL 2FJHB 5HI4C 4JQXC 4B0MM 2O5ZL 3GMMB 2FSEA 3SDDB 2IPTH 3FAWA 5E2UH 3OGCA 5DK2B 3CFEA 1KB5A 4NN6B 1MRCH 3W11C 1CL7H 1S7TA 2F5BL 5D96B 5EU4B 5I1KH 1KIRB 2D7PA 1CBVL 4KPHH 4LLDA 3BZEA 5L6YH 1J0JA 1JZ6A 9CGTA 1MFNA 1PDKA 1EERB 5F9JB 3LQZA 2MFNA 5T1DH 4BSWB 2VLJD 3HNTH 4L3CA 3WFEL 5FUZH 4J3UA 1H5BA 2R2HB 1HIML 2ZOLB 5SX4H 4HIJB 3U46B 4B50A 2ICES 1GHFH 2ZUTA 1ITCA 1OAYL 5F7DA 1JGLL 3NIGF 2NY1B 1C5DB 3K2UH 4GUPB 3VGFA 2FJGA 2RR3A 3CUPA 3ZYIA 5F1IA 1CFNB 2XZZA 2EZ0C 1XGRA 2IFFH 4K8RH 3JV6B 1ACZA 2WIIA 2X4NA 2GW5A 3S5LA 3QG7H 4NJ9L 2GJ6E 4PUBH 3GSRB 3ARYA 3HG1B 4O58H 2VZ3A 3ARDB 2UUDH 4NYLB 4YFLF 5H8DA 1CFSA 5EB9A 3L5XH 2W1NA 1BZ9A 1B4JL 3M45A 3ORJA 2EXYD 1QPXA 5I1JL 3V0VB 2FJHA 5AD0B 4MD4A 4JFQB 5EBLB 3QO1B 4L8CB 4HF5H 4HGMA 3RGVB 4JDVA 2ESVD 4ZTPH 3AMLA 5K9QG 3QULB 1DVFD 2EDDA 5DK2A 5KOVC 5T3ZE 5ESVB 5A2FA 1KCRH 1F90H 5E5MB 5EU4A 1KIRA 5MERA 1XAUA 1YEKL 1ES0B 2DQDL 4FXLA 5IHBA 4XB7A 4H26B 3MLZL 3PQYA 4LHUD 4CU6A 4L5FL 4OKDA 1K8DB 4N8VG 2APTA 5TQ2H 1UADC 2FGWL 5F9JA 1I9IL 1IM9B 4LVOC 4XNYH 1EJOH 5FO7B 2X7LB 4JVPA 2R2HA 3BDYL 1NUGA 3LD8B 3U46A 3NZ8B 4XXCA 3DETD 3EO9H 2NX5B 4OQTL 3MJ6A 5EN2B 4WUKL 3KLHC 3FN0L 3H7BB 2FIKA 4A6YH 2I5YH 1C5DA 1UM4L 1YN7A 3SKJL 4FNLL 1RU9L 4LU5L 1FNGB 4EI5B 2DICA 1TPXB 1AXSB 1JHLH 4GJTB 3NCCB 5ELIA 3JV6A 3H0TA 4LVHB 3EO0B 4OFYD 1DQJB 2W92A 4PRHB 4TYUA 5LAXA 3QNYA 2J8OA 4M7ZC 3GSRA 4OGXH 3HG1A 2RFXB 3ARDA 2EDBA 1T5XA 5IVNA 4UU9B 3MGOB 5CINH 5LGHL 1CICB 3S36L 2P8MB 1NMCC 3HNVL 4G3YH 4TN9A 5HGGS 4JFQA 5D7SH 4JFPB 2KZWA 3P9MB 3QO1A 1U41A 3DUSB 5IHZB 3RGVA 2QADB 4UNTA 5DI8B 2EDLA 5ESVA 3BEVB 4YHKL 4LSTH 3HNSH 5CMAA 1ES0A 2DTMH 2BNRD 4H26A 4OSUL 1K8DA 4PLJD 4Q74A 5D1QD 3TZVC 3GNML 1QOKA 5FYLL 1FFRA 1QSEE 4MD0B 4RNRA 5FO7A 3QI9B 3GBLA 3UZVB 4NQUA 3SE4A 2YPKB 3SPVB 4OCNC 5I2IA 4APQC 2B1HL 2CDFB 3INUL 1T2XA 3H7BA 1OGTA 3VXUE 3FMGH 3QXUA 3EJZD 5ALBH 1HSAB 3ARED 4GMTH 1FNGA 4EI5A 1FN4A 4AEIH 1AXSA 5F9AC 2BSSB 4N1HB 4WEBH 1JGDB 1YEIL 1DQJA 3EO0A 4PRHA 3TCLB 5I1EL 3MRCA 5DA0B 1T66D 1D3CA 2Y6SC 2OJEB 3RTQB 1IT9L 5KSVA 1XR8A 3O6KL 4OV6F 3HPLB 1J18A 1TLKA 4PRDB 3RUGF 2P8MA 1QRNA 4WFEE 5ESAB 3ZTNH 4XI5C 1JHKL 4JFPA 3P9MA 1Z3GL 4WHCA 3DUSA 5IHZA 2RB8A 4NQXB 1RSFA 1S7QA 2QSQA 3LS4H 5DI8A 2AJYL 2V2WB 3BEVA 4MJ2A 1SBSH 1J1XL 3GHBH 3FRUB 4MAYA 3ROLA 3S35L 1NFKA 1V7NL 4QHLA 4CN4A 1NCBH 1QNZL 3G6JB 1I8LA 2QKIB 2YD2A 1AR2A 3BUYB 3QDGD 4XPHH 2DJSA 1N6VA 3QI9A 2D7TL 3R8QA 3VCLB 2Q3AA 3LN5A 2YPKA 4OD1H 4LCIL 1BWWA 4NC1C 4XHQA 5FA3B 1RY7B 4FOMA 1WJ3A 1LO4H 5F7NC 4LKXA 1AC0A 2EXWD 1AGEB 2VERN 1DBKH 4KVNH 1RZIB 2QQNH 1Q0XH 1FLRL 3FN3A 3V7AG 3C5ZB 2VDPL 2PTTA 1KFAL 4LSSL 2BSSA 2VXTH 3HRPA 2HTLD 3TCLA 1MJUH 4LKCA 4KK6D 1NCWL 3FZUD 1P1ZA 1IQWL 5D2NB 3RTQA 3HE7B 2W0FB 5BW7C 2VZTA 2NXYC 3HZKB 5D1ZD 1RHHA 4ZFOL 4PRDA 2FWOB 4AMKH 2N56A 1WTGT 3JV4B 3O3UN 4S2SA 4M1CD 3LKNA 5HD8C 3AAZB 4PS4L 4FN0A 4WI3A 4JPWH 4EDWL 3QWOB 4GW4B 2FL5B 4NQXA 3F65A 5IBTL 3OR6A 5HYFA 2QSVA 3OKDA 2VQUA 1MAJA 1ETZB 4CU7A 1HXMB 1S78C 5D93B 4M7LH 2J7LA 2B39A 3UYRL 2JJSC 3GMOA 5CILH 4J6RH 3ZE0F 2VDRH 4ZSOA 5KSAC 5CIPH 4E41D 1Q72H 3VGGA 1BF8A 4C83B 1MNUL 3BUYA 2CRYA 2NNAA 3QDJE 3VCLA 1LO3L 4FQPA 5BV7C 2YZ1A 4I2XE 4HPYL 5FA3A 5B38B 1JWUA 2A0LD 1IAII 2CUIA 3ILPB 1SY6H 1AGEA 4X6EB 4Y16C 4JKWA 2P49B 3WIIL 3NCYS 3PL6B 4OLUH 3C5ZA 3EW3B 1QSVA 2A6KB 4NQDD 2UZIH 1E4JA 3CNKA 4WV1B 2X70B 1MQ8A 5C07B 1NBVH 1A6UL 5D2NA 4PJBF 3WJJC 2C5DC 3HE7A 2W0FA 4P5MB 3BKJH 1VERA 2XXMB 4P46D 5JOFB 3A0OA 2E6PA 4F7MA 1TJGH 1W8NA 1A6VH 1FFNA 2EE6A 2F54D 3U36B 4BQCA 5IOPB 1QG3A 2VQTA 3JV0A 3O6ML 3JV4A 5L9DL 4P5KB 4H1LG 3RL2B 1JJUA 5SWZE 3MLUL 1I75A 2YSSB 5ESQB 5KJRL 1JTOA 4NM8H 4GW4A 2VDLL 4BQ6A 5DZNA 4GO6B 2JJTC 2Z31D 4IDJH 4KHTL 3JTTB 4MMXC 2CJUH 4GXUN 1INQA 3EYVB 3ARRA 4HZLA 3CCHB 3BOVA 1Y0LB 4XNQB 3SCMB 4I9WD 4KJWC 4LCWE 5I8OL 3MLVL 4QRSB 5CZVL 3MOBL 3QEQB 3VD7A 4KI5C 4M6NL 5I18H 4FFVC 4NQTA 4LIQH 5C92A 1CGSH 3EOAB 1ZOXA 3T4AB 3MRMA 3VGHA 3IDGB 5B38A 1ZVYA 4QRQB 3MOQA 3TN0C 3F6IA 3ILPA 3P11L 4Z8FH 4X6EA 2YA0A 1MFBH 3O9WD 2KKQA 3EHBD 1TVDA 3PL6A 5HHVL 2A6KA 3B5TA 2FX9H 2O5XH 4JREB 3KYMB 4Z18A 1KENL 2NYYD 1TJHH 2A6IB 3P3YA 5F71A 3SO5A 3UMTA 2X70A 5C07A 3VMOA 4E5XB 1QLFB 5DLMH 4P5MA 4KWUA 3X13A 4UT9L 3MRFA 3FT3A 1YY8A 2W9EH 1C12B 3HFMH 1ZGLA 4WU5B 2VLJA 3U36A 5E8NA 4H20H 5IOPA 5JHDD 2APWA 2J88L 4MYWB 2F15A 4P5KA 3LCYA 5B39B 4G8IB 5TDNB 2P1YA 2LU4A 3V4UH 3U0TA 2YSSA 5KVFL 5D7JB 4CJ1A 5D7KE 4X6DF 5I74C 4D9LL 4DEPC 1XGUA 1A0QL 3SKOA 5F8QC 2VLRD 1KCKA 4O2CB 5SX4I 4XX1E 3I6LE 4AEHH 3DGGB 1BREA 3CCHA 3ZKMD 3U1SH 1A3RH 1MJ8H 4QRSA 4K3EL 4Y2DC 2XYCA 2I60L 3Q48A 1CTNA 3QEQA 3ARFD 1DQDL 4WFGD 2Q20A 2EH8H 2EC9U 2FECI 3OL2A 4ALAL 3HE6D 15C8H 3EOAA 5DJAA 3T4AA 3QA3A 3V52L 3BWUC 3IDGA 1IFHH 1UYWL 5FXCH 4F7EB 5CIPA 2VR5A 4RGOH 4GMSL 4QRRB 3IS0X 1U91B 1FG2A 1M1SA 4ODTH 5E8DH 2K7QA 1MY7A 5BRZD 1ORSA 1WZ1L 2ESVA 2CRZA 4Y5XC 3QNZA 1DVFA 4UT6H 3NPSC 2WANA 3KYMA 3WNOA 3BP5B 1N8ZB 1TCRB 2GSIB 1A9EB 3H3BC 1QLFA 1S9WB 5TF1H 2YMXL 4LHUA 4PJ5E 1TQBB 2DJUA 3QEHB 4P4RB 2PR4L 3CSGA 4X6CB 3RVTC 1AR1D 1REIA 1C12A 1DQMH 2R56H 2VXVH 3GBMH 3AS0A 1UG9A 3ULUC 3QUML 3DO7B 5B39A 4G8IA 4JPKL 5C0BE 3N85H 1U42A 2JCCE 1NCCL 3MRDA 4OZGB 4UTAH 4I4WB 2X05A 5F1NB 3CX5J 1HHJB 2P8PB 4UNUA 4O2CA 4TSCL 4JM2F 4GXVL 5IJKA 5KTEH 1JNHB 2ADJA 5T1LD 1IQDB 4LRIA 6CGTA 1D5XB 2UYLB 5L8KB 3GZKA 1NEZA 4YE4L 5EG6C 4LSRH 3QXTA 4F3FB 5B3NA 4N68A 5ITBH 3CD4A 4W4NA 2XQBH 1BECA 3EUUA 3ZKSD 4H8WC 1SVZA 4NRYB 4D9RD 4DKFL 4WI6A 1CG9B 2GFBB 2HA1A 1EHLL 1ZLSL 3I3DA 3VFGH 4F7EA 3TO4D 1XFPA 5A3ID 5T3ZL 2V5MA 1U91A 4OF5A 1FAIH 1CXFA 4QEGA 4BSJA 4ACPA 4CN6A 5EUKB 4NDMA 4PREA 2Q8AH 3QQNA 1FRGH 1N8ZA 1TCRA 3UO1H 4HJJL 3OKYA 3W0WE 3MXWH 2DS4A 5F7HA 5E2VL 3QHZL 5GZNC 3QT2A 2AK1L 4ZD3H 1QR1B 3LHPH 2H6PB 1NLBH 5EIQA 1T22B 1YECL 4PGBB 3OKEA 4KK8D 4HMDA 1SYSB 1P7QB 2W9DH 3ZKNC 2F5AH 1N64H 2YD7A 3PWUA 5DD5H 5HI4D 2X4TB 5LCVH 4HWEH 1QEWA 2XTJD 2NLJA 1UM6L 2E7MA 1PYWB 2V5SA 4OJFL 3MO1B 5IMLA 1D5XA 1WAAF 2UYLA 3TIDA 4OLYL 3W11D 2D7QA 1YJDC 5IVXF 5DFVC 1JYVA 1ZA3A 4F3FA 1RJLB 2XRAL 4PLKC 4JQIH 2R1YB 5FCUL 4I3RL 3BAEL 4NRYA 3DROB 3ARSA 3O3BB 5K9OB 5KVEH 1FCCA 1CG9A 5F6IB 4BQ8A 1OOAA 3BIAX 5J13B 3HI1B 4MHHG 3HG1E 1VFBA 3PHQB 4P3CH 2AXHA 4YBQC 3P0VL 3O3AB 4TUKH 3UTPE 1ZANL 1A7OL 1NCAH 1KTKE 1ZT4A 2ZUVA 2EH7H 5HGBA 2EZ0D 4PJ7B 1FPTL 1SQ2N 3QUZB 2OP4H 2CUHA 1GOFA 1LP9F 1F4WL 2PXYC 1QR1A 1UZ6E 1AY1H 2H6PA 5DRXA 3T0EC 1T22A 4YPJA 4PGBA 4QXGH 2BXYA 4F7CB 2DM3A 3GSVB 1FC2D 2CRMA 2FB4L 5IP4A 3HZVB 4X7SL 4QTIH 4XPBH 1IILE 2X4TA 1EFXB 4YHOH 4OIIL 2EYRB 4F8QA 4QT5B 1MREL 4AT6A 2HMIC 4QNPF 4KH2A 1PYWA 1OAKL 2NX5E 4L4TD 3IDYB 1JGVL 5J57B 2VH5L 3E8UL 3H9YA 2B0SL 3DNKA 2OZ4L 4H88L 1YYLH 1RJLA 2R1YA 1LO0H 3DROA 5K9OA 5E00A 8FABB 5D1ZA 1GJIA 5D71L 2BRQA 3LRHA 4S1SL 2BY3A 2H3NB 3BPNB 1GGBL 1P69B 4PRHE 3VW3L 4YHNB 3VXTA 3QXDB 3HI1A 1JBJA 5C71A 2EYSB 1CZ8L 1VESA 3H2WA 4HS3A 4HKZB 3KLHD 1TETL 3CU1A 1NAMH 1U0QA 4ENEC 1J5OH 3RP1A 4L29B 4O4YL 4PJFB 2FATL 2YRPA 5IWLA 1KCUH 5EUOF 1YA5A 2B7DT 5DUPL 3QIBC 5E7BA 3LPGA 1D6EA 4YHLH 1PX3A 5H2BB 1H15B 3GRWH 4ZAKC 1SEQL 3WUWB 4E41A 2X4QA 3QUZA 4PJCA 1HYRC 4NT6A 1YDPA 4TULH 1IBGL 5C9JA 4J1UA 3BD5A 3BPOC 1A2YB 4KRPB 2XZAL 4F7CA 3GSVA 5ADOH 5IJVA 5ALCL 4NJAL 4PJ9C 4LMQI 3ALXA 1CK0L 4X9FA 1RUPH 4K94H 1JPST 2EYRA 3TT1H 4NUJB 4QT5A 3U0WH 3MNVB 2BY1A 1JPGA 4FQQB 2PW1B 3DV6B 4NQDA 5GHWH 3G6DH 4Q7DA 3ARZA 1I7UB 1SHMA 4IHOA 4HZAA 3MRNA 1KELH 1LD9A 2Y25A 4BQ9A 3X12B 3EO1A 2B4CC 4XPTH 3I75A 5CP7B 1RZJC 2H3NA 4M93B 1X44A 3HC4H 1EZVX 4DFIA 5JNYB 3QXDA 4OT1L 4RGNC 1GGYA 1GIGL 1UQSA 4HKZA 3D9AH 4APQD 2KH2B 3TBWB 4O5LH 1MIEL 4R26L 3RX5A 4LCCB 4L29A 3SBWA 1M7DB 1KJMB 1FHGA 2P46B 1HNFA 4MNGB 4X99B 5E6IB 4MVBD 4JVUA 4PBWD 5EU6D 5H2BA 1H15A 5HI5C 3WFCL 4R96B 3WUWA 4NHUB 5AUMB 4WTZG 2BXZA 2Y6SD 1T04B 2VSDA 3LVEA 4M7JL 3SOBH 4MXVF 1E28B 3HMWH 4GRLD 5KN5B 43C9B 5BVPL 4Y4HC 3G6JE 3LRSB 4X8JA 4XI5D 4PGCB 3IFLH 5EORL 1T1XB 5D1XB 4NUJA 4JKPL 3MLRH 3MNVA 5GGSB 3D2UB 4FQQA 3DV6A 3WMSA 5IMMB 3RL1B 4BK5A 3KPMB 4ODVH 4NQED 1I7UA 5EOQL 3WIHA 1PZ5A 4OLWL 3TPKA 4LLMA 2I07B 5CUSH 2X4UB 1NCDH 4ZOEA 1OTUC 1FGVL 3RY6A 2CLZA 3X12A 3DVFA 2AJUL 5MI0C 5CP7A 1I8MB 1B0WA 2F53D 1SBBA 3BRDA 4N90E 4Y4KC 3LKPB 1LK2B 1WZKA 1U3HB 2DQEL 5D2NE 3W82A 5EOCL 2GJZA 1Z9SA 5ICXB 1JPSH 3TBWA 3OXRB 1FFPB 3BQUC 4LCCA 3NFSH 1M7DA 2EDOA 2H45A 4R90L 1A7NH 4X99A 5GSVB 1FIGL 2AXFB 2BOBB 5GGTL 5IFAL 5F7EL 3KPRE 3WXWH 4R96A 2CO7B 3TM6A 5AUMA 3BP7B 1T04A 1VADB 4K7FA 1R5WB 1ONQB 2RJMA 3HE6A 2ZSVB 1OWWA 1I8KA 5TGBB 3QIWC 2GCYB 5KN5A 43C9A 2E7BA 4FQXC 2XWBB 1U2HA 4XCFH 1R3HB 4D0DB 2GTZB 4I1NB 5HD8D 5C6WH 3DX6B 5GS1C 3VA2C 1FCGA 1W0VB 4RMTA 3T77B 1ZTXH 1T1XA 5D1XA 2WBJC 3L3OA 3LEVL 2EC9T 2O61B 3RL1A 3KPMA 2VXSL 4F2MB 3MRPA 1H3XA 1PQZB 5DJ2B 1S78D 5DJCB 2EE2A 1DQTA 5HDQH 2I07A 5CSZB 3V6OC 1CR9L 5KSAD 1DLFL 5AYUH 4MNQD 1RZGB 3G5VB 4M6OL 4NRZB 1T0PB 3T04D 3HUJF 4MDIB 4Z7NE 1XGYL 5IW1B 3KS0H 1FJ1A 2YBRA 3LKPA 1LK2A 3LQAL 5J9PA 2YS4A 3QDAA 3V4VH 1UEMA 43CAB 5H37H 5INDA 4KMTH 2FD6L 4PTTA 3UBXI 2E9JA 3DARA 1FVCB 3OJVC 1FFPA 1VEPA 4RX4D 1VPOL 5BJTA 5DD0L 4HH9B 3O6FC 4Y16D 5GSVA 1ZWIA 5EDXA 4Z76B 4QOKE 2EKSB 4JFDB 1MWAB 3P0YH 5D9SA 4Z95H 1AQKL 1GGIH 1OTTD 4JJ5B 3RRQA 1YMME 2AK4D 2YEZB 4CVZA 4ELMA 2P5EB 3DVGB 4CU8A 1R5WA 3FB7A 3MPCA 1ONQA 3Q5YA 2ZSVA 5TGBA 3DXAE 4KTDL 4OLXH 4HIHA 5I15H 1RIUL 3SKUD 2XWBA 5F9WB 4D0DA 4PRID 4XP9L 1KCLA 3MMEB 5DD1H 2GTZA 3GK8L 3QEQE 6FABL 2HFEB 4J8RB 1NFDA 3VXRD 1M71A 3IDJB 1LEKA 1C8PA 4P3DB 1MIML 2CXGA 1G7MA 1N0XH 2XACC 4G9FB 2HFFB 1O0VA 3F12B 2BJMH 1S7XB 2JE8A 3E2HC 5DJCA 2VAAB 5J89A 3EJYC 4LQFH 1IC7H 4YUEH 4CJ0A 3GMRA 1KN4L 3D85D 5CSZA 4PJDF 4KJWD 2Q8BH 1RZGA 3G5VA 4NRZA 1HQ4B 4Z7WA 1WTLA 4FFVD 4JFOB 1DSFH 1N59A 4PGJA 4L9DA 4MB3A 1HHKB 1FVCA 3UC0L 3V8OA 1J88A 3TN0D 4LDOB 4JQXA 2A74A 2RQ8A 3S8WA 1CFQA 4HH9A 1G0YR 1QFWI 1QUNA 5SWSE 4LGPB 4U6VH 2MMXA 3H9SE 4JFDA 1MWAA 1X5HA 4MA8L 4P5TC 4MA7H 1EZVY 3VG0H 2YEZA 2VABA 3PP4H 5KBNC 3R8BB 4OFKA 2Y7QA 4P2RE 5I1GL 4X7CC 4KTEH 5GRUL 4OD3L 4YDKL 1DE4B 4OZIF 3RVVC 1MHHB 3JXAA 4NQCE 4LSQL 3MMEA 5IESL 2KDGA 1U93A 1KN2L 5JW3L 1F2XK 3Q5TA 2F74B 4NO5B 3CMGA 3IDJA 3MV7E 1T5WA 4KHXL 3MRIB 1SJHB 1FNLA 4G9FA 1BLNA 4Z7VF 3BEWB 1IGCH 4QRRE 1MJ7H 3MLYL 3CH8A 2DIAA 4B5EA 2XZCH 2C3WA 1G7PA 1IGMH 5FOBA 1IMHC 5CEZE 3HI6L 4OF7A 1UFUA 5TDOB 1HQ4A 3TBSB 4AG4H 4JFOA 2ZJSL 4GBXC 4P57B 2FO1A 1DL7H 1GOGA 4HH8A 5F3HB 4S0TD 3SDXB 3WDJA 2P45B 1NGWB 1JTPA 2AJXH 4PGEA 4X6CE 4DTGH 5ILTH 4K3GA 1NMCB 3BDXA 1E27B 4B53A 1MEXL 4PJHB 2I24N 4S1RL 4JCLA 2HLAB 5BXFB 4YR6A 2C7UB 4K55A 2FBJL 4RCAA 4JDZA 3VXPB 3KPQB 4F58L 3QXVA 5DQJA 4OZGE 3DYMA 2YOCA 5T1KB 5C1MB 4FQCL 1Y6NR 3RWCA 1NGQH 4OLVL 1INEH 5BMFL 3TV3L 1P5UA 1HOCA 3D3VE 4JANB 3RVTD 3NA4A 1OAXL 3GI8L 5DO2C 3TZVB 5GZOC 1AD9B 3V5HB 1UGNA 4CDHA 1MHHA 1P7KA 1EEUA 3ULUD 3S6CA 1RIVH 3NZHH 4WUUD 2F74A 4NO5A 1Z6JT 4G6AC 1D5BA 4TTDD 1SJHA 3B2VL 1LDPL 2W60B 3RWFB 4NP4H 3BEWA 1BGXH 1S8DA 4MXQD 1I1FB 2ZCHL 1ACYH 2FHFA 2VL4A 5ADPH 1ZGLP 4G80A 1P4IL 3EOTH 1FZOA 5JQ6L 5F3HA 2A77H 4BFBD 4NHCH 1NGWA 4PRNA 1L0YA 3PXHA 1NC4D 2VMFA 2NY6D 2HLAA 4FQJL 5BXFA 4KZEH 5DC0A 3VXPA 3KPQA 2AJVL 3Q5OA 5CWSB 1DJSA 12E8L 4KQ4H 4NKIH 3IDIA 3S4SB 1ULVA 4P49A 3C8HA 1HINH 4XHJC 1HDMA 2GTWA 3O4LD 1S9KC 2Y06H 4LLUA 4Y5VC 5CJBA 1CE1H 1IAOA 1YUHA 4KKAD 1WIPA 3HAEH 1FC1A 3TZVA 1YNLH 1AD9A 3V5HA 2F53B 4HGWB 3CSBA 4Q6IC 1IGTB 5A16A 5IW6B 4APQA 2NXZB 1JRHH 3UEZA 2GT9B 5AZ2H 3F7YB 5C0RH 3RIAK 2W60A 1OSPL 3RWFA 4HT1L 1NUFA 3RDTD 3RKPA 1IEHA 2PW2B 4HWZB 3V0WH 1DZBA 1MFDL 1EHXA 4WY7L 2J6EH 2EDTA 5EU6A 5TH2B 4UIMB 1ZS8B 4UI2A 5DFVD 3C6LB 1MFEH 4PLKD 5CEXB 3HPJA 2B20A 2NXYB 1I8IA 4BZ1H 4CGTA 3CSPA 4PJ7E 4HG4J 2DYPD 3ZTJG 3AXLB 3WSQH 2V2TB 4L1HA 1YNKH 4R0LB 4NGHH 2X4OB 1EEQA 4PJIB 1KXVC 1FGNL 1TZGH 4I48B 4X5XB 4DVRH 2HH0L 1H0DA 4V2CB 1AXIB 2FIRT 3S4SA 4NQEA 4L8BA 4XMLL 5FM4A 1N26A 1E6OH 2R29L 4C55A 3TFKD 2OX5A 3DMMB 2F53A 1B0RA 2PXYD 5F1KC 4PJGF 2MCG1 4A6YB 4XAWL 5IW6A 1GRWA 3B3IB 1U8KA 3MLWH 1FL5B 4J4PC 3WJLC 1E4XH 3F7YA 3VWKC 3MBEC 4M4RA 3C5SB 1NSNL 5IMKA 4KTYA 5C3TA 3WXVH 1JF1B 2IJ0C 2ZUSA 4MJ5A 4D0CB 4MXWL 2RCSH 4HWZA 1MHEA 5GRVK 4FQIL 3BN9C 2HRPH 2HMID 5FYKU 5TH2A 4UIMA 5CBAB 3LN9A 3VXSD 4CMMB 2IQ9H 2MSPA 4PJFE 1FAKT 1CXIA 4KJPC 2B2XL 3P4OA 4N9GB 1S3KH 5CEXA 5E2TL 5BW7A 4HCRH 5DJZA 5I1DB 2G60L 4NN5C 1FNFA 3BMWA 3U0PA 4K23H 1F97A 1MFCL 3LEXB 3IDUA 1I7ZA 3DYOA 3T1FB 2V2TA 3TT3H 3ALWA 4JO3L 4PJIA 1GZQB 4N8CL 1BHGA 5J11C 4OIAA 2VJXA 2P48B 2Q76B 4M1GH 4ENED 2VDOH 5CJOH 2J8UB 5FHAL 3KNBB 4YHML 1BVLB 4OM1H 4XC3H 4JDTL 1MCHA 2Y36L 3OKMB 2JJSA 3KPSD 1Q0YL 3OJDB 2N1KA 1WEJH 4XC1L 2VDKH 5KSAA 4G9DB 3VFSB 2HFGL 3D5OF 5KVDL 2Y5EA 1PG7X 4LLAA 1UZ8B 3RA7H 2JB6A 3L5JA 3FKUS 4Z0BH 1RULH 1MI5D 5F88B 4QXTB 3HMXH 2R8SH 4JHWL 1EFQA 4P2OC 2YUXA 1FL5A 1LNUB 4BUHA 4OM0H 5T5FH 3AS3A 3C5SA 4BSVB 2VQ1A 2V6HA 3ZLQC 4RX4A 4QLRA 1JF1A 1UH3A 4Y16A 4NWTH 4MB4A 1WFUA 4FTVB 5E08L 2J12B 1TIUA 2JB5H 4I5BA 5T3XE 5DMKA 2HTKC 1A4JB 4CMMA 1BJ1J 1J8HD 3PWNA 4MNGE 3ULUH 1TTUA 4ORZC 2V7NB 3WJJA 4L8SC 1VCAA 4QHKJ 3Q6FB 3CMOL 1JFQH 3BMVA 1TVBA 1WBXB 2IANB 3T1FA 3IFNH 5CGYC 1A47A 3RNKB 2XFXA 1CD9B 3LN4A 4Z7UB 4Q9RL 3VXRA 5B38G 2DDQL 2ZZUT 4MJ6A 3OZ9L 2Q76A 2JJTA 2WQRA 5DRNB 3RIAF 1NBQA 4S1QL 1A6TA 3WNPA 5EZLB 2J8UA 4HMEA 3AY4C 4FZEH 4HD9A 2VDML 1CFBA 5TJWK 1UB5B 4ONGH 2VN4A 5ICZB 1DDHA 2JK5A 3D85A 2C1PB 5I8CA 4RWYH 5F44A 2EKJA 4Y2DB 5HI5D 3MOAH 1IKNC 4U1HB 4M62L 3VFSA 3MUHL 1ED3B 4IJ3B 3EGSB 1G9NL 1UWXH 3SGDI 2B8OT 5GGVY 4M6ML 1GGUA 1UZ8A 1HYSC 4RFNC 1FNEB 4QXTA 5C2UB 5I17B 3C6SB 2P42B 2G75B 4PD4K 4K7PX 1LNUA 4HKXB 4DAGH 1AHWC 2DF3A 4BSVA 1RUQL 3FN9A 3TN0A 4O9HH 4YFLI 2IG2L 4LAQH 4FTVA 4IRZL 5I1CL 2RBLA 4NBZB 2X1XR 4YXKH 3DRQB 3L1OH 5EWIH 3NPSB 1A4JA 4CMHB 4TUJB 1RUAH 1AXTL 4YLQT 3SDAC 2V7NA 4JFEB 3ARGC 4L4VD 1QHPA 1MAKA 1OTUD 1EO7A 3WFDL 2CRIA 2IH1B 3RU8H 1TENA 2YC1B 1WBXA 4K3JH 4PPTA 3IKCB 4D9QD 3RNKA 1MOEA 4Y4KD 5HGHB 2QLVB 4WUUB 3FO2B 1ZLWK 4LVNB 4Z7UA 5E2WL 3RWEB 2GK2A 4ELKA 5I73B 4LDEB 3JVGC 1YMHB 3D0LB 1BFVL 2C3XA 2NY2C 5DRNA 2EEBA 3IAGC 4X7FC 3GMNA 3V79C 1QFPA 5JA9A 1UB5A 5JLZB 2DQUH 3GGWB 5C09B 2Q86B 4Y2DA 1KC5L 3C8KB 4U1HA 2FLRT 4U0QB 3UPCA 3LMJH 2E9IA 1MVFA 3NAAH 4LHUG 5FYLD 4WFFE 1DBMH 3RIFK 2ZPKH 4NKOA 2X42A 4GG6E 3PDDA 3X3FL 3SE9H 5HYSB 4LARL 1FO0H 1P53A 2VWEE 3ES6B 5I17A 1ZT1B 1YPZB 4FQXD 2G75A 4HX1A 4HKXA 3BDBA 4YHYC 3RJQB 5B39G 2E7CA 3C08H 5I19H 1ZVHA 1JIBA 2BX5A 4M48L 4WHYH 2XA8H 2WBJD 3TIEA 1F4HA 3DUUB 4JEGB 4N0UB 4DN4L 3PXJA 1CTOA 3DRQA 4Y5XA 4XVSH 2D0HA 4JN2A 1KGCE 4NC2B 5MEND 2AKRA 3VMPA 3U2SB 3OAUL 1T4KA 3P4MB 4TUJA 4XVTL 3BE1L 5E70A 5IMOB 2FHBA 2VR4A 5GRZA 3VFMB 1NEZG 3BGFC 1K2DA 3DHJA 4OF6A 3PWPD 1T1YA 3NA9L 3QXWA 5DA4A 1X5IA 2YC1A 2VYRE 5MHSE 5KVGH 5I71C 2PN5A 4ODUA 4ZYKB 4WUUA 5FGBC 3GI9L 2P5EE 3FO2A 4D8PB 2YD3A 1JGUH 1BBDH 4FG6C 1IGFL 3GBNH 1W8OA 3D0LA 5EIIB 3S98A 3L7FB 3I9GH 4TOYL 1OWRM 3TYGL 4XBGA 3O6FD 1Q94B 5CEZL 3K46A 3WL9B 1HH9B 4OUUB 2KZ1B 1HE7A 2IF7A 5JLZA 2BZDA 3GGWA 3PF2A 5C09A 3C09C 2Q86A 4U1IB 5HHXL 1GXEA 3C8KA 1QLEH 5CEYB 4LPTA 4G9FE 4F7PB 4Z7QE 1EH9A 1D6VL 1JZ4A 1O7VA 2QTEA 3BSZL 1NAKL 1J12A 1B2WH 2G2RB 4I77L 5DJYB 2GEEA 1KIUA 4JKLA 4MWFB 2MJWA 4P9HL 3MV8B 4OLZH 4H5SB 1KBGL 4NZDA 1NC4A 4R97C 1AO7D 1U92B 1AE6L 2BC4B 2A6DB 1X9QA 3VG9C 2F5BH 4OIBA 3DUUA 4I3SL 1CBVH 4ZXBC 4MX7B 1VEOA 3QPXL 4X4YB 2XQYG 2X09A 2KQNA 1JYNA 3V9FA 3HC0A 2R2CA 3O3EA 1NANH 5IMOA 3WFEH 1TQCC 1MFAH 2AJZA 4XVJH 1HIMH 1RK1B 5TE4L 4Y1AD 3DSFL 4QTHA 2OTWB 3VXNA 3H3KA 1JGLH 2F8XC 3T0EB 2XKNA 3GO1L 1UACL 4P48A 2BNUB 2OJZL 2AGJL 4LLVB 4L3EE 4Z0XA 2DQFA 1G7IB 2BY0A 3MX0A 4O2EA 4JRYD 3VGBA 2BHUA 5BS0D 2EDXA 3WL9A 4YFEA 1HH9A 4NJ9H 3BYTA 4OUUA 4QWWC 3QCTH 5IBLC 4KQ3L 4P5TD 3QEGL 5CEYA 2UUDK 1S9VB 1U8IA 4M5ZL 3NIDF 2N7AA 5D2LB 5I1JH 4Z7OF 3V7MA 1X5JA 3PP3K 2G2RA 4V1DB 1K4CB 5DJYA 1PEWA 4MWFA 4ZUWB 3MV8A 2R4SL 4GKNA 5KSBB 4XB8A 3A6BL 4H5SA 5ETUA 3UJIL 3JV5A 4HC1L 2A6JA 3K8KA 3MV11 5HJ3B 5EZOL 4NFBA 3SDXE 1YEKH 4YX2H 4JFXB 4MX7A 1G1CA 4L5FH 3I2CL 4UUJB 2DQIH 4X4YA 4RDQG 1LILA 2I26N 3UBXB 4DGVL 1MCRA 1I9IH 1BWMA 4PJHE 4HUUA 5IB1B 1JYXA 3QIBB 3SDCC 1CDBA 1D5MA 1RK1A 1JHTB 4K7PY 4ZAKB 3VRIB 1ADQL 5JQHC 4OQTH 5ITFA 2OTWA 2COQA 2YRZA 2X9XA 1FZMB 3FN0H 1BM3H 1I9RL 1NUNB 2PXYA 4GBXD 4OBRA 4U3XA 3RIFF 1XGTB 3T0EA 1HHIA 3BPOB 1UM4H 3SKJH 4FNLH 2DWEB 4LLVA 1RU9H 4LU5H 1CLCA 1G7IA 4PJ9B 1UVQB 3HZMB 3GSUB 4F8TA 1GZPA 3U30B 5CJXC 2UV3A 3UPAA 1WBYB 5GGQL 5GGSY 4DGIH 5I6XC 2FJFA 1S9VA 4HUNB 5D2LA 5C0CE 1KTDB 3S36H 2MCPL 3KXFE 3HNVH 3VI4E 4HPOL 4ZUWA 5DO2D 5KSBA 1L7IL 5SV4A 4X5LA 3MRLB 4HMCA 4RGNB 2VLKB 5F96L 4YHKH 2R0KH 1NEUA 5HJ3A 4G6AD 3DECA 5E9DB 4DK3A 1PY4A 4OSUH 4N9OB 2DQCL 2ORBH 3GNMH 5IB1A 2R4RL 3QIBA 3LSOB 4HUWB 3FB6B 3VMNA 3JUZA 4EJ1C 4ZAKA 4JGJA 1G1YA 4QRPE 1D5IH 5EO1B 1FZMA 3S7GA 2P24B 1XGTA 2BVPB 5GRWA 5F9DC 1MI5A 5FF6A 5DFTA 1NDMB 2DWEA 5IT2L 1RAMA 4Y4HB 1UZ6F 4PJ9A 1UC6A 1PG7L 3PUCA 3SDDC 5I1EH 1MCNA 2FR4A 5JW5B 4U1SB 4NN6C 5HPMB 3EYSH 5DVKA 3CDCA 1WBYA 1AGDA 5BZWA 2XWTB 4YGVB 1H3VA 1R3IL 2D7OA 1G0DA 3KPLB 3DSNA 1G9EA 1KTDA 2DQHL 3WUWG 4FZ8H 3CLEH 4XWOC 1Z3GH 1ZK9A 3FQUB 1OM3L 2B1AL 5CFHA 5KS9A 4P0DA 1T0MA 5LXGL 4ZOBA 4Y4KB 2V2XB 1K5NA 1WWAX 2AJYH 4PGZA 1J1XH 4KJQC 5E9DA 2KPNA 3RVXC 3BQUB 1H3PL 1V7NH 4GW5B 3MREB 1P84J 1IAIM 4OTXL 3MGTB 4ZUUB 1CFVH 4HQQH 3LSOA 2D7TH 3WIHL 3FB6A 3QO0B 3QIUB 3PGDB 3QDME 5EO1A 4DVBB 5DEGA 2P8LB 1U3ZA 3MGAA 2P24A 2BVPA 4QHNB 5FYKH 5EOCJ 4JFFE 4ZFZB 3QIWB 3V5DB 1CD1B 4TNVK 1NDMA 3ZDXE 1FLRH 1RK0B 3R06B 1EO8L 4Y4HA 2MPAL 2DQTL 5T3XL 4LSSH 4HWBH 4KK5C 1QQDB 5JW5A 4GRWB 2GJ6D 1F5WA 2NW3B 5DVMA 2YKLL 3HI5L 2R9HD 3OWEA 4IRSB 1QYGL 4K7PL 1EMTL 5FB8A 4YGVA 1GC1L 4NCDA 4YHIB 1HSBB 1KCVH 1KTLB 1EGJH 1MCKA 4L4VA 2R1XB 3FAXA 4JZOB 4PS4H 4TRPL 3TWCL 3VFNA 5IBTH 3SE4C 1YY9C 5DZOA 1RPQA 4Y4KA 2V2XA 2GK0B 1GPOH 5T3ZD 4KDWA 3HLAB 1BAFL 4WI9A 4J4PD 4OUOA 3TH2T 3UYRH 3TEUA 3MBED 3ARWA 3BQUA 5JXED 4KY1L 4X4XA 4GW5A 1C08B 3SO3C 1A64A 5JZ7C 1MNUH 4PBXA 1NJ9A 3AUVA 5GS0L 4JY6A 1NCNA 4PYGA 5DMGC 1LO3H 2BCKB 4LHJB 1FDLH 4HPYH 1MRFL 3TPUB 1UKSA 1U8NA 5C08D 2EDKA 2P8LA 5D7LD 3QFJB 4QHNA 3RWDA 3MRJA 3ZSTA 2A9NL 2YN3A 3QIWA 1CICC 1QZ1A 5HXMA 2JJUA 4MJIB 4FQXA 3QUYC 2C1OA 2KL6A 1I7RA 5EPMB 4RMVA 5GS1A 5I75C 2QADC 1QQDA 1U8MB 3BI9X 2WBJA 4OZHB 4KKBD 1GAFH 5JPNB 2L0DA 1NGXB 2Z93B 2YPLE 3HKFA 5MENA 2CIIB 2PO6D 5JHLL 4YHIA 3ELAT 3MRHA 1II4E 1BD2E 5FKPB 4P59L 3O6MH 3P4NA 4MGXA 4JAMB 2C4XA 5L9DH 3V6OA 5TFSH 2R1XA 4JZOA 4NWUL 4RGMC 4ISVB 5KJRH 3P9LB 3CPLB 4HKJB 4QRTA 5C6TL 2HN7B 3GM8A 4KHTH 2VB5A 2UWEA 3L3GA 4EUPB 4P2OD 5KZCD 4XGZB 1HHHB 3GUTA 2FX8L 2QL1A 2P5WB 5L2KB 1WICA 1OP9A 3OF6A 3VFRA 3B8YA 3VFUB 1BQLL 4LLQB 4HULB 4BFGA 5I8OH 2IANE 1NBYB 4HIIA 4JRYB 3O6FA 5BS0B 5CZVH 3MOBH 4CADA 3QUKA 1AIFB 5IUSA 1MCQA 4JY5L 1QSED 4HJ0C 1UB6A 2XICA 1A1NB 3BPLC 2HTKD 4KDVA 5EA0L 4JGMA 1URLA 2VZUA 3U6RB 2ZKHL 5F9OL 3QFJA 1C5BL 1MVUB 4YQXL 2PTVA 3P11H 4M8QB 2AAVA 3VXUD 2Q7YA 4P4KC 3TF7C 3BIBX 4QF1B 4UT7H 1I4FB 1L9MA 4JR9L 3REVA 5HHVH 1KG0B 3CGTA 5EPMA 5E24E 4UMGA 1AO7A 3MRRB 2NZ9C 1C16B 1U8MA 4OZHA 1WF5A 3TBYB 2M2DA 5JPNA 4Q2ZA 2VRAA 1F3DJ 4ZO6A 5FGRA 1NGXA 4MJ4A 1N5YH 3NTCL 2OCFD 5DUBA 5IGXH 1MWAL 2CIIA 4XCYB 3ZL4L 5BO1L 2J88H 1V8HA 2ATKB 1RJYA 4PB0L 2BFVL 5KVFH 4WFED 4ISVA 2HKHL 2BVOB 5TE6L 2GITB 3P9LA 4X4ZA 3CPLA 4HKJA 4Y1AA 5BCAA 1JPTL 2XQYK 2HN7A 1A0QH 5ANME 1HYSD 1NANI 4ZUTB 4J3SA 5C8JB 3QHFL 4JFEE 3K81A 4EUPA 4TNVF 4XGZA 1HHHA 4UIKH 3WE6B 2HFTA 5CD5D 1A6WH 5L2KA 1T1WB 3VFUA 1A3LL 4BYHA 3VFVB 4K3EH 4JRYA 2I60H 5BS0A 4HIEB 5B4MC 3O2DA 4PJEA 2SEBA 4N1CA 1LO5A 4P5TA 3N1QC 3V52H 1XF5B 4U1MA 1UYWH 2D9CA 5HYIA 1BVKB 5GRYA 5J4MA 4GMSH 1VA9A 4LMQE 2VUYA 1WWBX 3UPRB 4OI9A 4JFHE 2C9AA 2H2PC 1CU4H 3IS1X 5EIVA 4QF1A 4G8GB 1I4FA 2DKUA 1KG0A 3ZDYF 1R6VA 1DANT 4DZ8B 1TMCB 1QLRA 2NY4B 3EYQC 1WGOA 3O8XD 1WZLA 5DVNA 2FYYB 2XZQL 3TBYA 4FA8A 3FFCB 3MFFB 1WBZA 5D5MA 1YPZE 1N2RA 1NMBL 1S7SA 4XCYA 2P7TA 5D93C 3S88H 4PJXA 1IAKB 3O45B 4YIQB 4PR5B 4NUGL 1MLCB 3QUMH 4QRUB 3EYUL 3NFNA 3NACL 4N0UE 3WFBH 4HFUL 4N5UA 2LV4A 4EVNB 3NMEA 4B41A 2GITA 5D6CB 3MV9B 3O2WL 3QZWA 4NO0D 4G43B 2Q87A 4H1LA 4GBXA 4ZUTA 1KIQB 1X5YA 4TSCH 4DCQB 3OSKA 5C8JA 5HHOD 3QB7C 3PWJB 4TVPE 2QHLA 3TVMD 4PJAA 3WE6A 2OYPA 1N3NA 4C54A 4WHTB 1NC2B 1YNTB 3MRBB 3QWRD 4YE4H 5DK3A 5IB5B 1KSRA 3RNQB 5HHNA 1QHOA 3UTTE 3QDJD 4UB0L 1IAIL 4PY8I 4WV1C 1MCFA 3CH1A 4DN3H 1BVKA 1VGEL 1G9NC 2EDQA 2UZYB 5T3ZH 3RX8A 4BK4A 3KG5A 3QP3A 3UPRA 4KKLC 2LU7A 3EBAA 4J3OC 1CIUA 1M6OA 3FO1B 2Y07L 3GMQA 4G8GA 3CVHB 2NCMA 3HR5A 3PDGA 5EZIL 4DZ8A 1NCUA 4LPCA 4HLZG 5I0ZA 4ZTOH 4FG6D 3KPPB 4QY8A 2EYTB 5LWYL 3FFCA 5D8JL 5ISZB 2YN5A 3G5YB 1PKQA 2JIXD 3H8NA 2MKLC 1IAKA 3O45A 3QHZH 4PR5A 3SCMC 2AK1H 1OLLA 4XP6L 5IFHL 3U83A 1MLCA 3IXTB 4QRUA 4LNRA 1YECH 5IQ7L 1W2KT 1T2QH 4EVNA 5D6CA 5CHNB 3LEYL 4G43A 4NNPH 3HC3L 3VI3F 1HILB 1KIQA 3K2MC 4DCQA 2FX7L 2MHAB 5EC2B 3O11B 2VKXA 3OXSA 2WUBL 4IMLB 4L8DA 3TBTB 4XT1C 1EXUB 1I3UA 3MJ9L 5DURD 4WHTA 4OJFH 1ZGLM 3RVUD 4BJLA 4LCWD 4ONFL 3UTOA 4FMFA 4AIZA 5IB5A 2YD6A 3RNQA 3RZCB 1DEEA 2PCPA 3GB7A 4X0KB 3BKYL 4I3RH 5FCUH 3TO2A 1UKTA 2AW2A 4I0PB 1S7WB 5DHVH 1HQRB 4GW1B 4MAUL 4BFIB 3M1BB 3U82B 1XF4B 4YC2C 4Y5VA 3X11A 4YXHL 4CN1A 3M8OL 1EHNA 2NY3B 4NKQB 3FCTA 1DBJH 1QRKA 1VACB 1DUYB 3FO1A 4BZYA 3P0VH 1G9MC 1CVSC 3CVHA 3CFDA 4PV8B 2IPTL 4RMRA 5C0NC 3LZFL 1Z5LB 1CI5A 5D7JC 4WHDA 2PTUA 1MRCL 4PJ8D 3KPPA 5E8PA 1UXWA 4V1DE 2EDJA 3VWKB 1MELA 3G5YA 4KPHL 5GQBA 3EZJB 3IJSB 1HZHH 3NPZB 2R2BB 2W0LA 4DZBA 3P4LA 3PHOB 3RJDA 4AM0B 4NQSB 5F3BB 5IBLD 1CFTB 3IXTA 2HG5B 4XBEL 3S4SG 5FUZL 4AH2B 1HI6B 3NIFF 5E4EC 2WZPD 5CHNA 2ADGB 3CXHJ 4E42B 1GHFL 5D7KD 4X7SH 1HILA 4KRLB 1FG9C 2MHAA 4NN5B 4IMLA 3TBTA 3I6LD 4FFZH 1MREH 5F7KC 3K2UL 1EXUA 4MQSB 5HYJB 1PY9A 1IZJA 2FECL 3OX8A 1JGVH 3M17A 3E8UH 1NFIB 1YN6A 1J1OL 2B0SH 5J1TC 3WKML 4WWKC 2OZ4H 4H88H 2WWKO 3RZCA 2GJ6A 4X0KA 1IEAB 1TVHA 4R6UA 1TCMA 3P0GB 3FOMB 1S7WA 5TDPA 1HQRA 4GW1A 5D70L 1V3JA 3SE8H 4BFIA 1XF4A 3SDCD 3VW3H 1FVDA 1A7PH 3K80A 4CUCA 3QJFB 5F21B 2GUOB 4RRPA 3F8UB 1CZ8H 5DFWH 5I16B 3FB8B 1VACA 4YDJB 1DUYA 1TETH 5KSUB 4GT7A 1J05B 4RDQF 1I85C 3OKLA 4HF5L 4YDIH 3RKDD 8CGTA 4O4YH 4ZTPL 2FATH 3C60B 1Z5LA 1OP5K 3HCVA 4R7NA 5DUPH 1K3ZA 4J4PA 4J3VA 1F90L 3WJLA 3CDGA 2PYEB 3VWKA 3MBEA 3LS5H 4RAUB 4PJ5D 4Y89A 1AGFB 4OI8A 1F6AB 4YBHA 5IHLB 2BSTB 1SEQH 2R2BA 3FQNB 3PHOA 2VLKE 2W91A 5EC1A 1IBGH 4YWGH 3AS2A 2HG5A 1EJOL 3VRJA 4AH2A 3D69A 3ZKXB 1XF2B 2XZAH 4HK0B 3QJHB 2ADGA 3RUGB 1CYGA 2H2SD 3L3KA 1CK0H 3U7YL 1I9JL 4F57L 2CKBH 1KNOB 3WDIA 1AKJD 4A6YL 1D9KC 4LCUA 2W65B 5IEKB 2BMKB 1JF5A 5HYJA 1NFIA 5JIKA 3W81A 1QSFB 1ZLVK 3B9KB 3X14B 1IEAA 4LVEA 4OGAC 4PJCF 4OGXL 4BKLB 5AG8A 3FOMA 3DHMA 2H41A 3FQTA 1T1ZB 2H32A 4MNHA 3IFPB 1J7VR 5CINL 2DQGH 4UQ3A 1T3FB 5H94A 3QJFA 1KLUB 5HDLA 1OPGH 1QSZA 4ZO9A 3EJJX 3JTSA 1FE8H 2JJVA 5D7SL 3V5KB 1J05A 2CO6B 1S7RB 4RFNB 1T7ZA 2R23B 4P2OA 3HNSL 1QPPA 1M7IB 5DC4B 1AGFA 3SDDD 5GXBB 5E03A 4HUXA 3WFCH 3D39B 3HTLX 1DBBL 5HDOA 2DM4A 3THMH 1F6FB 2H26B 1XF2A 1ZVSB 5BVPH 5F6HI 3SDAB 2OL3B 4L8SA 3ARGB 5F6IC 3S96B 5JMOC 4LQ1A 3VXUA 1KNOA 5EORH 4JCMA 3FMGL 3TBVA 2QEJA 1INDL 3L7EA 4JKPH 1G7LB 2W65A 5IEKA 1ZEAL 1LGVA 4HKBA 5DYOB 2XPGA 2IGFL 4WEBL 4JPIA 4KJQD 3CXDL 3X14A 2NY2B 2NY1D 3J7HA 3GKWL 4BKLA 1FGVH 3MLTB 3AY4A 2IAMC 3F7RA 4XZUA 3D6GA 4ZNCD 3AB0C 5JA8B 3F7QA 3CDFA 4WJ5B 1T3FA 5JHDE 4ZDHB 4GRWE 4W70A 2QSCL 3F7PC 1JZ3A 1IKNA 2IQAB 3HG1D 3ARDD 1CGTA 4G7VL 4JB9H 3MNZB 4WVRA 4WO4B 4XCCH 1S7RA 4R4BB 3UTPD 2I27N 5GGTH 3T3PE 5I1AB 1SBSL 3GHBL 4YHYB 5IFAH 1M7IA 1JPFB 4Y19E 3RGVD 4WDIA 3SQOH 4X83A 3IDYC 2BVTA 4XPHL 1JNLL 1KCSL 4M03A 3LB6C 3GJFB 1R24B 3LKRB 4LL9A 1MHCB 1ZVSA 4I2XB 3SDAA 3PIQB 2OL3A 3AVEA 3ARGA 5J7CC 1BOGB 3BGFB 3S96A 5FGSA 3E6FA 1IM9D 1MCPH 3Q3GB 3MJ7B 3BPNC 2VC2H 4WW1A 1CLYL 1G6RH 3LEVH 5C0AB 1G7LA 1BMGA 5BRZE 3K1DA 1YY9D 3SDYH 4ZPTB 2R1WB 2NX5D 2NY0B 3CIQA 1RIHL 2VXSH 5DYOA 2YR3A 2XY2A 3JVGA 1CR9H 4MJIE 5C2BL 3WFHB 4EI5D 5JZ7D 2X4RA 1XGYH 3VFPB 3D0VB 5D4QA 3JWDC 4PRHD 4WJ5A 3LQAH 4ZDHA 5DMGD 2ZUXA 1Z0NA 4LPYA 5SWZB 2WV3A 2FD6H 1J1PL 2DI8A 3MNZA 1RJZB 4NN7B 2HVKB 1VPOH 5DD0H 1CICD 4PTUB 1F4XH 3GSNB 3PGFL 1YEEL 5KANG 1V3MA 4R97B 1XH3A 5BVJB 4M7LL 5GGUB 1Z2KA 2QADD 2VDRL 2EECA 3VG9B 1U8QB 4ZXBB 2DJ4A 5MEPA 1W0YT 1MAML 4F80A 2J1KA 4D9RE 1IM3B 3VJ6B 4KTDH 2EE3A 2P5WE 5LGKA 3GJFA 4KROB 4WTZA 1RIUH 5FGCE 1MHCA 4I2XA 4U4BA 3B6SB 2OQJB 3PIQA 4XP9H 1HEZA 1BOGA 3GK8H 6FABH 5JIHA 3L3IB 3Q3GA 3MJ7A 1XCTB 3QI9D 1SY6L 3MRGA 4K71C 1MIMH 3TA3B 4OLUL 5FGBA 2FZ3A 2HT2D 5L0QC 4KKCC 1KB5H 4UNVA 2UZIL 4KXZH 5CSGA 3SGEH 4KRMB 1KT2A 5FA4A 1DQLH 5E6IC 4ELMF 3I02B 2WUCH 3I50H 3CK0L 1GC1C 3K8LA 3VFPA 5TE7L 4M3JA 4FXGA 2M8XA 1F11A 2OM5A 2J4WH 3WO4C 5SWZA 3RTQD 3A67H 4TVPL 4HUKB 2EDWA 1MQKH 1XIWC 2LABA 5HHQB 3H42H 3U4BL 3UC0H 1ZT7B 1NFDF 2BHYA 5DS8A 3NVQA 3IU3A 2FO4B 2CIKA 2LTQB 3T08A 2YUWA 4PTUA 3DLQR 5JOEA 1XF3B 1AGCB 2CJUL 2XTJE 2FNBA 4MA8H 5BVJA 5JDSA 1IGJB 5GGUA 2C3GA 1ZLWH 5C0EA 4Y4FB 1U8QA 4ZXBA 4ZFGH 1HNGA 1JWMA 5GGTA 3GSWB 2OSLB 4NZRL 5I18L 4TSBH 1IM3A 5GRUH 3VJ6A 3ZE2E 4YDKH 4Z7WF 4YHPA 2ENSA 4GFTB 2NMSA 2DI9A 1EVTC 1NDGB 2OQJA 5IESH 1QO3A 2WLZA 1XCTA 4Z8FL 1N6UA 5C0IB 3IJYB 1U3HC 4KHXH 7FABH 4U6XA 1A4KB 4MHHI 4JM2B 3OPZL 4POZC 2NW2B 1KYOJ 4ODSL 1WCBB 4G6KL 2ZCLL 4GS7B 1F42A 1LHZA 5JW4R 4JFZH 3I02A 3DX8B 3STLA 5AWNH 4IOIB 3HI6H 1BEYL 2EDFA 3C5ZD 3VD5A 2ARJB 3OV6A 5K33A 1DN2A 5B4MD 2ZJSH 4N90D 2X9YA 4O51B 1G7QB 5JTWA 4H20L 2QHRL 2GAZB 1S9XB 4OCSH 4AQOA 5C0BB 1JZ7A 1FO0B 1QA9B 1J87A 1Q9LB 2JCCB 2NZIA 3HE7D 5CLTA 4K9EH 3CFKB 4JHZA 1ZT7A 1MEXH 4S1RH 4I18B 1VFUA 1PSKL 1AQDB 2H2PD 1RMFL 1WUNT 2V9RA 1P4LA 2VXUL 5JIIA 1AGCA 1OVZA 5D7IF 4F58H 4EBQL 3MV9E 4L4TE 1A3RL 3ULVE 3BGMA 3EYQD 4FQLH 4FQCH 1UH2A 4G6FB