3PE3A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
701
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 268
structure length 701
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe3A03
2WQHA 3COPA 3MV2B 3CEQA 2QFCA 2QRGA 4LEIA 1RZUA 2IEIA 4GYWA 2BGUA 1P4HA 4RBNA 4PQGA 3ASHA 3WC4A 3C4VA 3MSCA 2J9QA 2O6LA 3AS8A 4I17A 3U3WA 3OXGA 4BTAA 4GYYA 4CGVA 2QRMA 3S28A 4YVQC 5DU2A 3CKBA 2XGSA 1FS4A 1OUVA 2JZCA 4ME2A 3S7FA 3RO2A 4BWRA 1ELWA 3MS4A 1FA9A 3HBJA 1A8IA 1WV0A 4MI6A 4GCNA 2IYFA 3RIBA 2XMPA 2QRHA 3OY2A 4X6LA 4LEUA 2BUGA 2FI7A 3JYSA 1XOIA 3LY8A 2ATIA 4J8FA 2FBNA 1Y8MA 2KC7A 2GPAA 2XCCA 4UQYA 1FU4A 3H4IA 4NRHB 1B89A 2XEVA 1Z62A 4HOUA 4F97A 2QNBA 2HO1A 3QHPA 3DZCA 3ZCPA 1GFZA 5BNWA 5FJYA 5KJNA 4RG9A 2X6RA 3PDNA 2KATA 1XV5A 4XI0A 5D01A 3E3NA 4M7PA 2QRPA 5I45A 1FC0A 2VYIA 1TJCA 2C1ZA 1WUYA 3RSCA 3UYKA 1NZDA 3RU0A 4I2ZA 5G05J 3R9AB 2C0LA 3CUVA 3LY7A 2LSUA 4I1AA 3OKAA 4BQEA 4N2QA 2Y4TA 4CDRA 4MI3A 2R68A 5FT9A 3BCRA 1Z6PA 3CKCA 4CGWA 1FU7A 4N9WA 4N39A 4WADA 5M72A 2C1XA 3G2LA 3S29A 5JTUA 1WW2A 3TG5A 4GPBA 3KAEA 3GZ2A 4YNDA 2VGXB 1O6CA 3ESKA 5DBKA 3CUWA 2GM9A 2GEKA 3VDNB 5KJLA 2VCHA 5FZRA 4O6FA 2GEJA 4X7PA 2X6QA 3ZN3A 3D0RA 3H4TA 3RJVA 5KJMA 3QKWA 5TMBA 1GPYA 3S27A 1B4DA 1PC2A 3VUEA 1V4VA 1XC7A 5JJTA 2IF4A 5A7DB 1FCHA 4NEQA 3LPZA 1Y8ZA 4KQMA 2H1FA 3Q3EA 3QKYA 2HYZA 3MQFA 4B94A 1AXRA 5EX0A 1YA6A 3UQ3A 4RIIA 3LYAA 2R5SA 3ZCTA 3VDMA 3BEEA 3K9IA 3L01A 2C4MA 2QZSA 3OKCA 3UPVA 2QLMA 3BDAA 2AVPA 3BEOA 4N3AA 3U4TA 3MS7A 2QN2A 1AHPA 1L5SA 1UZUA 2YJNA 4KYOB 4G2VA 3RSZA 1LWNA 4YUAA 1UQUA 1NZNA 2BGTA 2F3QA 3L7BA 3FWVA 4U07A 2ZB2A 4A1SA 5BW8C 2VCEA 4QLBA 1WW3A 1XNFA 2KCKA 3MT9A 4WHMA 4BFCA 3EDTB 2PL2A 1JG7A 4G24A 3HBMA 3ZCUA 3Q5MA 4GPKA 4X7MA 3NP9A 3CK7A 3MEKA 1XKXA 4AIFA 3O48A 3MTDA 4U0UA 4HOSA 1C8LA 4GYOA 4BQIA 2IEGA 2ACVA 3FP3A 1A17A 2GPBA 2FEZA 3CUUA 2ASVA 5GPBA 1PSWA 2YQ8A 2XPIA 2R4TA 3KD7A 4FZRA 5LQDA 3ASDA 1PNVA 2XA1A 3DD1A 7GPBA 3GUHA 3FFLA 8GPBA 3OTIA 2JJMA 5DXFA 4CTNA 2ACWA 4N2SA 2F3UA 3Q4AB 2G9QA 4J8EA 4G25A 1L5VA 1JEJA 2UY1B 4JL0A 3G2NA 3S0JA 1KLXA 3GZ1A 1SXPA 4Y6CA 2UWJG 3L7CA 3ASGA 3CV0A 1WM5A 2L6JA 3CEMA 4U0SA 5G05C 5HI7A 3RO3A 4WNEA 1IYGA 4GCOA 4UQZA 5CCLA 5TMEA 5C1DA 3T3GA 4GA2A 3TOVA 4EJ2A 3CVLA 4NQ0A 4FKZA 4KBQA 3CEJA 2QN8A 3ZGQA 3CK9A 4F9FA 3UUXA 2FO7A 3VTYA 1EXVA 1IXYA 3OTHA 5LCWC 2QN3A 5D00A 4G1TA 2FFRA 2FF5A 9GPBA 3MV3B 4WNGA 4MRAA 3GW4A 1L5RA 2IV7A 3LCAA 3QWPA 1KT1A 3RT1A 5BT1A 4I9EA 2PZIA 3NPAA 2VGYA 1M5RA 3C4QA 3NAZA 2Q7FA 2R66A 5IKPA 4YVOA 2VGXA 3D0QA 1WV1A 4M60A 1SXQA 4APOA 4GZ5A 2PQ6A 3G2JA 2FETA 1QKJA 3Q3HA 3Q15A 4GA0A 2Y4UA 3IA7A 4RIEA 3MTBA 3LY9A 3HBNA 3HYMB 2H1HA 3T3HA 2QRQA 1QZ2A 3SYRA 5ENZA 3L79A 1EM6A 4WNFA 5IKOA 4W9RA 5D0QD 2XCIA 4IN3B 4J8DA 3MBOA 3CVQA 5TMDA 5TVGA 3ZFWA 4JA7A 4BQFA 2Q6VA 1NOKA 1YA0A 3MS2A 3RKVA 2R4UA 1XL1A 3E3OA 2GJ4A 1NOJA 3GPBA 1J39A 1XL0A 4X7RA 3ZCVA 4HORA 2VSYA 1BX3A 3DDSA 4AY5A 3BCSA 2HY7A 2AZDA 1QQEA 2VQ2A 1ZU2A 2F3SA 1KT0A 2G9RA 2R60A 3E3LA 3WADA 2JLBA 4F96A 6GPBA 1PYGA 3G2HA 1YGPA 3BD7A 2UY1A 1HZ4A 5ARGA 1K08A 1RZVA 1P2DA 1IIRA 2BFWA 3Q47B 1JIVA 3Q49B 4GZ6A 2XA9A 2G9VA 1Y6FA 3NP7A 2F9FA 3CK8A 1FTYA 3L7AA 4YI5A 3NCHA 4W6QA 2E2EA 3QOUA 1L5QA 2GPNA 2C0MA 3MKRA 2G9UA 4I9CA 1LWOA 4KQ1A 4EQFA 4EL0A 4LDPA 3URZA 4XIFA 1NLMA 4RIFA 2VG8A 2IYAA 4G26A 4I2WA 4KXKB 4BT9A 1FU8A 2QLLA 3ZCRA 2OOEA 1Z8DA 2SKEA 4WNDA 3G2IA 3Q3IA 3WXXA 5EX3A 1E4OA 1C50A 4N5CA 2IV3A 3MA5A 4H7YA 4UI9C 3G2KA 3S2UA 4EL5A 3SZ7A 3N71A 2GT1A 3ASFA 5LCWJ 2X0FA 2VSNA 2YHCA 3OTGA 4WACA 4GZ3A 3S7JA 2QN7A 2DBAA 3ZHEB 4HWGA 2HR2A 3CVNA 2NC9A 1ZBPA 3OT5A 3T3DA 3OY7A 3QDNA 1C8KA 1NOIA 2AMVA 3UYLA 5FZQA 5HQ8A 1P2GA 2XCUA 2PQRA 3HBFA 4J0UA 3OKPA 1GPAA 3PE3A 1WAO1 1FTWA 3C48A 3T3EA 1HH8A 4XI9A 4KQ2A 3BD6A 4UQXA 2PYDA 3PE4A 4ABNA 2SKDA 3QWWA 4YI3A 4MHSA 4JA9A 1Y6GA 1H5UA 4CTMA 2IW1A 4G2TA 4UI9J 5ARFA 3ZPJA 3T5TA 4NC9A 1NA0A 2KS6A 3L7DA 2WPVA 3NC4A 1C3JA 2XA2A 3MRTA 1QM5A 4Y6WA 3NF1A 5KJKA 1L6IA 3AMVA 2ONDA 2V5FA 2KCLA 2C9ZA 1VGVA 3EBOA 3TAXA 4AY6A 4AM9A 5JJ6A 3SYMA 1GPBA 3TGOA 4U0ZA 3E4BA 3ULQA 3D1JA 1K06A 5JTTA 2SKCA 4AMGA 5AYWD 3T3IA 4RIGA 1P2BA 5G04J 4MICA 2P58C 1HXIA 1W3BA 2KCVA 3CV3A 5FZSA 2GW1A 4RENA 4EKEA 1KTIA 3RHZA 3VUFA 1E96B 4L22A 4M83A 2PYIA 3CX4A 3CUTA 1ABBA 3CVPA 1UQTA 2X0DA 4HLNA 2OFFA 3BCUA 4HOQA 5G04C 2LSVA 1L5WA 1Z6QA 3MT7A 1P4JA 3SF4A 2XCBA 2LNIA 4GA1A 1NZFA 3IAAA 1L7XA 2X0EA 4RELA 5DLDA 5EKQD 4NESA 2IFUA 3GYZA 1GG8A 1HLFA 1P5QA 4G23A 1NA3A 2WTXA 4MI9A 3MRXA 4N3CA 3WAGA 2PRJA 3CUYA 5CCMA 3AS5A 1F6DA 1FTQA 4EKYA 4MHOA 2FF4A 4RG6A 1P29A 4JHRA 2P6PA 1NVKA 3IEGA 1RRVA 3OXFA 4BTBA 3NB0A 5DIZA 4UI9K 3S7DA 3ZCQA 2QN9A 2AV6A 5A6CA 2AW3A 3KS2A 1IHGA 3OXLA 2BISA 1E1YA 2PQNA 5JJ7A 3AS4A 2I6HA 2XGOA 4Z5XA 3BD8A 2PRIA 3DDWA 3EBPA 3T7DA 2ECPA 2MHKA 2F3PA 1WUTA 4AMBA 2XGMA 4U04A 1JIXA 1JIUA 1PN3A 3LKUA 1F0KA 4F3VA 3CEHA 4HOTA 1JG6A 3FROA 3TSAA 2IUYA 4H7XA 4CTOA 4WUYA 3ZHEA 1ELRA 1GZ5A 4N3BA 2QN1A 3TG4A 4RIHA 3ZCSA 5D0OD 5CHEE 1P4GA 4BT8A 5HXAA 3MT8A 2C2LA 3S7BA 3VTXA 2QLNA 3MTAA 4REMA 3MRVA 1GGNA 3QWVA 5FTPA 3O3CA 4AN4A
chains in the Genus database with same CATH superfamily
5IJ9B 3RRMA 1JVNA 4BQPA 1K6XA 3L6AA 1R4NA 2WRZA 3QVUA 1R9MA 3GPIA 5HP4A 3PCTA 4MVJF 3E05A 3UOGA 1Q2UA 1MVLA 3VZPA 3H9GA 3CJQA 3RSEG 3IDAA 4FE4A 2YXPX 4FFMA 2PKWA 3CHSA 4CM3A 3PDIA 1JPNA 4DCSA 1K7CA 1YMQA 4K6OA 4HGZA 3IL2A 5I7RA 4HAWA 2HU2A 1T2UA 2G07A 3FNFA 4HN4B 3I62A 1NC3A 4U6QA 4L1BA 1EVJA 3KEMA 2ZWIA 4F11A 4PX3A 3SHQA 5GV8A 2I7VA 1KI4A 3DV0B 5BVGA 1E90A 2GARA 5ADWA 2V6GA 3UFXB 2DCMA 2PZLA 4NE2A 4MI6A 4G0XA 2CDRA 4PVDA 3CZMA 4PFSA 4XJTA 3BRSA 3WTBA 4ACBA 1BDIA 2CXXA 2JVKA 3DV0A 2RG1A 2OV6A 1TOAA 3INTA 3ND8A 3LY8A 3KVVA 2OGWA 4FYPA 3RF6A 2X6JA 4GMLA 3WSVA 1MOQA 4IG4A 5HZHA 5BV2P 3L93A 3VZSA 3DWEX 3MBKA 4HX2A 2NZVG 3LT0A 2IX3A 5CW1A 5AI9A 2EJTA 3VOSA 3B6MA 3KR1A 3UINC 5G2OA 2PIDA 3E70C 2Y3IA 4R2WA 1WXGA 2RD2A 3QM1A 3MZLB 2X4DA 1XMJA 4IZ6A 2L2QA 2NTYC 3LD9A 4DVJA 2R02A 1P72A 1TCUA 1Z16A 3PDNA 3WHIA 3ADDA 2KATA 4TKVB 1E62A 3C14C 1Z0AA 1Z3CA 2NO6A 2HLDA 2WSSD 1L4YA 3KB8A 3KEOA 2K6GA 1X6VA 4M1SA 2VYIA 3V4OA 1JR4A 4BEJA 3WHLA 4Y2QA 1USIA 4UQOA 2JW5A 3R0XA 4JXTA 4RV4A 2C0LA 2I55A 2WAXA 3AVWA 5CXXA 1T36A 2PR7A 3ET4A 1DBQA 3SBOA 5B3LA 3TLGB 1H4QA 4DSAA 1P7ZA 4NCXA 3L0CA 3U3XA 4HATA 2H0QA 1E5VA 4H77A 3H5AA 1E1QA 3EUWA 4Z4EA 4ND1A 1T9CA 2E82A 1IWPB 1BGVA 3BCRA 4IIDA 3TI7A 2PJUA 4FYMA 2ENWA 3HGQA 2P4SA 2XCLA 1ZC3A 4WJKB 4IH9A 1Z2OX 3AVVA 1O5TA 3PGA1 4N9WA 4P3OA 2YC4C 1UFVA 2O0HA 3WLPA 4F21A 2EW1A 1TQ8A 3DTNA 4WERA 3TXNA 2C5SA 3C15C 4GPBA 4LTDA 4XPZA 2ZVPX 1W96A 3H9BA 1Z0ZA 2ASEA 3CUWA 3K6SA 1HR0B 1J8VA 3FMOB 3A4TA 3VDNB 1UBCA 2OLEA 2QUZA 3K05A 2R5FA 2XB6A 1RPNA 4P34A 4PPFA 5G1NA 3BB1A 4Q9AA 1NI4B 1AHHA 3D0RA 2VDVE 4MW1A 3ZV5A 3RSLA 3KJZA 3DMDA 3AHJA 2IOFK 4H7KA 1PC2A 1Y7LA 4J29A 2JAQA 3CR3C 2CDCA 4OLJA 4GW3A 3WGJA 1DB3A 1FCHA 1VBMA 3X1JA 2A94A 2WHPB 1RP7A 2UZ3A 2M9MA 4B4VA 2JFFA 3BEDA 2VHZA 1SELA 1Y6RA 3DOOA 1SZDA 3FKQA 5F5XA 2J3MA 4Y2TA 10MHA 3DEOA 1U1FA 2J9XB 2LCIA 3QP9A 4M1KA 4RPJA 2O1WA 4TV9B 4U7JA 2I2CA 3LYLA 1KJZA 1KEEB 3BTVA 5E9QA 3RS5A 4E88A 3DEYX 4P7FA 4DW8A 2HB6A 2VQDA 2F8SA 3BEEA 3JAMA 2J49A 1ZAKA 4LNUA 1ZITA 3I37X 1NV9A 4KK4A 4PPQA 2DC1A 3CMCO 3CNOA 3BDAA 5C2YA 3OM0A 4KT6B 3PZ3A 2AI1A 4WI1A 3R7NA 3UAZA 4EB6A 4KZ0A 1KQ3A 4JY7A 2M6RA 4GXQA 4RMGA 3ZDRA 4EGSA 1QYCA 5IXYA 4EJ0A 2Q0QA 3ZN2A 2YHIB 1XHFA 2J59A 1TRHA 3D8UA 2QHXA 1AGXA 3EAGA 1BXKA 2RGAA 2J07A 4PSDA 4HS9A 2QK4A 2HSDA 2OC9A 1B7GO 3KV3O 4A1SA 1QV6A 2AI2A 4GX0A 2X6IA 1I5OA 2ZRKA 2NZYA 3I2YX 3KJNA 3MT9A 4UULA 3LKDA 3N75A 4EG8A 3RAUA 2WM8A 3ILXA 3KT6A 1DUSA 3P9IA 4MWGA 5I7EA 5KTMA 3SZMA 4ZI5A 3ED5A 1OQAA 5EAIA 2AQIA 1E8ZA 1RWNA 1PR2A 4AIFA 1I1NA 3DE7X 1TCAA 3A3KA 3ZS9A 4YAUA 3FP3A 1BFUA 4RCZA 4AKEA 3BWCA 6ABPA 2B4QA 4DG8A 1RAIA 4OFBA 4GLBA 5CAEB 3D8RA 4AJPA 4LHSA 3DTVB 5HQ3B 1XZPA 2Y0EA 4KYIB 5FWQA 2VHWA 5J1TB 3IT0A 5KJFA 2VJKA 3WMRA 4QYWA 2AG1A 3REQB 4DSUA 4Z0PA 1S9DA 2C9OA 4JKOA 4Q1AA 4B44A 4UU7A 2RARA 1XZGA 1CP3A 1RQXA 2NXEA 3KYIB 3IV6A 4LBVA 2GZHA 4BYGA 2EATA 3S8EA 2YWHA 2GS9A 1MO6A 3RNOA 2QM7A 3L22A 1QDLB 2HPHA 4HTFA 4IDQA 1G8AA 1I5EA 3BMNA 4A8PA 5JLJA 5K09A 2GWRA 1JXMA 4PR3A 1G8MA 2XWQA 4R9VA 3NOQA 3TAHA 3EC7A 3EIQC 2UY1B 1D8AA 2AR0A 3G2NA 5CFZA 6NULA 2ZQ5A 3GF4A 4HNAB 1VLHA 1KLXA 1Z2DA 3OFJA 2ETXA 4N9QA 4NR0A 5DYTA 4EJSB 4KVMA 1H2AS 1PNQA 1ZJYA 4NP6A 4NV1A 3B51X 4DPKA 5IUNC 2BFBB 1N1DA 5FR1A 3ILVA 3P8ZA 3A1EA 5ENDA 3BVPA 3N0RA 3TW6A 5LXTF 2A1UA 3V4RA 3A2MA 1VA5A 2HXYA 4EHDA 2CKMA 2OHGA 3K0FA 2ZXFA 1KJ9A 3NS7A 1SKBA 1A98A 3FLBA 3UK0A 4NQ0A 1DINA 2H4JA 5EJGA 4FT2A 3NH6A 1BO6A 1I80A 1OXXK 4MLCA 4S35A 1RPAA 4UNNA 3AH8A 1SUAA 5DXAA 4JOCA 4A73A 4PLFA 1YRWA 2P35A 4IINA 4LYFA 3WRWA 1CR2A 3QY9A 2A92A 1FX0A 1U7TA 3NNNA 1FFWA 4E51A 4ZVTA 4PYNA 3P2MA 1FP4B 2RHDA 3KU4A 2AB0A 3ICCA 1MTZA 3UKUG 2BGKA 3NR2A 3T7TA 4B6EA 4YT2A 2OAQ1 1PAUA 2AF3C 4Z86A 4RPIA 3FDFA 3HZHA 3FUTA 4QBTA 4K1XA 5E8RA 4I66A 4ZAZA 3RT1A 4I9EA 3GLHB 4LGMA 1RE0A 3ZPXA 3GK3A 2PZIA 1XXLA 1J24A 3PHJA 4R2LA 2ORVA 5KKCA 2Q7FA 3IQFA 5DISB 2R1VA 3HJGA 3TW4A 5LU8A 3Q6IA 1CEQA 3N6XA 1ISGA 2C20A 3QU4A 3TJPA 1AH2A 1WR8A 1ISJA 5JVDB 4BKPA 1IUNA 1XZJA 1Z0DA 4DLBA 2XTZA 2GERA 4G0PA 2Q5OA 1CZLA 3ETEA 5EZ5A 3QVXA 2OORC 4QGSA 3X1ZA 3C6KA 3QFTA 3TZCA 4JI7B 2IXTA 4E30A 1T5SA 4C7VA 3ZZTA 3BGWA 1BU9A 4P4LA 1M7HA 4NACA 1PJRA 2F43A 1KH3A 3BE6A 2R03A 3OETA 1QAOA 3WRVA 4JT8A 4IMIB 4OXKA 4BJ1A 1GFIA 2DYSE 4WNFA 1YL6A 1N36B 1T3ZA 3QLJA 3RIXA 4I5IA 3FSEA 2SCUA 4TRMA 4RTRA 1BHSA 3LNTA 1FMCA 4UUNA 4ZAFA 3T9DA 5B2EA 2G1UA 4ROTA 4TTAA 5KNBH 4XASA 1SG0A 3ZFWA 3GW8A 4P86A 4RCYA 3OX2A 5TVGA 2PRKA 1A95A 2PXCA 4XYLA 4A0RA 2R4UA 4L5JA 3KUKA 4O25A 3LG2A 4GF5A 4X8HA 2GVDC 3SFXA 1H2RS 2XWBF 4UREA 3TZHA 4BUCA 2DQKA 4FQ7A 1ZEJA 1C4WA 3USZA 2WVAA 3RRXA 2BRUA 4A92A 1E2PA 1TT5A 4QPPA 4X91A 3JAKB 3P5BA 1Z0JA 1RWBA 5EKDA 2R60A 5B7GA 5BMVA 3GT3A 4WFQA 1F0NA 4NSNA 2IQ5A 2JAOA 3PJEA 4P92A 4PLWA 1KZ6A 2CNKA 2WTNA 1X1QA 3B8HA 1L5GB 1CK4A 5JG7A 3SR4A 1J0XO 1KAGA 2FSUA 9LDBA 1E3EA 1K1AA 1HUQA 5BSUA 4CETA 4M46A 2ZE6A 1EP1B 3P27A 5EILA 3SR3A 3Q49B 1P6QA 2FAXA 4BIIA 2XA9A 4L85A 2JB9A 1TM5E 1FMFA 3KKNA 1BMQA 3DHVA 1KY4A 1LDGA 4ZPXA 3SZOA 4ZI7A 2YHUA 1DIHA 1ML4A 4RW0A 1JT9A 1V8DA 4UXJA 5JY6A 4NDNE 1RZ4A 3NI2A 2OAP1 5JAZA 1VB5A 3NCHA 4MW5A 3AF1A 3Q0IA 4FSHA 2VLIA 4UCQA 1BX0A 5ALMA 3DXFA 5JPIA 4FMDF 3Q73A 1Q0ZA 3I2IA 1EHCA 2PUHA 3PGJA 3U49A 3ADBA 2IH2A 3PFCA 4RIFA 3ICQB 2JFGA 3WKAA 2CYCA 4I2WA 3R44A 4UVEA 1PJTA 1X1AA 3I6IA 1LU9A 4IH1A 1LLUA 3EZ6A 4ZAVA 4P0PB 3GFQA 5BXQC 1ECLA 2FE1A 3KAJA 3L04A 1HMYA 4R98A 4TVKA 5EX3A 2AX4A 4NJEB 3OZFA 4UHBA 5EIHA 4HFGA 4Y6RA 4YUYA 1H85A 4WAUA 3LP8A 2R00A 4H7YA 4OI1A 2B0OE 4EL5A 1YS1X 1Z5NA 4NZMA 2B5WA 4LI0A 2IPXA 2C58A 2J3DA 3ASFA 3VYVA 4B7XA 4G5QA 4CMAA 1W2WB 4XLTA 4Y2JA 1N8TA 1GGEA 4G9BA 3U1TA 5T3RA 2J32A 4WACA 1XD9A 4GZ3A 1JCSA 2V03A 5AVKA 3K2QA 1RRCA 3WKEA 1V45E 3TSZA 1X7XA 5LU9A 1GUDA 3KOXA 2P9JA 3PEEA 2EBUA 4F84A 3N0XA 1SVNA 1OAAA 2G70A 2VUHB 2QYJA 3Q7QA 1PL8A 3OTOB 1VSUA 1PFVA 1UZMA 2ZREA 1HQYE 5ICMA 3AX6A 4LC0A 2DP4E 4EEXA 1K8RA 2CGEA 4ZT4A 2A33A 3B3JA 4IGIA 4O1PA 3UJ8A 5E6UB 3W6NA 2BF0X 1V4BA 1ZGAA 4GH5A 3JD3A 2IHVA 3BD6A 4X8QA 3WP1B 1N4RA 3HJFA 3AESB 2LP4Y 2LIVA 1NHWA 1MEOA 3I1JA 2JLSA 2WD9A 1V8BA 1NDQA 2JANA 2IOLA 1NYRA 3BIXA 2Q2OA 3D3JA 4H0NA 1K3ZD 1SCJA 1JALA 5JE8A 5J2UA 1WPXA 1GAQA 2PUVA 1WL8A 3VTFA 1FRVA 1XUOA 3KSUA 1U1EA 3L49A 3T7RA 2Q5HA 4UBOA 2WF7A 1EUZA 3IESA 4LYHA 3EJ6A 4EB3A 5TSDA 3R7AA 1SVUA 3WZLA 3PI6A 4BATA 4CIXA 1QX4A 1ZO8A 1B1CA 1WUKS 1Z5VA 1QVZA 2BT4A 3AM4A 3GFFA 5AMXA 3DO6A 4Q1VA 1RRMA 3DEZA 4HX5A 5EQDA 1NMZA 4ONEA 3CHRA 4C0HA 2E9SA 2GD0A 1KDOA 2OCDA 2XZTA 4IULA 3GDFA 3EDCA 3ONVA 4J0GA 4PAOA 4PZEA 4YACA 3IA2A 3EEQA 2ISSD 5A9RA 1RXVA 1XTSA 1P7YA 4LFCB 4LSGA 5HIKA 2F8XK 4P7JA 5GV7A 5E9JA 4I6JA 1WSAA 4CIAA 3WQHA 2AGVA 5FTMA 4MICA 3DLIA 4GMKA 5K3AA 3AV0B 1ADGA 3DZIA 1P2TA 2W2LD 2W6CX 3QI2A 4O2AB 3PVLA 5FZSA 3OZBA 2Z2KA 1UOQA 4RENA 4DIUA 2A9OA 4WN9A 3EZXA 2PUWA 4DY4A 2X8BA 1K8QA 3AZOA 3CUTA 4OQDA 2X0DA 3RKRA 4B84A 4X0EA 4IS2A 3GT0A 4YJDA 3WBBA 4QXOA 4ENSA 2BFOA 4O60A 3PUWA 1Y7IA 3AETA 4AS2A 4OGFA 2YDXA 3MGBA 1XQVA 4YLEA 2G0AA 4FOSA 5BNIA 3EEOA 3MUFA 5TQJA 3AERA 1ZJ5A 1F4LA 2XOKA 2VVTA 3ITWA 3VR6A 1ZJWA 1R4MB 4GE3A 1XQXA 3K1YA 5B4TA 1BQ3A 4P53A 4OXXA 3KXIA 4PRLA 3NAGA 1ABFA 3E9EA 3LL4A 4GM4A 4RWZA 3HC7A 3LLUA 3WAGA 1NF8A 3AVQA 4Q3DA 4Q7JB 2IS1A 4W1RA 2A1UB 4PR0A 3T38A 1ZSVA 2WKPA 4D0SA 1Y3DE 5AHWA 2C99A 4MHOA 3V80A 3AILA 2Z6UA 4KOEC 3ESLA 2DFDA 2C61A 1D4AA 1W25A 1SRRA 2RBKA 4JIMA 5JY1A 3K2EA 2P6PA 3U4CA 5LQJA 3BL6A 4BTBA 3K71B 1TO1E 5CMWA 1M83A 2QMHA 1HYEA 1Y34E 3ONNA 1GZ6A 1SM4A 1JEEA 2QTWB 3LVBA 4HI0E 4UU1A 1RYDA 5CITA 3T5AA 5D6OA 2WIDA 3H65A 5GM2A 4M1TA 1ZJZA 2FUCA 2OZEA 3O9ZA 1GKKA 2YINC 3CXRA 3ZWQA 2Q4OA 4MV0A 3DFFA 5CRIA 3SX4A 5FTLA 3KPYA 3NUGA 3ANLA 2ZTHA 2DQYA 3GFTA 2D2VA 2R8PA 3KAKA 3KC2A 3N70A 5B30A 4G4JA 3NXSA 3KBBA 3MXOA 2DYRE 1STOA 1N9AA 3I30X 4ZMBA 3BHJA 1C0LA 1DMSA 1XQ1A 3IOEA 2OVFA 1TTHA 5C35A 2QX6A 5E4TA 1FZQA 1PG0A 1YIAA 2C3PA 3KVYA 5TIIA 3UPUA 3CZCA 5CDGA 4GI5A 3KD3A 4I9UA 2BMWA 4RY8A 4WFKA 3FPGA 3UICA 3WJ7A 3UO8B 2HHHB 5EA2A 4MGIR 4YP1A 2JHCA 3EA4A 3ZE0B 3F6RA 5IZCC 4MAMA 4XUCA 2EQ5A 1NR5A 2P1ZA 1J21A 2HCJB 1DAEA 2B0JA 4I4NA 4LZNA 4LECA 1UKYA 4TM8A 1E2IA 4ALLA 3ED1A 2Q4RA 1DCMA 1PKXA 2YRWA 3MT8A 3E0XA 3A9WA 5JAQA 1IEQA 3EIXA 3RYFB 1M76A 1GDHA 3AU8A 1GIAA 2RKOA 2WJZB 1PK8A 2AFIB 3N5KA 4IKOA 3TE7A 3COPA 3E34A 4BO9A 3DAFA 4US2R 3MKQB 2C4TA 1YU6A 2DLCX 1KK0A 2BF4A 5ILQA 1K86A 1KO1A 1UPTA 3OBBA 2FEPA 3I9V6 3ZW7A 4C6RA 3K5WA 1IZ0A 2O6LA 3MCWA 4I46A 5FUYA 4LNUB 4Y2HA 3PENA 1ECCA 3PQDA 4IF6A 4QYMA 4EG7A 5I7UA 1E7RA 2CHXA 1CLUA 1I24A 1WEKA 2H2IA 3JY6A 5DNWA 5BR1A 1PJ8A 1XNQB 4JWKA 1CW2B 2XW6A 3E32A 4XLZA 1OU4A 3QLUC 4QFVA 1P1BA 2YVKA 3JCKC 5JWOA 4BE4A 5HCIA 5HDQA 1IVNA 3Q7EA 3V42A 5K0SA 1D2AA 1F4PA 3Q7IA 1NLYA 4RKYA 5CLFA 3FPSA 1MEJA 1Z36A 3W4KA 1VP3A 4GL2A 1A8HA 1VE1A 2ZWOA 4J8FA 4FNAA 3TI9A 2POCA 1E3IA 1T5OA 7ABPA 3CFYA 4PSAA 1RPTA 4JNKA 1YIOA 4PIPA 3HB7A 1KAHA 3V34A 2WD7A 3VBCA 4HOUA 2GVZC 3MUOA 1ST2A 3PKZA 4E31A 1Y8RA 2H54A 4B34A 3DZCA 3ONFA 3QPUA 3WLMA 5HYVA 1Z28A 3BPSA 4H31A 5CEJA 1KMMA 2ESRA 3CW9A 1M2OB 3EDQA 4OMDA 5DGIA 1KDYA 1NQTA 5HHTA 5E38A 2YYZA 1NF2A 2CV1A 3BXZA 3B2QA 3IOMA 4M7PA 2P79A 1BD8A 3JZDA 1COWA 3IUNA 3D31A 5KJEA 5CDHA 2FN9A 2OYCA 4RNDB 4MI1A 5BPPA 1J07A 3CVWA 4GBED 2PT5A 2I62A 2RGEA 2GK7A 4DM4A 2EBWA 4DJEC 3CH6A 3UCXA 2V58A 3V5NA 1KIFA 4RTOA 4GRDA 5EJ6A 4F3TA 4HH0A 1NMEA 5JO0A 2XEEA 4F3RA 3UMCA 4H7IA 2OBLA 5BP7A 4P7GA 5HA5A 2ZYTX 4CKWA 2PNJA 3KFXA 3SJAA 4E1BA 1ULHA 3HKDB 1EK6A 4Y1FA 4YPOA 4K9QA 1UPCA 3ZE9A 3LLCA 1S0UA 1VBNA 2WVJA 4JLPA 3UANA 4WX2B 2AQKA 3VAYA 1Y89A 2X8AA 4CQMD 3BAZA 2PX0A 3VHXB 1I0LA 2B8WA 5H7XA 4GZDA 1UBOS 2ZRDA 5JCOA 2HEGA 4X66B 1Z56C 3GZ2A 1UPXA 3A9VA 3LWNA 2NZ8A 2RONA 3WGHA 4EGAA 1R0ZA 4QYTA 1XQ9A 5JATA 5JDIC 3UPTA 4ARZA 3C3JA 3GU3A 1NI5A 3INYA 2E4AA 2RGUA 2XI4A 3P2IA 1KRHA 3SNXA 4GMDA 4I81A 4LRYA 2VT3A 3WA7A 4EI7A 1HDYA 2NQ2C 2VI5A 2PX4A 4XCQA 3EASA 4EHFA 1NP3A 2JD1A 4PCAA 1PV4A 2UZ1A 5LSAA 5JNSA 2PR2A 1C0KA 3MGKA 5HKAA 4KYVA 5DI9A 2VRBA 4KPYA 5EX0A 4HWOA 4UCWA 4RIIA 2MYOA 5JJ5A 5KVQA 4B79A 3IVMA 3EIJA 4HWTA 2H31A 3DBLB 3GYBA 4GL4A 2WNIA 4XYMA 4YFVA 4YMUA 1H6BA 3A4NA 4JFAA 3OKCA 4UOQA 3TSYA 4IX1A 6LDHA 5T7BA 3DWLG 4BSXA 1J70A 1AGYA 1LDEA 1SO8A 3ADKA 3JD0A 2W2MA 4DX2A 2IZOA 4IX9A 5A4MS 2BONA 1KGSA 1DT5A 1KSHA 2EERA 1LVGA 2H1WA 2B7BA 2PMKA 2Q5IA 3KE8A 2XVAA 1HM5A 5AK4A 5I9BA 3GRKA 3VH4A 2M1XA 1U2VG 1GGMA 1W75A 1QG6A 2IOHA 3T1OA 3B52X 4WHMA 3QY0A 5B6PA 3NOGD 3LKVA 4OATA 3CIOA 1ZVJA 2N3ZA 4H16A 4BU1A 3Q6MA 3COWA 3Q98A 4WESA 1C7JA 2C4NA 3HBMA 3JYPA 3ABQB 4NCAA 3NP9A 4XQ9A 1DUVG 2JL1A 1B2RA 1P31A 2GJAA 1RJ9B 2ZLBA 1CNEA 5ITZF 3H16A 3MJRA 3OZAA 2YYSA 4EKIA 4HOSA 1ODSA 6REQA 2IZ5A 2VJAA 5ENVA 4HDNB 5F1YA 3WMEA 5TY0A 2YS7A 2Y1KA 1VL5A 4EQ6B 1K92A 1W94A 3ZJ4A 4ER0A 3O4IA 1EVLA 2RFLA 4R1UA 4CRWA 4ZCMA 1OLUB 1N6HA 1RSZA 3BG5A 5ENRD 1XMPA 3LC0A 1X0VA 3C7KA 2XPIA 1NXTA 1VP9A 3CNHA 4MCJA 4TKUB 3X2SA 1JR6A 4BRSA 3AG1E 1BA3A 4G07A 1VMDA 2JHGA 3HUUA 1H8HA 2C8VA 3N2GB 3FUDA 4YJ2A 4HZUA 2X58A 1K0UA 2IA5A 3OJXA 5HS6A 4B1FA 1P0FA 4A1FA 4JBGA 2ZSKA 3WYEA 1K6EA 5GGYA 4XUEA 3T3MB 1BWQA 3UFXA 3R0IA 3V33A 4F86A 4KR6A 1QUEA 2Q62A 3PC4A 2CG2A 1JU3A 2QE6A 3QG1A 2P7IA 5CT5A 3UUFA 4EA7A 1OBFO 4NL4H 4QFBA 3DQZA 5JT1A 4JXZA 4J8EA 2VT7A 1VE5A 3TWWA 3HYNA 2H9YA 2W2VA 4D9JA 1K1BA 4QZVA 2HBRA 2FEMA 4BC1A 1M74A 2EIKE 1M8JA 2JDIA 2YICA 3BH0A 4ZGWA 1IAVA 2A0KA 3GG2A 3GJXC 3GZ1A 3O2SB 3UA3A 2V3CC 3D3MA 1U11A 2FW8A 5FOTA 1SVLA 3EIEA 2VQ6A 1CBUA 4XX1A 5BN4A 4HDMB 1F14A 1YBAA 1GRNA 3HVIA 1T2VA 5IVDA 3CEMA 3T12A 2WPDD 3ZOKA 4LOHA 3RJTA 1LV7A 5KSZA 5KTRA 2IKQA 3QLVC 2OT3B 1KDPA 4UQZA 2D74A 3Q75A 2PLAA 2RIPA 3BN3A 3PC7A 4XGNA 4CM7A 2HC9A 3RTBA 2YFKA 3BF8A 3LF2A 3CLSD 3NEYA 4YCLA 1T4MA 2JGDA 2RI1A 3G5UA 3CEJA 3C43A 1EFAA 2O2DA 2ODPA 2E4ZA 4HRYA 4MV5A 3HNPA 2VXOA 4IR7A 1WY5A 1UOPA 4QBHA 4M7OA 4TYMA 1TM4E 1IUPA 2PAAA 1JBKA 3TU3B 5CRVA 3HXTA 5AOCA 4BO7A 3RG8A 4PH4B 3KYCB 4G1TA 1U7DA 2P2CP 1XAGA 1NONA 2J33A 5KREA 3J81A 1ZAYA 1WMFA 2IF2A 1N75A 1BX1A 1CERA 2I1QA 2XY4A 2CN1A 3ECCA 4JD5A 5FO1A 4G63A 1XZ8A 3WGTA 1A1VA 3ZU2A 3ZDQA 2WE7A 2WP0A 3NPMA 2V7GA 3A2LA 1AC5A 2B2CA 1NASA 3WYFA 3CC8A 1X15A 1C4XA 2VGXA 5FTNA 2YCLA 2PANA 1KR2A 1TTQB 3RANA 5DDIP 4CU2A 5EIEA 3FA2A 2NMVA 1L5HB 1NU6A 4NU0A 5BSKA 4EZEA 4DLTA 1ZN8A 2CDBA 2ZBVA 1DVPA 4R4JA 2OCIA 2RHRA 1ZK2A 1BXRA 2Q4EA 3IA7A 3RV3A 3VMFA 4GMFA 3WJ1A 5KYWA 4OIMA 1AUQA 2FTKE 2QRUA 4AW9A 3SK1A 4F5WA 1NI3A 1Y8QB 2HSGA 2YWBA 4PZ0A 4TUYF 2BWJA 5KVCA 1HLGA 3L6BA 1QZ2A 1KEWA 1N1MA 4ZRDA 2PX6A 2JPDA 2MIIA 1EM6A 4TYPA 3CPEA 2VWGA 4XOUA 3REGA 4RS4A 3S1AB 2IBTA 4U1RA 4XWKA 1GQRA 2BKAA 1RXEA 3QW2A 1TZCA 3T4XA 3AESA 3DEPA 4G5GA 4QG3A 3TLKA 2QVBA 1JNRB 1NF9A 2Q3CA 3QKUA 4ZQEA 3BRCA 4ZXPA 4BNZA 2Q3BA 2JI7A 5HZKA 2CNDA 4L9WA 2PUDA 2YX1A 5CK4A 1XWWA 2QTVA 1P0MA 4NLLA 5TARA 4ZOLB 2VP0A 1ZSNA 4TS9A 5AIBA 1B6GA 4X71A 1LS6A 2XQIA 2IS2A 5K3SA 4NMXB 4N41A 2Z83A 4Q5IA 1L4NA 1ZU2A 2G9RA 2XB8A 3IAHA 3IAXA 4L6CA 3UMFA 1CJVC 3WADA 4HV4A 1RYNA 4N65A 4X6XA 3ZH2A 3OCCA 4N4AA 2CYBA 4NF2A 1R15A 1YGPA 4KK3A 4CM4A 5CFQA 1OE0A 4YJ3B 1GR1A 1OLXA 3RFTA 2JVJA 2PLFA 3ZZUA 1JZTA 3QYPA 2A14A 3RT9A 1ZVQA 4LMRA 3PWSA 4PWYA 2JHFA 1WZEA 3H2JA 2HM8A 3VX4A 3EQ9A 4GSKA 4LDAA 3ZVLA 1ZK1A 1C5KA 1Q1NA 2C1EA 1N77A 3BFPA 1OXKB 2CY0A 1CIJA 3W1EA 2PY6A 3TEFA 3N8NA 1RHMA 1WCIA 4ND6A 5E1BA 1UIRA 3R0JA 3ZYCA 4BLSA 4X85A 4Z4GA 1BHO1 1SBTA 3MC1A 4ZV9A 2V7QD 4B0OA 5LLDA 1S4QA 4YQZA 3GRCA 3QYAA 4CCWA 2KE5A 1M2FA 1Y7TA 1CU1A 3I4FA 1WY6A 3SP1A 5BUSA 2XCRB 5LP6F 3R6WA 1ZNQO 2BOVA 4HK4A 3JQGA 4HDRA 1T5HX 1N6LA 3H1FA 4YAEA 3GZJA 3UV7A 3VR4D 4X64B 4RC9A 3V1YA 3NVKI 3ZVRA 3E4DA 1H2YA 5A3VA 3G2KA 2ZULA 3ZJVA 1MENA 2K2WA 3GOQA 3TQSA 4RGVA 3F8WA 4ALJA 2P3LA 2GCIA 4GPZA 4YP5A 2WJJA 2B8JA 2C59A 2XMRA 3DAHA 3AFGA 4XPIA 4ZZ0A 2ZYUX 1V5IA 3EH1A 3G68A 4C0WA 2HSJA 1G4HA 1VMKA 4V1CB 2BTQB 3CRW1 2YXEA 5BQFA 1C9JA 3C8DA 4HDKA 3TCKA 1ID8A 2ILVA 3EQ6A 2IYTA 1WXDA 1OWNA 1MXHA 1V7CA 1GAWA 4DR4B 3T3DA 1ECPA 1EXNA 1LPMA 3PX3A 1N5JA 3OY7A 4I4IA 4ZFHA 2NW6A 3FNQA 4CLEA 4ANFA 1KETA 3WO0A 1X7XB 4KZCA 2AEMA 3LQRA 4QGFA 4DS3A 2BZGA 1UFQA 3ZV6A 4HB5A 1SCUB 4PRZA 4FFWA 2DPXA 2GRRB 2X3FA 3FUCA 3ZHXA 1RPJA 1B6SA 4E4YA 3OQJA 2HA6A 3I04A 4NECA 4CLRB 3BMCA 3PE4A 1XZDA 3D81A 3I3NA 4L2LA 1W52X 4QGHA 4YI3A 4DQKA 1COZA 3E37A 2AA3A 5EIFA 1I94B 5IFLA 2VJYA 4J0KA 2BHRA 3QLTA 3EF0A 3HRAA 2C98A 2DVWA 1M6YA 2FY8A 3C3XA 3LCJA 2HMVA 1E18A 3NB2A 1RVV1 1WNTA 2BC9A 4O2BB 4U7HA 3KB1A 3M83A 2WG2A 3L2OB 1N32B 3AF3A 4QQNA 5LR6A 1A71A 1EB8A 1HXHA 4QG7A 5AKJA 2NU9A 4GBJA 1Q95A 2HBYA 1OBHA 2H07A 3EIQA 4JA2A 4G4SO 4AWXA 1RI4A 5BVHA 2GBIA 3AIIA 3HB9A 4HQFA 3EBOA 4TRNA 5GJCA 4U8GA 4B2YA 5K0ZA 2V1UA 1OT5A 1RACA 3EGDB 5J2TA 1QF9A 2GN8A 1VL1A 3CF4A 4QM6A 5E6RB 5AFSA 1HNNA 3GG9A 4YP9A 4ESOA 1UBHS 3W8RA 4MPPA 4QUIA 1SNYA 2FJUA 4FU0A 4G1BA 4QXMA 4XX0A 5CU7A 3S2SA 1V1MA 1LRKA 2P9GA 3QUTA 5F2OA 3PKIA 1A4RA 3RIMA 2PU5A 4INJA 2SKCA 3AG2E 1JJFA 2AHRA 4ATZD 2ZSAA 3FNGA 1SVXA 3FPLA 4Q9HA 4L3WA 5E7MA 3U48A 1QIJA 1W3BA 4A2QA 3TZQA 1TE2A 3LI2A 4IHJF 4RH3A 1E79D 7REQA 5DM60 2XQGA 3TTYA 4CKYA 3GRUA 4LSMA 1A1SA 1W85A 1DCKA 4NBSA 1E6EA 1PQPA 1SIOA 3CVPA 2Q41A 3DTVA 2GLUA 1IKND 4X1YA 5A0VA 4P4NA 1TA9A 4FMBB 3S1LA 1H3EA 4WA7A 3ZD6A 1MJGA 1NZFA 4KIFA 4GA1A 4LJ5A 2IONA 2AW5A 4KFSA 4BBJA 1L7XA 4NV3A 5TT1A 2WXMA 3QRWA 4HB3A 1M1ZA 4NMMA 1EUQA 3SHTA 3HN6A 2XBMA 1IVYA 4ILGA 4IDAA 5EJ5A 2UYCA 2YQZA 1LV8A 4GC9A 4K2HA 3IGFA 3TBHA 1RXWA 1YE5A 1K4YA 2EGUA 2PS3A 3H04A 3LYUA 5CCMA 3K16A 5DHUA 1RR6A 4YV7A 4ZHQB 3S4YA 3AKYA 1H5NA 2WP8J 2EIHA 4WCVA 4FHGA 1SBIA 1I2MA 4ZT6A 3V8NA 4B7CA 4DMLA 1GR0A 1R00A 2ZYDA 5ADVA 4FR0A 1ULSA 1NMSA 1RTTA 3PNYA 4KMSA 4BKMA 4JHRA 2GN2A 4ZANA 2W7TA 3QVJA 1NVKA 3APCA 3FB1A 1RM4A 3FG9A 3AUAA 1I33A 4QX6A 4Y67A 5KHAA 1E8YA 1GPMA 1V6CA 3IV7A 1Z5PA 2VS1A 1USKA 4QA9A 4AO6A 1TECE 3LE8A 4FI3F 3WYGA 2NU6A 1NN3A 4ACLA 1KI3A 2D7CA 2PVPA 4EQZA 1HE4A 3JS5A 4LC1A 2I6HA 4M1EA 5DCWA 4C6SA 3FTVA 3VC2A 4AZ0A 1Q1BA 2FPOA 1BYUA 2GCGA 3INGA 3P0RA 3U13A 3MYVA 2PRIA 3KQUA 1IBMB 3RSQA 3GLHA 1YOBA 3BH7A 2UYQA 2KBXA 1FB5A 4KYUA 2WMNA 1MEEA 1V16A 1OX5A 3D5EA 3GJ4A 3IVRA 4M9CA 3P7MA 5DEIA 5LBIA 2I6QA 4BE9A 3UT7A 3E15A 3ZW3A 1NW3A 2PL3A 4U04A 3U7EB 1JIXA 3R3UA 3G17A 3TOXA 1T29A 2BCGY 4Z8XA 1VOTA 2XE4A 5THQA 4EX6A 3TSAA 2C07A 4ISBA 4K5QA 3DXMG 1N9GB 3LFUA 2BDEA 4O2BA 4M54A 5LXTA 1GTVA 4UUCA 2UYHA 1FYWA 2VXCA 4BIMA 5K6AC 4EUEA 2YWDA 3ZQJA 3QEOA 4HLDA 2DRIA 4OHKA 5CHEE 1U2TA 1V1JA 2BUCA 5HXAA 3A11A 5JXJA 4YRBA 4LERA 1PP4A 3IOYA 1E32A 2WOJA 4D46A 4B8CB 3P9NA 1GLNA 2D5AA 3PSAA 5KYVA 3DCYA 4IXDA 2HA4A 4QGBA 1MB3A 5HF5A 2C2KA 3L7YA 1C0EA 2OVBA 2V6JA 5LUAA 4NVRA 2D1FA 3KTOA 1V11A 2VSXE 3NV7A 4HG2A 5LMZA 2QRGA 2FSVC 2Z1NA 1J9EA 5LVAA 3OZUA 1OF1A 2IEIA 4IVRA 3IBTA 2I2WA 5C5EA 5KWSA 2NYUA 4EI9A 1DDIA 3KBOA 5FP0A 3FTZA 5HIJA 3RJZA 4YMLA 1UJ5A 3OMWA 2NGRA 1UT6A 2HMAA 4KN9S 5K0NA 4CZ2A 4BEWA 1M33A 1IZ7A 1UADA 3D3EA 3KL2A 3D3NA 3M1YA 3H2ZA 4HSEA 5CH8A 4HGPA 5EJ7A 3IDOA 2A0WA 1XWFA 3KXKA 3L8YA 3CHYA 2V6BA 4I3HA 3LVQE 4ME2A 2VJ8A 2O0KA 1XVIA 2PZ8A 4B75A 1ELWA 4JB0A 4KLCA 2WJ4A 1ACJA 1JTFA 5LZ8A 3S2YA 4MUEA 3H5TA 3UGKA 3C3CA 4DLLA 2GAFA 2UV8A 3RIBA 4K81B 5BVHB 4C0JA 3LHFA 3C16C 1OXSC 1SCNE 4BFRA 1OUMA 3IPAA 1QHXA 3EGDA 5ELMA 5H1YA 3IIIA 2NO0A 1QOZA 1U63A 5IBQA 4QUAA 2XGJA 4ZQBA 2BRUC 4CL0A 3O21A 5C4GB 2V3WA 2JGKA 3GCXA 3U6KA 4XKBA 2CL5A 4R2XA 4AO8A 2PUFA 2XUDA 4MWSA 3O31A 3SS9X 3VYWA 1WCYA 4BZPA 3UUWA 1G7TA 4MMZB 3V7NA 3F78A 5DGTA 4TKMA 4AZWA 1GWNA 1V1RA 3OJFA 3DNFA 1RP1A 5LQRA 5IM4A 2V8OA 1JZSA 3NWOA 8OHMA 2QRPA 2ETAA 5FINA 1CR4A 1MO4A 1KK1A 3FDXA 5FUBA 2Z5GA 5AKEA 4LIPD 4BNTA 2EJWA 4D9KA 2XUPA 1QPZA 1Y6ZA 3WL4A 1ESZA 1KAOA 1OZFA 1U0RA 3GELA 4NU6A 1TA4A 4NIKA 2C04A 1QZ3A 4M1ZA 3X1DA 2ZIRA 1P0IA 2O4UX 3DS8A 2XODA 2ZIVB 2GROB 1E5DA 5LOZA 3K8QA 3RCBA 2Q6TA 2CHFA 1UAGA 5JRZA 1C3EA 1T36B 1XTPA 4NOKA 2V55B 3AM3A 4MLZA 4TX1A 1UEXC 4K28A 4Q4JA 4CDMA 5JHGB 4EX7A 3ADOA 4WOJA 2QQFA 5JZVA 1FU7A 1WXQA 3W2HA 1EFCA 1L9KA 4B74A 5EFZA 1EVKA 2EX0A 2IE8A 5HMMA 3KZ1E 5JTUA 2JCYA 1WW2A 2YVQA 3I5AA 4AMUA 1BXZA 5AK3A 2EQAA 3KAEA 1ENPA 3IMKA 1ZX1A 1TN7A 2J48A 2VK4A 2X9LA 3MWGA 4EWLA 7ADHA 2Z8XA 3EXFB 4IDOA 1EMDA 4OQYA 4ZOQI 3W05A 1U80A 2B61A 3UGTA 3GPLA 2NUAB 2GZMA 1A27A 4LDNA 2JCVA 2VCHA 4H7FA 5L40A 1T4CA 2JFYA 2OWEA 1ZM4A 4QM7A 3H9UA 1ADCA 4UAVA 3PNOA 3S27A 4YCNA 3BMQA 3C3PA 4I5FA 2YXLA 3LCVB 3MFYA 1SK9A 4M8NE 4DMUB 2ZM5A 2ZGGA 1M1NA 2AYZA 3NQPA 3OOSA 2BMFA 3I92A 5DLPA 5TRTA 3QKYA 2N46A 1N6RA 3D6JA 2GLXA 3EU9A 4MQ5A 4G5YA 5CA1F 2XRMA 3PHHA 1EFRD 3ASUA 3KQPA 4JBYA 4M9SA 4EG0A 2O2JA 2QMUA 2I1VB 2WEKA 4Q4AB 1IXVA 2AFRA 4P36A 4WLVA 3IBCA 2YN4A 3N2IA 1O5MA 2P4HX 1JHRA 2EG9A 4HGRA 1P5HA 4LWQA 4QOHA 4YAFA 4N3AA 2NNWB 3T3NA 2MSLA 1TI7A 4LN1A 3PFGA 1KS9A 3CSSA 1AKYA 1JDTA 2IELA 2WIKA 4AF8A 3R0QA 4GTPA 5IN4A 3CHMA 1EHIA 3UCEA 4E5VA 4DJTA 5BQ3A 2ENUA 3A6HA 4YREA 3FWVA 2IOFA 2E0IA 1J0AA 3K31A 4KRFA 1KYQA 2APJA 1Q83A 2QZ9A 1PQYA 3JVUA 3PI7A 4MA5A 5LZ7A 2XIJA 3DCNA 4YUVA 1A5TA 1JQAA 2O1SA 2IEYA 2EFYA 3ZJYA 4X7MA 1CTQA 3GEHA 3GRAA 1XZKA 3GZ4A 1D9SA 1Q2XA 1K8YB 1RI1A 2W6MA 5EQFA 5G0VA 3WIVA 2NZ2A 4F5ZA 2VBIA 3PB3A 3G89A 5EE3A 3TVTA 3TLCA 3WNQA 3U0VA 3AHDA 4WN3A 5BQ5A 3DE3X 3FZQA 3JSXA 1H94A 2D1YA 3FPCA 3P2BA 3KT3A 4GWGA 4DLAA 2W58A 4LS3A 4YMGA 1G6KA 2ZFUA 2ASVA 5IBRA 5IT0A 1MW8X 5ITZA 4B3SB 3VHQA 2YFQA 4RFSA 1EWYA 1F12A 2BD0A 1D6JA 2QJWA 3K9HA 4Y1RB 1G21A 3TL2A 1KYZA 4ETMA 7GPBA 4ZV4A 2JGFA 3MJFA 1JBQA 1QF6A 1Y3BE 4L75A 1SQMA 2QRZA 4NICA 3B1FA 1FNDA 2WICA 4TZKA 4JP8A 2JJMA 4IJQA 1IHPA 1GQSA 1SUBA 1SUFA 4BMOB 2O8FB 1KBOA 5H8WA 5GONF 5TF4A 4D10C 4KXFB 3W0LB 3PXUA 2HGZA 4ZP1A 3MT0A 2J8SD 4BO3A 4L8VA 4KNVA 3LUPA 4Z0TA 4D98A 4F3KA 4V0QA 2LDXA 3JQ8A 1PV2A 3H99A 1MZVA 4OP3A 3U7HB 1SULA 4JL0A 4LBWA 1PHPA 2GTIA 4PO3X 5EPEA 3ZKWA 3D4IA 2OFOA 1I8TA 3MNFA 5DRYA 3RS4A 4G36A 1RBMA 4EB0A 1GCOA 3DZJA 1OTYA 1P1FA 3KR2A 3RE1A 1ZOSA 5A3SA 3ZV3A 4I5EA 4MVJH 2D0DA 2BBWA 2R2GA 1KJYA 4QFMA 2JRCA 4QOFA 2ZR7A 5BRAA 3HJRA 2KX7A 5JD4A 3VZDA 5KOJB 2EYUA 4JDPA 3A2KA 3CMMA 1CUYA 3N28A 1D6MA 2L18A 4ZMSA 1RQRA 3LCMA 3TZEA 4CLOB 2YOFA 3BFVA 1VDYA 2E6UX 4FKZA 4P81A 4QDTA 1UW4B 5F2KA 4B73A 4ZQIA 1X9GA 4JLAA 2P1DA 3STTA 2W2PA 1LVHA 1HEIA 5AVUA 3CGGA 1W1IA 4CM1A 1G1AA 4D79A 1SVOA 4DN6A 2MMGA 4HBZA 1XEAA 1LTKA 2E1PA 3M4XA 5T4HA 3A70A 3HDJA 5KHLB 3DR3A 4QL3A 1W19A 3PGVA 5FQNA 1DC5A 4TMTA 5EXXA 1ZW1A 3FYUC 3OJEA 3F5MA 1KZ9A 4S12A 2NP7A 3DH0A 2AFHE 1ORRA 2QTGA 2X2OA 3RYHB 3U9TA 1PSZA 3R4VA 1W49A 4NBWA 3THRA 5AVYA 3KKZA 3MSXA 3PLRA 2R66A 1M8GA 3PREA 5E2BA 4KU4A 1N0IA 1ZJ6A 2BH9A 3U66A 1UANA 2WJWA 2YS6A 4JQZA 2CJXA 3LX8A 3W04A 2UXCB 1NBAA 1Y37A 2IYSA 5FR2A 2OBMA 1C7FA 3G2JA 3QKIA 4MVJE 1LTQA 4N7JA 4OA8A 4E5PA 2AQHA 2C7BA 1G38A 3DLCA 2MOKA 3K2IA 3E18A 1D6SA 4I3FA 2MOWA 3FTDA 4MRMB 3RC3A 3QVLA 2R97A 3NEAA 2BFFA 3CURA 2P9NG 1UAYA 3V8MA 4O4HF 1FYDA 1KFJB 1UFKA 3EWNA 2RHLA 4DCMA 2FKNA 2VP2A 2HI0A 2P2ZA 2QM8A 1NLFA 2ZE7A 1T13A 5IKOA 1UK7A 4W9RA 5HIAA 2BEJA 4F1JA 2C5AA 4RETA 3B2EA 4GX1A 4FK8A 5FL7A 1SHZA 1E6KA 1XRLA 3O90A 5GONB 4O02B 4UOEA 4AP9A 1YB5A 1HLDA 4LVCA 3ZK7A 2P2SA 2QWXA 2XUAA 1B0ZA 3KJQA 4P08A 4CNQA 4D99A 4NAHA 4GVPA 2ZGVA 1QRSA 3PQFA 4J7UA 2DK6A 1EVIA 2WV9A 4XB6B 2WTEA 1EQAA 1KPSB 1KVTA 3B5IA 2G08A 4JKYA 4LNAA 3VR6H 1H1DA 5SZKB 3TFQA 1UZLA 4K26A 3CZPA 2VYQA 3GOHA 4FDVA 2R87A 5GM1A 3VPAA 3W5HA 3ZHCA 5JZBA 5BYJA 1DBWA 1VYHA 3NRJA 1WB5A 3P1UA 3BJIC 1N8SA 2ILTA 4PGGA 3HP1A 2PQ2A 2VJDA 2ERCA 5E4YA 2YZNA 1ODLA 1B93A 4AYXA 2JGLA 4BWVA 1XDWA 4A1OA 1QCZA 4DBVO 4YDSA 4GXNA 5C7LO 1QZXA 5LQCA 3H11A 5IU6A 2ZYHA 1C30A 3DB2A 1914A 1CFJA 1V5GA 3CK8A 1Z0UA 4Q9JA 3TLZA 1KO7A 5MDHA 3OUUA 2VUUA 2DMRA 4AY3A 4XTCS 2BFMA 2QENA 2VHXA 1W35A 4I4TB 1ZDMA 4P83A 4MYDA 3VPSA 2GPNA 2C0MA 4ZU1X 1F7VA 4I9CA 1PD1A 1QIGA 4BN4A 3IBYA 4QJ4A 4U00A 5A71A 4AQ7A 3BE4A 4Z0NA 4GSYA 1XGWA 3GRVA 5CIQA 3OU7A 3RC1A 1NLMA 5IXSA 2IU6A 1N7JA 2HZBA 1MQ9A 2QRKA 3C8ZA 1KNXA 4Q7KA 5ALLA 3QPDA 3N07A 1I2ZA 4MW2A 3ZIUA 1L7BA 2SKEA 3IIKA 2IYYA 2JAHA 5F5NA 3UZUA 1C50A 1YZHA 1YZNA 4REQA 1W5EA 3KKKA 3ROKA 1J20A 1E7MA 4U95D 2H6FA 1DJOA 3C2QA 4IIBA 1TJPB 4QVGA 2E1RA 1KBQA 2HCBA 5EE9A 4G8DA 5F2EA 5HF9A 4CWAA 4BVBA 3LX6A 2Y1EA 3I0NA 5TPZA 5AM3A 1CIVA 4U8HA 1BXGB 5LYYA 3ZHEB 1E1CA 1VJ0A 2HUPA 3D4OA 4W8OA 3OJ0A 3P2KA 5AQBA 3D64A 4DQUA 5KUTA 3RAFC 2VJLA 3PC6A 2WI8A 4G56A 4MKIA 4BO4A 1Z5OA 2RI6A 3ABSB 1ZNYA 2O6HA 4I1PA 1AKVA 2J08A 4WY2A 4EUKA 2V5QC 1LF0A 2QAGA 6PFKA 3SF8B 4P58A 1RMQA 2QI9F 4UZEA 3VTKA 3T5XA 4CFSA 4RXUA 4EFLA 5JAMA 2PUGA 4EEZA 1P19A 4ZYUA 3UAGA 1N2CB 1LQ2A 1JHUA 1U8YA 3GFSA 4J7AA 1P45A 5JNTA 2OBBA 4UM8B 1M6NA 3HVHA 3JATB 1TW2A 3GFOA 3PNTB 2VKTA 3R24A 3AJIA 1C8BA 5KHOC 5KBYA 4BNNA 2HHJA 5D87A 1KMIY 2B1RA 2NT4A 3M49A 3ORRA 2GPTA 4FD3A 4C7JA 5JDCA 3NBMA 1NA0A 1ZI9A 4PVCA 5CVUA 3TJMA 4DIFA 4BWGA 1U0JA 1I4TD 4NDZA 3TW0A 1OI4A 1G63A 13PKA 4OJKA 1WKCA 4P38A 5AUPB 5FLXA 2O05A 3NF1A 1SUPA 3KLMX 3AMVA 4Y7CA 3U3RA 3DUFA 3LVRE 3KHUA 4LRUA 1PJCA 5DBEX 1VECA 4WGGA 2Q3MA 5EOVA 5AUQA 3X2EA 2BYTA 1UPBA 1RAEA 4LJAA 4ZREA 3T41A 1IN5A 4JT2A 1Z33A 3FCEA 3HCAA 3HVUA 2ZYVX 1QQ5A 1DAMA 2QMOA 2XUJA 3HO1A 4IUDS 3ULEG 1I0ZA 2ZIXB 1QCDA 2BEVA 1R8XA 1VL0A 1GL6A 4O2AA 4P5DA 1GP2A 2CJWB 2R1TB 3IDSA 3OPXA 3TBFA 1C1XA 3ZLVA 1SBZA 3T3IA 1HDXA 1ONPA 1TYAE 1TKBA 2UVPB 3N53A 2HF9A 4BVFA 1XEXA 1SC3A 3FUIA 3QKRA 1I7SB 2VRCD 1KTIA 3ZWAA 3VAAA 4X20B 3C74A 3V8EA 4M83A 1XN4A 1B42A 1VLQA 4WRRA 1K97A 1Z35A 2WU1A 2H3EA 1ONOA 3RVRA 1KZPA 1O1SA 4BP3A 5HGXA 4HVLA 3ZVMA 4TUYB 3SC2A 1TU4A 2FSFA 5FFNA 4J8YA 2I8CA 1GL9B 3C5CA 4RF4A 1TQ2A 3IQWA 5TQ2A 4D9EA 3CH5A 1G8YA 1BOFA 1VIAA 1NYTA 1I6WA 1LX6A 1Q19A 2CBZA 2QPTA 3FWNA 3NFYA 3SZLA 3WBJA 2XCQA 4P54A 3RVSA 3IJPA 1B3RA 2OCBA 3DP7A 4JGBA 4BQSA 4MI9A 1X9HA 5J43A 1A9XB 1RWOA 3DEJA 3L6UA 4H15A 2IYWA 3AEYA 5AIJA 3AQ4A 3NTRA 3B38A 1PYOA 4O8ZA 4Q3OA 4WE3A 4CFZA 5CBPB 4EGQA 1HDRA 4X7BA 5FBWB 2C9DA 3ND5A 4D74A 2XRFA 2DUUA 2AD1A 1QNLA 5G41A 2FNAA 2HREA 2ZIGA 1Z07A 2QTCA 1KAMA 3D2AA 4PQFA 2CV2A 4TVOA 1FX1A 1K7SN 5E3IA 3ZXSA 5A62A 4JJ6A 4AOFA 2OP0A 2OR3A 3W8NA 1H42A 4EO4A 5DM70 3S3TA 2HQ1A 1OTHA 4OQPA 3ROTA 4AZ0B 3KDAA 4RTQA 3LBNA 3HVEB 1H0SA 4IQGA 4IHJB 2IVZA 2H8GA 3BT7A 4TWZA 4P0QB 4AKIA 1J6UA 3ZBUA 5CVTA 5TB5A 4E5SA 3OZCA 3RFCA 2YMQA 4ZK6A 3D7KA 2ZATA 3FFBA 2FV8A 3K5HA 3EPJA 2AKEA 1CY0A 5NLLA 3ZY5A 1J8FA 2YWGA 3AIOA 1N9GA 1WUTA 2D1TA 3OOHA 2QV7A 3SS7X 5L4NA 1D1PA 1YCHA 4ENRA 1QVVA 3FFWA 3JAWB 4QO7A 1F0KA 3WJAA 1SBQA 4E6HA 1M6EX 4Q1BA 3EBLA 4H7XA 4K3UA 1NDUA 4EF6A 1E3SA 3RD5A 4ARBA 3OZWA 4PCLA 3EXHA 5AHRA 3HCPA 4B43A 1SOUA 3WIUA 5BN3B 3D2BA 2OM2A 2VR1A 4Q34A 5HWSA 3G8YA 2HCFA 1ZH8A 4LE2A 4PLCA 4E85A 3HBLA 3EVDA 1F6WA 3PEVA 4XQGA 4X94A 3WGQA 1UUFA 1NQAO 2C2LA 1N78A 1X38A 2J7PA 4NI5A 4DK5A 1E2DA 2R6ZA 3UCFA 1Y42X 5DNCA 3HXOA 3VJLA 3FUUA 4DJAA 1ESNA 3DMTA 5ALWA 4FOOA 3UMGA 5IM4F 1F7UA 5A0TA 1BFDA 4Z9YA 3T1NA 5HCNA 5SYAA 1ZKDA 1YZUA 3KYJB 4OAQA 4IDEA 3LUAA 3CE6A 4AKSA 4DRXB 3ASHA 3ELWA 5FL7D 1V26A 4OQLA 4FMDB 1RBQA 4Q6WA 1U02A 3I5YA 3OZSA 3HJTA 2QRMA 5EXTA 3FHTA 1L5FA 4CEJA 4PAQA 1I7NA 3QI7A 4GGOA 2SCUB 1PNTA 2V5VA 1E3WB 5EJ2A 1BOOA 4ZK2A 4II3A 5I9LA 4G0UA 4FULA 3PH0C 3QMMA 4TXLA 2E4YA 1T2EA 1DKPA 3KR9A 3ZI0A 1BN6A 3U7IA 3RG2A 3T7EA 5A4AA 3UUEA 2WYVA 2ZUVA 4M9UA 4PBTA 5KYGA 1FMTA 2RG7A 2DFNA 2IYFA 2VYVD 2M6LA 5LM3A 1II8B 1W93A 1Y0BA 3H1EA 3IURA 3NC1C 5EYPF 3DYBA 3NDIA 4OB6A 4MO9A 1XZFA 1XDDA 3L1IA 1O54A 1C41A 1R1DA 2BGRA 2GMWA 2ATIA 2YXNA 3F8TA 3WLRA 2FBNA 2OEWA 3W5JA 1ZM2A 4FJ1A 3NDPA 3KETA 2B34A 2DYKA 1O95A 5F3DA 5DVZA 3WWCA 4AYWA 4BVHA 3HDXA 2V4UA 3FDHA 4UEKA 1Q0PA 1JUDA 4PUCA 2WYWA 5G53C 5EUCA 3CB4A 4MEBA 2PL9A 4O4LF 5FIUA 4DUGA 3C7CB 3GGOA 5AVTA 1GFZA 5CX1A 3M0EA 3W90A 3NT2A 3OZXA 5HS4A 5I3ZA 1EPUA 3B1ZA 1KJ8A 2AT1A 2VOEA 1UMDA 3LQKA 2IEDA 1SR8A 4V0OA 3ZYZA 3DAGA 4R40A 1Q1AA 2GN0A 5EC8A 1SD1A 4QTZA 5FUWA 3DDCA 1FXUA 4C0LA 1U2PA 3KEQA 1JIJA 5JD5A 3EVCA 3I61A 3ZX5A 1SWVA 2FN7A 1IXSB 3U3MA 1QFJA 2J0EA 2TYSB 3RFUA 5FYQA 1T8RA 2Z9CA 4D9FA 2JAUA 1NIJA 2QRVA 1T10A 3KKPA 4FFPA 5HJEA 2FDCA 621PA 4DJJA 5FT9A 1MC1A 3AUTA 4KIWA 1BVUA 3CLSC 4ZIRB 1L7VC 4L50A 3Q7PA 2VL7A 4N39A 2IPLA 2BTQA 2VSXA 5M72A 1KEZA 2C1XA 2CHZA 3FUHA 1GYPA 1MNAA 2QTRA 2AN4A 3FMVA 1GV1A 3HGMA 4MQFB 4WDRA 2VA9A 1O7JA 2GM3A 1T5IA 2YCBA 1KKMA 4P4TA 1YZ3A 1Y5IA 4C29A 3UC9A 3SOZA 5KS2A 3UFBA 1G5FA 1HT0A 5BMVF 1WUJS 3TCNA 1RLOA 3BJMA 3UMSA 1JAXA 1GNQA 5ALTA 3PGLA 1LFAA 2P2NA 3ZI4A 1QO7A 3D7SA 3OIGA 4I5DA 4E6EA 3OLYA 1NPDA 1CVLA 2BM1A 3S5UA 2O0LA 3AUSA 1UZNA 1CZUA 3H8JA 1VBFA 4WDQA 2QGNA 4B6QA 2CD9A 4QECA 4NEQA 2PM7A 1IK4A 2EFCB 1ZI8A 4OQXA 3U56A 3TM4A 1FJHA 3E7WA 1UT8A 3ETLA 3AONB 2FUEA 4E4RA 1CQJB 4ARCA 3EWAA 3L8CA 1NL3A 5LPNA 3TH5A 1U2GA 1CVIA 3O83A 4I50F 1BJKA 1WZUA 1IG0A 3QOXA 4KODA 2DAPA 3OQIA 1PZGA 3AFMA 1GQOA 3HJUA 1LW6E 5EN4A 2CBXA 3ZZ1A 5I7SA 2I3BA 4RJIA 3QJZA 1IN1A 4MQEA 3AG3E 2AJLI 5FQ6A 4IIGA 5ALDA 2POQX 2OCGA 2G4LA 2P9SG 2ZUEA 3ZLTA 1ZRMA 1D2GA 3OCJA 4HKTA 2OENG 1TPZA 1UK8A 3FF4A 3IT1A 3ZHVA 1BC5A 1DC4A 2GF2A 3THOA 2JJ1A 1C81A 1G5RA 3DDUA 2HADA 2B92A 1NBIA 2DQSA 4IIVA 3FVVA 3OT1B 2X5TA 1WW3A 4E4TA 4O2LA 4YMVA 4PW0A 3EDTB 2FZVA 2YJ4A 1HSOA 3BQNB 3CGWA 3ORFA 3FDZA 1QIKA 4MLPA 3ZCUA 3UJ7A 2VDKB 4DNPA 4LZWA 3ZEFA 2R5WA 1DBPA 3AHCA 3EA5A 2TMKA 3OQPA 4U7PB 4UVIA 4CKZA 4Z8YA 1JDUA 3C4JA 3AL2A 5BSMA 1X8KA 2HRRA 4BNIA 3W7VA 3O94A 3HZRA 2V4LA 2HSZA 1Y63A 1NVGA 3UKRG 1UDCA 3WNBA 3QYFA 4KQ9A 1MFPA 1TYCA 1JAYA 4Q24A 1X7ZA 2PWZA 5IF3A 1YTUA 1TKCA 1R6AA 1GILA 4OMFG 4QHSA 4LYGA 2N9UA 3V4ZA 1OYVA 1E96A 4K9NA 1QC5A 4ZAXA 1UBLS 1G7SA 3UATA 4KJXA 4V3CA 2VDUE 3EF3A 4C1BA 4ON9A 4V0RA 4AJ4A 3ODPA 4FGJA 1JHPA 1IJFA 1IEWA 1SRQA 3GDOA 4RQTA 3VOTA 3ZD9A 3JQGB 3OJWA 2Q8PA 4HDRB 3U4AA 1PT6A 1QCCA 3V4VB 2X7XA 4CQMB 4J1TA 1J5XA 1BEEA 2V7BA 2EXXA 3ABIA 4B6PA 3ETNA 4TS1A 3A04A 4I55B 3HIZA 3FWYA 2MRIA 1XRMA 3F3KA 2ISQA 4U2DA 4AG5A 4B71A 4ENTA 4G0YA 2XRZA 4WMLA 3TL6A 3WVNA 4DR6B 3FMGA 4UHDA 4N5LA 4PLYA 1Z4MA 3KOMA 3WY9A 4QHYA 3LS8A 4DLUA 4ANXA 2D0OB 3OFSA 2XQJA 3NJRA 1BXGA 2QQ5A 4OJQA 1U8AA 2CFRA 2D3TA 4HJXA 1JS1X 4TQUS 4F2DA 5IX8A 1Z4OA 2ONYA 3LBIA 3NH9A 1IYGA 4FSDA 5M3BA 3L7OA 4I1IA 5DX1A 5HNKA 4FWTA 2CB9A 1K3FA 5A9SA 1NVXQ 2F8MA 3T3GA 2YMPA 2CUZA 3GMTA 1N34B 1I32A 2WU4A 1R7RA 1Y9DA 2CXUA 3DWFA 4K9SA 5JROA 1JKJB 5GP1A 1VMIA 3ZHTA 5IT9A 4HS4A 3GGSA 2NTNA 3EC1A 4M1QA 3AB7A 4EJMA 4FNOA 2KZTA 3MJHA 3GVPA 4LTMA 4RZUA 5LOVB 1Y98A 5EYPA 5C0OE 5JSFA 3RU9A 1EA5A 4BQRA 1FK8A 4EA8A 5AXBA 4BAUA 1LI7A 1EWRA 3MAGA 4NJMB 4RKQA 2ETVA 4JQOA 2HWWA 1XQ6A 1B1AA 1JFVA 5BT1A 2CHUA 1N4AA 1R10A 2F8TA 5DV9A 2GA9A 4ZRMA 2OILA 5AVXA 2VGYA 3PR3A 4IILA 4XPIB 4F85A 3K0AB 1A5BB 4I08A 1U99A 1JZQA 3H42B 4GYKA 1BYIA 2XEXA 2NYRA 2Q5FA 3MCUA 2HT1A 3ML8A 3MUEA 3ZW9A 4FOLA 4EFKA 3A1TA 4RQAA 1DQYA 4ACKA 1J99A 1TAGA 2VP3A 3JZIA 3QHQA 1XPOA 3FZYA 4DLWA 1G21E 5EJ9A 1S4MA 2UUCB 4AY2A 5D3KA 4B2PA 3S7ZA 1M67A 4OMUA 4RJKA 5FHRA 1M54A 3U7FB 4J6EA 3BRQA 1R16A 3IO5A 1NFQA 5FNZA 1FFXB 2NWQA 3T15A 3BK1A 4B3FX 4LF4B 2PSFA 3LKBA 1Q12A 1UC9A 4FC7A 3ASYA 2W2TA 3AR5A 2D54A 2L0IA 3L79A 1IN4A 1WD5A 4QOIA 4UPVA 1H0RA 1ZN7A 2R7KA 3D4LA 4R7GA 1G4UR 1QTIA 1TUBB 1GPKA 1U3FA 1Y8QA 1YHNA 2NNLD 1NUUA 1FDVA 2P9YA 4KQGA 5AI0A 5GOTA 4IMPA 3T9KA 2OGTA 4X8MA 4CW7A 5JALA 4ZTUB 3E2MA 1NJ1A 4FBGA 5TEVA 4JUAA 3VSEA 1FPQA 2RG8A 1VE7A 5DT9A 4C6TA 4H0FA 5HKOA 2KBFA 2W6JD 3CG0A 1E3DA 1FSFA 3BOSA 3GLGA 4D4KA 3SM9A 3R2JA 3F1KA 5BWLA 4A3VA 2WYUA 2XKBA 3MOSA 1Y4SA 2ADMA 3TD6A 4BV3A 5A4KA 3GLRA 4CM4B 1UKAA 1R6UA 2O3JA 1LLQA 2YL2A 2WHXA 4I1SA 4XSHA 4RD3A 1H2ZA 3D6AA 1WKBA 1Z2NX 1M1YE 3L9TA 4IJVA 4FDMA 2IY0C 4R7TA 4F96A 1PYGA 1H65A 4KR7A 2WXOA 2QE7D 3CLRC 1MVNA 4W5OA 4W4TA 4WQMA 4BBAA 2ZT8A 2WDZA 5JBIA 5DSTA 2B7LA 4J7XA 5AI8A 5JNUA 1E6MA 1LTHR 2DX7A 4UVDA 1TD9A 4EQ6A 1N4QA 2RSLA 2VP9A 4MZDA 3Q9NC 2VJPA 1Q2ZA 1EP2B 5DLEA 3ZU4A 4GOND 2F9FA 2HHCA 4GMHA 5KOJA 4YI5A 1XMOB 3QEAZ 2RE8A 3NWJA 5HKKD 5LOVF 2GBLA 1T6ZA 1BGXT 1XLTC 7MDHA 1M5UA 1HYQA 1DRWA 3B5EA 3FULA 1JQ3A 1W8DA 1SHJA 4IRXA 1TJ5A 5D2CA 1F6BA 1KE2A 4BMSA 5BN1A 4TQAA 1CDOA 3O03A 4CMBA 2W5UA 4YDYA 2V5AA 5JI3E 3EU5A 1U2EA 3R1IA 3DO8A 2DY1A 4PHHA 2Y69E 2OYRA 4X5OA 1BD3A 1XG5A 2IBMA 2XT6A 4NZPA 2OOEA 2XPCA 5HM6A 3MYYA 5F73A 3O74A 5K4AA 3VXKA 1KIMA 5KQPA 3PDCA 1XCMA 1MX5A 1DKRA 1Z47A 5KBAA 2Y92A 4YGYA 3UV3A 3OWHA 4IYRA 3LCRA 2R86A 4D02A 2JLCA 5DGXA 3K6JA 4JK3A 4FDUA 2GK6A 4G1EB 3WKCA 4YALA 1EJ0A 1JLRA 1G5IA 2ZT7A 3IP5A 3VYTB 1FPPA 1R9JA 3ITDA 3HXLA 3BGIA 1ZH2A 3NGXA 5CK5A 3IXEA 3CH4B 2QTAA 3G5AA 3HXBA 3ZDXB 3DNPA 5FKJA 5JJBA 3ML1A 2IXAA 1VPLA 4PC6A 5M7EA 3PFNA 3RLIA 3V32A 2AMVA 4RK6A 5CVEA 4ZVLA 4NBKA 5LDGA 5TQ0A 4MRMA 1CUGA 1IK6A 1A72A 4WCDA 1TNZA 3B95A 1T4CB 5ED0A 2BJVA 4HQNA 2QNIA 2PKRA 2ZRMA 5D3QA 2GASA 3OD5A 2PE5A 2PK3A 5IJ9A 4WH0A 5JYDA 2CFUA 2H4FA 2PL5A 3KR0A 4MUMA 4UFNA 1G1MA 3EXG1 3ZUVB 4ZHBA 1KJNA 2YIJA 4GECA 2WPNA 4PHTA 2XENA 2CWDA 4I9NA 4RK5A 4TVBA 1ZMOA 4QGGA 3EPPA 4YCBA 3PX7A 2HK6A 3CJTA 1U04A 3QXCA 5EPUA 3ICEA 2C8KA 1OD6A 4Y6GB 2ONJA 3ZXYA 2OO5C 2WU0A 3LUFA 2BJHA 3W6OA 2CL0X 3G2OA 1A2BA 3G85A 3KSZO 3WLKX 1T4GA 1W76A 4K7JA 1W9MA 2YW2A 2VXYA 1Q0SA 1JTVA 3WL3A 4WKNA 4JT4A 4PGMA 2PH7A 4HOYA 2WW8A 3CCCA 3B3FA 5M5BA 4P4SB 5CEDB 2KCLA 1RVDA 4LOLA 5CW2A 2KI5A 2IHNA 3THYB 4QPDA 1M0WA 1TF2A 3IAUA 5AW2A 1R0LA 3A1VA 1E69A 2WWWA 3GN1A 2VH5R 4K9LA 5H83A 2CWWA 3NHRA 1M75A 2FMHA 2QL9A 2LIPA 1YDEA 5FPKA 5C8YF 2GCOB 3D1JA 2FFGA 4FFOA 3X1YA 4Z9XA 3WGMA 1RHRA 4YB8A 2O8NA 3EZYA 4FW8A 4N76A 3VCXA 4AMGA 1V6AA 1KU6A 2ZUBA 4KRXA 1E9AA 2RD0A 1XQYA 2PMCA 1NA5A 2GZ3A 3ZXPA 1A4UA 1U5AA 1HT2E 1UMCA 2Y1WA 3PUXA 4PANA 4CMGA 4WK6A 2Z2JA 2Q4BA 5F64A 4FFSA 5I01A 1E96B 1KARA 4C6TB 1SG6A 1RHUA 3C6MA 3FUNA 3KXLA 3ZU7B 2O8VA 2B83A 3HNRA 1KI9A 5I7AA 3ZOZA 5AW3A 5JJKA 3LV8A 3MT7A 4F1WA 2Q2NA 4C78A 1JHVA 2GO1A 2I4IA 4JGGA 4ZGBA 1CJSA 1TLLA 2QOEA 3FX2A 4JUIA 5J58A 1XTBA 3IYLW 1NAIA 2RMKA 3LT4A 4LY0A 4EKNB 1JFFB 2CFTA 2P9TA 4E1VA 1GG8A 2QSUA 3AYXB 4G23A 3CWZA 3AHFA 1L7MA 3EGEA 4NYIR 1Z2PX 4X9XA 3GYGA 1TGVA 4LX0A 2ZBEA 1HQKA 4GKJB 1HG1A 3LTNC 3KWJA 2AOWA 3AR8A 3IE0A 2KJZA 3GVXA 3OF5A 1SZAA 2RAVA 4NATA 1O3YA 2QL6A 5H02A 1NKVA 4R0MA 4AQYB 4WK4B 2PFKA 2J7KA 2GFQA 5EWLB 2I4LA 4DFDA 4ED9A 2ACKA 3NBYC 4F5YA 2PM6A 1RRVA 3NHPA 1KRWA 1L7RA 1DJPA 2C9YA 3K9QO 4Q94A 3NZEA 5AOXA 4MITA 4X95A 3LFHA 3HK2A 4QQ8A 3LOPA 1DEKA 2AV6A 3R9WA 4CIBA 4ARUA 1LB1B 4YP0A 2QTLA 1KF0A 4CLRA 1PEYA 1U6JA 1DWOA 2CUTA 2EVWX 4X84A 5FTWA 3PXBA 4M0KA 4PTYA 2LCQA 5IF9A 3BB3A 1T9ZA 3GA7A 3LA6A 3X3HA 1UXOA 3Q15C 2QAGC 3BD8A 3ETGA 2IZ7A 2IHBA 2XKJE 4U63A 3FEXA 3F3SA 3Q7AA 4U7EB 1XXHB 1C29B 1N2OA 4UPDA 2ECPA 1N7IA 2HIMA 4L7TA 1DO0A 1QFSA 1FLNA 2X1LA 4ZAWA 1HL7A 4BGVA 2XHEA 3U17A 2ODEA 2WZCA 3ZHOA 5LDHA 4GP6A 1PGOA 4OK6A 5T3YA 1U9IA 2QZJA 2WFLB 4B4KA 3K9LA 1CX9B 1AQUA 2O5EA 4F45A 1AMOA 2JBWA 2P67A 2IUYA 2WIFA 4OYSA 3NT5A 3WNVA 2OHFA 3BWXA 2W2KB 4RKWA 2XB9A 1LI5A 2YKGA 1FJ2A 4U5XA 4EHAA 2DFLA 1G3RA 4LF5B 3J7TA 3F6YA 3O93A 2AEFA 4PINA 2G6BA 2AN9A 2Z95A 3SBXA 5JNVA 2M6KA 3P32A 3VYSB 1FFGA 3ASVA 1HO8A 4HDOB 4UARA 4CUZA 2C54A 3SBDA 4AKXB 3U26A 1WBDA 4PZPA 2OGUA 3AJRA 2EARA 3EY9A 4F93B 3GJ7A 1DXHA 2V6MA 1RXUA 5I8PA 4MKRA 4J7CA 1DQNA 4DR5B 2X0IA 1NVFA 2P3OA 3M4NA 2BKLA 1SCDA 4L0QA 1T1IA 3SX0A 4D81A 2CK3A 3PZRA 4FBLA 1X81A 4EGJA 3U3WA 3I0ZA 4FN5A 2IPNA 4BE7B 3N7AA 1JHXA 4BOYA 2JFUA 1W0KA 1HPLA 3O6VA 4FUQA 1OXMA 3A10A 3TZLA 4X1KB 3OWOA 3IEVA 1TPYA 1Y3FE 2JZCA 2W43A 2JGAA 2E48A 4XZ4A 5JXIA 3I01M 3CNBA 5KSYA 1A8IA 5JS7A 3UIOC 3EF1A 2OO3A 1RWQA 5DCLA 3EVGA 4GCNA 1PQWA 2XEDA 1OMOA 2YN2A 2X13A 1KZGB 3AERB 2N42A 3CISA 1JWGA 1IOLA 3IT3A 2QXYA 4P22A 1LDNA 3RTAA 1GD1O 1XOIA 4B6FA 4P82A 3H17A 1CUZA 4HMOA 5DNEA 4GPEA 3RASA 3V7WA 1G5QA 3OJLA 2QRJA 3QG5A 4X1IB 3ZWMA 3HXEA 2XEVA 1NWHA 3LRTA 5J23A 1WCXA 2IYRA 5DTRA 1JJ7A 3F97A 3JQ9A 3O8OA 2J4CA 1BROA 2QX8A 2CMFA 2C9MA 3U09A 4DUGD 4UQPA 3E1GA 4DABA 2H1VA 4MP8A 3BTOA 1ZWKA 1ZUIA 5ILOA 1MV5A 5ALZA 3WBKA 3NKVA 2C1ZA 3S5JA 1QBKC 3IX7A 2A0FA 5EWMB 3RSCA 1Y9EA 1F3OA 3C5EA 3JU3A 2JIZA 2X9NA 2RC6A 4KKXB 1FVFA 3I05A 5H3HA 4MUNA 5ALHA 4Q4JB 4B93B 2JFXA 6Q21A 2ZS8A 1ZINA 3MWYW 4P7KA 2BSAA 5JC8A 3ZLJA 1G8KA 3W77A 1ZR4A 2FRXA 4MI3A 3EEYA 4JC5A 1WQ4A 4QOSA 5AJDA 4AKHA 5JCJA 4O0LA 4WFIA 1RFGE 2VHTA 2ID4A 3OC6A 4NFYA 3BU8A 1MDBA 4WKOA 4XTRA 1BE6A 4CG0A 3HY4A 1ZD8A 2PBLA 1RW2A 3EXAA 2GTPA 5A05A 3V30A 1FTNA 2NM0A 3JR3A 2AVNA 3TG5A 4RVGA 1E2FA 3H3FA 3SKYA 1UINA 3GLUA 2VRNA 2QP3A 1O6CA 5DBKA 4HCJA 5CFNA 1T1GA 1WUHS 2GM9A 3DMFA 2ZJ2A 4O2RA 4L9SA 2CMGA 5FZRA 3HUEA 4Y6OA 5LBUA 3WOHA 3W5AA 1SCUA 3D9IA 3PGKA 4Q4LA 3K7EA 1W4ZA 4C5BA 2R6GA 2GEFA 4Y18A 1C4KA 1HTBA 1QGAA 2FMIA 1B4DA 5AIAA 5TMBA 1LDMA 1YA4A 2YJGA 1FFAA 4JHXA 1JHZA 4YMIA 5L4LA 1IRXA 2JLUA 3ZNPA 3IHKA 4GICA 5SICE 3DLBA 3G0IA 4XGRA 3W8EA 4IP0A 2HYZA 2JBHA 3C3WA 1Z29A 4X44A 4KRYA 1FUKA 4F91B 5C52B 3AR2A 1KI6B 3KX2A 1Y7HA 2ERYA 1WU8A 5BORA 1H2HA 3AXSA 1O95D 3EGIA 3MUNA 2YNMA 4TXPA 3E1KA 5KQRA 4XFKA 4EG4A 1G6OA 5E2AA 3EDRA 1O96B 3CQGB 2ZWVA 4G2VA 1OAOA 3OQNA 4ZYWA 4LMBA 3ROEA 3SQMA 1NZNA 1A9RA 3JPWA 3D9LA 4IRUB 5DOVA 1TTTA 1W5BA 1H69A 1WCWA 2AHOA 2PWBA 2XWJI 1NXPA 5BW8C 1JR3A 1T6BY 4MA4A 4P4GA 4TKLA 5ECWA 1PBNA 1R9NA 3I5MA 4QPZA 4DA8A 1RRGA 4XM0A 5CA1A