3PE3A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
701
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 268
structure length 701
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe3A03
5FZSA 5G05C 2Q6VA 4UI9J 1H5UA 1NVKA 1Y8MA 3C4QA 3Q3HA 1C50A 7GPBA 3MKRA 1P2DA 2P58C 3OY2A 1TJCA 2C1ZA 1A17A 4N2QA 4AIFA 1QM5A 2BFWA 5G04C 2FI7A 3MV3B 4Z5XA 3BCUA 3O3CA 4FZRA 2GM9A 2PQNA 2WPVA 2IFUA 2WTXA 4UQXA 2E2EA 1P4JA 3C4VA 3ASDA 2SKDA 3Q3IA 3S7JA 4W9RA 4U04A 3DDSA 1C8KA 4J8FA 1GPBA 3SYMA 3TGOA 1UQTA 1JEJA 1UQUA 3ZN3A 3S0JA 2HR2A 1HLFA 3WAGA 3K9IA 3NCHA 2XCBA 2QFCA 4GCOA 1GPYA 1UZUA 2AVPA 1KT1A 2XPIA 1JG6A 2C1XA 5JJ7A 3ZCUA 3G2IA 4BTBA 2IEIA 4YUAA 3OXLA 2OOEA 2QN2A 3HBMA 5GPBA 2KS6A 2AV6A 3ASFA 4CGVA 4U07A 3BEEA 3RJVA 2P6PA 4HOSA 3EBPA 4Y6WA 1PYGA 3Q49B 4WACA 2VCHA 4APOA 4BWRA 3DDWA 3CK8A 2FF4A 1P4HA 2QLLA 4NEQA 1GZ5A 5AYWD 2G9RA 5TVGA 2NC9A 3CKCA 3ASGA 3PDNA 4RELA 3ZCQA 3NB0A 3ZPJA 2F9FA 4PQGA 1PNVA 5JJTA 3RHZA 4AN4A 2X0FA 3OKCA 5DU2A 2QN3A 5CCLA 1NZDA 3QKYA 3L7DA 2VG8A 4LEUA 3RIBA 1QKJA 2FFRA 4XI0A 3MS7A 1NOKA 1FCHA 3RO3A 2IEGA 3RO2A 2FO7A 4G26A 4A1SA 3AS5A 1NA3A 4KQ2A 1EXVA 3QWVA 4EQFA 4KBQA 4NESA 2Q7FA 3ULQA 3S2UA 5FZQA 3URZA 2J9QA 1AHPA 2XMPA 2O6LA 5ENZA 4B94A 2KC7A 2JZCA 1P5QA 3ESKA 3S7FA 2UY1A 1FU4A 3SF4A 3QDNA 2YHCA 2IYFA 1P2BA 1GG8A 3MT7A 2F3PA 1PN3A 2FF5A 4HLNA 3MT8A 3OY7A 1LWNA 4N9WA 3TOVA 4AMBA 4BT9A 3CUVA 4GA2A 3CVQA 2XA9A 1WUTA 4I2WA 3NPAA 3N71A 1WV0A 3MTBA 4BFCA 2IF4A 3T3IA 5FTPA 1YA6A 1FTQA 4U0ZA 3MS4A 2IV7A 2X6RA 5DIZA 4CTNA 1ZU2A 3EDTB 3T5TA 3MRTA 2F3QA 4N3AA 3Q47B 2ACVA 2BGTA 2PL2A 3PE4A 1XL0A 1WW3A 4M83A 2LNIA 1P4GA 5A7DB 3QOUA 4RG6A 2PQ6A 5KJMA 5BT1A 4X7PA 5HI7A 1WV1A 2C2LA 2GW1A 1ELWA 2C0LA 1FC0A 4RIIA 1RZVA 1NOJA 2GT1A 3CVPA 2C4MA 2GPAA 2QN9A 2XGOA 3D0RA 3T3HA 1IHGA 2VGXB 3LY9A 4NQ0A 1Y6GA 3U4TA 2UY1B 4J8EA 3AMVA 3G2JA 4GPKA 3O48A 3T7DA 2PZIA 1J39A 1KTIA 1AXRA 4G2TA 4HOTA 2H1FA 4RIHA 3L7CA 3RU0A 2XGSA 3CUTA 3DZCA 3T3DA 4FKZA 2X0EA 3CKBA 3VDMA 2BGUA 4N3BA 4EL5A 4YI3A 4MHSA 3SZ7A 1C3JA 4RIGA 2VGXA 5KJKA 5ARFA 1L5RA 3CV0A 2PQRA 3HBJA 3LY7A 3OXFA 3CEHA 2XEVA 5KJNA 4G1TA 4BTAA 2G9UA 4GA0A 5D0OD 1RZUA 1Z8DA 4EJ2A 3CX4A 3MSCA 2XA2A 1V4VA 2AZDA 3MBOA 1IYGA 4N2SA 2R5SA 3E3NA 3TAXA 2JLBA 4L22A 4AY5A 1KT0A 2R60A 3C48A 1PC2A 3MV2B 2HYZA 8GPBA 4UQZA 3GZ2A 1ELRA 3MEKA 2PRJA 3BD8A 2G9VA 2R68A 1WUYA 2IW1A 5JJ6A 3FWVA 4XI9A 1RRVA 2KATA 1FU8A 2L6JA 4H7YA 4CTOA 3L7BA 3JYSA 2QN7A 4WNDA 3LCAA 2R66A 4WADA 2QRHA 1HZ4A 4JA7A 3MRVA 3ZCPA 5EKQD 2IUYA 2QN8A 3BCSA 4WNEA 2VCEA 3RT1A 3S7DA 4Y6CA 3VTXA 4HORA 2QLNA 1NOIA 4JHRA 9GPBA 5LCWC 2XCCA 1W3BA 1HH8A 3DD1A 4NC9A 5JTUA 2KCLA 1Y6FA 3S28A 4JA9A 2ZB2A 1L5WA 4G25A 3ZGQA 5LCWJ 3BCRA 3G2HA 2QZSA 1L6IA 5FJYA 4AY6A 1B4DA 4M7PA 4RIEA 3ZCRA 3S27A 4YVQC 1Z6QA 2BUGA 3G2NA 3CEJA 4GCNA 2IV3A 1NA0A 1XC7A 3OKPA 3NP9A 3ZFWA 1F6DA 2G9QA 1WAO1 2SKCA 1WM5A 4BQFA 2V5FA 3ZCTA 3KS2A 4RIFA 3CEQA 3R9AB 4RG9A 4QLBA 3VTYA 1C8LA 1IIRA 4BQEA 3Q4AB 3COPA 5BW8C 2ASVA 4G24A 1P29A 3SYRA 2H1HA 5EX3A 3D1JA 1L5QA 4M60A 1F0KA 2HY7A 2PRIA 4KQ1A 4I17A 3G2KA 2ONDA 2KCKA 3WC4A 4WNGA 4GZ6A 2FEZA 5ARGA 2QRMA 3H4IA 2C0MA 5KJLA 3IEGA 4GYOA 1K08A 3NC4A 2F3UA 1XOIA 2IYAA 4ME2A 2ACWA 3QHPA 1QQEA 1QZ2A 2HO1A 3AS8A 3CUUA 5EX0A 3NAZA 1NLMA 1FTYA 4GZ3A 3IA7A 3S7BA 3QWWA 4RBNA 5TMDA 1IXYA 3CVNA 4REMA 2R4UA 4RENA 5HQ8A 1JIUA 3RKVA 1L7XA 5LQDA 4I2ZA 3U3WA 3FFLA 2YQ8A 1XNFA 4KXKB 2Y4UA 1BX3A 2I6HA 1XL1A 3G2LA 1P2GA 3AS4A 3IAAA 2OFFA 4KYOB 4O6FA 4U0SA 2ECPA 4GYWA 3OTIA 2VQ2A 3BD6A 5HXAA 2QRPA 2UWJG 3Q5MA 4JL0A 1EM6A 2PYDA 1XV5A 3NF1A 3EBOA 1JG7A 3CK7A 1WW2A 2BISA 3OKAA 2GPNA 2QN1A 4BQIA 1XKXA 1L5SA 2VSYA 4KQMA 3MRXA 1YGPA 3S29A 3HBFA 4X7MA 2VYIA 3KD7A 4F97A 1B89A 2FETA 1HXIA 3LYAA 3Q3EA 2R4TA 3BD7A 3GUHA 4J0UA 1GPAA 3VUEA 3T3GA 3OXGA 4F9FA 5JTTA 5DLDA 3OT5A 3GZ1A 5D0QD 4EL0A 1NZNA 3E3OA 2JJMA 3MQFA 1Z62A 1L5VA 4CDRA 3D0QA 4U0UA 4MHOA 3QWPA 5FT9A 2YJNA 5IKPA 3WXXA 5A6CA 3ZHEB 3CUYA 2QNBA 3VDNB 1JIVA 4MI9A 1FA9A 5IKOA 4HOQA 3MA5A 1E96B 4XIFA 5D00A 4HOUA 3UUXA 5CCMA 2VGYA 5G05J 3L01A 5TMEA 5BNWA 2XCUA 4F3VA 4CGWA 2GEJA 3GW4A 3HBNA 1NZFA 4UQYA 4G2VA 4GZ5A 3TSAA 4YNDA 3FROA 1VGVA 5FZRA 3BEOA 4NRHB 3ZHEA 2GEKA 2AW3A 1M5RA 2LSVA 1FU7A 1O6CA 4N3CA 3E4BA 3HYMB 3PE3A 5CHEE 6GPBA 3LKUA 3VUFA 4G23A 3TG4A 1GGNA 1GFZA 2SKEA 4UI9K 2GPBA 3QKWA 4BT8A 1E4OA 2F3SA 3WADA 3E3LA 3UYLA 2XCIA 4WUYA 1Z6PA 4MI6A 1OUVA 2XGMA 1JIXA 4LDPA 2DBAA 1LWOA 4GPBA 4X7RA 4I9CA 3RSZA 4WNFA 2X0DA 4CTMA 2QRQA 4N5CA 2ATIA 4ABNA 4WHMA 3LY8A 2PYIA 5I45A 1SXPA 3Q15A 2XA1A 4GA1A 2KCVA 2LSUA 4AMGA 4GYYA 3L79A 5D01A 3MT9A 4EKEA 2AMVA 2FBNA 4MI3A 2VSNA 3FP3A 5C1DA 3H4TA 1K06A 5G04J 4LEIA 3CEMA 3BDAA 1A8IA 4AM9A 3ASHA 4MICA 3MTAA 3CUWA 3GPBA 3ZCVA 4YVOA 3NP7A 3RSCA 4UI9C 5DBKA 1FTWA 2Y4TA 3UPVA 3CK9A 3L7AA 4YI5A 3UQ3A 4IN3B 4F96A 3CVLA 4W6QA 3OTGA 4MRAA 4H7XA 3ZCSA 2MHKA 5M72A 2QLMA 4J8DA 5TMBA 1YA0A 1KLXA 1PSWA 3UYKA 1E1YA 3KAEA 4N39A 1ZBPA 3MS2A 2C9ZA 4HWGA 4X6LA 2GJ4A 2QRGA 3GYZA 1FS4A 4EKYA 1ABBA 1SXQA 3OTHA 3T3EA 3LPZA 4I1AA 2WQHA 3CV3A 3MTDA 2X6QA 3TG5A 4I9EA 1Y8ZA 5DXFA
chains in the Genus database with same CATH superfamily
2ZCVA 1MR3F 1TR4A 2ACEA 2QL9A 2O20A 4JASB 2WB4A 4EFKA 1CE8B 3IRUA 5I3ZA 1EM8A 1K6JA 1JDBB 1TLLA 4ZT3A 2AX4A 3S68A 3ND6A 1DRWA 3W90A 4N8DA 1I3LA 1E20A 2CUZA 3OF3A 1R0YA 4L76A 1TOAA 2YDXA 2C95A 4N5HX 1CUEA 1L1QA 4NFLA 2VRWA 5EXTA 2Q9UA 3U7IA 4ARAA 3H83A 4FNOA 1O1SA 5LYJF 3MCUA 1QG6A 2YFHA 4PLYA 3GJ0A 1P4JA 1FLVA 2DP4E 3HKEB 3NPMA 5MGNA 5E7MA 4BLQA 3MGKA 4LOJA 5ESRA 2HNBA 3LBNA 5GJWC 5AJVB 1EVZA 3PNTB 3ABQB 2A88A 3H84A 4I4IA 3LNTA 2W0SA 2PX4A 5AI9A 1HO3A 4MQFA 4W7IA 2FX2A 4YJGB 4EVSA 5HX7A 1GW6A 2VT7A 1N6IA 5LOZA 5JNSA 1NP6A 1GPH1 1SAYA 3OJCA 5ALPA 2WTEA 4YWJA 3UOAB 2HBQA 2VHYA 1RI4A 4I1VA 3W2IA 5F35A 3X2FA 4NATA 5HZMA 1OVGA 1R88A 3V3LA 3M2TA 5FF9A 3RHFA 2V0NA 1D2EA 4QGBA 3RHTA 2ZUEA 1RXYA 3EG9A 3NH9A 1YRYE 3I8OA 1DCTA 2Q3BA 2YIJA 2KS6A 1SG9A 3Q6MA 4IPTA 1KYYA 1L6RA 5L3QB 4EHJA 1QWSA 4DQLA 3O7WA 4CMGA 3LDFA 2P40A 4RJTA 1T35A 1KJ8A 2QJRA 3EW7A 3FMFA 1IPEA 2PRSA 3KYJB 1JLKA 4RDIA 4KR3A 4NEQA 5EIEA 3DPUA 2PUJA 3MYYA 5SY4A 3VTAA 2ZBDA 2CFCA 4INZA 4C6TB 5B55A 5BN3B 5BYKA 4FZ3A 1ZNWA 2F9FA 2IYSA 2C8LA 1SD2A 4UMFA 5H3HA 3G2TA 5DU2A 2QN3A 1ODTC 3TDNA 4B2YA 4YQEA 4CR6A 1G8SA 3X1WA 5ADUS 1WETA 4D0LB 4FYXA 5KNHD 3KPYA 4ND2A 4Y1FA 1BOOA 1Y4DE 5MFZA 1NOKA 4ZQEA 1FCHA 3RO3A 2AL7A 1NNI1 2O57A 2OZLA 2KM1A 2I0FA 4K28A 4RX1A 4UZEA 3QPVA 1X80B 4TYPA 1NA3A 4HXGA 5EXEA 3TEJA 3TSCA 6ABPA 2KWIA 3PI6A 4JGGA 4EGCB 4BTVA 3OPMA 1P4RA 1XZQA 3F5MA 2HSGA 3AT1A 4AWBA 3ULQA 4XYEA 5BYBA 2WV7A 4LMBA 4UHCA 4WEOA 5IUNC 2D3WA 3JWEA 3IDAA 3E8MA 1U0HC 2FWRA 3WNQA 3OP4A 3MZ0A 4MJLA 3BSYA 5FWDA 2FF5A 3RSEG 2GZRA 1LV7A 1D4AA 1L5ZA 2OAQ1 2BHTA 3BJEA 3OQBA 4U4AA 4GTQA 1GV1A 1L5HB 2O6HA 3QFRA 3JWGA 4Q69A 4P4TA 3PQEA 2XHZA 3MTBA 1NZJA 4CNQA 3LS8A 3D6FA 5FWNA 5JHAA 5A06A 4ASUD 1YB6A 2QRUA 3H5IA 2JRCA 3I9FA 4HAOA 1K1AA 4W4TA 4G0XA 1XTTA 1HNXB 1RAEA 2J3HA 4HH4A 4E07A 4WX2B 5GIPE 2JLVA 3COWA 3HUUA 3I4CA 1EDZA 4MVJP 1FY2A 1DAEA 2R7NA 4G1FA 1H6BA 3WMRA 2PWAA 3N0XA 2YV4A 4X95A 1WW3A 1O4VA 3QE9Y 1HZZA 4NWIA 1U4SA 3DAGA 3FPCA 3NBXX 1OBCA 5IDWA 2GO1A 3INRA 2XYRA 1YULA 3DR5A 3R5KA 2AVDA 1X80A 4RPKA 4YA6A 3EAQA 5GONA 4D8XA 1TD9A 4HY3A 1BN6A 1QGYA 1WQ3A 4HP8A 4YROA 2PSSA 5DHTA 3WGHA 1MO6A 1YBVA 2CJFA 3R5XA 4LJYA 4XTRA 3UT5B 4DB4A 3JXEA 3KHKA 3LUHA 2PSFA 4ATNA 3GDWA 2DPGA 2I6TA 4G0QA 3ER9A 1ABFA 1ONBA 1CDZA 2OV2A 3TG8A 1RKXA 1TKBA 2H06A 3L6UA 1MN6A 2V6MA 1GT6A 2WG2A 4B46A 2PVPA 4FHCA 1ZCZA 3BXHA 4PYOA 3BEDA 4DC0A 3HFSA 2IPMA 4I1OB 4H0NA 3AEUB 3ASUA 3O48A 1X1CA 1XI2A 1CQWA 4OF4A 4ZVOA 1KSFX 4K40A 1Y89A 2YMLA 5HIIA 3OFKA 4RO0A 4MKRA 2OBFA 5BUCA 3PREA 1E4YA 2HWUA 3RF7A 1ADJA 2I6UA 5JI2E 2H18A 2FPIB 3FIJA 4HVAA 3THSA 3VDMA 4F11A 4JC4A 1BVHA 4D10C 3DQQA 1E8OB 2BFNA 3HJUA 1KZPA 3B53X 4ZIRB 1R8JA 1AWCB 1JWBB 3OCZA 1HI9A 3N6XA 4MKIA 2XD9A 3W7BA 2RGRA 2JHAA 4BNTA 1KDVA 1JWLA 1SXJE 1ZUD1 5F7ZA 1J5XA 1R6AA 3GAMA 3PQ8A 3T3PB 3SGHA 4R6WA 4FYMA 5IXJA 2IS2A 1YUMA 1XP8A 2R6GA 5DYWA 3TDKA 3RTAA 2ADOA 4H7EA 1VOTA 2DJ5A 4W1RA 5FTNA 2IJGX 5E0KB 1QDEA 1YD7A 5KNLA 3FPBA 3OCWA 5EIBD 4FZJA 1HE2A 1UPXA 2W2OA 1P8AA 4H7DA 4LHSA 4DWWA 3U48A 4AL4A 4JL5A 5ENRD 5JAMA 2V7TA 1C3OB 5AOXA 4UQLA 3KSDO 5KOJB 1D2GA 1ZH8A 3ABLE 1B42A 1H1LB 1Y7TA 4BZXA 5B2EA 4UHHA 5C8XA 5CNKA 2IW1A 2CMKA 4GPAA 4HKTA 4II3A 1KBOA 2QTRA 3MWJA 1YQTA 3AEUA 3IE0A 3YASA 4A6XA 5DH9A 1G9SA 1ZGCA 3DKVA 4V39A 2Y0CA 4K8RB 5CXSA 1C8VB 4PYNA 3DMFA 1UBTS 3CLTC 3GDGA 3RC3A 4BLRA 2G7MC 1HTWA 3MIIA 3SR0A 2JIPA 1KYXA 2QX6A 4XTCS 3FF4A 4KQFA 1XMIA 2YL2A 3FR8A 5FNVA 4XRGA 5AUPB 3U4HA 3PU6A 3EVBA 2QSZA 5K3AA 3CM0A 1Q15A 2Q3FA 3DE0X 1IAQA 3P2EA 4BQSA 2DC1A 4E11A 1N5DA 2XUPA 2ETCA 1E1MA 2A84A 2NXWA 3T34A 5AW3A 2FE1A 1V25A 3OOWA 4H1VA 9GPBA 1GQ2A 1XVLA 2WYWA 5EWLA 4IILA 3N0VA 1KI7A 1YIAA 3R7QA 3O93A 2GETA 2GF0A 3RYHA 1Q21A 2PZMA 3MERA 3B82A 2KCLA 1HMPA 3I52A 4POOA 1NBHA 1Y8QA 4HN4B 1JFRA 2FUNB 3WGIA 1QQAA 3UPDA 2HZBA 3ZGQA 3MWGA 2XNDD 2FOLA 1O9BA 2R11A 1JFFA 4TKLA 1CHDA 3F9CA 3BS4A 3GEEA 4BQOA 1C3OA 1QKKA 2IXEA 3AP2A 3ETNA 4F3YA 2OSBA 3F6CA 3Q9LA 2QD5A 1KFKB 4ARZB 1EXNA 2YRFA 1TECE 3FLBA 4M1SA 2OORA 4OHUA 3LKBA 4IG4A 3OJWA 3DVQX 3QVOA 1U3CA 4RSMA 3BH0A 4FULA 1CNEA 4LVOA 4M1WA 4RHTA 1BDMA 4BO9A 2A3RA 2GN0A 1Z2OX 4I14A 1SXIA 2B30A 2P2DA 2O2EA 4EYQA 2E1RA 1N36B 1KO5A 3W9GA 3EQ2A 4X1IB 5LB2A 5CIYA 3L8YA 3F96A 3K1AA 4P4GA 2FO1E 1OHHD 3QVVA 3CE9A 5FNVB 1WMFA 4HEJA 5FFFA 4B3BA 4DIMA 1U28A 3BZUA 1ORWA 1YZNA 4M8NE 2ASVA 3SYRA 4CV3A 2EX1A 4Q9IA 1QF6A 2AVNA 3G85A 1L5QA 5JD5A 2XB4A 1Z22A 3I04M 2PJUA 2HXGA 1F0KA 2PUTA 1KQGA 2EGUA 1RABA 5BWNA 2A9PA 4PDXA 8ADHA 3G2KA 1HE3A 2DZNA 2GRAA 1ZM4A 1JG4A 1L7MA 2WE8A 2ZIUB 3DHEA 1Q0SA 1U8AA 3ETLA 4HAXA 4MUGA 1BXRB 3HM2A 3DULA 3TZHA 1K92A 1E2LA 2YQ4A 2YIMA 2P69A 1QV6A 2IHJA 2AWIA 2W0MA 3B5IA 3PNQA 3LXRA 3SM3A 4DLRA 1R10A 2CL0X 3QUBA 4QQIA 3VV3A 1OIVA 1I1QB 1UMBA 2R9VA 1SU8A 4L85A 2A4MA 3IURA 1PDWA 2FNAA 3M4ZA 4LSZA 5G02A 3T12A 2WXLA 3TVTA 1ONPA 4NMHA 2FWAA 2VGEA 4JFRA 4P4NA 4YRCA 3GT3A 5AW8A 4HNTA 1PJBA 4QLOA 3WYGA 4TVBA 2B6NA 4AZ3B 4RTLA 4Q34A 2MDTA 3CSTA 4O2BA 2WT4A 1CYEA 2QMOA 2J0VA 2KBXA 8LDHA 2A92A 5AH0A 3T7RA 4EPYA 2Q4RA 1SA4A 4Y1RA 4X1IA 3EAGA 2VNKA 1EFPB 1WXHA 2XADA 1Z29A 1QJ4A 3CW8X 4Y2VA 1H5QA 3N28A 4I8IA 4IMJB 2GRLA 1JLSA 3OQNA 3AVYA 4PO1A 1M1XB 3C24A 4F4FA 5LQDA 4HYEA 2W6QA 1A2BA 1HV8A 4MYUA 4WJKB 3B2QA 2EV9A 4WK2B 5EXSA 2XB9A 5HBRA 5EMKA 3WLLA 2IBMA 1BPOA 3EZGA 4CG0A 2G8NA 4YRIA 4YP6A 2IQIA 2LDXA 4AVXA 4UNQA 1GTG1 3D3KA 1UG3A 3W9BA 1OWLA 3F4LA 1DQYA 1BD3A 1ZB1A 1O96A 2AD5A 1QH1A 3PC8A 4QEDA 3EHRA 5BSRA 5L7WA 3BXXA 1V8BA 4Q7MB 4FDVA 4C20A 1L5JA 4H1TA 3EHQA 2IH2A 3V2IA 5JSHA 5H4GA 4CIXA 2QVXX 3EFOA 5TF4A 2J9XB 5ERXA 4R9NA 4BBPA 4ARIA 2OEWA 3TXMA 3M33A 1P2VA 2O2HA 4UVHA 4ER6A 5BR8B 1S8NA 4YT2A 1WCYA 4PSCA 2ZWVA 5BPHA 1UJBA 1PHRA 3RJTA 4G0VA 2PRKA 2FUEA 1R4MA 4NZZA 2OZEA 2IOYA 1MOSA 2VNJA 3QMWA 4RTMA 1A7UA 4NBWA 2F7SA 4W6ZA 5AHOA 4URVR 4ISBA 3KZOA 1Y9AA 5FYDA 3DYVA 3PRJA 3UENA 2ZAOA 2R4TA 1DAFA 1GPAA 1JG2A 2WJGA 1U7XA 1NASA 1YCSB 3FSEA 4Z53A 2CHQA 2WJIA 2QRVB 4M87A 4PWYA 4JBIA 5IVDA 4DDTA 1RVDA 4PLTA 1SMKA 3URKA 1M54A 4F3KA 2GRPB 1N52A 2OEVA 1EHIA 3W3AA 1J2EA 1JXAA 5TARA 3WQQA 3DHYA 1FYVA 5LD2B 4L4RA 4LSGA 4H7IA 1WUHS 1KZOA 3NAGA 3PR2B 2FB9A 4YPVA 5G0WA 2X19A 2GYYA 4ZAYA 1R9MA 7MHTA 4QDUA 4GQAA 5JHGB 4AXHA 1X7ZB 3CGHA 4A82A 1H85A 3V9AA 5EY5B 2FPIA 2IOHA 2F1OA 4AKTA 2BGRA 5FH9A 1DCEA 3AP3A 3KV1A 5K0NA 2GDJA 3LE8A 2AXQA 1GUDA 1O8BA 3TQHA 4LZAA 1N3YA 5CT9A 1N0QA 1P3JA 3NC1C 4YPFA 2DKNA 4UEWA 5I7RA 3AVOA 1TMKA 1TYDE 3NALA 5EE5B 1Z47A 4M0FA 3RYIB 2QL6A 4CIVA 3QNMA 5IT9A 5HCUA 3G8YA 2BHLA 1PTJA 2CB9A 3KQQA 4IIFA 2IK8A 3RTDA 1Y5RA 3PL5A 4WWPA 1J8FA 4HNAB 3UMVA 3LHFA 4TRJA 1W4LA 3W5VA 4HYTA 1HFAA 1SXHA 1CUFA 4I3GA 5HCIA 4YS6A 5EOVA 1E96A 4PN3A 2GH1A 4A16A 3AXTA 4OBEA 5K0ZA 5HR5A 5IYZA 4G1BA 1ML4A 4OFZA 2D1FA 3D8NA 2IZOA 2ZDHA 4NBSA 4OU4A 3TE6A 2HPZA 3QKWA 1GWNA 4HDRA 3HCBA 2V7BA 2Z5GA 5FYQA 3PK0A 2OWDA 4BWFB 4DJFC 3HXOA 2DQKA 2WAYA 1YONA 4Z49A 1Z6PA 4LJ8A 1OUVA 1ODLA 1JIXA 1G21B 1Z4OA 4PR0A 2DFDA 3SF0A 2MSKA 4WVFA 2JLUA 3FPSA 5I9SA 1YKFA 2FKNA 3BL8A 4LGCA 1RP1A 2ZE8A 4WNFA 1RDFA 1VG8A 3WV5A 3VO2A 4ZYTA 4GOKA 4B7XA 1WR8A 1RWPA 1I7NA 5GVRA 5I7EA 1MX1A 2IZ6A 2VP2A 1WMDA 2JVIA 3A1NA 4DG9A 5ILOA 3PHBE 2ZJAA 4LISA 1KY3A 2Q9AA 2KI5A 1NV9A 4GF5A 3OZBA 1GAEO 4IJ5A 5JC1A 1GO2A 5KOIA 4TXRA 4D8YA 4WNIA 2FBNA 3D3MA 4XM0A 3CEPB 1L7EA 1R74A 1SO8A 3NV7A 1YRHA 2VSNA 2VOEA 3PQCA 4OX9Y 1W35A 2FUG6 1U28C 1T26A 4RHUA 4RSRA 3E48A 4EGFA 4YMVA 4PGGA 5IY5E 4HQOA 1C80A 4U02A 5DCLA 5EIBE 5E76A 4MRPA 2VUSA 2G5CA 3B9BA 1JXQA 3AYXB 4J7AA 4OXRA 4QQKA 2P7HA 1BCSA 3AY0A 3EZFA 3K5IA 3BGVA 4UI9C 1F17A 1TF5A 1CR2A 3DLIA 3MMXA 4HZUB 2NO4A 1BU9A 2PKEA 3B1XA 3D6HA 4JP3A 3UJAA 4C0JA 4C7VA 5HA5A 2P27A 1RYMA 2REQA 4M36A 1DG1G 3MF4A 3IDSA 2WKRA 2BE7A 5BO5A 3VPHA 1OY3D 4J8DA 3IEVA 3GVCA 1JW9B 2ZDGA 2JI7A 2X58A 1RPJA 1U7UA 3C3MA 3LQFA 3OZ7A 2Q7DA 4WZZA 2C9ZA 3WP0A 1FP1D 2IGBA 5B7QA 2XITA 3SKXA 2Z83A 4TYNA 3PRZA 3GLGB 3CR3A 4QXMA 3A7EA 2AEFA 1X1EA 2Y1KA 3I34X 3NIBA 5AK4A 2CNKA 3QKUA 3DZGA 2ZG6A 5BSTA 1KEEA 2FPSA 3NEJA 1ABBA 4PFQA 4ZZ3A 3KDAA 1SXQA 4XCXA 1M34E 2VXOA 5KJ1A 2XY4A 1G6OA 1IXKA 4ML3A 3LS2A 4HFGA 3UKUG 4I9EA 4Q4JB 1BU5A 3EN0A 1ZIPA 4OHYA 5G05C 3D3WB 4I99A 3A9WA 5IVKA 3C4QA 1T1RA 2IA5A 3HEAA 5CMWA 2JLCA 2B8EA 4G41A 3NGXA 5CGQB 3OY2A 3WWPA 2XT0A 5BR7A 1AT1A 2HPAA 3WO1A 2R1TA 3G2SA 1UPUA 3MUEA 2BEVB 2OLEA 4GXTA 5HYVA 3QTBA 3M8KA 1YZQA 1E32A 1E1RD 2E2EA 3UH0A 1ESDA 4XYBA 2JGKA 5FI0B 1V3VA 1ZA2A 3CISA 3BQOA 3K1ZA 3JRWA 4EMTA 3H8JA 1KQNA 5C2YA 6Q21A 3WGUA 1BHQ1 3CQ9A 5H8WA 1NVGA 3TLMA 4Q1EA 1HL7A 2AFIB 5E2BA 5GVSA 1QP7A 1Z8HA 5DI3A 1RRKA 2QQGA 4DM7A 2DLCX 1YL7A 1VC2A 2V8SE 4GKJB 3PNBA 4QOSA 4FADA 4ZYXA 2F0YA 5KQPA 1O8CA 2E21A 2VATA 4Y1RB 2RJOA 3VZSA 4YAWA 1F12A 1BOFA 2DPYA 2R1ZA 1WABA 4V2IA 1OXUA 5EXDA 1JTEA 3THYB 3GLFE 3BGSA 2ZRPA 3ZVLA 4NOLA 1OLUA 1KYVA 1JX6A 1ZS9A 2YWEA 2PD4A 3QG1A 4FT2A 5ERGB 4FFBB 3ZKWA 4BDSA 3VR6H 4MAMA 2AV6A 4CGVA 4PS1A 4REQB 2X0RA 5JCJA 3C3OA 2GA9A 2C7QA 2Y77A 4GGPA 1ZESA 4FDTA 3TDMA 5EJMA 1SU6A 4GVXA 1YOBA 3EWSA 3F3MA 5KIAA 3PT5A 1QCYA 3IDQA 3VSAA 2IH5A 2Y0BG 1CD5A 5ENTD 1GZ5A 1SCKA 1UWVA 2HO5A 2G9RA 1SA0B 1NV8A 3LSTA 3R5TA 4ZV9A 3IPRA 5EINA 3LKVA 2C2HA 2BEVA 1S8FA 1XK6A 3CLVA 2RAFA 2W8ZA 1LCIA 2Q49A 4QDKA 1HG5A 3EG9B 4RV4A 4XKJA 4IMPA 5FLKA 3FOFC 1W87A 3JQRA 3A4TA 4I1UA 4M1TA 3JVUA 4N5MA 4MVJF 4E5VA 3NJRA 4K6CA 1RLIA 4ZT6A 5LM3A 5ALGA 1OX4B 1ACLA 3QMPA 3RRFA 3JQCA 1EB8A 4EW2A 1IXVA 3ZBUA 1J8YF 3KKQA 4LK2A 2I03A 3DE5X 1E8XA 3H75A 4EQFA 3TKYA 3V2GA 5EJ4A 4ZC1A 2EJVA 4U8YD 4JH0A 1RW2A 3RK6A 3P32A 5AQEA 4CM5A 2FPMA 2PMEA 3RU2A 2WJHA 1RC1A 2RAVA 2QVBA 4P5EA 1DRKA 2ZAMA 2XMPA 1XYVA 4ND5A 1SZAA 1QONA 3IQXA 3RJMA 1EWTA 3LCMA 4B94A 1CNFA 2O48X 3FG9A 4CL0A 5IVIA 4YDSA 1DC3A 4LZJA 2IYFA 4B0PA 4KVZA 2FVYA 4L02A 3VVBA 1JWFA 3OY7A 5BN3A 4LXUA 3KSBC 2ZJOA 4BT9A 2YYAA 4GA2A 3CVQA 1GNTA 4YWHA 3UJ9A 5LQAA 5J2UA 4KVGA 3MM4A 1VG1A 2I65A 3SNXA 1PR2A 3QIVA 4DR1B 1UK9A 4CM4B 1GZUA 1AA9A 1O9GA 1ZUIA 3DBLA 3RC1A 1SN7A 1YZKA 3TNFA 3O3MB 3MS4A 5F2NA 1YK0A 4C0EA 1K7CA 4CTNA 4X8OA 3MRTA 1XFAA 4C5AA 3N5KA 3OQVA 5ISMA 4GOOD 2QA5A 3D3QA 5I7FA 3HEMA 3JQAD 4F8EA 2PO7A 2HQBA 2VP4A 5AK3A 5EQDA 2Y1CA 1VE5A 2OO5C 1KK1A 4CDGA 1D2CA 4FOTA 2A9KA 4KRFA 2IP4A 2QW8A 4IL5A 5KEIA 3MT0A 4DCTA 2BM8A 4KXYA 4P4LA 1JA9A 1HE5A 1LRKA 1INLA 3DFFA 4RF2A 4TYMA 3STXA 1ZK1A 4DV2B 1T3ZA 4O59O 5JMOA 4DILA 1A9OA 1QOZA 2O8VA 2UY1B 3KR1A 1X8LA 3UM1A 1DZIA 2G6BA 1U2GC 3PD1A 4MCAA 3INGA 3IUPA 4IXTA 1GL7A 1L7VC 1CB0A 1UBEA 3ZW8A 3LCVB 1ZONA 2QTCA 1ICEA 3HJNA 3QF7A 4RS4A 4ZDJA 1IL0A 1R9NA 2DR0A 3ND9A 1ADYA 1BX1A 2OOKA 4ZRNA 2BDUA 1MFZA 2Q0XA 4AO8A 4UVGA 4DREA 4YMUA 3HSSA 1XWFA 2EFJA 3UPTA 1MB2A 3KAJA 3AIMA 2X0EA 3ABZA 2ATVA 4OM8A 3IOMA 3BFXA 5CGZA 4DVJA 1YGYA 3FCAA 1FMTA 3AM3A 3UY4A 3GPIA 2P11A 1GTRA 4C2UA 4Y2GA 2J6HA 4S1VA 4GTVA 2WIJA 4UDNA 4WOBA 1A9PA 4RJIA 1MJHA 2FW6A 4N3NA 1IB6A 5IG2A 3AVUA 2D7JA 5THXA 4EYOA 4YT8A 5JQWA 5E4TA 3FZEA 3BH7A 3FBGA 3FHJA 3GNSA 5BR4A 4MKZA 1YMQA 4IR7A 2R8XA 1A95A 3MSCA 2AZDA 2HNKA 2IUFA 1ZG3A 3O2SB 2XB6A 1NHWA 1P5ZB 4WPGA 2UV8A 5EGSA 1VKNA 3AKDA 2BHNA 1XNGA 2C3OA 4HZUA 4ND4A 5EE1A 1NMXA 4EUHA 3W6OA 1B23P 1YCDA 1G6KA 2CCKA 1GRQA 4O63O 3PEYA 3MV2B 4BETA 2NVBA 3OZUA 3RVBA 3TMYA 3EGWA 2HJSA 1YNOA 1YZHA 3K8ZA 3TJZA 4YDWA 3P9RA 2RGWA 1JXMA 1RPAA 1WOMA 4FHEA 4BC1A 5JJ6A 4NH0A 4Y9TA 3ASZA 3ENZA 1B41A 1TUEA 3CO0S 1Q57A 4XE0A 2C2ZA 2QTGA 3GFQA 3SD7A 2UUCB 3ONNA 4I50A 2B20A 4WA7A 4Z1OA 1U3VA 5SYMA 4WADA 3HA5A 1J23A 3MCZA 4FE4A 4QPNA 4Y2HA 1HDZA 4JHXA 3VM6A 4V3IA 4NARA 4PVDA 4UNIA 1OBOA 4ETMA 1RYFA 2QTZA 4L75A 3W5AA 4R83A 1KO7A 3MWLA 3EMVA 2VK8A 4IFTA 4JQZA 1CQIA 3SXJA 5C8VA 2AOUA 1CQJA 2O50A 4XYLA 3R8FA 2BSXA 5TQ2A 4AIIA 4JHRA 4YP7A 4AUNA 1BHO1 5M04A 5L6LB 1YACA 4LDJA 2Y1LE 3HPQA 3Q9SA 2REXB 4JBGA 1ESCA 2J9RA 1ULAA 2HU5A 2IY0C 1SC3A 2YNMD 2VDQB 4HUQB 3KSUA 2XTJA 4IV8A 4MLCA 1SQ5A 2JCGA 1KH1A 3CF4G 4JA9A 4ITUA 5DVZA 3G2WA 3FU3A 3EPLA 4KYUA 3QHQA 4X00A 2VQFB 3FUIA 4GRDA 3EZNA 3GRPA 3CH4B 5FJYA 4O2RA 1YL5A 1KYWA 1JHPA 3TPZA 5FOQA 1RRCA 1E6MA 2MWMA 3KKMA 4B4VA 2CDBA 1MYOA 3EUFA 4G5HA 2QJTA 3ROFA 1PR4A 2BUGA 1U90A 2M32A 4PH4B 2EW1A 1D2HA 3AV3A 5DI3B 5C5EA 5GMOA 2VEOA 1CRZA 2D0DA 4XVCA 1D07A 1E6EA 2NT3A 3H1TA 3PBKA 4FFVA 4MULA 3RBXA 3ZGYA 4EY4A 1F6DA 1RADA 4I50B 5TDHA 4UYKB 1C1XB 2BRUC 4KGDA 4NU6A 4OQEA 1OT5A 2XSZD 1UXHA 4X8MA 1UF9A 1ODFA 2VPYA 2YWFA 3Q2KA 4PAGA 4UAUA 4RG9A 4J7CA 4BZPA 4NFSA 3UB2A 1JFFB 1JHXA 4EM6A 3QPBA 4TGLA 4XDHA 4YJ2A 3OA0A 2QD1A 2VJQA 1SBQA 4AM8A 3DVRX 3HMQA 1PU2A 4HH1A 1H2XA 4IKOA 3GYXB 2IC5A 3WWYA 1KEVA 2A33A 1K86A 4TYQA 5HKLA 3WFIA 2QIPA 1EVYA 3AB3A 2CFUA 2EBWA 5LMCA 4GZ6A 5HIMA 4O0MA 2RARA 4DANA 1GTL1 3LQ2A 3ECSA 1C7IA 3L07A 1T3HA 4Q48A 1M3SA 1I7LA 3OLXA 1E3WA 1S9DA 2VT6A 2QE6A 1ES9A 2YN2A 1IK6A 2H1CA 1QUFA 2QXTA 2J32A 4CKWB 4R1MA 1KEUA 5FTKA 3QJZA 4OK5A 4D8TA 1P5JA 3LK6A 2XMSA 3DNMA 3C6XA 3EMKA 3GCXA 4WNAB 3QOWA 1N0RA 4XSGA 1QK3A 1JTFA 1CE8A 1KKMA 2GN9A 2FU5C 4UUQA 1FSGA 4BRSA 4F1SA 3ANYB 1XEFA 4DN6A 5AIAA 4IFEA 1WLYA 3CUUA 2I6XA 1CUIA 2GFIA 3GHYA 3ELDA 1D03A 4FHFA 2Y0PA 4HTAA 2C20A 4N8SA 4BP1A 4Y1EA 1E2FA 1YU6A 3DZHA 1C1XA 3IMCA 5J5CA 3D5TA 4QM6A 1ZH0A 1XEXB 1P2FA 2W6IA 3WWEA 1UJ6A 2OXFA 1JI0A 2TMKA 4RTKA 3RKVA 1Y33E 3FDHA 3U3WA 221PA 3HP1A 3GA0A 3LBHA 1F14A 1NBWB 5I9NA 1IBSA 1L8LA 1OAOC 3VJKA 4D8WA 4TV3A 2I2FA 2DPLA 3C43A 3N5CA 1ORVA 4O6FA 5E1MA 3VHXA 5AM5A 4EG0A 1FUKA 1DIAA 4BLSA 1A2KC 3L5OA 4FX2A 2QAIA 4I5FA 5FFMA 4D1YA 4PNEA 3SHTA 2HEIA 2FG6C 3BK7A 3QPAA 2XYPA 5KX5F 1O4WA 5FAXA 1H0HA 3HSKA 3VKWA 2HK9A 3DHNA 3SEQA 1SWVA 4AJHA 3EVGA 5FXMA 1AQNA 3LT1A 4J4BA 3GV0A 4UM5A 5I5EA 3U1BA 3PHJA 4JI0B 2FSGA 3GLSA 3WDLA 3I4RB 1SHKA 3LUPA 4LA4A 4NCXA 2MR5A 4ND8A 5KC9A 3UJNA 3PUJA 3RIMA 1E7MA 3BB4A 1X1TA 3ETHA 1AIPA 3MJRA 3SC4A 3SP1A 3TLJA 5B37A 1R0LA 5JA4D 1EQAA 2V6GA 4A23A 4EATA 2FEMA 2CZCA 3IOCA 3ONLA 4ANUA 2O9JA 5ALKA 5AI8A 3HXPA 4OGFA 1FJGB 2ERYA 4DR4B 1T2CA 3R8XA 4R9SA 1Z63A 1PCXA 4I2VA 2I4NA 1E1RA 2R6JA 4J0UA 1VHLA 2K2QB 1O96B 4N03A 3NDIA 5K3FA 5KQRA 2IITA 2AJ8A 2WTAA 4QVGA 4OVVA 4LY6A 1X7YA 1CS0A 1PUIA 1AD2A 1DKMA 3BWYA 4RUKA 4KZKA 4MEJA 5KVAA 4DLZA 2DH6A 4JUCA 1TFRA 4R1LA 1DKUA 1VBKA 3RRUA 3C3RA 3Q0TA 2AXVA 1G21E 3SS7X 1ZU5A 3FAZA 2QNBA 3DTNA 4TWZA 4DYVA 5JZVA 2AJLI 3ZGVA 3MOGA 4F1KA 5H59A 2ZBRA 3QU7A 4W5WA 4YRPA 4AS3A 3RC2A 3FUDA 1F1JA 4HOUA 3ER8A 5G05J 3U60B 1P73A 2H11A 1KL7A 1JJFA 4NBNA 1N4PA 3E03A 1QMGA 3DMNA 4BEPA 3GDHA 3PH0C 2BEDA 2X5TA 1NFQA 3FZYA 3ZZMA 3PUYA 1E5LA 2IUTA 3IH5A 4O1HA 3HCNA 3THXB 1Q95A 4I1PA 2R2LA 4FGZA 1OKKA 4GSKA 1L5HA 1YHNA 3KR2A 4D4LA 3BEOA 4OLAA 4IUYA 1KI9A 1MQ8B 2PANA 2ZE6A 2X4LA 2WKWA 3RIEA 3TUZC 5KSOA 2WUGA 4HDCA 4HH0A 4R51A 4TN1A 4DDHA 5LKRA 4YQZA 4GVPA 2QTHA 3OLCX 4H4EA 3FDXA 2RGBA 4MR8B 1MV5A 4Q94A 1OGIA 1P0FA 4BWVA 1CF4A 4XQ9A 4IDHA 1IB0A 2W9JA 1I14A 2XQIA 4KUHA 4P32A 4UMDA 2F17A 3PXAA 4XWAA 3JVVA 2IXFA 3E3LA 1K7FB 1UJ2A 2RK6A 3HZOA 2DFKB 5EKUA 3RYIA 2H57A 4GX5A 3CT4A 4ZI3A 3PTAA 2ET6A 3TLEA 1U3GA 4GPBA 4AP5A 3BWXA 3B3JA 3K2BA 3EX7C 1QWOA 2HKIA 5A3SA 3RSZA 3LIPA 5I8WA 4Y6LA 2IRWA 5H3LA 1ECFA 1U1EA 4UYJA 2AWOA 2XGGA 2GAOA 2ZR7A 1KY2A 1TPYA 4YIHA 4ZOCA 4DV4B 5CFOA 2VBIA 2I7VA 2VHUA 3X1XA 2CDCA 5G53C 1NX9A 1C30A 4ZV4A 5J40A 3P45A 4YAFA 3B3GA 3T4PA 1QBKC 1K4YA 1RS0A 2P67A 1SB9A 3RUIA 2KBEA 1N6OA 4Q02A 3GK3A 2NPOA 3H4TA 3T41A 3GP5A 1DJQA 3QOFA 4QLAA 4K05A 5DYTA 4AFNA 4GR4A 2WIGA 1CY4A 3BDAA 2D5IA 1T6YA 1ZD9A 4OYLA 4TXNA 1WBJB 3VDRA 3VPSA 3SBSA 3MTAA 1A8IA 3LX5A 2EGHA 1G0NA 3RS9A 4EF4A 1N3BA 3GAZA 4IEFB 5F4ZA 3RO7A 2PUBA 2GYUA 4Y2XA 4PAWA 3MLEA 4FW9A 2ZJ2A 3TWOA 3ETCA 3V1NA 4BE9A 1G5TA 2XTAA 5EZYA 4MV9A 1GGKA 8AT1A 3SY2A 1GKUB 1ZL0A 4HNAD 3OTGA 4JP2A 5MGBA 1IATA 2YOFA 3JATA 2YWRA 1J22A 4GBGA 2ZDQA 1B0AA 5IS2A 1VIVA 2HA5A 2HX1A 5B36A 5TIIA 3F47A 3I2IA 2H2GA 4O4JB 2WYVA 2MMGA 5F3WB 4MGEA 3U3ZA 4I4CA 2WMDA 2BFPA 5NULA 1NBME 1P39A 6CHYA 2WXIA 2VZ8A 1SCNE 2P2ZA 3UMGA 1BCSB 2PM8A 1L1RA 2RHWA 3ZY5A 2D1QA 4N49A 4BNIA 3N8HA 3K70D 5DK4A 2WQHA 4O02B 4JZKA 1Z07A 3F6PA 2REQB 3W0LB 4FGKA 2EG5A 4LJ4A 3T4XA 4HXYA 1NVKA 3ZIUA 1Y8MA 1SK8A 1U98A 3RS3A 2FWPA 1K3TA 3OLYA 1QFSA 1ULBA 4DIBA 5A4IS 5BSGA 2P58C 5A4JA 3EDRA 1TJCA 3GU3A 1K8QA 3LPDA 1YDWA 1Z83A 1Z74A 4WV3A 5C5DA 2YVLA 3O4IA 3MV3B 1NRIA 3TGPA 1MRNA 3OEHD 5HRYA 3LUCA 4IWYA 4O5AA 5E6RA 2PGXA 4CLHA 16PKA 4KKVA 5CLFA 4O4LF 2DVWA 1TVMA 4B81A 3HPRA 4Z8XA 1FFXB 3CFYA 4FD3A 2KLHA 2C94A 3UANA 5JZBA 4M2LA 4DE5A 1XELA 3L0PA 4Q01A 5C9ZA 3EFHA 3UUWA 2OCAA 4G0ZA 2X0IA 3QWBA 3S70A 1V37A 1NJ1A 4E22A 2WSMA 4HAYA 3TQTA 4EBAG 3WWZA 1GPMA 3GQBA 2OR3A 2YZKA 2OWEA 4DBZA 3FNRA 3GGOA 2JHCA 1OZGA 1H22A 2Y3IA 4XM2A 4CL3A 3G2IA 3KK0A 4EH1A 3G2PA 3CJRA 4RKEA 4CW7A 5EG5A 2F3RA 1II0A 1TCUA 1TKRA 3KLOA 4EKDA 1K2VN 3PQ4A 2QN2A 1VPLA 3IUBA 4BO0A 2GM3A 1XQ9A 1TA4A 1X14A 4FB5A 3ZYCA 3HABA 1Y98A 3EGCA 1DT5A 3F6YA 5IMSA 3PQ2A 3DF7A 1KAHA 2WWHA 1QHGA 1JMKC 5E8JA 4H6PA 1T8PA 4WACA 4AS2A 2AFIA 4C4YA 3OZFA 3AJIA 1NF2A 4JI4B 3Q41A 3CVWA 2DWQA 3OQPA 1DO0A 4QGAA 2F8YA 1HOXA 4IJVA 4P2BA 4ZV7A 4A03A 3GLIB 2Z8ZA 2NZUG 1D6NA 1FSSA 1MGPA 4RHXA 4ZPXA 5GONF 1K5GA 1SVOA 5EYLA 2JAHA 2QV7A 3KP1A 4X1OA 5AI5A 5F1OA 5TJ9A 3P9XA 5E6RB 3SVZA 5CAEA 1MEJA 4DUZB 2JH3A 1U7OA 2FI1A 4Q82A 4BKUA 1OLUB 4NS1A 4M7CA 4LI0A 4DJAA 1T1EA 1CIVA 1KH2A 1PTJC 4WECA 2DUUA 1AS2A 3T3OA 1X8JA 4G37A 4IBOA 1LLCA 1T1GA 4IVQA 4V0KA 5CFLA 5JS6A 3CHQA 2C7OA 1XNRB 3OWHA 4Z0TA 2CLLB 3RS0A 4I8XA 4K26A 4XI0A 4C4OA 5ITZA 3PICA 4FB4A 5IAAA 2AHRA 3AF5A 4YDHB 2Q29A 4WKNA 1K9SA 1YFKA 4HO1X 3BULA 1FDTA 3OM1A 5CDFE 4F2WA 2CLSA 2I4OA 4KQ2A 1AB6A 2WF7A 1X7ZA 1U9ZA 2V74B 1Z08A 1FDRA 4ZA2A 3C3YA 4JHJA 4KAXA 3LKZA 4J2HA 2LV8A 3REFA 3T5DA 3ZWAA 1RBQA 1LVUA 4MLZA 4ED9A 1GD1O 3GT4A 4F5ZA 4PC2A 3FB4A 3T0FA 5CB0A 2VTBA 4B82A 4MXDA 4BNLA 1J7JA 1Y5MA 2WSLA 4Y2YA 4D3DA 1IVSA 1OH7A 4PW0A 1P2BA 5EMNA 3WBFA 4HDQB 3H9GA 4MQEB 4AMBA 3KUCA 4LPSA 4YV0A 2C3PA 3IBFA 3IULA 2DH5A 1T3SA 1W94A 5AHRA 4CKCB 1L7QA 3V8VA 3E9YA 4BGIA 4MJXA 4OQPA 4AKXB 4HLEA 3RTGA 1Y3FE 3ABME 4P7JA 2COUA 5CDFA 1GTMA 3A0RB 2JFPA 3G9ZA 1M8PA 4LNUD 4A0HA 3QSYA 1ULSA 4KHZA 4RV5A 3T5TA 3MYRA 1OTHA 3HDJA 3F5SA 3N2IA 2J7PA 3KZKA 4ACLA 1ZMTA 1L4MA 4R6XA 2XOKD 2P6UA 5ICEA 2GHQA 3A6KA 3H2KA 5CFZA 3DTYA 4M83A 3UV7A 1HPLA 5AKHA 4JCCA 3D7MA 5BNTA 3MELA 2OILA 3B3AA 3L22A 4K9NA 4U7HA 5B1IA 4WAUA 1ZGHA 1O7JA 2X3YA 1F0NA 1PGOA 2X2PA 2BKXA 4EB0A 2PGJA 1RZVA 2XMCA 3K6RA 1ZM9A 2WFZA 1QH1B 1H9CA 1MHTA 2O7QA 4TTSA 1Z75A 4WSOA 4MSUA 3A06A 3DBLB 4L6CA 5EN5D 3TRHA 3ITDA 4M89A 5BN4B 3FVRA 4NOMA 4RY8A 3SM9A 5T8KC 3TZKA 1TO6A 3QLJA 1YJ5A 2JIDA 1T9GS 3U7GA 2YS6A 4BFLA 3TTSA 2E18A 3KOUA 4Y2JA 4AQDA 4NAVA 3P9ZA 2E4ZA 5AJYA 3DCYA 1F8XA 5DDIP 1JEQA 3RV4A 4BUZA 1SK9A 2VDVE 2H1RA 3DV2A 4LG1A 3TOCA 5EC8A 4DDMA 4F12A 1M7GA 3NXSA 3EXG2 4CKCA 1V5FA 4ODIA 2FR0A 4IEEA 4QYIA 3J81A 2QVLA 2JATA 1G8JA 3DZCA 3SDZA 3DPSA 2FK8A 4DX6D 4Y7CA 1HKHA 2X5XA 2WHPB 2HD4A 3CLSC 3ZHRA 5MFPA 5FIUA 4YI3A 1RTTA 4BJ5A 1C30B 1ZGAA 4RK5A 4NH4A 3OBIA 3IQGX 3L0IB 1S6YA 2VPZA 1C2YA 4CMKA 3L92A 4WXYB 2PQRA 2FDCA 1HE1C 4FM9A 3FTFA 5IPFA 4UQPA 1NIPA 4Y6GB 5FOTA 2MT9A 5JXJA 2X22A 1U2EA 4MROA 2E2WA 4P84A 4PYRA 2V8BA 5KKCA 4MUHA 2H1WA 4FR0A 2HE0A 3ADOA 3WTBA 4F46A 3E5HA 1P1KA 2ZQZA 1O03A 3ZOKA 3L43A 3FDIA 4ZO4A 3DE7X 4WCDA 2WXHA 5K0BA 5ALQA 2C7RA 4LTMA 4RHFA 4I5DA 2KLBA 1FDOA 3FUUA 5H81A 1KT0A 1NA5A 3NHFA 5ALHA 1CY2A 5FWAA 3NHLA 2ZS8A 4IDPA 3PX7A 1Y8RB 3O8DA 4HRAA 3EF0A 1Y9EA 1FNMA 3ML8A 2A1IA 4JXKA 1AV7A 2AQHA 4DQXA 3LQKA 5KUTA 2P5SA 3UT0A 4BZZA 4P81A 2KATA 1FU8A 2FE4A 2P9PG 4GP6A 4O4JA 4BRZA 2HK6A 4LY3A 2GRNB 1AQJA 3DO6A 3GARA 3UXYA 3JYSA 1P7CA 3ENKA 4EGSA 2RHMA 3P4XA 2QRHA 1CUBA 2YYZA 3ZGZA 2WHPA 1IN4A 2ZUBA 2W6MA 4Q4DA 1E2MA 1NW8A 3HY3A 4CM3A 1CEYA 1BRTA 3T52A 3KT3A 1C4WA 1PYDA 3KQWA 5ABPA 1PWYE 1UMDA 1R0SA 2B2CA 2GEDA 1CF2O 2PFGA 3WMWA 3BXPA 4EZKA 1QFXA 3LYLA 4ZVUA 1IFXA 1RE1A 4LNGA 1LS1A 3CLSD 4U8VD 3ER6A 1GGMA 1JU9A 1E2GA 1QQ7A 2DYKA 2QVCA 1WSBA 3PSAA 4EHKA 1QV7A 5JTUA 3V8RA 1RQNA 3HXLA 1GPDG 1E63A 2DTDA 2OEPA 5F78A 4GE0A 1YA4A 4QRHA 1CUVA 3UNXA 3W5UA 3T06B 3HLTA 3M6LA 3BE6A 4X24A 5JRDS 1UCFA 2XCSB 1L6IA 5DNDA 4QDJA 4WZBB 3ZV7A 5EP2A 2EKBA 5FBKA 3R74A 4E1AA 2RHBA 3EZ9A 4P8RA 2WG1A 2JL1A 4YVQC 2WXMA 4XEHA 2VPIA 4BV9A 1MHQA 1Z4QA 3WKEA 4CG2A 4PYJA 4NQRA 1VBFA 3L1IA 1XCPA 3PB3A 3NOVA 3PPVA 4YO7A 1T4MA 4PZDA 3O4FA 4MH0R 5D5QA 1COWA 4B6PA 1RHRA 2BSQA 1D8DA 3V1LA 3AY3A 1GNPA 1XC7A 1Q16A 4JCOA 3Q6NA 3G23A 5CERB 5EHQA 5L7YA 1AH2A 5JSQA 2B4YA 1FMJA 2FW8A 4KSBA 3QMVA 1YTUA 1Z73A 1SA0A 1N25A 4JNCA 4BQFA 2P1ZA 3SI5A 1SVLA 2QI9F 4KFSA 3ZWCA 4CM8A 5CLQA 1DMSA 1ZEMA 5T8IA 2VF5X 1O6BA 4FMPA 4YAKA 3H1AA 2BH9A 3IQWA 5HEKA 1P29A 2MYOA 1YE3A 2Q07A 4RXTA 5DSZA 4B80A 1O5MA 4AZTA 5KYWB 3VV2A 1OX4A 2Y1GA 1Q74A 3U31A 2QV0A 4FSHA 5F33A 1CQXA 2DQSA 3EIOA 1CDDA 4OAUC 1AF4A 2Q4EA 1D7OA 3FGNA 4FI3F 5IHXA 2NVOA 1NVMB 2PTGA 4FMBB 2X4IA 3TIVA 2RCNA 3KXKA 3GLGA 1ZRMA 5J63A 1L3IA 3IHKA 3L6OO 1RWVA 3D7LA 2HDWA 3DOHA 3OFND 5FQ4A 4KWHA 4EHDA 2E4AA 4I9FA 4Y6PA 2ZXFA 3IEGA 2Y68A 2PAAA 5T3UA 3RSHA 2F48A 1E1NA 1XMSA 1Y3CE 1OWOA 1RLMA 1DEOA 1ZCFA 3AUJB 2B35A 4KIUA 1KAEA 3Q1LA 4AROA 2HR1A 2UUBB 2CMFA 5LVAA 4HD8A 3COZA 3DF9A 4UVDA 5EJFA 2F9LA 1PAQA 2V55B 2RC5A 2GKSA 2Y9PB 4HAZA 1EWYA 3KT8A 4IW3B 5J2UB 1M2OB 3BFPA 1AKNA 1VPVA 2I9CA 3DXFA 2FN7A 1UWKA 1B3BA 3E3AA 1PS8A 3LL4A 3Q9UA 3AHGA 3KQUA 3O4RA 2IWHA 1SKMA 4FONA 3CN7A 5T4FA 2F43A 2P5TB 1BX0A 2R1TB 4R40A 4A1FA 4D42A 1DKNA 2DSNA 3J7TA 4A10A 3QARA 4BHTA 1VL8A 1RYBA 4WTOA 5CJ2A 3R7NA 3UMBA 2A6PA 1CETA 2YDYA 1C3VA 4WCVA 3DHWC 4I2ZA 2B0CA 1PQ4A 3GVHA 5B1HA 3T9AA 3QLVA 3QY0A 5DXAA 3RK4A 4EHIA 1BMFD 2I6HA 1TF2A 3CWQA 3FN4A 1GNVA 1IUNA 1DAPA 1GSIA 3DYIA 3LUDA 4F8JA 5LMUB 1QFYA 3EYWA 1HE8A 2YN4A 2HQRA 1OH6A 4Q7KA 1EDDA 4U0SA 1JAZA 3GRAA 1EU1A 1WP4A 4GQBA 3NFRA 4NYIR 5CVUA 1QE0A 3HC7A 3ME5A 1AN0A 1N6KA 5JDCA 1JWAB 4R69A 2WMYA 4P54A 4DARA 4MYTA 3AV0B 3Q5MA 5B1BE 1SZPA 1DIBA 4JJ6A 2DWZA 1FYEA 1LGYA 1W59A 5L3RA 1E5VA 2V7QA 2Z8XA 4M4SA 2C83A 4RF5A 5G0UA 2O8BA 4BNJA 3DFIA 2J5BA 4JT8A 1DPGA 1TCAA 2JB9A 3U7JA 3QU4A 3TRJA 5LJIA 5LP0A 2JKVA 5EJ7A 5JZMA 3WYNA 2XECA 3CU5A 5ALEA 4KQMA 4BU0A 1MO2A 4MTLA 5JEDA 5AW0A 2H1OA 3GUVA 1TTQB 1M2OA 4PLVA 5E1DA 1VA4A 5IEBA 2QX9A 3LT2A 2GAAA 2DIWA 3NCTA 3HKDB 3WNCA 2PJDA 4DLWA 5ANRB 4AN0A 1UFVA 1ZD4A 4EFDA 5BW4A 1T9GR 4DR2B 4U7JA 1ZJWA 1R8SA 2AXEA 4J0FA 2OGUA 4HS9A 1L1FA 3U16A 4L0CA 1NQXA 2A5DA 4LCTA 3QE0A 1NZNA 4RWEA 3UKOA 3RABA 4QOJA 3LWNA 1ZZEA 2F1HA 1LX6A 3BJZA 4NL4H 1K3FA 4P08A 1VHJA 4X6XA 2NVUB 4RV9A 4CDRA 5FQ7A 4MHOA 4RY9A 4MKFA 2LE0A 1KMMA 5AKIA 3LGAA 5EFOA 3SX0A 4MA5A 2PLRA 3S1LA 4MI1A 1AG9A 2PZBA 4G5OA 3PKJA 2ZANA 2MRIA 3KKEA 5K45A 2DZOA 4W63A 2FGJA 1Q2UA 4HBZA 2WXFA 3MA5A 4HOQA 3ZW3A 1THMA 2ZSBA 3TPCA 3UUXA 5JH7B 3LQ1A 4QEZA 5GJVC 1Z4JA 1XTBA 4IO1A 5BQOA 5JXIA 3KKKA 4WIAA 2KBFA 5AJDA 2B8TA 4PC3A 2JJQA 3UXGA 3AILA 1QG4A 2G5GX 4OGLA 1XZFA 1NVVQ 1CVLA 4LCEA 1Q91A 1M2VB 1U7ZA 1PLKA 3D2BA 3UV3A 3OD5A 4WXMA 4UDYX 5B7PA 2VP3A 2VYVA 3ISMC 2OCDA 3GZNB 1VJ1A 3WGQA 5NLLA 4XWOA 2D6FA 1IEQA 1QBGA 1QJCA 1Z2CA 2AW3A 2WSSD 1SCUB 3AJAA 3AW8A 3O83A 3IKLA 4KNVA 4U0KA 2IU3A 4N3CA 4XGRA 4DGQA 3KB8A 5E95A 1UKAA 3H7IA 2WF5A 2BGIA 4EPTA 1K5HA 2ZT6A 5F52A 4D9BA 3A70A 2H0QA 2H16A 4GLBA 2GPBA 1S2GA 3GJZA 4FBMA 4JKOA 3LO8A 5AW1A 1SUFA 3MCWA 4FHGA 2MU1A 3ULEG 3AB8A 4DLYA 2D4HA 2EKZA 3AINA 3VHLB 2Q3HA 2Z6AA 2OQVA 3I09A 3S55A 4V0OA 4Y8VA 1PNTA 2Z2YA 3JQQA 3NWPA 4X7RA 2YASA 3ZHQA 4DJDC 1VLHA 1J21A 3E82A 4KH0A 3AKCA 5HRUA 1FYFA 3MJCA 3VNVA 3EXFA 4CUZA 5AVQA 2J46A 2NXPA 1NJGA 1OI4A 4KO4S 2H5EA 4MR8A 2XA1A 4NRDA 4RTSA 3KSMA 2LSUA 1ZOIA 2R87A 5F77A 3R9XB 1ZNYA 3IT2A 2BGGA 3L0BA 3QNWA 1NR1A 5CP8A 4R8KA 3GNTA 1WBBA 3L8MA 1XXLA 1A8UA 5AR1A 3A25A 1RT9A 3PEVB 4RY0A 1Z0ZA 1ZGGA 3QQ5A 3U26A 2G9NA 1RQPA 3CEMA 4J8PA 4UHEA 3UK6A 2LNDA 3OIVA 4BVHA 1UPAA 3KYIB 3SPXA 2G76A 3T3NA 2OCIA 3MX3A 1ORRA 3CNEA 2QT9A 2WD8A 1YSCA 3KQOA 1AUVA 3WHPA 4PBSA 4DNFA 5DBKA 1FFYA 3AEKB 3UA4A 3HKEA 4MZDA 5TS3A 1XYYA 4J43A 4U6SA 4YI5A 3ZDAA 3JQAA 2FTKE 4K03A 1PF7E 5B53A 3V80A 2QJWA 2WTBA 3HWRA 3I32A 1JPVA 3TW8A 2XDAA 3ZY6A 3HHMA 3V8BA 1H1LA 5TMBA 1F2UA 1I4WA 1FW8A 2I91A 1I7PA 4JVLA 1IN1A 1QXSA 3ORFA 5CURA 1ZXLA 1XIVA 2VJBA 4X92A 3RM3A 1KJYA 1UPFA 2B6HA 2O0KA 3OTOB 4CL2A 4R81A 1CEEA 1SQ6A 5BV0A 2GAJA 3INTA 3FW1A 3GCGA 3O82A 2OXRA 3QPUA 4RGYA 3U3KA 3USES 5K0TA 3PG5A 2ZRDA 4QWWA 5HKKA 1RRGA 1POWA 2R7KA 2C2YA 2XAAA 1NXQA 1RAGA 1BO6A 1ZOPA 3FNIA 4E15A 2PKYX 1ZI6A 2X8LA 2YUTA 3D4OA 3TMAA 5EZYB 1JB9A 5DXFA 4BNFA 2YKGA 5FZSA 1Q1ZA 1YUBA 4IJKA 3E33A 4WNAA 2QUZA 5FEMA 2VF8A 5I5GA 3RIHA 4QKQA 2YH2A 5CBPA 1T4GA 2MYNA 3A31A 3MRSA 4QPCA 1G3IA 2FZ4A 5KTSA 1QP0A 3GLIA 2J6IA 1I3NA 4QOGA 3D9JA 4RAOA 5TSDA 1CSEE 3RUEA 3ICQB 4AIFA 1QM5A 1DZ3A 3PUIA 1BGXT 1CR6A 1D04A 3V42A 4L2LA 4HQDA 1Y8QB 4BMPB 4EYGA 5IJZA 3FLMA 1XEXA 1YTLA 2WPDA 2XWQA 1AHIA 2J3IA 3I6MA 3IPAA 3GLHE 4BNVA 4DCCA 4D9MA 1Z7WA 3HUTA 3PXUA 1XXHE 4HTFB 1Q0PA 1LJLA 4Q0MA 1CQIB 3BHNA 2SKDA 3ZLUA 4BGEA 1EE1A 1X94A 3A04A 2J3EA 1C8KA 4X85A 3VPDA 4IDEA 4X3PA 1SOUA 2HR2A 4DNPA 2XBLA 1LK7A 4YJ3A 1XLWA 3IAUA 4FBGA 1D1QA 1N5OX 1V16A 1I4TD 1ZJZA 2XWJI 5C1OA 3G8DA 3F3YA 2C1XA 2DWCA 4ZPJA 4JJFA 1D8EA 4NENA 2WLSA 4MA0A 1OFVA 4ANWA 4UD2A 5DHFA 3BT7A 4ZVTA 1CVRA 2WHYA 4CKBA 2VDJA 3HJTA 5TC4A 1PDOA 4RYLA 1GLGA 5EIDA 1PEDA 3SZLA 1E5QA 1TZ2A 2GTIA 4ND8B 1HDEA 2QQ5A 1PFVA 1AMNA 1D0IA 3EK2A 1P74A 3B6JA 5BSMA 3FYUB 3U4AA 1TVKA 1NYTA 2AFIE 2AUNA 1M9NA 2WVAA 3T5GA 1WD7A 1EUCB 2CXXA 3VC7A 3WKCA 1BS9A 2F8MA 3TLKA 1EP3B 5AYWD 2FLKA 2B82A 4P0QB 2GN2A 1DAIA 3D2AA 2CKDA 4YN3A 4ZAXA 4AZ0A 3E18A 4YECA 3GUCA 4ZAVA 2X0NA 5GJBA 2VJOA 3RHZA 1SQGA 2RBKA 1S63A 1X7YB 3HH8A 3NLLA 4MV8A 3WNVA 4E5YA 3AL0C 4CI0B 1LZLA 2I3BA 3C5HA 1N4SA 5KWVA 5E38A 2JHPA 2LAIA 2WXGA 2H2IA 2ZFUA 3B13B 3MS7A 3VNAA 4DSZA 2GN8A 2G0AA 3FSGD 2C54A 4AZ3A 4LDZA 2Q0QA 1IJKA 1WZIA 2A35A 1KEZA 4LJSA 5F12A 1ZKMA 2OV4A 4MDYA 3Q7RA 4G36A 3MAJA 4P0TA 4OTZA 4QOIA 4BKQA 1A4UA 4F9TA 5G3YA 4OX9B 4YFVA 1YAJA 1VXRA 5DHPA 3FLEA 5G4KA 1XMJA 1FFDA 1QANA 2AMYA 3O84A 3R5JA 3UFBA 4TL9A 1R0KA 3UGKA 3T9KA 4D3ZA 2NVUA 5BSUA 4R4JA 3V31A 4GTTA 4X45A 1JIJA 3ADPA 1Z2EA 1U31A 4G5YA 1LXCA 4IIGA 4EF5A 1Z12A 4B2PA 3F8TA 4U95D 3I9V1 4Y9RA 3AESB 1QBQA 3DC2A 4O4IB 3FMPB 1PTKA 3MUOA 4JODA 1E7RA 1KZ9A 2ZSUA 5I3CA 4I2WA 3T5PA 2O3QA 1MTOA 4OJTA 5AM4A 3QX3A 2ZJ1A 2P0YA 2IF4A 2QD4A 1KPSB 5EKXA 2CY0A 2ZSIA 3DV0A 3HLYA 3CX8A 4BWGA 2WXRA 4CG1A 5J2UF 4P58A 1X77A 4L23A 2ZJ5A 3RSGA 3GHHA 4KZ0A 1ZU2A 1FQJA 1AKVA 1QP8A 2F3QA 4TSFD 2LBPA 4K7JA 1Z26A 3FBTA 5BWOA 1SQFA 2HTFA 3R2JA 4JSRA 5TXGA 1DAMA 4P0PB 3B13A 4DT1B 4I7EA 4OQNA 2PJRA 3TJRA 4BU1A 2CE2X 2R5WA 2CHEA 1OTYA 2ZULA 4OQYA 5KX5A 3AM1A 1KDTA 1OT3A 5JJBA 1YJXA 1LDNA 4HNQA 4KPUB 4XFKA 5BWCA 2DR2A 4OCZA 4XVRA 4IDGA 4HBGA 3TTWA 5DKFA 5GV7A 4TXHA 4HVCA 1ZHHA 3ICCA 3RS8A 2YUIA 4J0DA 4G4GA 3EZYA 2Y6UA 1W4BA 4H0CA 4CIBA 5TVKA 2VGXB 4PHTA 5AOXB 4BGUA 1NRXA 1FP4A 2LKCA 5FINA 3K4PA 5HRCA 2CUTA 4XD7A 2QYOA 3WLNA 1V5GA 2TMDA 1ID8A 4YHBA 3I05A 4MYSA 4OHBA 4MVJG 3W3AH 5AQ1A 3R0IA 4OLHA 2J8ZA 5EJEA 4G4IA 2CXUA 5L3VA 1LSJA 4IJMA 4TZKA 2QY6A 3ADCA 4OFWA 4BPBA 1GXSB 2XUHA 2ZYWX 1Z2NX 4HLCA 4L95C 3DV0B 2OHIA 1LVHA 3BC1A 3O8NA 4R3UC 2RI6A 3ACDA 3TCNA 4G3XA 3A36A 3PNPA 4PHGA 3SZ7A 2AKYA 2V7VA 5JXHA 4R9VA 4KE7A 1CS0B 1DLJA 3NVAA 1STOA 4KO8A 2P9SG 3FB1A 3HB5X 3I5UA 3REQB 3BH6A 1ARZA 3VX4A 3T0IA 2COKA 5HW0A 4DT1A 2E5LB 2BD0A 1TK2A 4HPJB 5JFTA 1CZHA 4ZQCB 3WAKA 1UDRA 2WU0A 5LQCA 3EYAA 3JQPA 5G4LA 1EJ2A 4GLFA 3ZR4B 3SFTA 1JFTA 1YYHA 2RG8A 3NEPX 4N2SA 2WOOA 1YRLA 3E3NA 1NGSA 2CVPA 3OM0A 3PQ7A 4I1YA 1OHHA 2B8WA 2IPLA 4ID3A 4KDEA 5FPSA 1YRQA 1PQPA 4JVSA 3KZVA 2X5KO 4L5BA 4DJJA 1YBHA 1ZXXA 3EZ2A 2OHJA 4Y2TA 1M7BA 3AC0A 2QNIA 3PC8C 1JSRA 3MJEA 5IC5A 1JEYA 1GQYA 1NUPA 3R75A 4UTRA 1WUYA 5DCUA 4EJFA 3HVRA 4R2LA 1UP6A 2I7XA 2B98A 2E6KA 2H4WA 4OLJA 1I2BA 5AKEA 5AKXA 4ZDWA 2X8JB 5IUKC 2O5CA 2B61A 1JIKA 3WLQA 3VR4A 4D80A 3DEKA 3P2JA 4PHFA 4G0WA 2GEUA 3BIOA 4CT5A 1MVNA 4MLDA 1OTXA 4FDAA 1X13A 2PL9A 3DZ8A 2PV0A 5AKKA 4BJ1A 2NYUA 4QU8A 1IHBA 1EX6A 2QLNA 1Y7HA 4JGIA 3PHCA 4N6OA 2X77A 2H3EA 4Z8YA 1NLUA 3REQA 1DTSA 3NBFA 5HF8A 4F2GA 5LBUA 3U37A 1QR2A 1M6VB 3A1DA 4HDAA 5CEAA 1YCFA 3EDMA 1E5DA 3F4KA 4KFRA 3PGKA 1VYTA 3KOZA 2H4YA 1BMDA 3SG0A 3T7JA 4ZQHA 4OUKX 4MIYA 2GHTA 2GHRA 3IS3A 3DSWA 4Q05A 1DADA 3BCRA 4X62B 4LWZA 5A05A 3ZU5A 3R7LA 4EFNA 2M1ZA 3UCEA 1UMBB 3FYCA 3FOEC 4X94A 4M7PA 4E5SA 4TKZA 1KYIA 5J2TB 4GZMA 3A28A 2PZGA 2W6ZA 4QRDA 4ETNA 5BV1A 4CF5A 5GQSA 1QIHA 1HRKA 4PZYA 4D6PA 5CFRA 5FULA 2R5NA 4XGNA 4MA4A 3D6AA 4NBTA 4GCNA 2NNWB 1V2HE 2AG0A 3CLUC 2PX8A 3H2YA 2UYHA 1FOEB 2LTAA 5EDSA 3EIEA 1MB9A 3QFHA 1L4GA 4ZHQF 4W5TA 2EOAA 2E5WA 2DZDA 1P31A 2ADMA 5AP9A 1G17A 1BU8A 4QJ5A 3S2FA 3WLEA 3D59A 3UM3A 3TWXA 1A9ZA 1YWGO 5H02A 1MAHA 5HZHA 1C2TA 2OG1A 3AEXA 4WWNA 5LYYA 5C51B 2ZXUA 5H9WA 1TQ8A 3PYXA 3SZGA 4A8TA 4ER7A 5AKGA 4ZYLA 3LUAA 2PEZA 1YFJA 1RKVA 4ZALA 1Z17A 2PX3A 1LS6A 3SQDA 3C15C 4MEAA 1GITA 1T8YA 3ORYA 3AHDA 4HLLA 1C7ZA 5CXQA 2BZ0A 2Y3AA 2ONDA 4R16A 5LDGA 5THQA 4BVKA 2PT7A 4WNGA 2FSVC 2C7BA 3KDPA 2NYJA 2QRMA 4FVTA 1ND6A 1GL3A 1SBHA 1XZDA 4WA8A 4ZQGA 5KQGA 2Y8EA 3MTJA 5KJLA 4WLNA 4NABA 2WEKA 2CHGA 1A7JA 1R4NB 3NM4A 4RANA 3Q75A 1TJYA 4FEAA 4K9LA 5J2TA 4MMZB 2PGNA 3I28A 2EIME 3FZNA 4C1BA 4E2ZA 3AWIA 1E0DA 2I3AA 3BBLA 2NO6A 4ZCTA 3P2IA 2OOSA 2YR0A 5F5NA 3E23A 4G84A 3B5JA 3MTIA 4XSHA 3ZHUA 4R2XA 3K09C 5JATA 2E6UX 1QPBA 4R1TA 4FJYA 1W2WB 2G07A 3U17A 3VYRB 2BFAA 3I3SR 4ZVVA 3T6KA 1AP7A 2R6DA 4MV3A 4GZ3A 2Y0EA 4ENUA 1OWPA 1DWQA 1GZVA 2IHUA 5HGJA 1ZN7A 3OLZA 1XTJA 3H65A 4P98A 4RENA 4UVIA 4R31A 4DR5B 5J90A 1K5PA 1V96A 3LUJA 2FZ5A 4XDZA 4NU8X 1NQWA 3B3QA 4RD4A 1YJCA 5AOAA 4X5OA 4F6LA 3KZCA 4LC9A 1NXWA 2VWGA 5IZCA 4URKA 3NAQA 3DWLG 5AJWA 5I8ZA 4PX9A 1KARA 1MJGM 3U3RA 3EQZA 4E3WA 3BMNB 3ETGA 2Q5IA 4L9RA 5IN5A 1W5FA 5K4GA 5DZSA 4B43A 3ROTA 3DJFA 2VQ2A 4N0QA 1L4EA 5EUMA 5JW6A 2PYDA 3M1LA 1JJ7A 3T5MA 4O1MA 1E0SA 1FYXA 3RWOA 3NF1A 1J09A 2H7XA 3GJYA 1C0EA 3CK7A 1WW2A 3A8TA 3I6BA 4BFYA 4CR8A 1E8WA 4DPLA 5BN4A 5JQGF 2Z9CA 4KJZA 2VHQA 2XYQA 4N0DA 5COAA 3RR2A 2I78A 3TB6A 2PXCA 3E32A 2WWWA 3PUVA 1H5NA 1EVJA 1XJ5A 2WP0A 1CZNA 3FUKA 3T3MB 3VO8A 4P3PA 3AR3A 1CTQA 3NNSA 3OJOA 3ORQA 1V8PA 1LUAA 2C4VA 4DFDA 1DOHA 3IEMA 3FA2A 3NGLA 9LDBA 2FN8A 4L16A 1NPYA 2P41A 1XZJA 2A58A 3CZPA 4GPEA 1K8RA 1WNTA 4YRAA 1BMQA 3PFIA 1HQCA 4ZVPA 1BGVA 1VCIA 3ZK8A 2DPXA 2NACA 4ZT7A 4YDQA 3K16A 4JKYA 1FP4B 1S70B 3PX3A 1DOZA 4HG2A 3JQBA 1URPA 2YYSA 3OT4A 3BB1A 4JMPA 2E49A 3ELWA 4A3SA 4KE9A 4DCNA 2FKAA 2EF1A 1DMRA 3B9RA 1L7AA 3AOEC 2JGDB 4FLHA 4EHNA 1WKCA 1E2UA 2Q4BA 3GD5A 3TIXB 4RH1A 3MTQA 3ZVKA 4YJDA 4YLYA 2FJPA 1REQB 2W2KB 1D9XA 4CM4A 1XCBA 3STUA 5IU6A 1MX6A 1CR0A 1YRAA 3V7WA 4C05A 2HBYA 5BV2P 4QZVA 3VMMA 1ILWA 4LXIA 3AF0A 3P2MA 1ZJ5A 2V5UA 1XAGA 2MSLA 2CL7X 4MAAA 1Y8RA 1R8YA 5ALZA 1Y37A 2I2AA 1KOFA 2ZSEA 4TTTS 5IKXA 4DIFA 4C4XA 1RM5A 2YFQA 3H0CA 4YNDA 4NPAA 3AI1A 5CA1F 1POXA 1I1HA 3S2IA 1F4LA 3HBLA 1QVRA 2BKLA 4G1EB 4F92B 3E9CA 1VB5A 2CDNA 4S1PA 2GEKA 1M5RA 1H1DA 4RLFA 3KQMA 3SS9X 3FE2A 5JH7A 4ARBA 2X6KA 1FP7A 4U1RA 1W19A 1H8HD 1BLXB 1QPGA 1VL6A 1GGNA 3ZEAA 3STWA 1JQBA 5E75A 1SM4A 2OBNA 3E37A 2NXJA 3NTQA 3HP4A 3HDHA 5DJ5A 2B83A 4DC1A 2PKRA 3JD2A 1UAAA 4FHKA 4XX5A 3V7UA 4MI6A 3FTCA 3HBAA 5IAGA 2ZU0C 4ZJUA 2I1JA 3L7MA 4J0EA 2RGGA 4M0CA 2Q1YA 2X8JA 4MS3B 4KLAA 2Y69E 4G4JA 1WZNA 4FLBA 3ILYA 4I9CA 3I9MA 5LQNA 4IYJA 4JLWA 1VMKA 4LC1A 2L69A 4WERA 2Z1DA 4B47A 3AUFA 2W6OA 5AW4A 2H6EA 4S1OA 1WOYA 1C9NA 2NG1A 2PYIA 3CIOA 5CVVA 3Q15A 3CPSA 4E94A 4I6EA 2I7DA 2RC6A 4F72A 1X87A 3PZRA 1CT9A 4PGAA 4JJ7A 4TMKA 4Y9DA 4AF6A 3ID6C 5C7YA 2ERCA 3R3YA 4E7PA 4LJRA 4J8SA 1IHUA 1PG2A 2W83A 3H0KA 4KPEC 5BMOA 4BZWA 1C3EA 4B3RB 3ODGA 4PAOA 3S8YA 3KXLA 1WTAA 4ZI2A 3FPHA 4UBMA 4HWPA 4AP9A 5A9TA 3WQBA 2FRDC 4BWYA 4B76A 4JJZA 2CW5A 1TXGA 5AI6A 2I2XB 4AZWA 1HEYA 1YL6A 4QBHA 3IIIA 3SKVA 4GMGA 4BFZA 4LFAB 1M34B 4B3IA 1JH9A 3IEIA 1MO4A 1VPEA 2VJAA 3F0TA 3FFBA 1U04A 3GXOA 4PSUA 3B1WA 5H0IA 4LGMA 3QV1A 3ZH2A 5A1TA 1YR2A 5DLYA 4DC9A 4KXWA 2AJBA 4ZQBA 3B89A 3CNBA 1PSWA 3JSXA 3CMCO 1FBTA 1WL8A 5EVJA 1V39A 2W2NA 2Z2KA 3D1VA 3UWMA 4WN3A 2F90A 3GJXC 4WFIA 2P6OA 3OTNA 5AAOA 1T6ZA 3EPRA 3GAFA 4G0NA 4WZAE 3VVMA 2NZ2A 2Q21A 1EMDA 1XZKA 2QAGC 5BXYA 3I2GA 4P36A 2DERA 1ML3A 2X3UA 2I1KA 5AQBA 1ZLXA 3EZ7A 1A27A 5CA1A 4QAQA 3II6X 1QF7A 1X3LA 4DMHA 2TS1A 3KD2A 5INTA 2V1UA 2D62A 3KCQA 1MC1A 4TMWA 1FRNA 4IOKA 5F21A 4O3MA 2Q6VA 1HQYE 1FDUA 1ZIOA 2VAVA 3K1YA 3OA2A 3OE4A 3QVMA 3VKUA 2P9EA 1IY9A 1EXWA 1SKUA 3ANTA 4GMFA 1NVBA 1PJSA 2MSDB 1E1DA 2YV5A 3FM9A 2PGOA 3IUJA 3DFZA 4TZ0A 3VKVA 1BH2A 2L9BA 2FFBA 4QFDA 4G5FA 2Y1WA 5P8WA 3O3CA 4TN5A 4Q16A 3V4LA 1QYXA 3RAUA 2AN4A 4JVOA 4KZPA 5SICE 1NJ8A 1UFKA 4K87A 1JR2A 3H5NA 4YRNA 8OHMA 3KVNA 521PA 1UOPA 5DNEA 4U04A 3QVXA 5L3ZA 1LRLA 3W5DA 2IDKA 2OPHA 3T5AA 5K6AA 2PN1A 3OLWA 3ZLBA 3LBAA 3M5WA 3NHJA 5YASA 1NTRA 2IPOA 4NMWA 4ZGWA 5ALFA 2A1TS 3PDWA 5JCOC 2XCBA 4EF6A 1S9HA 4J7UA 4TSRA 4C0LA 4IUBS 4CQMA 4XJTA 1SOVA 3HMKA 4LJKA 5DMHA 4NZ9A 3PLNA 4XJSA 5A4AA 5CB6A 2OOEA 2XODA 4MMXB 2B25A 4JYAB 3L4JA 1T91A 2REBA 1WRBA 1H93A 1EF1C 2PM6A 3BEEA 1UL1X 2HQ1A 2QMHA 3DBHA 3OD1A 1BN7A 2GARA 4IIUA 3FUMA 3EVEA 3NC0C 4KSCA 3QG5A 3EXG1 4DLBA 1PYGA 5B6PA 3PJRA 1UJKA 2B0OE 4YJGA 2VHTA 2FF4A 1IIBA 1O58A 2NXNA 1T3TA 2QMYA 4KQHA 4Q1AA 2C82A 4AG3A 3H1EA 3ZE6A 1JQDA 1FJ2A 3R4CA 3V4VB 3GGGA 1PAUA 4PFJA 3ZNOA 5ANRA 2C7VA 2OQRA 5JZ9A 2VHVA 4K9OA 3PDNA 3ZCQA 4P3OA 2R2AA 3NOCD 2ZCUA 2P2SA 1E3WB 1U11A 2IEZA 1M76A 4PQGA 3AUKA 2Y1FA 4HX2A 1LBHA 3G5TA 4P3NA 1ECPA 2L0XA 4FHZA 3LCCA 5JY1A 3IDZA 5KVVA 3ILVA 1GAWA 3GJ6A 4OMUA 2E5FA 4UXHA 3TXNA 2PUGA 3LX4A 2PKQP 3O91A 2BR3A 2OGSA 2FSPA 3WFZA 2ZBFA 4RDXA 3CF0A 2XOXA 3QWVA 1YQQA 1Y1QA 3F8WA 1V2GA 5DWVA 5A3VA 2IXGA 4CQMB 4CM6A 2JI8A 2VYFA 1AKMA 4N12A 5AJXA 1E1CB 2JBAB 5HQJA 5DIFA 2F55A 1NBAA 4QM7A 2JKYA 1AM4D 4NJMA 2W9XA 4DRXE 1DG9A 3T5XA 2JZCA 2GXUA 4IAOA 3J80A 2CSXA 4RK0A 3SJUA 4ZHQB 2UY1A 2DFNA 3LPLA 3N86A 4JBWA 4EY8A 1JPLA 2JD2A 3ZJTA 4N9WA 4HLNA 2VSOE 5BW5A 3CUVA 3RADC 4XWGA 4KAJA 3WO0A 5C7IO 4V1CI 4CHGA 1EX9A 2C4NA 2EBHX 2E89A 1C4OA 1ZW1A 1WS6A 3MEQA 4LRTB 4XJXA 5ICGA 2F43B 5AHXA 2JJ2D 4BSZB 3DA8A 1T8SA 4WZBE 5IAKA 5K3FB 2R1VB 4TWIA 3E84A 3EVNA 1K4MA 3FI9A 4PBRA 1FX1A 2IV7A 2FUG1 1JPUA 1YS7A 2WJAA 1A0OA 5DLEA 1EWQA 5MHTA 1WZCA 1E89A 2RG1A 3I9KA 3AQ4A 5DBOA 4AK9A 1JE0A 1PZEA 1RLTA 4LHEA 5JSKA 1BWRA 1KBZA 4CF4A 2BKUA 3V2UA 4BY9E 4FOOA 4MUIA 4O4IA 1EBUA 1Z2PX 2BV3A 2OXEA 5CVCA 4ZRDA 5E7QA 4HEHA 1DQZA 2C0LA 5HIAA 3K9FC 2IYYA 4AEZC 4LNUA 4OATA 3HJHA 3SEFA 3T94A 2NOAA 2XD4A 4TPKA 1DBSA 3PHIA 4Q9JA 5DTQA 4D96A 1L5KA 3Q73A 1JV2B 1VHWA 2VJDA 3S5JA 5JVDB 3CZ4A 3PYMA 4IOLA 5BP7A 3R9XA 4EGAA 2CK3A 1QE3A 1AX9A 2DKOA 3AIKA 3P4YA 3R1IA 2BF7A 4WOPA 4E5KA 2A5FA 1E2QA 3PFWO 4RE6A 3QEOA 2WU1A 4DCGA 1TCCA 3A4LA 1Z38A 5T7BA 5FFNA 5B3SE 4EPZA 5PGMA 4MQLA 4LS3A 4MS3A 2R3SA 2PZIA 2GBLC 3HGMA 4P31A 4KITB 1IBLB 3B1FA 3JTMA 2GUGA 1T8UA 3M81A 3OZWA 3AIOA 4WD3A 1EFDN 5KKAA 3ZHVA 1KP2A 3ZQUA 4CLRA 4K1XA 5I4KA 4MUNA 1A8QA 4E33A 2CV2A 4MQUA 2YZ7A 2YJTD 3FH5A 4NCIA 3GNLA 2H52A 1N5IA 2IXDA 1ZW6A 2G82A 1P4SA 3HIZA 1CQJB 4NOJA 4O6VA 5AW7A 3VX3A 3C7AA 4NVRA