3PE3A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
701
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 268
structure length 701
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe3A03
2XGOA 1XL1A 2IFUA 1PYGA 1FA9A 3AS8A 1RZVA 3AS5A 2VCEA 5CCMA 5BW8C 2FF5A 4B94A 2LNIA 4XI9A 3JYSA 3ZN3A 5D00A 2HO1A 1Z8DA 2AVPA 4H7XA 4RG9A 2GPNA 4X6LA 4UI9K 4F96A 3Q5MA 2FEZA 1WW3A 3OTGA 1JIXA 2X0EA 1M5RA 2LSVA 2BISA 1P2GA 2V5FA 4M7PA 2VCHA 3ASDA 3Q3HA 4KQ2A 1W3BA 4J0UA 5HQ8A 2GM9A 4G26A 2PL2A 1FU4A 4YVQC 2OFFA 1P2BA 3OY2A 4WNFA 3QKWA 1QZ2A 3NC4A 5TMEA 3NPAA 3Q3IA 4HOSA 4I9EA 3S0JA 3UUXA 3OKAA 4I17A 2IEIA 3MV2B 3OXGA 1JIVA 1BX3A 2C2LA 3ZCQA 5A6CA 4W6QA 2XCUA 3GZ2A 4GZ3A 4CGVA 4EKEA 1WW2A 4UQZA 1HZ4A 3S7FA 3UPVA 5JTTA 3HBNA 2QNBA 3NP9A 3Q49B 3ZFWA 2SKDA 2DBAA 1HH8A 5I45A 1JIUA 2F3UA 3LPZA 2FI7A 2C0MA 2PQRA 4G25A 2XGMA 2QN2A 2QLLA 1HLFA 2GPAA 5A7DB 1P4GA 4I2WA 1HXIA 3ZHEA 1TJCA 3G2IA 1L6IA 1F0KA 4YNDA 1NLMA 3FP3A 3QWWA 2G9VA 3ULQA 2ATIA 2QN1A 2QRMA 4QLBA 1NOKA 3OT5A 3T3GA 3QOUA 5EX0A 1PC2A 3ZPJA 3RSZA 4WUYA 4GPKA 1L5QA 3CK7A 5C1DA 1A17A 3GPBA 3CEQA 2XCCA 5FZRA 3UYLA 4J8DA 2QFCA 4AMBA 3VDNB 3C4VA 2X6RA 1EM6A 1GGNA 1FTYA 4NESA 5FZSA 4CTMA 1JG7A 3NAZA 5G04C 2GJ4A 2XPIA 1QKJA 2PQNA 4WNGA 3CUVA 4GPBA 2FETA 3SZ7A 1H5UA 3FFLA 1XL0A 2AW3A 3FROA 3MS7A 2UWJG 2C0LA 4UI9J 5KJMA 2R4TA 2NC9A 4N3AA 1B4DA 4YI5A 5DXFA 2PRIA 4EL0A 1ZBPA 3T3EA 3NF1A 3R9AB 3K9IA 4YUAA 2VSNA 1F6DA 1NOJA 1P4JA 4G2VA 2QN9A 1YA0A 3MRVA 4N9WA 3CUYA 4JA7A 3ZHEB 3T3IA 5DLDA 2L6JA 3ZCSA 4I2ZA 1WM5A 2C1XA 4HWGA 4F97A 3MKRA 3L79A 4RIEA 3HYMB 1Y8MA 4N2SA 3GW4A 2WTXA 1LWOA 3Q3EA 3O3CA 2BGUA 1B89A 2AV6A 4W9RA 4U0ZA 2XGSA 1NVKA 3RIBA 4RIIA 3QWPA 1P5QA 2HY7A 2GEKA 2PYDA 3SYRA 2JLBA 4IN3B 4GCNA 5D01A 3ZCPA 4M60A 1PSWA 3TAXA 1WUYA 2QN7A 2R5SA 3LCAA 3COPA 3RKVA 2HYZA 3UYKA 1O6CA 1ELRA 4RIFA 4WHMA 2X0FA 3UQ3A 1FCHA 1IYGA 2KCLA 4N2QA 2GEJA 3TSAA 3OY7A 3CEJA 4YVOA 3OKPA 4BQEA 2KCKA 1FTQA 3BCUA 2VGXA 2UY1A 3MS4A 1GZ5A 4RG6A 1VGVA 1FU7A 3TG5A 2I6HA 1UQTA 4BTAA 2BGTA 4MRAA 4AY6A 2GPBA 3QHPA 1Y8ZA 2ECPA 2Q7FA 3H4TA 1J39A 1YGPA 4N3BA 1NZNA 1UZUA 1WV1A 4XI0A 5FZQA 4GYOA 4BTBA 3QWVA 3AMVA 1RRVA 1K08A 1XC7A 2QRQA 3HBFA 5EX3A 3MA5A 2AMVA 2QZSA 3BD7A 3CV3A 3Q47B 2KATA 4GYWA 4O6FA 2GT1A 1KT0A 2X6QA 3MQFA 4EKYA 3L7CA 3DZCA 3L7BA 3C4QA 2KCVA 4JHRA 1E4OA 3C48A 4MI9A 1RZUA 2XA9A 4LEUA 2XMPA 2SKEA 2O6LA 3BCSA 2R60A 3E3NA 3CVNA 4X7PA 1C8KA 4G1TA 3RO2A 1C8LA 2QRGA 2VG8A 3DDWA 3L01A 5G04J 1Z6PA 4RBNA 5JJ7A 2R68A 1GG8A 4MICA 2VSYA 1PN3A 4EJ2A 5HXAA 4HOUA 4KYOB 3AS4A 5TMDA 1WV0A 4REMA 3MT7A 4RIHA 4AM9A 2VGXB 1YA6A 2UY1B 3VTXA 4U04A 2ACVA 2QN8A 5DBKA 3GUHA 2R4UA 1C3JA 3NP7A 4NEQA 3S2UA 1C50A 3ASHA 2P58C 2VQ2A 3H4IA 3ZCVA 3O48A 2QRHA 5DU2A 1IIRA 1ELWA 3KS2A 3SF4A 1FTWA 2ZB2A 5JJ6A 5KJLA 3BEOA 3G2KA 3ZCUA 3E4BA 2BUGA 4RELA 1NA0A 4RIGA 4CTOA 3FWVA 2F9FA 5BT1A 4YI3A 3CK8A 3ASGA 1NZFA 4UQYA 3MS2A 3VUEA 4G2TA 2HR2A 3MSCA 7GPBA 1Y6GA 4KQ1A 2F3SA 2G9QA 3MEKA 4HLNA 4KBQA 4WNDA 2VGYA 3BD6A 8GPBA 3CK9A 3LY8A 2XA1A 4CDRA 3S27A 4AN4A 5FJYA 3CKBA 2E2EA 3RJVA 5EKQD 4PQGA 4EQFA 1Z6QA 4L22A 2KC7A 2PQ6A 1E96B 4N5CA 3MRTA 4F9FA 5IKOA 4AMGA 4CGWA 1NOIA 3MTDA 3Q4AB 4CTNA 2C9ZA 3OKCA 3CEMA 4MI6A 3D1JA 3CVLA 4U0UA 5FT9A 1LWNA 1Z62A 4FKZA 4LDPA 3QKYA 5BNWA 4F3VA 2IW1A 1GFZA 3CEHA 2H1FA 3ASFA 2G9RA 4WNEA 4J8EA 2IUYA 4ABNA 3S7BA 3EBPA 1QQEA 5KJNA 2JZCA 3S7JA 2G9UA 2Q6VA 1SXPA 2JJMA 3Q15A 4AY5A 4WACA 3GYZA 1UQUA 3E3LA 4MHSA 2FF4A 3KAEA 4Y6CA 4Y6WA 3L7AA 4G23A 1ZU2A 1IHGA 2QRPA 5LCWC 3SYMA 1KLXA 1XOIA 4BT9A 2MHKA 3T3HA 1P4HA 1L5SA 2F3PA 3MBOA 4AIFA 2LSUA 3TGOA 4BT8A 4Z5XA 1XV5A 2KS6A 3MT9A 1L5RA 4X7RA 3IEGA 3ZCTA 4XIFA 1Y6FA 2IF4A 2Y4TA 4HOQA 5FTPA 5HI7A 3CVQA 3ZCRA 1XNFA 2GW1A 4MI3A 4G24A 1FC0A 3QDNA 3HBMA 3OXLA 3LY9A 1E1YA 4BWRA 1AXRA 4N3CA 1L5VA 3LY7A 3BCRA 4UQXA 3S29A 4HOTA 5AYWD 3TG4A 4M83A 2X0DA 2VYIA 2PRJA 3MRXA 1P2DA 2C4MA 3OTIA 3CUUA 5ARFA 3URZA 9GPBA 2IV3A 3WC4A 1NZDA 3NB0A 4BQFA 1NA3A 2P6PA 4U07A 5ARGA 3RO3A 3VUFA 1KT1A 4NQ0A 1XKXA 4GA2A 1FU8A 1KTIA 1L5WA 2YQ8A 4I9CA 4NC9A 3PE3A 4GCOA 4BFCA 5IKPA 3RU0A 5TVGA 1SXQA 1WUTA 5LQDA 3D0RA 1IXYA 4EL5A 3N71A 4APOA 1K06A 3CX4A 3RT1A 3VDMA 4HORA 2J9QA 5GPBA 5D0QD 3BEEA 3NCHA 6GPBA 3U4TA 2FO7A 3T5TA 1GPYA 2XA2A 3E3OA 3LKUA 4I1AA 1L7XA 3VTYA 2IYAA 3G2JA 4ME2A 1OUVA 2YJNA 3ESKA 2C1ZA 2QN3A 3T7DA 3WADA 3MV3B 4LEIA 3RSCA 3IAAA 3PDNA 3LYAA 3EDTB 5TMBA 2ONDA 2IV7A 5M72A 1JEJA 3DD1A 3OXFA 5ENZA 2FBNA 2ASVA 4BQIA 4JL0A 2XCIA 4JA9A 2YHCA 2XCBA 3WXXA 3G2NA 4GZ6A 2FFRA 1FS4A 5KJKA 3GZ1A 5D0OD 3MTAA 3CVPA 4A1SA 2XEVA 4U0SA 5CHEE 2OOEA 4GZ5A 2PYIA 2SKCA 2QLNA 2IEGA 3MT8A 5LCWJ 3T3DA 5JTUA 3BDAA 3WAGA 3G2LA 4GA1A 5G05J 4GA0A 2Y4UA 2BFWA 3IA7A 4NRHB 1JG6A 4RENA 3CV0A 3D0QA 4WADA 1PNVA 1AHPA 4KQMA 1P29A 3CUTA 3L7DA 4KXKB 4J8FA 2R66A 1QM5A 4X7MA 3MTBA 3DDSA 3HBJA 2AZDA 3G2HA 3S28A 2H1HA 3PE4A 1ABBA 3U3WA 1GPAA 3S7DA 3RHZA 3BD8A 2ACWA 1V4VA 2IYFA 2WPVA 3ZGQA 3EBOA 3TOVA 3CKCA 1A8IA 3OTHA 5JJTA 1WAO1 2PZIA 1GPBA 4GYYA 5DIZA 3CUWA 4N39A 2F3QA 2WQHA 1EXVA 4MHOA 5G05C 5CCLA 2QLMA 4UI9C 3KD7A 4H7YA 4FZRA
chains in the Genus database with same CATH superfamily
2ZULA 3IUYA 1KKUA 4LJYA 3KZ1E 2IU6A 4XI9A 4JLMA 1Z8DA 5DYGA 3NWEA 3C5EA 5TRTA 1PNRA 1K4YA 1HKHA 3RGWS 4FNAA 5CX1B 3FPHA 4J0UA 1XVTA 2P2YA 3TNDA 5JXHA 2C2KA 2QE7D 5KQRA 3W1VA 2CLKB 5EIOA 1BVHA 5ALVA 4B82A 3HSKA 4D8XA 1LDYA 2QMYA 3UENA 1OX4B 2F3UA 2FI7A 3DMNA 4ANVA 1BGXT 4EYSA 2PX4A 5DF1A 1MIOA 2J6CA 3P8ZA 5HG0A 2F62A 5GINE 3I5AA 1ISIA 3M3DA 3BH7A 1K8XB 3UM3A 4C1NA 4MGEA 1FTYA 3OP4A 1YFKA 1JG7A 1CFJA 2A7QA 1QIJA 3H1GA 1JTVA 3SC2A 1YRAA 4MW2A 4II3A 2VNHA 5THQA 4Z99A 3OLYA 3J81A 4ZJYA 5AMXA 3DLAA 4G85A 4NY1A 1JFFB 3R9XA 2GJAA 1PS9A 3EG5A 5LB4A 1ZR2A 1RKBA 4FDAA 5ERXA 2EP8A 4L2IA 4L85A 4OLJA 3RBZA 4JSTA 4QNNA 4L1KA 4XJXA 4GCNA 3SZRA 2DFVA 1NUTA 1Z18A 1WUYA 2QN7A 3PVLA 1IN8A 1C1DB 2AI3A 2J0UA 2XMGA 5KTTA 3GYGA 5MF6A 3OLQA 3E9RA 3I73A 4GNRA 3C3OA 2JGDA 1SKMA 4JD5A 3BHJA 3ZVRA 1GARA 5JS1A 1SH7A 5JZMA 4LYFA 4KH0A 1RI2A 2PJUA 2P2ZA 4AQYB 2ECQA 1RPNA 2ORIA 2JI9A 3TRIA 2BFEA 1GCOA 4QWWA 4CIBA 5AM0A 4HLLA 2XB9A 4LQ4A 4Z1MA 2QRZA 3WKAA 4CTOA 3ID6C 4PHFA 1JHPA 1SEVA 4EITA 3ASGA 4KT6B 3ZV7A 5F77A 4HRXA 1BEZA 2MYPA 1L7RA 3DL4A 5IWCA 4WNDA 2RH9B 4RF3A 1HQKA 2FE1A 4ASUD 4DNQA 2YNMC 4AXBA 1QRRA 2R2GA 5JMWA 4FDLA 1PJSA 1ANKA 1Q3HA 4N6NA 3X1YA 4B48A 1PF7E 4WMLA 3WLAA 1AT1A 1U3UA 2P9SG 3DTVA 3TQRA 2ZXFA 1E2BA 2NZYA 4LDJA 4A8HA 3AI1A 4F8YA 5J08A 4RC9A 2VAPA 3JQAA 1MDBA 4LHEA 4QNRA 1E5DA 5JQWA 2GBGA 5AESA 4KWIA 3TE6A 2VDKB 2XE7A 1Y5RA 1O1RA 4DCNA 1X1TA 1TZ2A 1GA4A 2ZRJA 4LRXA 2O8FA 1UBEA 5KYTA 3IVCA 4LY9A 3BCRA 1DFGA 3M49A 5LQSA 3AFOA 3LGSA 4J1SA 1AY0A 1ETUA 3K5WA 1HG5A 3DOCA 3P26A 2E48A 4U7FA 4ZCQA 4ALLA 1MV8A 2DLCX 4FFNA 1TW2A 4G37A 4HUQB 1Z0FA 1INLA 2D74A 3D0OA 4ACAA 5SZHB 4B3BA 1KWGA 2X0IA 1YDFA 3D7KA 3M2TA 3UK7A 4WKOA 2BR3A 1CZUA 1T3LA 4DPRA 3ADKA 1U2QA 3PDNA 1DAMA 5ERGB 3IEVA 5TMBA 1AKMA 4G4JA 2ALJA 1TKCA 1MC4A 1NVEA 3PZ3A 1US8A 1NYTA 4JOCA 4RVDA 2IY7A 4N48A 4YAKA 3ZDFA 2GA9A 3LOUA 2CXXA 2SKCA 4JB3A 1HWYA 1D0IA 4E6HA 3K0HA 2BSXA 3A1NA 3MGBA 3L1IA 2CVHA 3FTNA 7MDHA 2R8OA 2XNCA 1FRQA 2Z43A 1Z3CA 1V7CA 4H2DA 1PSZA 1D7AA 4I99A 2J30A 1IN7A 3UVEA 3DZBA 3WWCA 3L41A 3VYRB 2IIPA 4B4OA 4RLFA 3CUWA 4YCMA 4G6ZA 2A5LA 1N4DA 4KXQA 3PEYA 2ID4A 2PMBA 2B36A 2QPLA 3DXZA 4CYMA 3KKQA 4O4LF 2YRWA 4F91B 3QGMA 3H1PA 1OJ7A 4OAVB 1F06A 5DM4A 3ASDA 4WLUA 4O2RA 1Z6XA 1Y4SA 1L4MA 4EJSB 1K8YB 3HKCA 4BMYA 4QUGA 5DGXA 1DTSA 1E1CB 3B6MA 4JKIA 3MINB 3H75A 3IT3A 3NIDB 3RG8A 4GQAA 1NN3A 3CS3A 4JB2A 1D4AA 4X1IB 3F3MA 3WMFA 3PGMA 3TINA 3DQQA 2PX8A 2Q5QA 1XCLA 5IDQA 5JEDA 3GA7A 1A17A 3SK1A 2UVPA 1F8YA 2BI4A 10MHA 5HE9A 3U3RA 5G04C 2GJ4A 4KYUA 1PV2A 4F2WA 5I8WA 2HFJA 4ILGA 4MS1A 3KYCA 3JQ7A 2CXUA 4QRIA 5JMOA 3W9FA 3HP7A 4OYSA 3IURA 3N76A 1U2VG 2IHBA 2GPWA 4S1TA 5D5HA 4YP7A 3CEAA 2ACKA 3IMCA 1B89A 1MX9A 3MWJA 3VMMA 3V97A 1GHTA 4B4KA 5HJEA 4TM7A 4F84A 5BOSA 3MZ0A 3HXFA 1RSZA 5DBGA 4HYTA 4KE7A 2FOXA 2G7MC 4INOA 2ZUCA 4KRGA 3OOWA 3D6TB 4FZ3A 2ECPA 5AENA 1SVMA 2AMLA 2XUPA 2AWNA 2VHXA 5EZQA 4B6RA 3IR5A 2Q9CA 4GOND 3PS6A 3INYA 2WWIA 4O63O 3KZOA 4Q24A 4DPLA 4FGUA 1Z3YA 5KWDA 3QOFA 4ARUA 3N2KB 2PL9A 4GP6A 5JNWA 4E33A 1OBOA 4RBNA 2WSSD 1R6BX 5A1TA 4EGCB 1YR2A 4DSAA 5DI9A 3L77A 5DBKA 4D9KA 3ETCA 2IHTA 2H48A 2H7VA 2D2FA 5BT1A 1N5JA 2PKEA 2XY4A 5E3IA 4J9VA 4MP3A 4J2TA 1CVIA 1N6HA 4EHMA 4R1LA 4AN4A 4L0QA 2DHDA 3KSZO 1N6KA 5CFPA 2YDYA 3BMQB 1USVA 2J4FA 3OFNA 2X4GA 3JWPA 2JFQA 1ZDMA 5BVGA 1GUYA 2YRFA 2HR1A 1O97D 1Y3CE 2ATEA 4BECA 3B70A 4K6GA 3OF3A 3T94A 4U8HA 3OM8A 3I9MA 1J5PA 3JASA 4B3MB 2FEAA 3LPAA 3R7SA 1H6AA 2EKPA 4UM5A 2OLEA 4E46A 3HDHA 4JEHA 1FVOA 5DMHA 1S3GA 3PQEA 4HLEA 2V5UA 2AOXA 4RXUA 1M2VB 2O20A 4E2WA 3LWBA 4CMGA 2FVXA 2QUBA 3VU3A 1O1SA 3UIEA 1IHBA 1A9OA 5J3JA 2H1RA 3HGTA 4URHA 2PIAA 2C54A 3FBWA 5AW5A 5IKPA 4D4MA 1TXGA 3L6OO 4MUHA 1JBKA 1CPYA 1WDWB 3W78A 3H18A 1KE1A 4TLBA 5BW8A 4TYWA 1WWKA 4C6RA 2B6NA 4WCFA 3IAUA 3S40A 1Q74A 3AF4A 3Q12A 2JI7A 4K5AB 3DW3X 1KS9A 4R1QA 3SG0A 1SUCA 1NE7A 2V9CA 2WM9A 2PA3A 3D6JA 3WK6A 2GN8A 5JXGA 4YDEA 2AOTA 3UM0A 3IA7A 1PUIA 4DBVO 4IJQA 4GPMA 1ZN7A 3QLUC 4K81B 2E37A 4RZXA 5AW1A 5AOAA 4Q4AA 5LJLA 5K51A 3ZHQA 1H23A 4IZIA 1Z0ZA 1UFQA 2C2XA 3JQEA 3USCS 5CG2A 4UCWA 3DT8A 3PSHA 3HXTA 1T4GA 2OMEA 4XR4A 1VJ5A 2DOKA 4A5OA 3IOMA 3J81k 3ABRB 2XADA 4A9AA 4DARA 4EYEA 2X23A 3Q9SA 1CP2A 1FT1A 3O31A 5LXTA 1P2BA 1J97A 2FXIA 4ZYVA 4HNSA 2UAGA 3PBKA 2IU4A 3OQIA 1XRNA 1U0SY 1A8HA 4PZZA 4BO4A 3F1KA 1L2TA 1H6BA 3ASNE 4G36A 1H1TA 3IAS6 4UD6A 3N53A 1BVUA 3FTDA 5TE9A 4QNMA 3WZ2A 2GPAA 4YT5A 1TNBA 5EUMA 3B38A 4RNCA 4CIVA 2XWQA 3EOZA 1UDRA 3DL2A 4HQNA 4MRSA 4B6JA 1RNLA 3R7NA 3D1VA 4YJDA 5JWOA 5JJCA 4MVJG 4L5AA 3E9YA 3DLPX 2UYCA 3FX2A 5TJ9A 4KRFA 3PLRA 2WD8A 3OH8A 3FFLA 5JU6A 4FKMA 1ORVA 2FPXA 3SQWA 3UXYA 4Q94A 3DE0X 4N9WA 3G0OA 2DFDA 4AX8A 3MKRA 5K0NA 3CG4A 3DM5A 3QELA 1T26A 5IHPA 2D2XA 4DLKA 2AL7A 5C5EA 1E9FA 1FLDA 2F9LA 1UOPA 2A14A 2C4WA 5JNUA 3T0GA 2UY1A 2YXNA 4RG6A 5JI3E 3FGNA 2IUFA 4D42A 2EIKE 4EFMA 1RE0A 3S99A 1S9DA 2WYIA 1UEIA 4GLOA 2JFBA 3AVWA 4RD0A 1KAHA 3DWFA 4AAYA 4DMFA 4HGPA 3E23A 2YOGA 3T41A 4PX3A 5KX5F 3KKNA 4Z7OB 4JQOA 1DIOB 4AZWA 5DU2A 2Q41A 3IGFA 3HL4A 5BSWA 3WOVA 4HQLA 1B41A 2JGMA 2IYTA 3ZI7A 3DLHA 5AOVA 5HP4A 1LPAB 3BDIA 4RJLA 3F74A 2GCGA 1S3IA 3GFSA 4XX5A 4CN8A 2EKQA 4HWRA 4L22A 1RPZA 4BKOA 3S81A 2VI5A 2WUWE 5L3SB 4UWHA 1SPXA 1K86A 2JLUA 3MTIA 4P4UA 1QHXA 2XBLA 3T1TA 1YONA 2GARA 3FSGA 5BORA 2OLKA 3O8QB 2IPNA 4Y6WA 4UE2A 4UWFA 1IBRA 4ZMBA 5IWAB 3KE9A 4KNVA 5J4VA 3G9TA 2GJSA 1C3OA 4G1BA 3OOYA 4LRSB 1IEQA 4IG4A 2A94A 4M76B 1TUBB 1IN6A 2HLDA 3LCUA 4ILIA 3QP9A 4ZO8A 2A5UA 3HACA 3SM3A 1MT0A 5ARDA 3PGKA 3P71T 3HU1A 4B2YA 4GA2A 1P1IA 3DC7A 3I5MA 2IZZA 2ZJOA 2WHXA 2NVUB 2ZR7A 2PY6A 5E4YA 5HA5A 5CCEA 4NXNB 1H6CA 4UHFA 1OOEA 3CH5A 3Q15C 3DOFA 3IV7A 1E7QA 1EFCA 3AU9A 3KCNA 5CA1A 3TXXA 1MW9X 2OYCA 1IONA 2PH5A 3X44A 3CRZA 3TZBA 4HNQA 3GH3A 4F8EA 2PR7A 2FUG6 5EIFA 3FJYA 4P80A 4C1BA 1GZHB 3RSQA 4LNBA 3BXHA 3M3PA 5FPHA 3HABA 2P9JA 1QHHA 4H7KA 4F56A 1Z5UA 1DQZA 1OLXA 4ZOBA 4ZZ1A 2HH9A 2WPVA 3TIIA 3ZTWA 1ZD2P 4QBGB 2VHZA 3E1GA 1CUCA 5KTSA 2RKWA 4PCUA 3GVCA 2ONKA 3MZLB 3JYSA 4EZIA 1JR4A 1ZM7A 1KVUA 1KGDA 3NWPA 3FNHA 3CSDA 1D4OA 3QFFA 3DG9A 3I9KA 1W3BA 3WK5A 3KQKA 3DCIA 4X20B 1A4UA 2ZAMA 5ARCA 3GLIB 1JPLA 3JQ1A 3DAHA 3R8CA 1A8UA 1W35A 3ST7A 4IXTA 4TVSA 2J6BA 1Q19A 1IZZA 3KKMA 5K4HA 5C9ZA 3UFBA 4MUIA 4IO1A 2QN2A 3DBSA 4V1CA 4Q5IA 5SYAA 1I13A 2CXNA 2H4HA 1F0KA 1T3TA 2H54A 3WSVA 4J8DA 1S7GA 3EMKA 4H7FA 1L5OA 3ZNQA 3ETJA 3B13B 3DOIA 1BE1A 5SY9A 2Y6UA 3TUIC 2QG4A 1P31A 5AVOA 4RTNA 1NQAO 4LJ5A 4CLOA 1ZVMA 4C01A 1IOVA 1WMAA 1R4NB 3EMDA 4MWZA 1KZ4A 4N54A 3U64A 3L0OA 1RFGE 1E2JA 1M5UA 2E1RA 4FXOA 4TYNA 1UKEA 1RVV1 4UUMA 4OHRA 1QYRA 4G0NA 1KXJA 1TQHA 2OWDA 3E0XA 4IS2A 2VHYA 1A7JA 3WP1B 2G25A 4CIDA 1NJ2A 1UBOS 3BXEA 3D64A 4H08A 2ZKIA 1RP1A 1SBCA 1NASA 3O4RA 2ISSD 5HR5A 5KNGA 1ZGJA 3H17A 4W82A 5CJPA 4YMHA 3LOPA 2GN9A 4LOKA 4DV6B 3A6GA 3K72B 1J0DA 4C0AC 1WCV1 5BNIA 3FYDA 5ITSA 4C0JA 4Q05A 5BMVA 1SZPA 1M2HA 2YCLA 3WGNA 3JQ0A 2WSMA 4WERA 4GXTA 3OPYA 4KC0A 4MVJH 1SCDA 4XJTA 4OA5A 3NYIA 3UXEA 4AZ3B 4S35A 1ZIOA 5D87A 3UGTA 3WOHA 4BLSA 1L5NA 4YJGB 3R7AA 5GMOA 3RLIA 4GM4A 4IPTA 2IHYA 3GCXA 3OFVA 3D9PA 3FXAA 1WLYA 2LAIA 2DY1A 5BNWA 3NC1C 4IS3A 5A9SB 1KP3A 4IDBA 3ASFA 3UB2A 2LWIA 1CYEA 2G9UA 1NBHA 1JQDA 5BW5A 1MO4A 1YJCA 2PKCA 1QZTA 2BN4A 4YHBA 1PJCA 5FOVA 2ZVJA 3LM8A 4J0IA 4L4SA 1I1NA 3BK7A 2XQGA 3U62A 4FWBA 3SJAA 3D2BA 1DP4A 3DAFA 4ZAZA 5CB0A 4BE4A 5CECB 4DWJA 4ZGBA 2ZJ7A 1NXOA 3EDOA 2HNKA 5DRYA 3QW4B 2BHTA 1YC5A 3TPCA 2XNHA 1UF9A 3CLUC 2WWTA 2R44A 5A5DA 3DMHA 1QO9A 2HF2A 2LXMA 1A9PA 1PTJC 3WQSB 4TVBA 2QAIA 1ZQ1A 4L2YA 1GKKA 1X81A 4PPQA 4MV6A 3LXUX 1P60A 2ZBRA 4L4UA 3T15A 3NG1A 2C0PA 1YK0A 1E8NA 1A8SA 5FTJA 1WZNA 5ALZA 1SVKA 1XRJA 3NI2A 1AK1A 2FJBB 5EIHA 5JT1A 2AJLI 3F9IA 1QU3A 2F9MA 3FUJA 2JVKA 1U9IC 2PRKA 4I55A 3RFTA 3LP5A 4A16A 1ND6A 1T9ZA 1SQMA 1JEJA 3PH0C 3IPYA 5L7YA 2VQEB 4OJKA 2F64A 3EZ9A 3M4NA 1NWHA 2YWHA 1IWPB 4DZRA 2PSFA 1OY1A 2PN1A 3C8DA 4CDGA 5B4UA 2YUIA 2PS1A 3MTJA 4NBVA 1EI9A 4M98A 1AB6A 5G05J 1LDBA 3AF1A 5B64A 3VHRA 3ZDZB 5TPZA 1O4VA 4M0FA 4AXXA 2LPMA 1NMZA 1QVWA 1ADFA 1YULA 3CKCA 1HSZA 1DXYA 5D7NA 4IWNA 5B58T 1KPIA 1OFHA 1IXZA 2YOFA 3DF7A 3HJHA 3HV0A 4HVBA 2KJZA 3A36A 1YQTA 4GGMX 3W5AA 1Q84A 5L4LA 2ZPAA 1AGRA 2RGNA 3OM0A 1NM5C 3NHYA 2XXAA 1UC8A 3FUDA 4KV7A 3LJKA 4WKNA 3N07A 4RK6A 4G26A 1W96A 1G8SA 2H2AA 4ZT5A 3R6TA 3I45A 1NAHA 2CFIA 4N6OA 2DR0A 4EY6A 1XWIA 3MV2B 3FGZA 4KMOA 5CYGA 1JDBC 4EKEA 2EGUA 2YHUA 3S7FA 3EDYA 2I6TA 4R9UC 5BRAA 3IPCA 1T34A 3AESB 3TZQA 2YFHA 3OUZA 3Q9NA 4JIMA 4IIJA 3H2KA 3IDFA 3U6KA 4MZXA 3FU3A 4B4DA 1GQYA 2R87A 5HF8A 1HX8A 2UZ1B 5E9QA 4KHPB 3W7AA 1YVPA 4W9NC 1PL0A 1CS4C 1P2TA 3FH8A 5KKNB 2B9EA 2GWHA 3HXPA 1EFTA 2E89A 3FOWA 1FNSA 1E5XA 4CMEA 4XTCS 1OLOA 4LQDA 4QJBA 2NO9A 3T95A 5LQCA 1RWOA 3EEBA 1YMPA 1H0KA 3W8FA 4RVBA 1CP3A 3PD0A 3L17A 1NR1A 3I5PA 1ZM4A 4GE0A 2KCLA 1XN4A 2OSVA 3KSRA 3UUWA 1V95A 1SVIA 2WI8A 3AU8A 1F9AA 1T1EA 4GB9A 4OI1A 3HN6A 5FJJA 5ENSD 3AMVA 4IYPA 2YHEA 2OBLA 2C8VA 2Z4SA 4CF3A 2I55A 1VI6A 4ZVSA 1NU6A 3DDHA 2J9ZB 1N57A 5CNJA 3V1TC 4E1AA 4UFNA 1GG8A 2JVIA 5LA6A 5FPSA 3D8UA 3HYRA 3TXAA 4NEQA 1E59A 5C5DA 2P58C 4GYJA 2NUTA 3TLZA 2GEDA 1GRQA 4DWOA 3KM0A 3MJTA 2SCUB 4ALIA 2PRZA 1KPGA 4CZ2D 4B75A 2AXNA 4ZYUA 4RNDB 2BTQB 4ENQA 1MX6A 3ULEG 1Q7BA 4KO2S 4L72A 4D25A 1XZMA 4F1JA 3GT0A 4QQRA 2VQSA 2O3TA 4YT8A 1M3SA 2PKQP 1M7GA 1IQUA 4LF5B 2CJWA 2K4MA 3N7UA 4QBKA 1Z08A 3ZY2A 3LE8A 3EH1A 4LDPA 2XPYA 3HY6A 3HPQA 4MYUA 1WKCA 1YBHA 3TIXB 2X7HA 3VVCA 2QTWB 4QARA 4J8PA 4EVRA 4HXYA 3RBAA 1QHFA 3WSWA 1PV1A 1J8YF 4INPA 4IRUB 1JUDA 1I5RA 2ZTSA 1XJQA 4PLGA 2QMOA 5ANLA 1BHSA 3T3HA 3K20A 1HE5A 4KK4A 4QM6A 2OV4A 2KX7A 3VPFA 3V7UA 3G85A 4V0SA 5CW2A 4YPVA 3HEMA 3FUVA 2O8VA 3R5SA 4G01B 5TR9A 3OLCX 3FGPA 1JA9A 2PRJA 1OI4A 3G7UA 1Y33E 2C4MA 2XEXA 4HRMB 4DDTA 1DRVA 4WFIA 3EZYA 1M8GA 3L1VA 3DZDA 4JQYA 1QCDA 2XTZA 2EP5A 4BFCA 4WW0A 4NBLA 4O33A 4YMIA 4OOFA 3NYRA 2FO7A 1KL7A 3PRYA 3HZHA 3EISA 4PZAA 1A4RA 5CT5A 4J7WA 3T7DA 3EGXA 4UNSA 4BQIA 1I3KA 5INTA 3MWLA 1N7GA 2QD4A 3OZCA 2J9FA 3F73A 1DQNA 1PT5A 3EXHC 1B93A 1VZ2A 2C7PA 5CK4A 3R1IA 1CE8A 4DX5D 5CUQA 4DDVA 3EXG1 4W5OA 4BGVA 2EGHA 3DOOA 4XE5A 3I62A 1P29A 3HJCA 1IXRC 3ZYZA 1NI4B 1EFVB 4NYMQ 1C80A 1A8IA 3R5JA 4UATA 4IX9A 5KVQA 3R44A 5JLAA 5EWLA 4ZCPA 1K75A 1AUPA 4HX9A 3T8KA 2BPOA 3VR5D 2AI1A 3A6EA 3BORA 4MR7B 4PHGA 2XECA 4RDIA 3H5LA 1E60A 2B6CA 2J9RA 1NONA 1FSZA 2XKAA 5K2OA 4BNFA 2IYNA 2ZUEA 2IEIA 2HOQA 4AKIA 4GXRA 4RH1A 2J0QA 3LPCA 5CD1A 5FJIA 4Y7CA 5CBOA 4MDEA 5HS0A 5KSZA 2H1OA 1MEJA 4AYWA 3RSZA 3N7AA 4J0DA 3ZUVB 4I08A 1TM3E 3I05A 4G0PA 4HEHA 3H5RA 4X3OA 4CQLB 1VBFA 2CDAA 1OWLA 1E2HA 3SQXA 1ZBPA 4IP0A 1MFZA 3PA6A 2CNWD 1GAXA 4I2ZA 3K5HA 2UZIR 2GFHA 3GP8A 5HBGA 3KEGA 2IZOA 3Q75A 3FHCB 5DBEX 4LGYA 3BG1B 2FMUA 3DUWA 3Q7SA 1W8DA 4K6MA 1FUYB 2X0FA 1QV6A 4OOEA 4INAA 1WKBA 2Q3BA 3AZOA 1RCTE 5D2CA 3PEVB 2XE8A 3KIPA 2CWWA 2Z5GA 4MV0A 3K9WA 3PPXA 3KZXA 4OGGA 2RHJA 1WDLA 1YMUA 2F8XK 2I0FA 3CHYA 1DG1G 3G8AA 5JZ9A 4P29A 4EMUA 4GWGA 5I7UA 5JSUA 5IJ9A 1IY0A 4ODIA 3KR0A 2Y1WA 3EZ7A 5F9FA 1VXRA 2O8CB 2F8MA 2E7ZA 1NAIA 2NZUG 1LI7A 1KZHA 4R40A 1U9ZA 4E03A 2VAWA 4XFJA 1ZIYA 1OD6A 2H7XA 2EW8A 4IXWA 3HSSA 2C9YA 3RSGA 1II8A 1DXHA 4CCAA 3IXLA 3DA8A 3I3SR 5BPFA 5CNMA 1UKVY 3U3DA 3IR6A 5JG7A 1LBSA 4QOHA 2FR8C 1RWVA 1RI4A 4BASA 5L51A 1W0KA 4A3VA 3W3AH 2XWPA 3G0DA 2VBFA 3D6MA 4HAWA 1UKAA 4M22A 1ZZGA 3R3HA 4YRKA 3QPBA 3GLVA 3LWDA 5BV7A 4M86A 4J43A 3EXIA 4WT7A 3CMMA 1AV7A 3FZYA 4QPCA 4S1VA 3L4KA 3VBCA 3G68A 3HDJA 1CUUA 1SXJE 2YXDA 2QTCA 4Z0NA 2FMXA 4MINA 3I3NA 1DWPA 1GV0A 4Y2VA 1VGQA 2ZRHA 3S44A 4G86A 4DA9A 4V0KA 2WWRA 2FPMA 5FP0A 4G5GA 4O4HB 2I7DA 5EWMA 3ETLA 4L23A 3WMEA 1DBSA 1ZNYA 1COWA 3NORA 4RKEA 1PR0A 2AFIA 4KFSA 4DL9A 3Q0EA 2EARA 1XTZA 1HDIA 2DBZA 1EUYA 1FXWA 1DJNA 4C9BA 3RUPA 4YQEA 3QJ5A 2JLXA 4A6XA 3KQHA 3VVBA 1VMIA 1G8YA 1V8OA 2ZROA 4HF7A 4M0MA 2C2MA 3M5DA 1P3JA 3G8BA 4ZAFA 3TJMA 1HXHA 3QVVA 5AO9A 4C20A 4AJ4A 4NRHB 4PFQA 4FHDA 4MA4A 2QXYA 1AU9A 5K20A 5C7YA 5AXAA 1ZK1A 3AV3A 1MOSA 4MW5A 2ATXA 1F2TB 2QR2A 1Y0BA 3LT0A 4RZIA 4Z9XA 2C2ZA 1MX3A 4IVRA 5CLLA 3VR6H 2RAFA 1XTIA 1VLJA 4GP7A 2O14A 4BP3A 3PC8A 5HOQA 4UQPA 3AVVA 4WAFA 3B1VA 3OQHA 2LNIA 4QYMA 2FLVA 2PSEA 3EU5A 3X0DA 1E2UA 2VKQA 1OZHA 3JQ6A 4HDSB 4YDYA 4IHJF 1Q92A 5ANRB 4C4RA 4YJ2B 3KSBC 1XCBA 4ZVRA 3N2ZB 3UMYA 2VDWB 4PNHA 3VMFA 5ENTD 2ESRA 1DKMA 3O2SB 1D0SA 2QROA 4NJEB 1KO7A 1NZJA 1ZB1A 3BH6A 1G21B 4ZREA 3KJXA 3FCXA 2AA3A 4M1SA 3DSXA 3G0BA 4D3SA 4HBDA 3DR5A 2WHPB 2MSDB 1E8XA 4E7PA 1NVXQ 4HWTA 2PZEA 4BXOA 1E4VA 4E32A 1GCIA 3H2GA 4M1YA 1IHOA 2YJ5A 1Q83A 3UUEA 1V9LA 4JJ4A 1IC6A 3LKBA 4UI9J 4QEDA 3AWIA 1FXSA 4CE6A 3ZZ1A 1MQ9A 4U7GA 4NYIR 2JLZA 3SF8A 3L79A 5JUWA 5KYWB 3EHMA 3D8HA 2HK9A 4EPRA 3PITA 4CQMA 2A5GA 2HFKA 3UYKA 2ZWAA 3ZU7B 4KYVA 2BI8A 5AKGA 3RWMB 1Y9ZA 3OY7A 4FE4A 3FCYA 4RZUA 3L6DA 4F3KA 4HRNA 3HRIA 1CYDA 4R5MA 1ZMTA 4D57A 1G18A 1UQTA 2DERA 3GAAA 3LDZA 2YTZA 1IY1A 1XF9A 3I6YA 2JGAA 2B8EA 4MITA 4JJ7A 3ZHYA 5IZCC 4GYWA 3QOWA 2QK4A 1E4EB 3V1YA 1YB2A 2E2WA 2R8EA 3H2IA 2C59A 5F7ZA 1FFXA 5IEJA 1C9MA 2CXSA 5KQPA 2GLUA 4K6HA 5FWYA 1QGAA 4YP9A 1Y5MA 2VP6A 4MPDA 4XXHA 3W79A 1SCUB 3GDGA 1GZSA 1C4KA 2P2NA 3SGLA 2RJNA 3MD0A 3BKWA 1KORA 3ZLJA 2P9CA 3P9PA 4LHWA 4ETIA 3D43A 4PQGA 1OCRE 2VK1A 1A5AB 4MI1A 3ZN2A 3VZQA 1MH9A 1LC0A 3F6QA 5IKOA 2AOUB 4B76A 1NNUA 1WXWA 1H8HA 2DUNA 2I03A 4UTXA 2FJPA 4FFOA 4Q9AA 1AF7A 4DQ0A 4ZVKA 4UHCA 1RLOA 2JH3A 2OZLA 1OCEA 5EWJB 1XKTA 4GT1A 5B7QA 2ZUWA 1XZPA 2NZVG 3IQDB 4NZ9A 3THSA 3PL5A 3RU9A 3IOBA 1RYEA 2V3VA 5FI0B 3AVXA 1HT3A 1N25A 5ITVA 2WG2A 3AJAA 2Q49A 2ENWA 3BMXA 3HE3A 3KZCA 2HMUA 3WTCA 4JL6A 1T5DX 3RUFA 4F06A 5K6AC 1GSOA 5K0FA 4D43A 4F5EA 3IQWA 5JI2E 3M81A 4ZOQI 1P0CA 4TZ6A 1VMEA 3FWYA 3ZE9A 1B0PA 4JBYA 4U8GA 3LBIA 5CIYA 4TRQA 4PRLA 1GRVA 1QMPA 3O4IA 5T4EA 3GLHA 5LP1A 3DEOA 1TD1A 3JAKA 1FNCA 1EXDA 3CVXA 1J90A 4KR7A 2I4LA 3JXJA 1R6AA 3TE7A 5FL7A 2OQRA 2NZ8A 2HGSA 1H2WA 2ZTUA 4ZU1X 4URWR 3GJYA 3F78A 1TOAA 2RD0A 3Q2KA 1U1GA 5DEIA 3MCUA 4RK4A 4D4JA 1H3FA 3IR7A 2QXTA 5G3YA 4C4OA 2C96A 4WADA 2OO7A 2HHJA 4S1OA 1QVZA 1VM6A 2FFAA 1RWNA 4L75A 2VN8A 1TF7A 2H1HA 3OE1A 1W5TA 5J1SB 3CB2A 3RVSA 5FR1A 3P96A 1VHJA 5IAGA 4R41A 1UMDB 4FUQA 3GWZA 2J3KA 2QJFA 5K01A 2G88A 3L82A 5ALPA 2Y4NA 2FE4A 4KQ2A 1UC9A 4IIDA 2PZ8A 5T64A 2EWVA 3FB4A 1RW4A 3NHJA 2J3JA 5IT4A 1YZGA 3DV2A 2VPZA 2RDMA 1AZWA 1YZNA 2WJVA 4LYGA 1F6WA 1AF4A 3WL3A 1EFAA 3PWKA 2O7RA 5A2QA 4QPNA 3IV0A 4OJQA 3UFXB 4DG9A 3QNUA 3BMNB 4G1VA 3CBQA 4EEKA 5CFOA 1CS0B 1ML3A 3DEZA 5KOJA 1KVRA 3D3JA 3KC2A 1KMIY 2R8YA 5ITZA 3BIFA 1M74A 4QU9A 4XH9B 2Z8YM 5ILQA 3N6RA 4CL3A 1G5TA 1XJ5A 1A9XB 3A28A 4YUAA 5D51S 4IHKA 1RC1A 2ZKLA 1NMXA 3PC4A 4JFRA 3LZCA 4J4HA 4C0WA 3CXRA 2LCIA 2WMYA 4DQKA 2CL6X 3OTQA 1DEOA 3G0IA 2PS0A 5GP1A 4XLLA 3UQ3A 1E8OA 4B81A 4ZJZA 5DT2A 1YR8A 5EPOA 1FTQA 4HZIA 1XDGA 3BUSA 1FU7A 2CDRA 2F1JA 1PSDA 1ZVQA 4L51A 2HLNA 3EHDA 1GFWA 1OA1A 4TRJA 2XOKA 3IMKA 2FWBA 2NUPB 3VSEA 4FD3A 3KPUA 3EXFA 1XZCA 3NBYC 5KOHA 5CB6A 5LDDC 2Y1LA 1YZUA 1AGXA 3F47A 1G3QA 2ZJ5A 4JQCA 3VC1A 3L54A 2GBLA 4BVKA 3GJ0A 5TGDA 1TTTA 2RFAA 4MCIA 4UTVA 1PLKA 5EI5A 3QY0A 1XR3A 1M10A 2NNWB 2YR0A 2YHAA 1JLLA 4EAQA 4E13A 4KODA 2G9QA 2NZWA 4G8LA 1UFKA 3BWEA 1G4AE 4LY6A 2F0YA 3W1WA 1FY2A 4XUDA 3H4MA 5F1PA 3KQOA 4A0RA 1PKXA 1G3RA 2B2NA 2V1XA 5E6SB 4RSHA 5KTYA 1D1PA 2Q3HA 4QUDA 3BH0A 3O4FA 1E92A 5K1ZA 4R8LA 3IS3A 3S7BA 1WL8A 3NV7A 3CH7A 2D1SA 1Z15A 2X8JB 3VM6A 3ICCA 1P5HA 3KAEA 5ESXA 4JWKA 3ESQA 4MUYA 1JHOA 2I7VA 3GFOA 4LTNA 5KYXB 2D0PB 2D2EA 1JSZA 2VPQA 3Q85A 4R1OA 2AC2A 2QRJA 4QX6A 3UAGA 2AXQA 4PE5B 3TEMA 3SXJA 1L5VA 4CMIB 5HKBA 2RI6A 3D3WA 1JR2A 3FZQA 3LU1A 5GIOE 2W6JD 3CUUA 1FFSA 3F6BX 1TPZA 3OPQA 1NA3A 2ZBUA 2KBEA 3TFQA 4IZ6A 1F17A 2A57A 5BRJA 1ZXLA 3JY6A 2ZDGA 3PTZA 1HZZA 2MINB 5BYKA 3CIOA 4B0PA 1F3LA 1D4ZA 1UOQA 4APOA 2HDNB 3EIHA 5GPBA 2JAOA 3G79A 5EJ4A 3OC6A 3SJBA 4ME2A 3VPGA 5H59A 3SEQA 4DREA 2EIME 3WADA 4FYMA 4JI4B 1B6RA 1GYRA 3M33A 5IXJA 1SBTA 3H1TA 2LKDA 3CNEA 3JQ8A 1T6YA 5B37A 2OM2A 1JHUA 3M4ZA 4PYNA 1E1QD 1J1UA 1N0WA 4IV8A 2FI1A 4BN4A 2XDAA 4RE5A 2YDXA 2AG6A 1UANA 3QWAA 1NXVA 2CT8A 1ONOA 4B44A 3EFOA 5JRDS 1W4CA 4PONA 1AK9A 4EATA 1ORIA 4L4RA 3IKJA 5D3QA 2QOEA 1MLDA 4H7YA 3K9GA 4PS1A 2F67A 2ZWVA 4LG1A 3JZIA 3EQ9A 1XA4A 2ZUSA 2I3BA 1PQPA 1EB8A 3G5TA 2QZ4A 3NNDA 3BFKA 4CKWA 1Z13A 3M83A 3TOCA 5IX8A 2GRLA 3FHLA 1E6MA 4MZDA 3NRBA 2O05A 5IEBA 1GJRA 4RVFA 2EFGA 3KQNA 3KEQA 3VNQA 4QBHA 3Q1LA 3PC7A 5TY0A 2FWMX 5E6UB 3RTCA 1KI9A 4K0KB 4DQDA 3A6KA 1CHNA 5FQOA 5JSQA 3G3EA 3QWWA 3PC2A 2VJBA 4YUYA 4KB5A 5HVNA 4JP3A 4P1ZA 2GAOA 3L04A 4KI0A 4ZVTA 4JOQA 4M36A 3GLFA 5M2QA 4MYTA 4AW9A 3AERA 5BT8A 4OQNA 2K2WA 4ILHB 1A5BB 3CUVA 2Z0MA 4Y9UA 4A1GA 2HIHA 2RHRA 1OCZE 3I4RB 3FZNA 1L0BA 2KWIA 2C98A 1QWSA 3UMVA 3KKZA 1FFCA 4EW6A 2X7XA 1TM1E 2IGTA 5FUQA 2GN6A 1DKQA 4D8TA 4WKBA 1KOGA 4U1RA 4P81A 1BTOA 1T9AA 1ELOA 4DJFC 1Y34E 1M34B 2W2KB 3CJRA 1EWVA 5KKAA 4X00A 4BGEA 3IAEA 1N9AA 3NH6A 5IXSA 3CVOA 2R5SA 4KOEC 2I22A 2O19A 1W75A 3U44B 2DIWA 5LP6A 1KFEB 4KLCA 2XXJA 1NP6A 4N5LA 3KCQA 1V1JA 3NW9A 3U3JA 1GPUA 3MQ4A 2WJAA 1I2ZA 4YROA 5JHAA 4AN0A 3AU5A 4PNZA 5H4GA 3CNLA 1VRCA 4UREA 2FK7A 5JECA 4Z8XA 3MGAA 3K9FC 2I34A 3ENQA 3UJ6A 1E4OA 5A6SA 4I1OB 3ASOE 2R48A 4MUMA 5A2GA 3CVNA 3D59A 2BBOA 4Q3AA 1UPCA 5KU1A 3EPPA 1ZIXA 3AS4A 3PXXA 5TMDA 3VTFA 4IQ8A 2DFTA 1M0SA 1RHJA 2WVHA 4FYYA 1G4HA 4F71A 5EIEA 1XPRA 4Y30A 3L84A 5EMNA 3IE2A 4FE3A 3OSUA 2IO2C 2L69A 3OPXA 5CCXA 1X14A 3OCYA 2JFNA 2FX2A 4U2KA 3IPXA 1C7FA 5ADHA 5IJWA 1IM2A 1RJ9B 4MQMA 5JQGB 5AUPB 4B8CB 4G84A 1KJNA 1SAYA 1U28A 4AUNA 3S3TA 1VIYA 1DIRA 4J6IA 1DJMA 3AI7A 6LDHA 1R6DA 2PMCA 4HX2A 1Y7PA 1QOQB 5K0BA 2JIPA 1JHYA 3WFZA 1KRXA 4MHSA 4ZYXA 4BDSA 3G6KA 4A4DA 3N39C 1NUQA 3K2IA 1PG2A 1AO0A 1IMOA 1W8IA 2AQHA 3WRXC 2HBRA 4ENVA 4X64B 2N9UA 1JGTA 1F7UA 3VJMA 3E32A 4K9MA 3RABA 5DO9A 2E4YA 4LF8B 2EZUA 4OI2A 1NZDA 2GNPA 4JLOA 2W2QA 3S2ZA 4X7BA 2X6IA 1GU0A 3MLEA 4OKNA 3QPUA 2A88A 5T5QA 3TBKA 3NEYA 4AN1A 1RQ2A 2EJCA 2BP7A 3EXHB 3MRSA 3TZLA 5LKAA 1ACMA 3LYUA 3QXGA 2WXLA 3O1JC 1OI3A 3DAOA 3QXSA 1V11B 4O4IB 1E1DA 3AEUB 2J5XA 4HGNA 3QV1A 3STTA 1LZLA 3N0XA 4JDPA 4F4HA 1JDNA 3ITNA 2QYJA 4RWZA 2VK8A 2IEGA 3ZZNA 3PD7A 4DA4A 2IITA 4C3ZA 3E18A 1MAUA 1QTQA 1XTTA 1CDZA 1QGED 2PO7A 4J7XA 5IABA 5EAIA 3DEYX 3HBJA 4M1OA 5TJHA 4D92A 4DR2B 2MYNA 4JL5A 2GK3A 3P2BA 3PC6A 2R8XA 2QAGB 3EBOA 1L1RA 3PHGA 2JCYA 4MUBA 4OUKX 1H2RS 4NL4H 3SR3A 1W0JA 4HAZA 2WUVA 3A2NA 3WYEA 3PNSA 4Q4HA 3AXSA 3A6ZA 2CJPA 3CKYA 4GECA 4K8RB 3OT1B 2OR3A 5DB4A 2ZEJA 1THZA 1K6IA 2GRMA 4FYJA 4KREA 4JR0A 5EN5D 4LHSA 5C32A 5F2KA 2FPKA 4OHVA 4LV8B 3Q10A 3VV3A 2QGZA 2ZTLA 3C3JA 2M9MA 5HTKA 5JS6A 5TT0A 3PQ5A 1CEQA 4DS3A 4DLZA 5JTTA 1YL5A 3SXUA 2H2HA 2AJAA 4I2WA 3A1UA 1ISFA 4DLVA 1PVVA 4AJNA 2RE8A 4PX9A 1SXGA 2WWGA 1MRSA 4KXVA 1R3DA 4JITA 1S2GA 4QHYA 3GLGE 2GXSA 2J32A 2AC7A 2AXZA 4ENSA 1SRRA 4RV4A 1HNXB 1D5WA 2RC6A 4FVTA 1HO8A 4BVEA 3CN7A 4CODB 1YB1A 3PUJA 2WTNA 4PLHA 1PT9A 1OB5A 4OSOA 5GV8A 3I39X 3MJEA 1ELRA 3GJRA 1SCIA 1IY9A 1X9IA 4RTKA 4RPHA 4MGZR 3M7IA 1O5OA 3LW8A 3KPWA 4HDNA 4G5SA 4R01A 3TG5A 3H4TA 3I76A 2XR1A 3E84A 4WZBE 2HA2A 5A06A 2GT1A 3EPLA 1P1RA 4P0QB 4KJXA 5HFAA 4YDSA 4H1TA 2XMPA 4E2XA 2PLFA 2BMFA 2YL2A 5IYZB 3F67A 5A4MS 4Q02A 4FBMA 4KGZA 4E6EA 2WG0A 3ZE8A 3AV0B 3I9V1 1QP7A 3CG0A 1M6WA 2HAEA 2B0CA 3TH5A 1NJ1A 2P9EA 2V7UA 1REQA 1KZ7B 3RYTC 2I66A 4E22A 1T6BY 4BOYA 1VE3A 5JNVA 4YGYA 1BE6A 1KVQA 2RGGA 4GI5A 2IF0A 4EFDA 1NY6A 3FSRA 3TU3B 2C5EA 5EIXA 1JL3A 4R1SA 4HTAA 2UYGA 3SK0A 2G9RA 3MC1A 1TUIA 3VKVA 1RAFA 3GYZA 1WG0A 4RX1A 2E0IA 4C0LA 2QZAA 3L8MA 4ZICA 2J5QA 1DG9A 1SMKA 5AI5A 4HG2A 4PQYA 4P4SA 1J7JA 5J9FA 4XWOA 2OO3A 3PEUA 1DXQA 2XITA 4FJ0A 2R2LA 3SD7A 3TR5A 4C4XA 2OHVA 1RKXA 1YVRA 1GIAA 4I4IA 4WK6A 4N0DA 5FULA 5H4HA 2ZSKA 3HDGA 4EBAA 1IDOA 1RHRA 3IRVA 3D8NA 1RAAA 4RF4A 3TNLA 4XGRA 2HK7A 3CWQA 3VR4A 2AR7A 3ABME 2HRZA 3ABLE 3RVQA 1P7VA 3O7WA 2QA5A 4QPPA 3CX4A 4J4TA 4AUKA 2NGRA 3OURA 3D4LA 3LP6A 3A4NA 4D8WA 1EFRD 2QTBA 3Q8MA 3TRFA 2FRXA 2HWKA 4ZCMA 2FUEA 2G09A 2XZLA 1ZUNA 3ZDEA 4YP1A 3LPNA 3U1TA 3COYA 2QT0A 4POOA 1RLMA 1Y5NA 2ZYUX 1SIBE 3CZ4A 4IH1A 4C48B 1W73A 5CM9C 1HRKA 2V4HC 5G1NA 1BMQA 1BS1A 5KTKA 1VPWA 2F1IA 4J8FA 5HNKA 4U9HS 2JATA 2EG9A 3NVMB 2OORA 1T9BA 1VPEA 1U3WA 1V4VA 3TOVA 2F3TA 2WQHA 4XZ4A 4K9DA 3B6IA 1L5KA 1EIZA 4LBYA 1DVPA 3EAQA 4URKA 4ON9A 3PA8A 1Y1PA 3IPRA 4K9OA 2WWVD 2D4HA 1N2HA 1DCEA 3AR9A 4KUEA 1M73E 3UAWA 1I9CA 1X3SA 4C3UA 1T2UA 3DO8A 2PGXA 1BX3A 5KSYA 4W5TA 5A6CA 3PEFA 1FMTA 1XEWX 3PQ2A 1VMAA 2JHCA 4XM0A 4LWPA 4EEZA 5HZKA 4QELA 1L6IA 5K0CA 1FRVA 5EUBA 1QGUB 2BYTA 2R6FA 4IGKA 1B43A 2MIIA 2H8GA 2MWMA 3T34A 1FZTA 3AEZA 4JN6B 2XPIA 2QJWA 4B3HA 1LI5A 2FETA 2GCEA 2BEWB 2PHZA 4LHVA 2UZ4A 2J1LA 3IBYA 3KOYA 1Y1RA 3I61A 4HDAA 1PI3A 3PR3A 5IBCA 1KR5A 3DPSA 1DB3A 4G67A 2CHUA 3TQSA 4A8PA 3MAAC 4D0RA 2JABA 1GU7A 2R25B 1IZ8A 3CNBA 3U2QA 3HWX1 1OXKB 2G6TA 3CRMA 3HVJA 5EQDA 4MMYB 2OO5C 1HDZA 1ODCA 4TZ0A 3FTXA 4EO7A 3E9NA 1LNSA 3T9FA 1U6IA 3SHOA 2AJDA 3IVXA 3NYQA 5J90A 5CRVA 1A2QA 3VHXB 3B9QA 5KCMA 3EUVA 1N6NA 1V35A 3PXAA 2QIPA 2R6AA 1MC8A 2W2LA 1Y1LA 2ZWMA 1NT2A 4JI3B 3E4DA 2D1FA 1K1EA 3W5DA 1QLJA 1R4MB 3T9DA 2R7LA 1SXJC 2O4UX 1VIAA 1M6HA 4KI7A 1BDBA 3ZHTA 2ZUUA 1SVLA 4CM4A 4JI5B 4COOA 2ZB2A 2WBLC 2QTVB 3W1EA 2PMDA 4XWWA 3R3YA 4BLWA 1Q7TA 2H8KA 2PDAA 4QECA 4KVGA 3TWUA 4XIJA 3VUEA 1WY7A 3LHSA 2X41A 4Z3OA 4KBQA 3ZV5A 1KO4A 3AG5A 3THWA 2MYTA 3AIMA 1R66A 3GGPA 2XSZD 2F4NA 4NWIA 1TK3A 4BO0A 4DR1B 5BSUA 1DX9A 4YDQA 4U4AA 3JQCA 3FD8A 3MYVA 1GT6A 3CPSA 2E4ZA 4F3VA 3INRA 2VFAA 3CH6A 5BO5A 3A6PC 1QQEA 3WRYC 4LVUA 1SXPA 1QE0A 3LUAA 4XB2A 3QB2A 4LZLA 4CU2A 1J49A 2ORYA 4P3NA 2D6FA 4JEIA 1KJZA 3EPRA 4L9AA 4PWZA 4HTFA 5BWBA 2WTAA 3NVAA 5IULC 4DMCA 4A26A 4LXXA 1ZL0A 2XZDA 2CKDA 2VWQA 4KLAA 4EUEA 1GDHA 3VJRA 2BJHA 5BV8A 3NEJA 1A77A 2YZNA 1BKSB 3DPDA 4TTRA 3CSUA 1A4XA 1CUFA 2FGJA 2X3YA 4NOJA 4ALJA 2DCPA 3CZAA 2C2OA 1H2BA 4N0QA 3FPJA 1X7XB 4EFKA 4BO2A 4ZVNA 2C3OA 3QUBA 2ZAYA 3VV2A 4DLTA 2SICE 2YW2A 4HDKA 4L50A 2GBFA 3P2OA 5FOXA 4IEIA 2QVBA 4EA6A 2AUNA 2ZYHA 3OZUA 1IZ7A 4C5CA 1A2BA 2DJIA 2IOFK 4X44A 1WD7A 4FMCB 2PM6A 4AWBA 2H4ZA 2P75A 3RIYA 1R6XA 2YYYA 2ZRQA 4HQ6A 3WG7E 1N54A 3LHDA 3PDWA 3PQDA 4YV0A 4RVUA 5CW1A 4ZTUB 3NTUA 2H2WA 5CBPB 2F1KA 1G4UR 1OAOA 3A6DA 3GRCA 1A2OA 3LYLA 4GVPA 2AH5A 5TQ2B 3RIXA 2FF5A 2GVNA 4KPUA 5ICCA 2RGAA 2YHIA 5CAEA 1V1RA 1CQWA 4ZC1A 4JGGA 4TV8A 1VRVA 5JO9A 4JYZA 2VCHA 3FTEA 2ZM6B 1HU3A 4F5DA 1MUUA 3TWWA 1T5TA 4LXTA 1USUA 1IB0A 2G63A 3S0JA 4Q3LA 2CCJA 2XMSA 1HFJA 3EHNA 3UXMA 1ORRA 2OP1A 1X7YB 4BVHA 1IEWA 4CIXA 4RGQA 1MHPA 3SBOA 5JZOA 5H5JA 1IUKA 4KQXA 3ZH9B 1JCSA 1RTKA 5KZMB 1Z6ZA 1U0HC 2QYHA 4CQJA 1AKVA 3AY6A 5H0IA 4NFHA 3OCWA 2X2PA 1D04A 1N34B 3LV8A 3UBTA 1MJFA 2FWIA 3CEQA 4YXWA 4Y6PA 4BMZA 3S2EA 2OKCA 4IH4A 2V0NA 3U7JA 3D54D 3JW8A 5M04A 3E9MA 1NJ5A 1L8XA 1PVDA 3HYCA 2UWJG 4YI5A 4MIKA 3QE3A 3K9IA 3LDGA 3PZBA 4HD8A 3E15A 2L6JA 1NNSA 4PVDA 2IHVA 3LQKA 2O0KA 1VG8A 5IFLA 2Q7OE 1U8CB 3JQGA 1XCOA 1VDZA 3UM9A 3ROQA 5EE3A 2WPDD 3JVDA 2OV1A 2BH9A 3V79K 3HPRA 2ZXWE 3FG9A 1F0PA 2SHKA 3I9NA 3MW8A 3CEJA 3ZV3A 4D4HA 1ZAYA 4P5PA 3ESCA 4ENPA 4W6ZA 2PL5A 1P1JA 2R1VA 1WHSB 1L5GB 2FU5C 1XDZA 2YJZA 4BTBA 4B47A 3JWEA 5D85A 4OMDA 2QRQA 3TNYA 5THKA 1XZFA 4CLRB 3GQBB 4CEJB 3Q5DA 4IWYA 5FLYA 2XTAA 2C97A 2W11A 1N0RA 5DYYA 5CNIA 3HK2A 3JWJA 1QK5A 2CV2A 1L7PA 2ZSBA 2JKYA 3EOBI 4PYJA 4PHHA 4XRGA 2GRUA 1OXUA 4LYHA 1MGOA 1C50A 4EW3A 4TSKA 3VTZA 4RPGA 3F6CA 1GGFA 4LDNA 2G80A 2B78A 3NOGD 2WNHA 1Y8RA 3UJ9A 1CUAA 4G1FA 2ZUVA 4CFYA 2KC7A 1BOOA 3AKYA 3AKZA 2FSIA 5HCNA 1KY5A 3PNPA 2WSYB 2VNIA 3VOBA 1U7WA 1EG7A 4V38A 1QYWA 1LKZA 1ZOSA 1KSFX 3SHQA 4B46A 1NFFA 2GYWA 5AJWA 1QIGA 1QJCA 2XYRA 3FMPB 1Q16A 4Y98A 1ZIPA 4ICIA 4H9GA 4FR2A 3LP8A 4KAJA 4REOA 2PKRA 3ULKA 3GUZA 1GKYA 5LVAA 1UXKA 4L15A 2Y69E 3KYIB 1Y8QB 4HGQA 3T99A 3U0BA 1IXKA 1SVWA 4Z5XA 1MH1A 2CB9A 3AHFA 3UF0A 2I1QA 4EY7A 1P5JA 2C4HA 4J0CA 3UGJA 5B7NA 1Y48E 1G0NA 1P5RA 1QKKA 1QR2A 3GFGA 4UTNA 2R1TB 1VBKA 1GZ3A 3PPIA 1WXXA 1MNAA 4U8YD 2X77A 1ZCBA 3RVBA 1EFKA 1L7AA 1IY2A 3RRYA 3U3ZA 5CT9A 4AP2A 3DTTA 2R00C 3LA8A 3SC3A 1TT5A 4I5GA 3K92A 1ZOIA 1E5QA 1EVIA 1FDVA 2NUAB 3MELA 2R86A 2E82A 4I50A 1UFOA 2ZBVA 4MVJE 3RJZA 1X15A 5IRCD 3C4JA 5JY1A 3F8TA 5A9TA 4FA6A 3ICWA 2G28A 4ACKA 3N5KA 5BNZA 4EHDA 2V7QA 1JG6A 5IANA 4UOZA 3FF1A 2DH6A 2B30A 1T36B 5KTRA 2XNDA 1O96A 4UXHA 5AI4A 1G1MA 2HCBA 2XUIA 2BGMA 3WQHA 2OHJA 1V16B 4KQ9A 1DRWA 3BWDD 4IRXA 3WRWA 4LV6A 3U5ZB 3CC8A 3MFYA 2WQ7A 2GZAA 2ZM5A 4DX7D 1SBQA 3SEZA 3WIUA 2WWWA 1EUCA 3HJAA 3PR1A 2PT5A 3L6EA 1I10A 2NSYA 3TUZC 3CUKA 2PO5A 1D2CA 2BISA 2CK3A 1WB6A 5HK8A 1F38A 2BFDB 1T5LA 5ENDA 4QGAA 5BY2A 2QM7A 1O57A 2A5YB 3MHTA 1QUEA 1SOMA 4BIMA 3W5HA 3Q88A 4TTTS 1TNUA 4FJZA 4UEWA 2QNBA 1CEYA 2REQB 3RC9A 1H4VB 5C4MA 3VU1A 1SPBS 1ZD4A 5A7DB 3ZJTA 1B73A 3HKDA 3CTPA 3UYLA 1N7HA 2HW8A 3YASA 4ZV9A 4K6FA 3ET5A 1HK7A 3WBFA 4FJYA 1GTG1 1EGAA 4BEBA 2BVNA 3R8FA 2HYDA 1XSEA 3GUCA 2XVMA 3FZEA 4B4WA 2WDPA 1RHUA 3JQBC 3SNXA 1Z0SA 4EZJA 4JP8A 4G9GA 5CDFA 3HTXA 2JCGA 4MR8A 4CG2A 2XPZA 4JUAA 1T2AA 2ZJ3A 1Q22A 3IRUA 3U39A 2DZNA 1KYZA 5JAMA 1WCYA 4PGAA 3TGPA 3R9MA 4GYKA 1MV5A 3ELYA 2HV8A 1PX0A 2Q5HA 1CUBA 2WF7A 4GPTA 4NOLA 5FUVA 3TYXA 2COKA 2FMFA 1LC3A 3D9HA 1KI2A 1ST2A 3F6YA 1XDDA 4C7OA 4QBFA 1O95C 1U31A 3SSNA 2ZISA 4ZK6A 2C04A 3MA5A 4W1PA 1MIHA 1AH2A 3AVUA 4A8JC 2QB5A 3MQFA 2FZWA 1G5RA 4CUKA 4GMKA 3E27A 1S3FA 4ER7A 4CM1A 1FPMA 1GYPA 1QF6A 2Y0DA 3W06A 2WAAA 2WHQA 1PN3A 3DBLA 1ZMOA 4QDUA 3LCMA 3ODPA 4QUJA 3CM0A 1P72A 1ZH0A 1IIRA 3ZKAA 4I2NA 1CC1S 5KQGA 5D66A 2EQAA 3ZKWA 3APFA 3QVGA 2XVAA 1SD1A 2X5NA 3PI7A 2J49A 5CVVA 3ROKA 1CRQA 4BNIA 1QRSA 1NKVA 4V0RA 3ITWA 1SU8A 3AEQA 4IWXA 3HS3A 1Y1QA 2O1EA 4V2UA 3RAFC 3LQRA 3Q4AB 2YNMD 2QYUA 1KI1A 2WHRA 2RSFA 2IYUA 4AYXA 1SWVA 2Y0EA 3CVUA 3H5TA 1UZLA 4JLWA 1RADA 3AF2A 2PTGA 1QG2A 1BQ4A 2XF8A 2W9JA 2Q2NA 3WMRA 4WESA 1QQ5A 4YAWA 3GUYA 2C61A 2CF5A 3VLDA 5I01A 1Y6QA 1QBKC 3HCNA 3GOQA 4KN8A 5B1DA 3EB9A 2BKKB 2JLYA 3KR2A 3DBRB 2GK7A 1E5TA 4MKGA 3V1MA 4ZU3A 5GJCA 2WHYA 2Q6OA 3FVTA 1M66A 4BGUA 3B8HA 3LWZA 2O5CA 1N5MA 3ZWAA 7ABPA 2AEEA 2RI1A 2WA2A 4TV9B 4IXNA 3IAXA 3WC4A 3JQFA 2VDMB 1M1NB 3BIXA 1HOXA 3DNPA 1KQGA 3A1CA 3JQQA 4XA8A 5DPMA 3BK2A 5IN5A 1S2IA 5AVSA 5T7BA 3BTUA 1H2ZA 3PXCX 2BSAA 2XUAA 4QBIA 3IT1A 4XX0B 2ZIVB 4KWHA 2JEKA 4AROA 4CV1A 4CL8A 4K9QA 4DLXA 3KOXA 3TXYA 3WLOA 3ENZA 3UWOA 4A5SA 4KU4A 1N3LA 3LF1A 4Q7QA 1CQJA 4HH1A 3P1UA 4U3JB 3QV2A 4LK3A 2E5LB 1KSJA 1XX6A 4CG0A 2VNAA 5JJLA 3VTKA 4B33A 1SBIA 1KDZA 3IKMB 2OBXA 2AFHA 1UJRA 3NAMA 2BE9A 1U4NA 5M29A 5CCLA 3L1UA 4WASA 1OX5A 3BT3A 4Q3NA 1SY7A 1KEEB 2OK7A 1Z2OX 2WQZA 1A27A 4Q4JB 2KB0A 1NX9A 4YEDA 4PR3A 5TXGA 5B36A 3K5PA 4RFSB 1O94D 3JALB 1PFUA 2AN1A 5I4IA 5JD5A 3TEFA 1QK3A 2Y1KA 2VATA 1EEHA 2O8BA 1YMVA 4R8VA 3M6FA 3D6NB 3PXDA 2F1RA 1E3IA 4RW0A 1ZAKA 2W48A 1ES9A 3K4HA 3SE0A 3PNYA 4GM1A 4C0BA 5TDHA 3DJYA 1GLVA 2R97A 3TFWA 4A2QA 4MUXA 3JV7A 3FOAA 5BN5A 3W5IA 1EVZA 1Q20A 4H18A 1P1FA 4MA5A 1Y8AA 2C3UA 5MHTA 2H1LA 3SFYA 3LL7A 3KALA 2I65A 5JVDB 1HSOA 1MZPA 3FY4A 2NXNA 1UDCA 1UMCB 1B1CA 2EJWA 3K8YA 4DMUB 2P68A 4KL8S 5T3UA 1SRQA 3DZJA 5CH8A 3QU2A 3OZWA 3WO0A 2R4QA 3NIFB 1JLSA 2IW3A 4KQGA 1PR2A 1R1DA 2C8KA 1LWOA 1WX1A 4B71A 4U7WA 1QIDA 1C1XB 3DMDA 1CQIA 2E4WA 2OBNA 1CEEA 1E7UA 2JW5A 4PQEA 1O6CA 3OZTA 4F60A 1N7IA 5E2AA 3PYLA 4JVSA 5KPJA 4GMGA 5A62A 4FNMA 2VJCA 3V8EA 3VR2A 4K86A 2V7BA 3U4IA 2VPIA 2GPBA 4F1KA 2FQWA 4PZCA 3TTUA 3RKSA 4BNLA 2J9YB 3CHOA 3T1YB 1ZBDA 1FNDA 3T4XA 1C8BA 4P4LA 1T35A 3B5IA 2HMWA 5T3RA 1RRPA 2C57A 4O2BB 4X7PA 2QQEA 3KSUA 3FPEA 3M9XA 1WDYA 4W7IA 3BTSA 2H5IA 4ND8A 3R75A 4MV3A 2DWUA 1W44A 1YMQA 1HLDA 3APDA 4EBFA 3WGUA 2DBYA 2B1QA 3AEXA 2PMKA 1HE4A 2DTEA 4CIYA 4P7JA 4B74A 4AJPA 4PSVA 4PSAA 1B6TA 4F53A 1VJGA 4IJMA 2AWOA 3AY3A 3UMGA 1Z06A 4ADSG 3EIQA 3NPMA 4M1QA 5ICFA 1BHQ1 3G7NA 4LPSA 3H7AA 2X9QA 5E3JA 1N9ZA 4P35A 2D7CA 1IN4A 2DYKA 4G8JA 3GFPA 4LSZA 4LFCB 4HNHA 4QFMA 1JKMA 2OCXA 4BATA 3GJ5A 3G2SA 4NCBA 3NAWA 4J16A 3MPOA 4DBZA 3DPIA 1GTL1 4HFRA 1PG0A 4ITUA 4RPLA 1V41E 3C3RA 1W19A 3JRNA 4LJKA 3A06A 1EXNA 3B3QA 1QTIA 4MGIR 2VJKA 4TQUS 2DX7A 4MMZB 1USKA 3V8BA 1EQ2A 5YASA 1MOPA 4WN9B 3DBIA 3FVQA 5K03A 3USZA 2ZS7A 4RKQA 2FFHA 5ALJA 1T2CA 3AHHA 3NEAA 4MDHA 4NV3A 1X4RA 5IAOA 2OXCA 1CU1A 3WDSA 1XG5A 2VH5R 4OU4A 4URXR 1Y6RA 3AXTA 3TTTA 3RU0A 4AZ0A 4P7KA 5CHYA 3OTWA 1FVXA 1H2HA 2NZJA 3GRVA 3ADBA 1D6SA 4MQFA 1QC5B 2FMKA 4KV9A 1UT5A 2HEGA 4R2XA 4JLKA 4C30A 2FSSA 3VR3A 1KKLA 5KDDA 1EX1A 3DD1A 1DCMA 1U0NA 1XD9A 5ENZA 4JL0A 4A10A 4WIAA 2PS3A 5FWAA 3MTAA 2R7KA 2IHJA 2DJ5A 3K9NA 4GRIA 1WB4A 2EVWX 2QI9C 4LN1A 1I9GA 1JR3E 1CNMA 1I6LA 3K8ZA 3ZHZA 4BLPA 2QX4A 3JAWB 3DJFA 2R03A 8MHTA 3KHTA 4RXTA 4HZUA 5SY4A 1UADA 4ND3A 2FG6C 1VP9A 4D6PA 5LZ9A 3SQNA 4DIEA 1P2VA 3KV1A 4DSTA 4DZZA 1T3ZA 1DO8A 1NXWA 2A58A 5ESRA 5K3OA 2H59A 2ADOA 4AZSA 4NONA 1VPDA 1CRWG 1G64A 3PFFA 5FEUA 3BD9A 2CD9A 3K16A 2HA0A 4GR9A 1K2WA 3I01A 1N2XA 3PC3A 1EJBA 4TUYB 1IBCA 5AI6A 3WFJA 1OSNA 1YAHA 2J5KA 3ZDBA 3VPDA 4DY4A 2HPAA 4XWTA 1B8UA 3JS5A 4GOKA 5J63A 3O47A 5GJVC 3I2IA 1OASA 3CGWA 1L3BA 3NFYA 1VHQA 3B1WA 5H9WA 3TLMA 1BXRB 2BT4A 3ZIAD 1XVVA 1PYDA 4DNOA 3CLSC 4PZ9A 3FDZA 3FKSA 5JCJA 5AW2A 3O8BA 1XDSA 1WXFA 2VRNA 3FVWA 2Z1NA 1QHGA 1ZJ5A 3QE9Y 4NV0A 2Q9AA 1JIIA 3HYMB 4RPCA 4CM7A 4XJSA 1P7PA 1DUIA 2AV6A 1NVKA 4DY6A 2JLBA 4RIFA 1HL7A 1O5MA 2FHSA 5JASA 4PO8A 1H6OA 3OUUA 2ZTHA 1OBFO 4GX0A 4LYYA 4E07A 2DHEA 1JHXA 1U0OC 2WIKA 3ZQ6A 5FQ8A 1SXJB 4J75A 2VTBB 1YJ8A 2CBZA 1I3OA 3SYLA 3E58A 4ZZ2A 4Q34A 2XE4A 1KFBB 4DOMA 3DVQX 5JDCA 1NDHA 2NAFA 1YRBA 2FH5B 1IJBA 3W7VA 3EAGA 4CKBA 1CUZA 5KTPA 3T7RA 2WD9A 3CONA 3G5UA 1GAQA 5FTNA 2R17C 3TGWA 2R4UA 1X7WA 3QX8A 4GFDA 1R6TA 1Z0JA 2PANA 6PFKA 1VMDA 1TB4A 3RYIA 4HNUA 2VH2A 2JHGA 4UE6A 1KBOA 1W2WB 1L4NA 2JJ1A 4LQLA 5B58C 3M9WA 1CY2A 2WMNA 1YDMA 1XLUA 5ENVA 1RBZA 1NR7A 4R2WA 4YLEA 3M6AA 4RA6A 5DLPA 2C9ZA 1LWNA 4A0HA 1MQAA 2FZEA 2BKXA 5F35A 2DFPA 3WGZA 4WNEA 2ANBA 1WP9A 3WLPA 3THYA 4ZOCA 1WLSA 4XLTA 2WU8A 2Y0CA 2PKXA 1LD3A 5BYBA 4ZYWA 1J0AA 1ILWA 1YUNA 3B53X 2VEDA 3NETA 2V59A 4M49A 1LTKA 1CXZA 1O6BA 3LDFA 4H1VA 4UVHA 3B7UX 1NBMA 3D4IA 4X7RA 4BVLA 4BFLA 3GJQA 4EPZA 4G1EB 1JDBB 3EGWA 1U2PA 3QEBZ 3RC8A 1CY1A 2GRAA 2P90A 1UINA 2B0JA 2IYPA 3IEXA 5BQPA 2BD0A 1YR1A 3PHHA 4BNNA 1GZDA 1FDWA 1P3DA 2EZ4A 1USGA 1FU8A 2KQUA 3U9LA 3TIFA 5DTMA 3HCAA 1F1BA 2C1EA 3N71A 4RK5A 4MLZA 2OPBA 5EDSA 5C2YA 2POQX 4MLCA 3MCZA 4IDPA 4O4HF 2TMKA 4ZDWA 4BSXA 2GK4A 4NZYA 2I6SA 1EJ6A 2FF7A 4XUCA 4KO1S 4YRZA 3LYAA 4ZZIA 1MENA 3KJQA 1UC4B 2YMPA 3ZVKA 3G2NA 5IJZA 4QXRA 4DCSA 1MO3A 1N8SA 4U0SA 3R5KA 3SZ3A 4JD2G 3GI1A 3D9LA 5IVIA 5EJMA 3SKVA 1NW3A 1FYWA 3KZKA 3BA1A 4RENA 1BG6A 4UNIA 3ZTYA 1Y6JA 5C4GB 3WX0A 2N75A 4PYMA 1Q0LA 2WC1A 2V7WA 1KERA 1URPA 5HOEA 3TI7A 1K7EB 2YIMA 1E9SA 1DGQA 1DAGA 5JZVA 4LVCA 4PSDA 3SIXA 2CNNA 1YJQA 1H2EA 3GL9A 2AVPA 4M0PA 1Q0ZA 4IHQA 3U7RA 4XSVA 4N47A 4KTVE 1OW3B 2ZJFA 5DX8A 1XLTC 5JPDA 2IYXA 5BQ5A 3ELWA 3IDSA 2C29D 2IS4A 2GS9A 3E8XA 3HI6A 4TUMA 4L4YA 3V2UA 4DI3A 4OMFG 3RUAA 1PWEA 3C8ZA 3EGOA 1Z45A 1SC9A 3DYBA 1X9HA 3S5UA 4JA0A 4YJ2F 1ZPDA 2O8DB 1WSDA 2OC9A 3C2QA 1FEZA 2ZB7A 3M4XA 5FCDA 2ATIA 3OSZA 1ODLA 1R12A 4LJAA 4OI4A 3TWRA 1YU9A 3B3GA 1U2GC 1FP6A 2XZTG 1NF8A 3B3FA 3EW7A 3C3EA 2XYQA 4RD6A 3VDRA 3UJCA 3CO0S 3DTYA 2D1QA 2IX9A 3HVUA 1JNZB 1I32A 2I29A 3R9AB 3H05A 3I1YA 1C9JA 4L3VA 3RS2A 1EAMA 3GLKA 3ZLBA 4E5VA 1IHDA 5FQNA 3H1EA 1FSSA 2Q1XA 2RJ3A 4BMNA 3KLNA 3PZ1A 2Z6UA 2EC5A 4BJ5A 2BFNA 2I33A 4WNIA 2I6XA 4Q69A 3AF5A 4ZN6A 3L02A 2NMVA 4WWPA 1MA3A 5AJHA 4BC1A 4U2FA 4OMUA 4BQSA 1Q57A 5LYYA 2VP0A 3CLJA 3TSYA 5FRDA 4YFVA 3MJCA 1P6UA 3D7RA 3M3HA 4E15A 1IM5A 1K08A 1T9GR 3HBFA 4QUKA 1VCHA 4JSYA 3F46A 1IN1A 1EESA 4JHRA 2QRLA 4RPKA 2HGZA 3KVVA 1Y9DA 1U5CA 3FYUC 4HKTA 2GHQA 1II0A 2FSHA 3IIMA 3GAZA 1U7DA 3CPEA 1TI7A 4OQXA 1SEPA 2GEBA 1KMHA 1DOHA 1X1AA 2PL3A 2XQIA 5CP8A 1N5OX 1Y6ZA 3FH5A 1RRKA 1QPBA 3ICQB 4F46A 3GCGA 3VNVA 3LCJA 5HRYA 1T8PA 3K6SA 3ELDA 5C8YB 4HDRB 1NOIA 2B8JA 2G06A 3I4GA 1YJ5A 2I4MA 5D1NA 2IT1A 4C14A 2HBQA 3ONEA 3H8WA 4L8FA 5C3MA 3NR2A 2XNKA 2C8JA 4BV9A 4BU1A 3GVIA 5KO2A 4ZQEA 4CGZA 1ODFA 3UJNA 1TCVA 3L4BA 3BX1A 1J9GA 4C2UA 3RS8A 2OCIA 3KDPA 4I8XA 4GI2A 2CDNA 5EJIA 2P4QA 3K94A 3VR0A 2H08A 4WJZA 4WA8A 5GM1A 1BN6A 2ILVA 3ZNNA 2ZR8A 3A1WA 4RACA 3Q7PA 3OQNA 1NF9A 2P41A 2A92A 4AS3A 4GW3A 4DG5A 3O8RA 1Y3DE 4BBPA 3HYSA 2IU0A 1DEKA 3RO3A 4CQNA 5FWXA 4RTMA 4UYJB 5COQA 1NF2A 1P9RA 1RBYA 1KZPA 3ABKE 2BM8A 3TVTA 2IH4A 1FTGA 4UVGA 3RKRA 1GNTA 1QANA 3B2EA 1P2SA 3GXBA 1GZ4A 2O7QA 1YTLA 4QUAA 1PWXA 3DR3A 4AICA 3SDZA 5DHPA 4U00A 4GC9A 2WZQA 3L4SO 4IDQA 3OXFA 4B6OA 1GGEA 4XARA 1L7MA 3TX2A 4B3CA 2GXQA 4ZT2A 5FOTA 2BEUB 4EZEA 4N12A 1O8CA 5TF4A 3SQDA 3RFUA 3WAGA 2QTZA 5JEEA 4Y0VA 2WWXA 4F72A 3U7FB 2JI6A 2H85A 3L2OB 3LIPA 5DBIA 3Q3GE 2WSLA 5AVXA 4V3CA 5KWJA 5E2BA 5EXXA 3NUGA 3PDUA 1F60A 1P7ZA 4W4TA 4YWHA 1N2CE 4ZV4A 5EPEA 4YAEA 4BMPB 4BYGA 4PWYA 3WAJA 2Y1OA 1TYDE 5FADA 3U4DA 1E7VA 2FZLA 3WGVA 3O8OA 4K28A 1MGPA 1WW3A 4DI4A 2I7TA 4UARA 2J7PA 1YC2A 1N4RA 3FUKA 2OFXA 3SE7A 2Z9BA 3PXEA 5DDIP 1FU4A 3TL3A 5C31A 4EHJA 4FZ5A 3Q3IA 1KSGA 4FEGA 5LMCA 4ZQBA 1NFQA 3ZDRA 1MABA 2NSDA 2DWZA 4PAOA 2BGRA 4JLNA 1JHDA 4UUOA 1UQRA 4D9BA 4XGIA 1FS6A 1EQUA 1M6EX 2BGNA 1RQNA 4H3SA 1TJCA 3ZHBA 4ZHSA 3SQVA 1O6FA 1C3XA 3LRXA 4PFJA 4TWIA 2SNIE 3B60A 4F21A 4PU0A 1HFKA 2VYFA 1JBQA 2JIZD 3G2UA 5D3KA 3BRWA 1CW2B 2AW3A 1R9GA 4R54A 3B1FA 2JFYA 2E21A 4RLHA 3OX4A 4EF4A 2WPNA 2JCBA 1S5PA 4G2VA 4M99A 3ZGVA 3AEKA 2J09A 4FEYA 1UK6A 3U7QB 4B7XA 2PCLA 3GW4A 3CZ5A 3DRAA 3UN1A 2BEJA 1HS6A 3URKA 3E22A 1PHPA 2QNRA 2WLTA 3H0CA 3HZRA 4A8JB 1FCHA 3QXJA 1EBBA 4E3ZA 4LX8A 2CY0A 1GZ5A 1R27A 1U0BB 1BWPA 3ND8A 1H9BA 3JD0A 1HYQA 3QEJA 4KK3A 2PUAA 3WGKA 4V0QA 4YRQA 2OBBA 4TYPA 3BG0B 4WDRA 1GEEA 3V2XA 3IE1A 3IAFA 1T4CB 3QE4A 1MDFA 2H1WA 1ID1A 3HKBB 5DNEA 5GONA 3OFJA 4IQGA 4X90A 4ZI3A 4PYKA 5CRIA 2I2CA 2EW1A 3O48A 2Z95A 3LWNA 4UEJA 1E3TA 2IEYA 4EB8A 5F1KA 2OHFA 3A58B 3GROA 1J56A 3EXG2 2PFSA 4MV5A 4Q3KA 2AEFA 2FSUA 4OBWA 3T7KA 2JIOA 1WQ1R 2ACEA 3CRRA 4BO6A 1YHYA 4RSRA 3ZJVA 3LSTA 1E7MA 1FTSA 1T8RA 4CZ2A 2NN3C 4BBAA 1DAIA 4LZWA 1EM8B 3E8MA 3RW9A 5KJNA 1FL9A 4Z2AA 2ZYDA 4MRNA 5IM4F 4WACA 3IAHA 3FWNA 2B61A 1TC1A 2XCSB 2PGNA 4G23A 1C81A 4AO7A 2H4YA 4FT2A 1QYCA 2ZBGA 2WZBA 2CLMB 3QPDA 3GR6A 3SVLA 3PFIA 3B7SA 3LO5A 2YWRA 4ILKA 1ZLYA 4HPWA 1RYDA 2H1IA 3U7IA 3WLKX 2AG8A 3KB1A 2Q2WA 4DANA 3FUUA 5FKJA 1YQWA 2I87A 5CXQA 1XGKA 4ND6A 3I5XA 1P6XA 2XAAA 5H82A 2KW5A 5KAMA 2F59A 4ZO9A 2X4DA 1ZN8A 4JC8A 3HA7A 1K6XA 1Y3IA 2Q9UA 2P6PA 1HA3A 1T0PA 4LZZA 4M87A 4RPJA 2ISCA 4S1WA 4IUBS 4N3NA 4WZAA 1VPTA 2DWPA 1JA0A 4X1KB 1TAGA 2COEA 5CPFA 4AJIA 4JX8A 3HN7A 1IUOA 1WCXA 4G0ZA 3FVRA 1K66A 2P8JA 3WISA 1X0VA 2VZLA 5FHQA 3OCVA 2Y4OA 3W4IA 1PT6A 1XN1A 2DH5A 2F4VB 3RSCA 2YV2A 5G0VA 3LA6A 1YE8A 3L8EA 3OJXA 3UO8B 3A8TA 4PLZA 4BZWA 2PMFA 2DBRA 4GPIB 2QZZA 2BFWA 3QEKA 3QFRA 4OAQA 3PV0A 4MIEA 1VCNA 2OXTA 3Q7EA 2ZPUA 4RTQA 4JSRA 3ZWOA 4UTOA 2XCRB 4OL0A 4DLNA 1J20A 2GYUA 1LD7A 1H3NA 5AVUA 1LSSA 2QVGA 2I2WA 3U5TA 2HJ9A 4OSEA 1SIOA 2IOYA 5AHWA 1H2XA 3F4BA 1PZHA 2CXTA 4UM8B 1P77A 2A5DA 2FPIB 4EKIA 1SUIA