3PE3A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
701
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 268
structure length 701
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe3A03
3T3GA 3OXGA 4FKZA 2PZIA 2C2LA 3CX4A 2QRQA 1P2DA 3MTBA 3AMVA 2F3QA 1FS4A 2HY7A 4JHRA 3Q4AB 1W3BA 2QLLA 5JTTA 2QRPA 2VG8A 4U0ZA 2PQ6A 4U04A 2Q7FA 3MA5A 3FROA 2VYIA 1E4OA 2XMPA 5D01A 2KS6A 2Y4UA 4U07A 2GM9A 4QLBA 3LY9A 4WHMA 1RZUA 3Q3IA 3G2IA 3MRTA 1FU7A 1WUTA 3EBOA 3MRVA 1RRVA 1LWOA 4YI3A 2QRMA 4RBNA 5AYWD 2GT1A 3SYRA 3CV3A 1NVKA 1GPYA 4WNFA 1KT0A 9GPBA 2QRGA 2P6PA 1P4HA 2IYFA 4AIFA 1L7XA 2F9FA 4LEIA 3GUHA 2FETA 2XA2A 4ME2A 4XIFA 1L5VA 3DD1A 2QRHA 4RIIA 2R66A 4H7XA 2XEVA 4YVOA 4N3BA 2VGXB 1XL1A 3CUWA 2QNBA 3GPBA 1JEJA 5D0OD 5DBKA 2KATA 4UI9K 5IKOA 1M5RA 3RU0A 3HBFA 3CEQA 3MS7A 1FCHA 3VUFA 2ASVA 4G23A 1XC7A 2C9ZA 2QLNA 1L5SA 3L79A 4MHSA 3S0JA 1B89A 3VDMA 3NAZA 3L7CA 5ENZA 3L01A 2SKDA 3RHZA 3MV3B 2OFFA 5D00A 8GPBA 2YHCA 4N3CA 4X7RA 4N3AA 2G9UA 3ESKA 3WADA 1HLFA 4J8FA 4GCOA 5TVGA 4GPKA 2BGUA 5EKQD 3KD7A 3OTIA 5FTPA 3LPZA 2BUGA 1FU4A 3VTXA 2F3UA 1L5QA 3OXFA 3G2KA 3PE3A 5KJKA 4YUAA 2SKCA 5FZQA 2C0MA 1EXVA 3O48A 3RKVA 1NOKA 3IAAA 2H1FA 1FTWA 5G05J 2P58C 4RELA 4U0SA 3OTGA 3GW4A 1XNFA 2ACVA 3MTDA 2JJMA 3OKPA 4EL0A 4AY5A 1KLXA 2SKEA 3ASDA 2LSVA 3QWVA 3TAXA 1FTQA 2GEKA 3AS4A 3WC4A 2HYZA 4X6LA 4AMGA 3WAGA 4B94A 2QN2A 1P2BA 4JA9A 1V4VA 2J9QA 3ZHEA 4MICA 1EM6A 3NB0A 4F96A 2R60A 3ZCPA 3D0QA 1GFZA 4BQIA 3VTYA 3LY8A 4BTBA 3LYAA 1B4DA 1NZNA 3CUTA 1JIXA 1AXRA 1QM5A 3MT9A 3T7DA 4RENA 1WUYA 2Q6VA 1O6CA 3SF4A 5A6CA 3NP9A 3AS8A 2X6QA 3ZCVA 3CEJA 3ZCQA 1YA0A 4RG9A 2HR2A 3HBMA 2XCUA 3QWWA 2VGYA 2KCVA 2XCBA 2IFUA 4NQ0A 1JG7A 4CGWA 4CTOA 3Q49B 4UQZA 3L7BA 4MRAA 1L5WA 2PYIA 3FP3A 3FFLA 3C4VA 2IUYA 3ZPJA 3S29A 1IXYA 1RZVA 1SXQA 2GW1A 2PQNA 2AVPA 4GA0A 1NOJA 1KTIA 2ACWA 4NRHB 4KQ2A 2IEGA 3L7DA 2FF4A 4KXKB 4X7MA 5TMDA 4MHOA 1NZFA 1GZ5A 4RIHA 2GPBA 5DIZA 3TOVA 3MEKA 3S28A 4O6FA 3BCUA 2AV6A 4UQXA 5FZSA 4G1TA 1PN3A 4UI9C 3KAEA 3Q3EA 2BISA 3U3WA 3BDAA 2LSUA 2WTXA 3CK8A 3S2UA 3ZCSA 5A7DB 3BD8A 3AS5A 4MI9A 3E4BA 2LNIA 4GZ6A 4EQFA 5KJMA 3CKBA 4I17A 5KJLA 2X6RA 4I9CA 4X7PA 4BQFA 2KCLA 4G2VA 5EX0A 2ATIA 1NLMA 3U4TA 2WQHA 2MHKA 1IYGA 3CK7A 3MBOA 4GZ3A 4I2WA 1UQTA 4G26A 4BT9A 4ABNA 4H7YA 1XOIA 3C4QA 4M7PA 3ZGQA 2IYAA 3HBNA 4KQMA 3S27A 4YNDA 1OUVA 3CKCA 2QN1A 3OKAA 4EJ2A 3ZHEB 5DU2A 5FT9A 1ZU2A 4I1AA 3LY7A 3BEOA 4NC9A 4WNEA 1UQUA 1A8IA 2G9QA 4UQYA 1WV1A 2NC9A 2XGSA 1NA3A 2FI7A 4GA2A 1PNVA 4GCNA 3PE4A 3T5TA 2BGTA 3URZA 3T3EA 3WXXA 3T3HA 2GJ4A 5KJNA 1IIRA 1H5UA 1ELRA 3D0RA 4RIEA 2F3SA 4F97A 1YGPA 3ZN3A 4RIFA 5HXAA 2ECPA 4GYYA 3RJVA 3TSAA 3IA7A 3QKWA 1C8KA 4HOQA 2AZDA 5G05C 1AHPA 5LCWJ 2R68A 4JL0A 4N9WA 4J8DA 3FWVA 2E2EA 5ARFA 1F0KA 5GPBA 4LDPA 2IV7A 1A17A 2VQ2A 1J39A 4KQ1A 4WNGA 3O3CA 5HQ8A 4N39A 2QN9A 3SYMA 3ASGA 3CV0A 2I6HA 3EBPA 1YA6A 3TGOA 2PYDA 2AMVA 1ZBPA 1K06A 3ZFWA 4FZRA 1XKXA 4NEQA 1Z6QA 3CEHA 3G2NA 3GZ1A 3GYZA 5HI7A 3Q47B 5BNWA 1Y8ZA 3QWPA 4Z5XA 3BD6A 1K08A 1P4JA 1LWNA 3BCSA 4UI9J 3HBJA 2IV3A 4CGVA 1JIVA 1HZ4A 2C0LA 4KYOB 1ELWA 3DDSA 3G2LA 4N2QA 2L6JA 4N5CA 1BX3A 4BFCA 3OY7A 2O6LA 3Q15A 1E96B 3NC4A 3ULQA 1WW3A 4AMBA 5CCLA 2XA1A 2PRJA 1P29A 5BT1A 1Z62A 4CTNA 2XA9A 2FO7A 5IKPA 2KC7A 2R4TA 4Y6WA 4F3VA 3RO2A 2GPAA 1Y6GA 2BFWA 4J0UA 2UY1B 3D1JA 5TMEA 1F6DA 3UUXA 4HOSA 1WAO1 1HXIA 3G2JA 4I2ZA 1E1YA 4BTAA 1GPBA 3BD7A 5G04J 3TG4A 4LEUA 5LCWC 3ASHA 3CK9A 4HLNA 3MS4A 2PRIA 5JTUA 4HWGA 2FFRA 1C8LA 3E3NA 5BW8C 1P4GA 4F9FA 3COPA 2C1XA 5DLDA 3ASFA 3S7BA 5JJ7A 4PQGA 4AY6A 3BCRA 4BQEA 3OKCA 2PQRA 2F3PA 3H4TA 4YVQC 2ZB2A 4WACA 2JZCA 5FZRA 5CCMA 3MKRA 2VCEA 3HYMB 3DDWA 4L22A 1TJCA 2VSNA 3UQ3A 2QZSA 5EX3A 2IEIA 2X0EA 1Y8MA 2GPNA 4AM9A 3JYSA 4YI5A 4I9EA 3BEEA 3VDNB 1PSWA 3R9AB 3N71A 3QOUA 2R4UA 2C4MA 3CUYA 1Z6PA 7GPBA 2QN8A 4WUYA 3CVNA 4W6QA 4EKEA 3ZCUA 5JJTA 3NCHA 3RO3A 1P2GA 3CVQA 4APOA 4M83A 4EL5A 3C48A 2WPVA 4RG6A 2QN7A 3MQFA 2IW1A 4CDRA 3CVPA 2G9VA 4N2SA 2VCHA 1JIUA 3NF1A 3L7AA 4WADA 3ZCTA 1NA0A 1QKJA 1C3JA 1C50A 4WNDA 1WM5A 2VGXA 3Q5MA 3S7DA 3LKUA 3S7FA 5M72A 5FJYA 1FA9A 4MI3A 1NOIA 4G24A 6GPBA 1L5RA 3MV2B 3UYKA 4NESA 3T3DA 4BWRA 3RSCA 3Q3HA 4HORA 4W9RA 2FBNA 5LQDA 3SZ7A 1UZUA 2FEZA 2X0FA 1P5QA 3VUEA 4GYWA 2IF4A 4M60A 3TG5A 2OOEA 3KS2A 1Y6FA 1GGNA 3IEGA 5ARGA 1GG8A 4XI9A 3NPAA 1QQEA 5D0QD 2KCKA 2FF5A 1Z8DA 2QLMA 3OY2A 2AW3A 4GZ5A 1FC0A 4BT8A 3QDNA 3OTHA 3LCAA 3E3OA 2H1HA 1FU8A 5CHEE 2YJNA 2X0DA 3UYLA 4A1SA 1XV5A 4EKYA 4RIGA 3CVLA 3T3IA 4CTMA 1ABBA 4MI6A 1PYGA 2R5SA 2GEJA 4GA1A 3E3LA 3CEMA 2DBAA 2HO1A 1SXPA 3K9IA 2PL2A 2Y4TA 4U0UA 1WW2A 4XI0A 3NP7A 4HOTA 1PC2A 3GZ2A 4KBQA 4Y6CA 3MS2A 2UWJG 3RT1A 1FTYA 2UY1A 3OXLA 5JJ6A 2ONDA 3MT8A 3QKYA 2XGMA 3UPVA 1QZ2A 4J8EA 4REMA 2JLBA 2XCCA 2QN3A 2XCIA 3RIBA 4GYOA 5TMBA 3MSCA 3S7JA 3CUUA 3DZCA 1WV0A 3MT7A 3EDTB 3H4IA 4AN4A 2XPIA 5G04C 4HOUA 4JA7A 4GPBA 1KT1A 3ZCRA 5I45A 3MTAA 2XGOA 3MRXA 5DXFA 1NZDA 1IHGA 4G2TA 3QHPA 2YQ8A 5C1DA 1HH8A 3PDNA 3G2HA 1JG6A 4G25A 1GPAA 1VGVA 2C1ZA 2QFCA 1XL0A 2G9RA 3CUVA 3OT5A 2VSYA 2V5FA 1L6IA 4IN3B 3RSZA
chains in the Genus database with same CATH superfamily
2W0SA 1ZMRA 1G38A 1KPHA 2Q1YA 1B8NA 3EPKA 2C2LA 2V7QD 3CX4A 3GGCA 2QTHA 4WESB 3U3KA 3FN4A 4IEFB 1YASA 4P33A 5SZHB 3S2GA 4B4DA 1RDFA 1GITA 1NL3A 5HS4A 2P2CA 2C2YA 1TZBA 3PNKA 4MUJA 3PX2A 5EC8A 1X14A 3I4FA 4QXPA 2W00A 5AQBA 5BV0A 5A3JA 4C2UA 1WTAA 2PQ6A 1JCQA 1KYYA 3E5NA 1GQQA 4FC8A 1UUFA 2X8WA 3F8SA 3I04A 3QE3A 3FNGA 4OLFA 1EG2A 2EBHX 3MD0A 4P7BA 3WLAA 2IONA 4CLRA 3K2QA 4P83A 4DYDA 2HHHB 2Q8PA 5BUZA 2PJUA 3KFXA 1XHLA 1DJMA 4CZ2D 3FVQA 1V1JA 4K6GA 3VR6D 2I7DA 4N7MA 4NPCA 4AIRA 2G28A 2Q6LA 1D9ZA 4HUJA 2BSXA 1KYWA 2FMUA 2WWWA 3A3YA 5BXYA 4IS2A 3UWSA 4A3VA 4QU5A 2PUFA 4R31A 1UWKA 5CLJA 1FEZA 4ZI7A 1W5AA 2OMEA 3EC1A 4MQ5A 4OVKA 4JYZA 4UBMA 4OB6A 1Z0DA 4TL6A 4C78A 4IOMA 5SY4A 2YCBA 4JUCA 3OEWA 1FS5A 2A5DA 1MRSA 4TTPA 5E2IA 1U8CB 4GOJA 1A7UA 4QGHA 5KDLA 5HSGA 5A2GA 4H0NA 3TWWA 1ECGA 2JIQA 5LYJF 1K5GA 2R6DA 1VJTA 4NU6A 3WX0A 1JPUA 3OWHA 4EMTA 4DUGD 4KVMA 1JEJA 3FCCA 3IQWA 1U0EA 2MWMA 3L82B 4V24A 5JAMA 2CV1A 3AB3A 3LZ6A 3I12A 2GK4A 1NT2A 3HBFA 3L4BA 4GM0A 4Q1CA 4HYEA 3FUNA 2FEWB 2ECFA 1LDEA 2ZIWB 3P2MA 5C8YB 5F2NA 2FW7A 2CFZA 3LS8A 1B3RA 2YRWA 4OYYA 1GPWB 1ICEA 5JH7F 3LZDA 3EMKA 1Y1QA 2BBTA 1NNUA 1ZSNA 2D3WA 5CB0A 3DTNA 3B1XA 2UDPA 2XUJA 3HA3A 3I2KA 3K9CA 3IXEA 1RWXA 1VLVA 3AR4A 3L7YA 4MA4A 1X1EA 4G37A 5SV2A 2YFKA 1PFYA 4F9EA 8GPBA 4FXOA 2W2LD 1CE8B 1OF1A 3FNIA 2GM5A 4M1MA 2VATA 3PIDA 4UC0A 5DNCA 5KYYA 2JLYA 1WB9A 3Q9NC 3C41J 4BCDA 3OZDA 1MJGA 4J8FA 1XZKA 4JAVC 1LY1A 4TN5A 5ENVA 1QHEA 2OEPA 3BIOA 1ZNZA 5C1IA 3W34A 1Z37A 5FTPA 3E84A 4AXBA 3ICCA 3GLKA 5AIJA 4Z86A 5ECDA 4MQ6A 1NRJB 2NQTA 1XCPA 3NHUA 4QOJA 4EO9A 1XVVA 4NZPA 2Y0DA 3TEFA 4UEJA 2X14A 5DNVA 4X62B 3OEHD 2UYHA 1IOLA 1Z13A 4Z9AA 4PLYA 1JQDA 1ZMTA 2Q5JA 1ZWLA 3OLWA 1BI7B 3QBVA 4OREX 4WZAE 4ZU1X 4Y2RA 2PM7A 3FAZA 3SBOA 1XNFA 5FINA 3G2TA 1AB5A 3A04A 5AI0A 4OJNA 4F4UA 4Q69A 4AY5A 1TRKA 4KXWA 4LDQA 1NUTA 2V6JA 4B8YA 4YXFA 5FPPA 3T5AA 3PP8A 1I4WA 2QDXA 2QN2A 4FHGA 1LD7A 2YZ2A 4TL9A 4JBIA 3E8MA 1HEUA 5M3BA 4DWVA 1GFZA 1FFXA 5EN4A 2P2ZA 4K40A 3PUJA 3LY8A 1TEZA 4S1PA 4BAUA 1BHJA 1SQ6A 4IDCA 4PAMA 4RUKA 5BN3B 1BGVA 5KNDD 3TQQA 1NZNA 3M9XA 1JIXA 2C78A 1EVLA 1H2WA 1QM5A 3A6HA 4YMTA 5CDGA 1G66A 4ISBA 3EFEA 1G6HA 2BBWA 2QTTA 3N39C 3NMUF 5AQ7A 2FX2A 4PRKA 5CURA 1XCMA 2W8ZA 3RTAA 2JIMA 5FI5A 5IAAA 1HQCA 3A0UA 4QT4A 4WINA 5T3RA 3WGHA 2XBUA 1F9AA 4FI3C 2AJTA 3EA4A 3ZCQA 3IHTA 4RG9A 2YWEA 1NBOA 1SBZA 4ED9A 3EGDA 3IIMA 2OSVA 2EOAA 3TCKA 3LBYA 1E2UA 4FWBA 4BY6A 4NQ0A 1UM9B 1XXHA 1OV6A 2AXNA 3ABSB 3BL8A 3FE2A 2VTEA 1U3UA 4NJMB 1KIAA 2EU8A 4K9RA 4JEUA 3D6NB 3H8SA 3DE2X 3K0AA 5A6SB 3SBXA 2E4XA 4EJMA 4V2UA 3FP3A 4HTAA 3CEAA 4FIZA 4XYBA 3S29A 4MIEA 2GTPA 1CVLA 1VL8A 1UPUA 3U9SA 5KQPA 3SQXA 3LUPA 3TR6A 9LDTA 4O60A 3A1EA 1QIJA 3DB2A 5KINB 2R79A 4L23A 2AXEA 4M1OA 5GONF 1GN9A 4RZXA 3TAUA 3M89A 1QWOA 1U2ZA 2AF3C 5EIDA 4KXXA 2UZ3A 4D4IA 1HG5A 1I6KA 1W0KD 2FPIB 1C3EA 2FW8A 3C5WP 3IB3A 4KXKB 4JIMA 4CU2A 2Z9CA 1TO2E 2QGZA 3FUVA 4CKZA 3WKCA 4QOFA 2VK4A 2F8LA 4M8SA 2WTAA 3LK7A 1IG0A 1B43A 3I6YA 2G06A 3GEPA 2OM2A 1PYDA 2HJVA 4QM7A 2DCMA 2Q2QA 4Z6KA 5TC4A 4AJ4A 3RUIA 3F78A 5KJ6A 1PX0A 1M1YA 4WH0A 2W11A 4MI9A 3PZDA 1NSYA 4QASA 4CKCB 3CC8A 1T36A 2AJ8A 1R2QA 4O3MA 2LIVA 4BV3A 4BV8A 1Z74A 1NM5C 3NEJA 4R2XA 3SEZA 4UUPA 1H93A 2ATIA 3HHEA 4MUXA 4WBNA 3LGSA 2KLBA 4DT1A 4ZO9A 3WYCA 5JQGF 1C1HA 1NBMD 2NVWA 4UFOA 5BUQA 2O23A 5F2EA 4BCBA 4Z8XA 1Q0UA 3RS2A 2WXKA 3H5WA 2MINB 1IN8A 2VT3A 4B85A 4FJ0A 4J3FA 2WOJA 2F1KA 2FDRA 2ZJ5A 2V8SE 3NVMB 4DC0A 3EGOA 3EW9A 4EJ2A 3ZHEB 2QNRA 3O03A 2BC9A 2L42A 2QX7A 5AI6A 1UBHS 3PQ4A 3BEOA 3TZKA 3HLTA 4HDQB 4C08A 3IVAA 5AHKA 6Q21A 1F0PA 5LWQA 2VPXA 3QITA 2ZIRA 5CIQA 1SVLA 2HK8A 4ROTA 3V8EA 5J58A 2E87A 4GGPA 3PE4A 1LZLA 4GC5A 5DYTA 4ZGGA 4DV0B 3S1AA 1M1YE 1K97A 1GXSB 1PSDA 1V37A 2B4AA 2VNSA 2R6AA 3IQIX 4JROA 1YB6A 3UTMA 1H5UA 3J5PA 4NLLA 3ODPA 4BFYA 1HEIA 4YRNA 4N5HX 4TMFA 5AOVA 5SZKB 1CB0A 3FTUA 2X9NA 3QQPA 5C46F 1SELA 3OSZA 5I8PA 5ITZA 4OMFG 5ALPA 3GQBA 2EFYA 1N5KA 3NLLA 2PX5A 5K3BA 2LVBA 2IGBA 3OUZA 2XYGA 4YDWA 4R2JA 2H11A 4R1MA 3N5CA 3PQ6A 2Y1KA 2HXSA 3ROEA 4B09A 2YOFA 3AFGA 3BXFA 5DE3A 5ALTA 2PHZA 3STWA 4I08A 5K51A 3VOAA 3F96A 1BFUA 3R8XA 4DMUB 1SVSA 2X15A 3OZGA 5FWQA 1YJAA 2D2IA 2W2MA 7MDHA 1XCLA 1FQOA 2AFIE 4QYIB 4RZIA 4GUDA 4JVOA 3VI4B 4MS4B 1ZHOA 4IQ4A 4JX9A 1RXSA 1ZBPA 1PQWA 1Q6ZA 4MQUA 1W34A 2HFKA 1NF3A 1UK6A 1JXOA 5I4CA 3K7EA 1MLDA 1MB0A 2PGAA 2ZR0A 3PVCA 3R9KA 4HBDA 4YAJA 4O1PA 4NEQA 3MXOA 2NU9A 3OFKA 4N5MA 1HT2E 1X74A 2FW9A 2RIRA 3M0EA 5TGTA 4ZCTA 4OYRA 5BNWA 1T5BA 3BU8A 3EG9B 2PRYA 1XR3A 2PZJA 3G49A 1U0JA 2HV9A 5DTIA 4EJ0A 3HL0A 3JAWB 2I33A 3ZN2A 1GV1A 2WG1A 4O08A 2Z8ZA 1ODFA 3VVBA 1P3JA 3DVAB 4QE3A 1PZXA 4IRUA 3ADCA 1VJDA 4I6GA 5IBCA 2YIDA 3KYDB 3DUFA 4EJSC 3PLNA 3PNOA 4YAWA 5JSFA 4GKJB 2WFZA 2RBKA 4CTKA 1CNEA 1BKYA 1XP5A 3EN0A 3GI1A 3HXFA 2PN1A 2BV3A 1YT5A 3ULQA 4DE5A 2VPWA 2GFQA 3W1VA 3HZRA 2MJLA 4LE0A 2QENA 3T0FA 1CCWA 2EARA 2WK1A 2RD0A 3EIHA 4C4OA 2NUPA 1D8AA 2LE0A 1P29A 5B6JA 1ZQ9A 4BY9E 1NQWA 2CNNA 1FP1D 3QPCA 4UCQA 1HU3A 3IHVA 1IE3A 3B9PA 4BX8A 4GPMA 2CNDA 2VF5X 2PS1A 1JKMA 1GNRA 2M6LA 1JMKC 2Z2XA 3CF0A 2BWJA 1W96A 2I4IA 4J43A 1XN4A 4FFDA 1KP2A 4FOPA 4KITB 2X1HA 5FTJA 5B3JC 1JKJA 2ZITA 1U9CA 4NK4A 4NCAA 4PCUA 4XIGS 4RJJA 1FCJA 5EHQA 2JANA 1J6UA 3Q5DA 4PAOA 3AQ4A 1EFVA 4KRYA 2XUKA 3H2YA 1P4GA 3OESA 4LHVA 1KR2A 4YWJA 2YVUA 1YJBA 3NTLA 1G21B 3TXMA 3BWCA 5ERYA 3KQSA 1QQ5A 5BSFA 2D3TA 1H4SA 3FTQA 3NNDA 8ADHA 4I55F 1O95C 3R5XA 3MHTA 2ASEA 3S5UA 3WQRA 1DKRA 3D9OA 1UJ2A 2I76A 3UWKA 4BNLA 3AL0C 4PHCA 1Q3HA 3VR5A 1W2WB 4GR4A 1ZOIA 5CU7A 4RFSB 3WSTA 3O8BA 2GKGA 1LU9A 4I9UA 4R5MA 4XUDA 5FOUA 5JYCA 2GBGA 5IM5A 5J47A 4DV1B 1T8RA 1OZHA 1ZUWA 2F00A 2NZJA 3KZVA 4GPIB 4E08A 3WLPA 5AVQA 1EI9A 1XCOA 3P9NA 4N7RA 2PGIA 4XJXA 3WBFA 4BKMA 5F9HA 5JJIA 3B12A 5JJTA 4EWLA 3NRBA 1TIKA 4LMBA 4X1YB 3STXA 1XDUA 4WXMA 1F3OA 1O8BA 1J24A 2BY4A 3BK7A 4GL4A 1JHXA 4ZTUB 5I4IA 1BJTA 1P0PA 1C8VB 4P92A 3R77A 1SOUA 4EHBA 1MO2A 1COWA 2BOVA 2VCHA 1R5NA 1JR3A 4DLZA 1HURA 3ISMC 1UOEA 4JJ7A 4GXNA 2BZ0A 4JT2A 4JZKA 3UK7A 2K7FA 2A5EA 3X1ZA 3L17A 2NSYA 3CXUA 1MEOA 4RORA 3LDAA 4L72A 3WGQA 4B34A 1V25A 2YYSA 4LN1A 3ZW3A 3OIFA 2F8TA 1H2ZA 3WNQA 5HZKA 2N1BA 5JXHA 1KFCB 3FOZA 1WD5A 4KZCA 1JEAA 4WOBA 2JNWA 3FU6A 1BOOA 1CHNA 1NF8A 1T9DA 2EGGA 3EIXA 4H27A 3W9GA 1WMEA 1T1SA 4M36A 3DQZA 3V7WA 1GRCA 3SNHA 3NOCD 1WB5A 3AHFA 1QIIA 3FGOA 3Q3HA 5A1JA 3PK0A 3BK2A 1MG0A 3CZ5A 1U7HA 5IRCD 1JFFB 3JQ1A 2OUIA 3CGWA 3IAM1 5LU9A 3VI3B 3KS2A 3C8DA 1F1JA 3NIDB 4KH1A 1WDMA 3ON5A 1GADO 3CNNA 3LUDA 4JXJA 1PR5A 3SJZA 1YFKA 2E82A 1O94A 2H1SA 5LZ7A 2IHNA 3EU5A 4KACA 1EK2A 2FPPA 1QZZA 1GDTA 3H99A 4ZC8A 5IAOA 2D62A 2VP9A 3W6PA 2P40A 1CEQA 1W1UA 1QE5A 4ARAA 1PW7A 3GHHA 4GLJA 3CR3A 3NG1A 4KVFA 4OPMA 4JLDA 4BT8A 1J1UA 1XT6A 3T9EA 2ZBQA 4BFUA 2OHIA 3E0XA 1I7DA 3DUWA 1H6AA 3UH1A 5K3OA 1WF6A 1AT1A 2K7ZA 4IL5A 1T15A 4FLBA 2CLKB 3RFXA 4ZRDA 4CEMA 4B4UA 1UMCB 4BC1A 2RHWA 4BUCA 2JAXA 2GPYA 3LT2A 4PWZA 4GLFA 3IBGA 5ALXA 5IFLA 4ERXA 3LJKA 2G9ZA 4MR8A 4HLDA 2DBAA 2EQBA 1YIAA 3N8KA 3VPAA 2CBGA 4LA4A 3V2HA 4B89A 3K5WA 3KDSE 5FA6A 3UV3A 3WBBA 5BWMA 1U4SA 4FLHA 1U1EA 4QOIA 3VPBA 4X1IA 5IJZA 1UZNA 2ONKA 1V8DA 2W6IA 4LDAA 4DMLA 4E15A 3HKEA 2HHCA 3CTMA 4LG1A 4EVIA 1IH8A 1IY0A 4KN8A 4E13A 2RFAA 4EA8A 1EJ2A 3SC4A 4US1R 3MYVA 3K9BA 1WLYA 4MGYR 1ADFA 1PLKA 3PHIA 3QUCA 2LP4Y 5J1TB 4V2IA 3TAHA 1V54E 1JDBB 1JVSA 1IK4A 2WIFA 2FGJA 3OF3A 3U56A 2VBIA 3DEJA 3MT7A 5AIAA 1P39A 3TPCA 3TTVA 2Y71A 2Q45A 3AP3A 1IK6A 4R3WA 2C29D 3EHEA 1YSCA 2AJCA 2OD9A 3HN7A 4MV6A 4F6LA 4EVQA 4RPHA 4QIHA 3R09A 4JI6B 3SIWA 5I45A 2C7PA 3GL9A 3G9XA 1RD4A 4MVCA 3AJAA 3EHRA 1PJ2A 2GSDA 1KS9A 4TQAA 2E9SA 2XYPA 4H16A 2ZAGA 4N5QA 5JHGB 1HY3A 4PX5A 4CFSA 2CE7A 3PJDA 4UVGA 1I3NA 1Q57A 4MVYA 4UOZA 1FP7A 2OM6A 3I9JA 1O1TA 2YWJA 5JR3A 1UJJA 4MUIA 4YAFA 1YBVA 1YS7A 2F62A 3RJZA 1T24A 2YZGA 1W19A 4JNKA 2PZIA 1CVIA 5ALQA 4BNIA 3AUJB 3N0VA 1PTKA 3VR1A 2QRQA 1X3LA 3AMVA 2V6MA 1SEVA 4PYOA 1EX1A 1H69A 4YPOA 2Y1LA 5TVKA 5AW7A 1WXGA 5K0CA 1T91A 4FP7A 2A78A 2ZTLA 3PNVA 1MEEA 2ZIUB 1NATA 1PR1A 2ZUFA 5C52B 1G7CA 4U04A 4RCYA 2XVXA 3EHDA 2D74A 4MUNA 1BHO1 2NT3A 5EMJA 4CIBA 2VYIA 3A4MA 4DLQA 3ITWA 1U04A 4QULA 1B0PA 1S4QA 3LBAA 3RQIA 1UKZA 4EENA 4XGQA 2MIIA 5E38A 4DJ5X 4P4SB 3K94A 1AA6A 4ILIA 4L4SA 3GV0A 4CNBA 4WEQA 2ZBFA 2X6TA 4DXAA 3SS9X 5B7GA 4N76A 5HS6A 4NARA 1QVRA 2C3UA 1Q20A 2VS1A 5AJYA 5DM1A 4UAJA 1P6XA 4LV8B 4K28A 1YYHA 2Y9MB 3DGFC 2H5LA 3MMNA 4R8KA 2Q6KA 2IYOA 1Z2CA 5JFTA 5E76A 2GT1A 1NZJA 1GRVA 3D43A 2NSZA 2QJOA 1WZNA 1RMQA 1ZMXA 4JLBA 3DDOA 5K4HA 1NDQA 3TL2A 3RFUA 2Z5LA 1JJVA 2W6ZA 4YR9A 2XA2A 1QIKA 3K0KA 3IEVA 2H29A 4ILEA 3ETCA 1HL3A 1KSJA 3RS7A 2LZ0A 4DMRA 2G1JA 1JPNA 4JN6B 3RUHA 1IFXA 4PYRA 2XEVA 1LK0A 5AN8A 1GPKA 3LEWA 2ZKIA 4U2KA 5B3KA 4CL2A 1U5AA 3B7WA 4TYYA 2C5EA 2VPYA 2FMKA 5BYAA 4MV5A 4INPA 4I0WB 4FDMA 1W93A 3KEAA 2FEPA 4JLUA 5K8VA 5LDHA 4QGGA 2ZBGA 5IBPA 2VLBA 4U9HS 1V26A 2GASA 4AKTA 2QQGA 5TR9A 1Y1SA 2A4ZA 3GA5A 4G81A 1IKND 3L79A 3FZQA 1FSGA 3DDUA 3D6AA 5F3DA 4B0OA 5A4AA 4JD2G 4BNVA 2IF0A 2ZYWX 4PLHA 1Z0KA 3KLNA 5AHXA 2JB9A 2PGDA 3T0IA 1GPJA 2DP4E 2BCJQ 3CLSD 1KIMA 1RTKA 1GHTA 3JQBC 4YQEA 4AROA 4TLDA 4ZREA 2XT0A 3L4KA 3O73A 1ML3A 2CZQA 1E1QA 2O2GA 4EPZA 2PO7A 3PUYA 4OHPA 1D4AA 1RRPA 3CFYA 1QTRA 3L41A 4M0MA 4P93A 5EP3A 5CVTA 5KOHB 3OXFA 4JJGA 1F48A 3JQ9C 3F3KA 4NPAA 3NJ8A 2QU8A 4Y6GB 4GP6A 5LFAA 3RUEA 1DMRA 3ZZNA 1YRQA 4MWGA 4Z4HA 3A9TA 5JZVA 2ZT8A 1LF8A 3RKVA 3OURA 3PNMA 4ZQIA 4H08A 1Z73A 1OVGA 2IH2A 2GBPA 2RHMA 4QJ5A 3GEHA 4M7RA 1A0OA 4Y6QA 1V16A 4GEKA 5LU8A 1WSAA 1JAYA 1U1CA 5FO1A 3OZVA 3LVQE 2JDIA 2RGGA 2SKEA 1FTQA 3FPSA 4EY8A 3NTRA 2OBNA 4HWRA 5CDFA 1IL0A 1TQHA 4ZT7A 3T1QA 4DX6D 4BNDA 3HVEB 3OEYA 4RVCA 4RULA 2J9QA 1N8SA 2LBPA 1W47A 5JC8A 4LJ4A 1AK9A 5LJIA 4R8VA 2XDWA 4X3OA 3SR3A 4PWYA 5D66A 1SPXA 1TU3A 2ZU0C 1T1RA 1J2JA 1T6ZA 2C20A 2H0RA 3SQMA 2GPSA 3A4IA 1M6HA 2CHZA 2I03A 2OXFA 4L5AA 4BQSA 4EKNB 4DXHA 5FWNA 4PRZA 5LMNB 1BDBA 3EIJA 1P7YA 2W6CX 1A69A 5E1OA 1TNZA 1JB1A 1JV2B 4R71A 1KWKA 5EGNA 2GN2A 4TX1A 5CECB 1VJGA 1TYEB 3U4IA 4CEIB 1L6RA 1ZJWA 2TMYA 4Q21A 2CCKA 4BGEA 1PSZA 1KQNA 3SXPA 5TIIA 5CD1A 5CNJA 3D9QX 3GP3A 3CU5A 1Z17A 1T1IA 2R7MA 3GYXB 1E6MA 3ZHXA 5DBHX 4R0VA 2NP6A 4F1SA 1N2EA 4OB8A 5IT4A 2XOXA 5GWXA 2XGJA 1TCUA 1W73A 2VAVA 5IN5A 3OJLA 2PNNA 5A7FA 3P2JA 1WP9A 3LQFA 3HJBA 3R76A 1XFDA 2LIPA 3CF4G 2C04A 4GZMA 1YK1A 3S2EA 4B6QA 2J3HA 2O0LA 4AJWA 1BA3A 1HQYE 3UAXA 3SY2A 1LBTA 1VE9A 1YB5A 2QRJA 2FWAA 1EZ1A 2QRUA 3X1DA 2QTRA 2PFKA 3MK31 1VPEA 1N9KA 2C7RA 1Z5OA 1OI3A 1P2SA 5AVXA 1L8XA 3ND9A 3TLJA 1G3NB 5ADUS 1PG2A 1USKA 2YXPX 4WXEA 3V1KA 1QANA 1V1MA 2FPPB 5K2OA 2JAPA 1Q1BA 2YWBA 4OA5A 2MYUA 2IXDA 4NYIQ 1PW5A 1Q84A 5AHOA 5FZSA 5IUJC 4FYJA 1R6AA 3P4XA 1JEYA 1RAIA 4YJ3F 3AGPA 5K0JA 2JEKA 4U8HA 1JHOA 1L5YA 1WHSA 1AO3A 3KQPA 4H1TA 4B3MB 2PZBA 5L3SA 1MV8A 4X64B 4O1IA 3E4BA 2C3PA 3OSUA 3ZEFA 3GRUA 4MVJF 2GKSA 3FTNA 4IM7A 3ZNOA 2GROB 4INZA 2XYQA 4OX9B 3CRMA 4DPRA 4BLTA 1CUEA 4IEIA 4KN5A 5B3AA 3REOA 4E21A 4ZHSA 3P9YA 4M1EA 3RVKA 4EYKA 3I2YX 1P33A 1EFRA 2X1MA 4NYJR 4F5YA 4KQJA 4FMDF 4TMYA 2C61A 3EZXA 2GLUA 2OB1A 4AKEA 1TNUA 4E85A 1H1DA 2V5UA 5FBRB 4H18A 1Z18A 4K6CA 2PPLA 4Y1RB 3E9DA 3T5GA 2PWYA 1M34B 3R6LA 2CV2A 2IYAA 2C2BA 2XITA 2M32A 4HATA 3CKCA 1XQ1A 1ZWKA 1DXHA 4K9NA 1EZ4A 4RHCA 1ZU2A 3QUSA 4LUNU 1LCIA 1PL6A 3B53X 3CPHA 3GJ4A 3M83A 5EG5A 4CW7A 1UXIA 1L7NA 1CKEA 2C2XA 1X9IA 5KWDA 2WSIA 2C31A 3BHIA 4JUBA 3X1XA 4ER0A 4ALJA 3OX3A 3C85A 2K87A 2NC9A 2FV8A 4DIBA 4XE0A 5AUNB 4ZDJA 2Z8YM 2GRJA 1A71A 4AUMA 2B98A 5IJ9A 2WYUA 2XMQA 4B3TB 2J3EA 4UBJA 3V8PA 2JBAB 1UBTS 2B2XA 2A6PA 3O21A 3URZA 2VZ8A 3MJSA 1YVEI 3PEUA 3FOBA 4FYHA 4XLTA 2PRKA 2P9TA 4DI4A 1H3NA 1PTJC 3N05A 4XD2A 1ESCA 1X87A 2NXNA 1SUPA 2O8VA 1KWGA 2O9JA 2JLUA 2QM7A 1BLXB 4FCVA 4X1OA 3SICE 3VTAA 3ZN3A 1D7OA 4IIJA 2H2AA 1GTZA 1B2LA 2X6HA 1YZ3A 5G0TA 3LF2A 4BMYA 2KM1A 1B8OA 2NP7A 1I5OA 4P4TA 1AHPA 1K6MA 4X66B 3SIXA 5JYEA 4LBYA 5BSKA 3BYZA 4MB0A 5LDGA 2JASA 4J8DA 3C8MA 4F53A 1ODTC 5B3LA 1GA1A 1KBOA 5BPPA 2X4LA 4GU5A 3WB9A 1R4NA 4N5LA 1TW2A 4GMFA 2FW0A 4II7A 1W75A 1UMDA 3LCVB 5L6MB 1XNQB 1XMXA 2EQXA 3R7WB 4ZOQI 3V7NA 5AESA 4MS3B 1F51E 2EFCB 4JB0A 3K96A 1D2HA 1JNYA 2AC2A 5DRTA 2Y66A 4YCMA 2W7TA 3FPCA 1PEKE 4DDMA 2O8DA 2CK3D 3CV0A 2CLDX 2FUG6 2X86A 2AWNA 4QDKA 1EK5A 3VSCA 1Q83A 3PHJA 5KVCA 3PKIA 4RA9A 3G2QA 4UMFA 1Y34E 2W6OA 3QBJA 4A7PA 3I09A 4Y9DA 1NMZA 2ZTUA 3EIQA 4MWZA 1CFZA 2J3KA 4OI4A 4KPEC 3PHLA 3AI3A 1WXQA 3M2TA 5JFGA 4TXJA 5K03A 2HF2A 5ICFA 2PS0A 4GX2A 5KCMA 3TSYA 2WIJA 1PG5A 1UJKA 2Z2YA 3I3NA 1NXWA 2FWBA 1ZZEA 2FDXA 4JELA 4KXFB 2EDAA 4LQ4A 2O2XA 4ZYYA 5E6RB 1K86A 2PZFA 4IPTA 3KR2A 1N3BA 5DNDA 1F7VA 1HYBA 3ZNPA 5THKA 2H4HA 4KYOB 4JASB 1PWYE 4KAFA 3VTFA 4ECAA 1FTNA 2C2GA 1KH3A 3UMYA 1I33A 3FNRA 2GH1A 2DBVO 3TXXA 3PF8A 1BMTA 3VXKA 3IQFA 1JR3E 3UMBA 1Y4AE 3RK4A 2X2OA 2ZI5A 3MSXA 2RAUA 3BL6A 3ESXA 2AOTA 1YZQA 2VQFB 2QQEA 3D7MA 5LXTA 5CCLA 1NXXA 1SCUA 2HDWA 4G85A 4ZO6A 1R50A 3CSDA 1TXGA 4UUCA 4YRKA 2ZXEA 1IZ9A 4WQMA 4GMLA 1Y48E 3QE0A 4L8VA 1K8RA 4U6NA 1ZD9A 5D84A 4F3VA 2HA6A 4RKQA 5CHEA 3P9QA 1J23A 1N5OX 2ZGDA 5EKSA 5ALFA 2GEVA 1GG2A 3GVHA 4FTWA 3BIJA 3NC1C 3NOOA 2D7JA 3WJ1A 1QRSA 3K6RA 1LBSA 2BGNA 4IIFA 3R3UA 2Q3BA 1W0KA 3BZBA 4DGSA 3LQRA 1CDOA 1OI4A 2ACKA 3N2LA 4RHYA 1VECA 3LX5A 1SU8A 4JBYA 4MVJH 2VHVA 3NRJA 2MT9A 1S70B 3BWXA 3QK7A 4ND6A 2FPSA 2PIAA 5LP0A 1IXRC 3PU6A 1DO8A 1RKUA 3O0TA 3B5IA 5HCUA 2G5TA 5DIFA 4YUWA 1PEDA 4OFWA 2WLTA 3L8HA 4DLUA 3L07A 2GUWA 1N6LA 3LDFA 3ZIMA 2O3RA 2ZRIA 2QL6A 2TMGA 3FBTA 1E0AA 4L6IA 2VF2A 2GZSA 3NH9A 1QR2A 2CXSA 1GY8A 2P41A 4X8QA 5CCMA 1YO6A 2VCEA 4QDOA 4GRDA 4RPJA 3IALA 3LKBA 5AUPB 2YY7A 3HABA 2H1CA 3GJYA 4X91A 4CI9A 1N5RA 2VJMA 4QNNA 2C84A 3PZ1A 4FHJA 3M1AA 2GPNA 3PPYA 1EYHA 3L8GA 1KDYA 1IN5A 3EWSA 4NCBA 2R85A 5I7WA 4HDMB 5AJZA 1V8FA 4NBVA 2DCPA 1SVIA 1Z0JA 3X2EA 2JAHA 5K3FA 5TPWB 1V2HE 5ALVA 1HMYA 3A9VA 3ROXA 3ZLTA 4EKEA 4YMLA 2I0FA 2VQEB 4MVJD 4B47A 2I8LA 1XJQA 1X7ZB 4PPNA 5HW0A 4OGWA 4FONA 3SR4A 1ZM7A 1F17A 1V3QE 3AEQB 3PT9A 2VA8A 5DBIA 1GLNA 2FSPA 5KUTA 4HR7A 2G9VA 3B6JA 3KJZA 3VX4A 2OBBA 3ROTA 3V1YA 3ZJTA 2FJBB 1SHZA 3NC0C 5B1HA 3G7NA 2GVZC 5T3UA 3SXJA 4BO8A 1QOZA 2H7CA 1JR6A 2W6JD 1F4LA 5M72A 1K7SN 1NY5A 3I5XA 1MJ0A 1TAQA 2AQKA 3H2BA 3WK5A 1U6JA 4KI7A 3QVWA 4APFA 1RI5A 2QPLA 3NHFA 4MPRA 3N3AC 2QTAA 3NHPA 5P21A 4IHJA 3S8EA 2DETA 5JLAA 4OUDB 1ZBQA 1L5RA 2VUIB 3JS5A 4L78A 1P8JA 2I4RA 5CH3A 5TF4A 1FE8A 3WIVA 5GJVC 4OY3A 2BELA 1XSEA 2ON6A 2PWPA 2R00C 3E27A 4DKXA 3QNWA 1ZI6A 3RK6A 2I1JA 1YQQA 2JIRA 3AB8A 3K1ZA 4RQIA 4OP1A 4EUHA 5A4IS 1A8SA 4X85A 3MC1A 4ZT4A 1W7AA 3P45A 1IZ0A 3J81k 1ZM4A 2RH8A 4ZVRA 3ZI7A 4JHXA 3ONDA 3G2PA 2PSHA 2VYCA 3BF8A 2FR8A 1FIUA 2FMTA 2G08A 5IWCA 1ZN7A 4GX0A 3MNFA 4CKXA 4NFHA 1RAAA 2D2VA 4OBXA 5AJHA 1DDOA 2H7XA 3HH8A 3BEDA 3HCOA 4MZDA 2B8WA 3MCZA 1H19A 4O4IA 5ECWA 5BNIA 1ADYA 1ACJA 2DCUA 4FUTA 3KVNA 1OYWA 4HFRA 3F46A 1YZLA 4F8EA 3AO0B 4HCJA 3RG8A 1QLJA 1ZU4A 2BLNA 1X2BA 3MA0A 1BAPA 4KHZA 3KJFA 4C01A 1KK1A 1DAGA 2JIOA 3H1BA 5D2CA 3GEGA 2HMSA 4NULA 3MPUA 1L4MA 2FSSA 3VRHA 4CEHA 5BWCA 1GPH1 2GXSA 3HP7A 3KT0A 3JQDA 2J3QA 4NENA 4MBGA 1KF0A 2P2DA 3EHMA 3L7KA 4O59O 4EA9A 4ZYTA 5ABPA 1G7SA 3GBPA 2W9XA 2OL4A 2PTGA 1PC2A 4QPZA 2VWHA 3FUXA 3IBSA 4ENVA 6YASA 3BFVA 1K6EA 2FZGA 1CQPA 3DZFA 3I2HA 3WMWA 2WIAA 2ONDA 2Y1FA 1HDEA 3I37X 4Q39A 1AB6A 3CGGA 3LRPA 4XB1A 2OFOA 3SEQA 3OMLA 4PGFA 4CIVA 2RB5A 4GYOA 4EBAG 4UAVA 4YALA 3G1WA 2KZTB 1R0CA 2CYCA 2EZTA 1WV0A 4TXRA 1WXDA 1JHYA 3BIXA 1BU5A 4FDUA 4L28A 3CIFA 4BP1A 4DMCA 2FOIA 3QE2A 1GZ6A 1AXEA 4PG7A 2C5FA 1YUBA 4RKFA 5CXUA 3GUZA 3H65A 3CISA 5D7BA 4M1TA 5G4KA 2DR3A 1G16A 2BTQA 1PV2A 4PQRA 1ZJ5A 3ZOZA 4BYGA 1JG6A 4CQJA 4G25A 2R8ZA 4G86A 3LSYA 1JI3A 2CNWA 2GEUA 3BTOA 2QFCA 1XL0A 3FSRA 3MBKA 4PGHA 5HE8A 3ZHTA 1OFIA 2NO4A 3EGXA 5JSYA 4WOKA 2Y2UA 3H1TA 1OLSB 1W88A 1TR4A 2IYNA 3FYHA 2QAGC 2WNIA 2XBLA 4UTOA 1UMCA 1GUAA 5DGXA 3AB7A 2V7EA 1LSJA 1S4MA 3MBIA 3Q6IA 4N03A 4OQDA 2GCOA 1ZA1A 4QHSA 1DKQA 2OPBA 1UBSB 1KZHA 1RI1A 2V6GA 3VO8A 1VJCA 5IVHA 1TM4E 1OHHD 4N3NA 4BZZA 4HGYA 4FFLA 2HREA 5ALWA 2GA8A 3ZIUA 4HZGA 2RAFA 5AKHA 1UKEA 3EXEA 3SN6A 3HJUA 1TLTA 1YHZA 4C6HA 1KJQA 4DDUA 1CUFA 1KXJA 2Z2KA 5KHAA 5BRJA 2L18A 2R48A 2V4MA 4D46A 1ZESA 4XWKA 2YMQA 3EGCA 4RTJA 2H85A 3P97A 1XKLA 3ZDRA 3K9WA 1UKVY 3UCXA 1RFGE 2JCGA 5HK8A 5KVSA 4G0WA 2FA9A 4MINA 1OILA 5A5DA 1ONOA 4KYTA 3E35A 4QC2A 4ZCSA 3WRXC 5FPTA 5C3MA 1UADA 1ZICA 1ZJZA 3DLCA 3QEKA 1XTVA 3W8FA 2HEIA 2P2LA 2XWPA 2QX9A 4BKPA 1XZAA 2OO7A 4P5DA 2PKQP 3CMCO 2ZVPX 4O2BB 3NW9A 3G68A 2WU3A 3C16C 1YE3A 3GFQA 3MWEB 4CF5A 2I8CA 2J0UA 16PKA 4KUGA 4LRSB 2D0PB 1H8HA 4ZXFA 4BKQA 1G7TA 4EKIA 2IYFA 2CZCA 3QP9A 4DDHA 2EP7A 3TUJC 2DZOA 1MABA 2GBFA 3M3DA 1YULA 3ECAA 5JQGA 2Y68A 1K8YB 1DJNA 2EEZA 1INZA 2HYDA 1L7DA 1LDNA 1T35A 2KQUA 2V7UA 4G56A 4TGLA 3GPBA 4ZVMA 3TLEA 1C5KA 3CONA 4R5HA 3KZXA 1CVRA 3TW8A 3E34A 4RTOA 4MZXA 1E1MA 1SVNA 1Y8QB 2VDOB 4YRTA 1HETA 3W79A 2JLWA 2GVNA 1GQRA 2D1YA 2Z4SA 4UWFA 2QMQA 5BSGA 3QPBA 2CBXA 2YUTA 4C2BA 3G0HA 4OYHA 3H5AA 2CV0A 1G8MA 3GPDG 4XW2A 2ANBA 3SC3A 3HCRA 4P4UA 2XVAA 5JS7A 4D79A 3W78A 1KFKB 3K20A 3STVA 3QTTA 3MQ2A 2SKDA 2WSYB 3Q7IA 1TT7A 5ECGC 5C4GB 4Q9HA 2YX1A 1FUUA 2Y1OA 3AHJA 4X7RA 1KYXA 1LJ8A 3E7FA 1QIFA 4UBNA 5JXGA 1OPRA 4YQYA 5BSEA 1H23A 2XZDA 3I34X 4WK6A 3UFXA 1IIBA 1LLCA 3M9LA 1NJSA 3SFXA 2BGUA 4MW2A 5NULA 5F5NA 1Q7GA 1Y9EA 2WVGA 3DV2A 1NONA 3H17A 2WPDD 4BFLA 3IE0A 3QSGA 1XTZA 4RPGA 1ZDMA 2EJTA 4YECA 3O38A 2G04A 2JBWA 3L0SA 4ND1A 2SKCA 4L8FA 5HFAA 1GQFA 4KRGA 3AETB 4YJHA 2RHLA 1Q3TA 4ZIRA 5ELXA 1UPFA 4KGXA 3ZE0B 3APDA 4X8LA 5LIRA 3MJ4A 4FHKA 1Y5RA 4GOMD 1EBUA 4I2VA 1DXYA 4RQBA 4YEDA 1YU9A 2WILA 3DF9A 4U7GA 1DI0A 2EIXA 4L9SA 3ZQJA 3LLUA 1J99A 3IKTA 1UXGA 3PTLA 4PV7A 2LSVA 3H8JA 2VYNA 5IW8A 4M8IA 2HYZA 3D5EA 5IMBA 4MRMB 1Z0SA 3ROMA 4HNVA 1MBZA 2XUIA 3FULA 3V33A 1Y3HA 1PZEA 4RK7A 4MICA 5BSTA 3WYAA 3C1TA 4D42A 4GT1A 4F96A 4Z7OB 3T9KA 4KLAA 3ZGYA 5IHXA 2VJYA 2WAYA 4KE8A 4N5DA 4W5RA 3AVWA 3RYTC 3KX2A 1SUDA 3PX7A 3QJZA 1T2CA 3TGWA 3NUQA 2VP0A 3JAKB 1G20E 4HEA6 1NNSA 5JNTA 1R3DA 1DGQA 1N2XA 2B37A 1XPOA 3MT9A 5U4QA 2DQKA 2VDLB 3G2MA 2B8EA 4L8WB 2FCAA 5DP1A 5GVSA 1E3TA 3X2SA 3ORRA 1NF9A 2WUDA 3VH1A 3LKDA 3RGGA 2BKUA 2IJGX 2AMYA 1FFHA 2RAVA 1XD8A 2SNIE 4LOIA 1XWWA 3RKSA 3QARA 2Y76A 3A27A 3QWWA 4IRUB 3MJWA 1ZMBA 2Q3MA 4OMUA 5A2QA 4A0SA 2G1AA 4CCYB 1QGED 3ZZTA 3MLEA 5CDHA 4NBWA 1E3IA 1L5WA 2AN3A 3BJZA 2J7PD 4A1FA 2JG3A 4IH4A 5I9SA 1N1GA 2E0IA 2C82A 2PSDA 1JSRA 3HCCA 3UI2A 1A96A 2ZRBA 2IHVA 4P8RA 4FB5A 3Q9UA 2XMSA 4Y6PA 5BXOA 1PGQA 1TA4A 3C3EA 1QS0B 1G8SA 4DPMA 1IOWA 1IDN1 5G0SA 2GCIA 2YWCA 1EWTA 1TO6A 1E5DA 1WHTA 1A3CA 1K4MA 2VNIA 4GL2A 4AP6A 1UJNA 1U9YA 4A8PA 2FF4A 2VBCA 4I5IA 2NSJA 3UM2A 4BU0A 1UZMA 4D3DA 5E6UB 5C2YA 4FYMA 1ZK4A 2OLKA 3BXHA 1FJ2A 2XKKA 2MMCA 2QNIA 4FU0A 5FBHA 1EM8A 4F4HA 4KFSA 1MJNA 5KJFA 4V3BA 4XVCA 2Z08A 2AE2A 4P36A 3F9IA 5D8DA 4PLCA 5EUBA 4B3IA 1W5TA 2GHRA 2ZJ3A 1DJPA 3V00A 5T4BA 2FSFA 4DR1B 4CN8A 3VU9A 5LNK6 2YW9A 2GUGA 3RS9A 9LDBA 3PPVA 2OK8A 4D1YA 2X6RA 2CHGA 4OP2A 4X7PA 3TI9A 2X6IA 2HN9A 4W8GA 3ZXXA 4G2VA 1YR6A 4UNSA 5CLIA 4YJKA 1XTUA 4YFVA 5AI4A 4KUEA 5AJVB 4CIWA 4AI6A 3ZYKA 1XG5A 4UD6A 1VLHA 4F3KA 4C0JA 1YE5A 4BWFB 1HE1C 4LX0A 3GD5A 4H7YA 4PUCA 2GRLA 1XOIA 2XDAA 2Z5VA 1A50B 1FUKA 3DEHA 4WCFB 4LKOA 4HNAB 4GTOA 2RMKA 4GPTA 1Z2NX 2WY2D 1QONA 1X1BA 3H7IA 3MZLB 4PM4A 5CMWA 1EJBA 1EF1C 1TM7E 3EEYA 3F6CA 2AW6A 3O31A 4NZOA 4UU1A 5T41A 4BMCA 1PKXA 5KWIA 2QVYX 1HZZA 4LK3A 2Q3HA 4CG3A 4P34A 5H83A 1SOVA 2G9QA 4U5QA 2I1KA 1GILA 1T4GA 4CM8A 4HTFB 5LZ9A 2GNAA 3C3DA 1YR3A 3U4HA 1AKUA 3K1TA 4IJWA 2BFDB 1OUMA 2O1WA 4DCGA 4EX7A 3OPNA 4I3HA 3KR0A 3RC3A 2AGVA 1J9GA 5GV7A 2GILA 5CH5A 5D3KA 2BYTA 2A1IA 2DLDA 1KL7A 1N1EA 4GOXA 4LJ6A 1OWNA 1NVMB 1ORDA 5J59A 1ISGA 2I6TA 4FX2A 3Q8WA 4YMVA 2IYVA 3FNFA 3GFSA 3S70A 3DR5A 5KKNB 1QCYA 4JP3A 3H42B 2IOSA 3FUKA 4CT4B 5D5HA 3F6EX 2FUEA 2TS1A 1CS0A 1Z0IA 2DUWA 1UL1X 1T29A 2G8NA 4J7UA 4V0KA 5GPBA 5JE8A 1AUPA 1R3UA 4HWPA 4RPIA 4TV9F 3R0VA 3EZFA 5J2TF 4BO2A 4CMIA 3DHYA 3OG9A 3MAAC 1WMDA 2QTMA 4TV3A 2ZRPA 4C4XA 4E6PA 4FN4A 3AY7A 3OU7A 3ME5A 1IUPA 2WKSA 3COSA 3RUPA 1QC5B 2BFCA 1R16A 2QN9A 4KBFA 3A2NA 4KYUA 2SICE 4ZYXA 4EJ6A 5IH7A 4I1MA 1MJ5A 5DN6A 3WLNA 1Z0FA 4ZVTA 2X58A 1WCV1 3OBIA 1J9EA 5JS2A 5B4TA 1SWWA 1IEQA 1AQLA 4Q9AA 4AMYA 1NLUA 2GQ0A 1JR3D 5EMHA 3DZDA 2IYXA 5DT2A 3VV2A 5J43A 4HDRA 1D7AA 2NU7A 3GGGA 4YLEA 1E59A 4E6EA 4FU3A 3AXTA 3TNDA 2L2QA 3WGIA 2HM8A 1ETHA 3BSYA 4RDXA 1UBJS 5DGTA 3L1JA 3UENA 1XTRA 3EF0A 1VCOA 3WMEA 4PZDA 2ZJ7A 2QLBA 2PZEA 3OZWA 4E70A 4OQXA 2VTBB 2ZSAA 2WBLC 4LUCA 4MRRA 3ZWXA 1C29B 4JJZA 2DYSE 1DG3A 2V6FA 1G291 1RYNA 1FYEA 2G36A 2H6IA 1T5SA 2IBMA 2WABA 2ZG6A 4C4RA 2BEUB 2ONZA 4GVXA 4WAFA 1PFKA 5BW6B 3WB2A 3OMXA 1GR1A 2NT4A 4HPXB 4LZJA 1TAHA 4F9TA 2R1TB 4DLYA 4HX9A 5K8CA 1Q7RA 1TJ5A 3M6LA 5BSRA 4LGVA 1E20A 3ZOKA 5GADl 1H2YA 1SXJA 1Q0QA 1SCBA 2XQVA 3HGTA 3M8KA 4Y3UA 4OHFA 5EP1A 4C7JA 5CDTA 4A27A 1U7TA 2YOHA 4MIYA 3WS7A 4KR3A 1FQJA 2ZEJA 2R7KA 3IDZA 1AS2A 2PSSA 4RWEA 3VLEA 4Z0HO 5KNDH 1ZJYA 1ZSVA 2CFCA 3BB3A 5BY2A 1XQYA 3EC2A 3N6XA 1EBBA 1V2GA 2SCUB 3QU9A 3WLRA 3O92A 5HFNA 4BC0A 4E32A 2ONJA 1VBKA 3L4JA 2ZIFA 3T38A 1JYEA 4IXDA 2H1WA 5ECYA 2DRIA 2IL1A 4Q5IA 1A2OA 1K68A 3B2EA 4MVJP 4BLVA 1V5GA 5AYVA 1M8FA 4YIHA 2GS9A 5BPFA 5JNSA 4TYNA 1Z68A 4F1PA 4OQEA 3B7UX 1JHMA 2DKFA 2KSQA 1KKMA 2Q5CA 2UVQA 3SSMA 1XZMA 3PFCA 3ZDCA 4HWGA 4WKPA 1MB9A 2CLEB 3N59A 3DULA 2E5FA 4CDMA 4C7BA 1QBQA 1M6VB 1OAOA 4Z1MD 1AQNA 3EGXB 1QO0D 4M9SA 1JSCA 4RTRA 1KOFA 1PGOA 2GFIA 2PT7A 4JMPA 1O94C 4C7XA 4MUHA 2PGLA 1RYHA 3B8HA 4M0KA 2H1LA 1F6BA 1SXJE 3V7YA 1EK1A 4HPJB 1PZHA 5F1PA 1ZGHA 3CR3C 1JN0A 3CE9A 2HJGA 3OPMA 4G1UC 4F91B 3IYLW 5JNRA 4X7BA 2NACA 2R87A 2QJWA 2NVBA 3VHXB 2IEIA 3RSLA 3B9BA 4YDQA 5IM4F 5BMOA 4CZ2A 1BO6A 3EVTA 5ESRA 4YI5A 4CR8A 3P2BA 4I9EA 1VL6A 2YRFA 1QU3A 2PE5A 1BMFA 5L4LA 3UAVA 4AP5A 2VP6A 2R1UA 2J8ZA 1CEXA 1EFKA 3U3OA 4CKWA 1KE2A 1N9GA 4HD8A 4JOBA 4F8JA 4APOA 3K70C 1M72A 3W6NA 5JBNA 3LZCA 4XX0B 4PHTA 4B79A 1N0IA 4QVKA 4F56A 2V98A 4MA5A 2EFEB 4OU5A 4PAQA 3DLPX 3THWA 4UTXA 3D3EA 3FU3A 4MROA 4S04A 4O8ZA 5KIAA 3GMSA 3HKDA 4IDFA 1G2OA 2I4NA 2P7IA 3K3PA 3KDPA 3ZYCA 2Z09A 4PZLA 4D9EA 1C50A 3RHTA 1ZUNA 1X0VA 2G0AA 1VDZA 3Q5MA 5LP6F 3HKBB 3RYCA 3NALA 2D1QA 1A9RA 1L7AA 1ZD4A 1J0BA 1L7MA 2ZULA 3VX3A 4CV0A 3PFKA 2Q3EA 1TQ4A 2E21A 4M1QA 4P38A 4HRMB 4B93B 1XP8A 2AJBA 4FS8A 4RM3A 3OX1A 2IPNA 4PCLA 5HIIA 1DO0A 2QR5A 3F5DA 1AY0A 4CRWB 2H52A 3KEQA 4GKAA 3K09A 2ES4A 3AF1A 2QR2A 2NZ2A 3AUTA 1E4EB 4MS4A 1Z47A 1QH8B 4TKUA 5U4XA 3WGNA 4B3BA 3Q8LA 1OH8A 4EFLA 2JFQA 4IUDS 1U8XX 4P35A 2DAPA 2J09A 3R0IA 1UMDB 3JWJA 5DHQA 2C7QA 5FBKA 2IEBA 3W2IA 5LNK1 3I1YA 5FORA 4AJJA 3JQ7B 1M2HA 2VP3A 4LOKA 1B23P 4JJ4A 4YRRA 4IJKA 2NXWA 1QQEA 4TUYB 3ZGZA 1NLZA 1CQXA 1COWD 1Y42X 1Z4OA 2H6FA 2PUVA 3K0FA 4G1MB 5LM3A 1NJ2A 3LHKA 4IMIB 4CGYA 3CVUA 3T5XA 3FF4A 4AXXA 4XIYA 4C4TA 2FRXA 4LI0A 2X0DA 3W2FA 3V5NA 5BT8A 3TIVA 4ZGBA 4LYEA 3THWB 4G65A 4DDKA 3TB6A 4PINA 4D9CA 1J8YF 4QO8A 1YA8A 5LVAA 2CFRA 2B5VA 1ABBA 4MI6A 1I7NA 2HM7A 2QLFA 3B5EA 5CW1A 4BEJA 1MGPA 4P08A 5IWAB 5JO9A 5DJ5A 5E3JA 1HYHA 4IQFA 4MWCA 5A0TA 5EQDA 1RXVA 4KWTA 2AJAA 5AW9A 1WW2A 2FE4A 3NP7A 2Q1SA 1VL5A 1JL3A 2IXTA 2JGMA 1KARA 2I91A 2HJSA 1VRWA 2HKIA 4C7OA 3BMCB 3AKCA 3KKZA 4NE2A 1MVNA 2HA5A 2ZYAA 4Q1FA 4MRPA 2ZWIA 3FYTA 4ENWA 4FDVA 2JZOA 3CLSC 1PQ4A 1ZQ1A 1HE8B 3MN1A 4PPYA 1JALA 3UJAA 3ZC3A 1NWCA 3FLMA 4YT5A 4E5NA 2XCIA 3PNBA 5B6IA 1P9LA 5FWAA 1VJRA 4HQLA 1JLLA 1VMIA 1L7RA 2V0CA 2Y4OA 2X5JO 3BAZA 3OCVA 4Y6OA 5EWMA 3E7XA 4URXR 1ZCAA 4KUHA 3C6XA 5CVEA 4DREA 3UK2A 1B15A 2P4HX 1YQDA 1C8BA 3SZOA 4W4TA 5G04C 1ZUHA 4EHDA 4H1VA 4KCGA 3QE9Y 3ZCRA 1BWQA 2HA0A 2X3FA 1SJ9A 3CWQA 3LMKA 3PD1A 4J29A 3ZGVA 1NNI1 1YVDA 2GRRB 2ADMA 5LXTF 4KLNA 3FHOA 4IIYA 4R1PA 2NX2A 4TXMA 5LP6A 3RS8A 1FY2A 3OP4A 1CEEA 4XB6B 3KSAC 3E03A 2CNBA 4D4HA 3QHQA 2J5KA 2CUKA 3AVQA 3V2IA 3OOHA 1BEZA 3LLVA 4FKZA 5JASA 1ZH4A 1P62B 3LKZA 4XIIA 5I01A 3THXB 5KC9A 4EK9A 3MXTA 4R69A 4CLEA 3CQGB 2KB0A 3TWQA 2CDNA 3DHWC 4ARZB 3GJZA 5G0WA 4QJIA 2N9UA 3KP1A 1XKQA 3QGMA 1M2VB 1FYXA 1I2BA 2VHJA 3E6AA 4HMOA 4J4HA 4NJEB 3MWJA 1FMFA 1Q1EA 2TRSB 1EUCA 3ESDA 2REOA 2WVAA 1Q91A 1E4OA 1GAQA 1C81A 2ZJZA 3TLZA 2FPGA 4G4SP 4K7JA 1OB2A 1FT1A 1Y1TA 1QOPB 4HL6A 4URYR 3SR0A 3PVSA 3TOXA 2QYOA 4O25A 4BSZB 2BEWB 3G0CA 1OA1A 4QQFA 3LY9A 3FHLA 2GMWA 4G1EB 4OSPA 3X1MA 1I6WA 4JDUA 2IZ0A 2Z9DA 1MJHA 1QF7A 1WCIA 3A14A 3AJRA 4MO9A 4CCYA 3GCZA 4HEQA 3SYTA 4MVJA 5T4FA 1H6BA 1QXSA 2PQ0A 1ELKA 1LK5A 1SUAA 3NHWA 5FH9A 4NQRA 2J9RA 4A23A 1Q6YA 1GUFA 4XJTA 3WYEA 5KTSA 2XUHA 4DCPA 2I6SA 3MGGA 2C5LA 3R9XA 5IKMA 3OI7A 2P9UG 3G9QA 2A1UB 5IDWA 3JZIA 3U09A 3NAQA 4N3BA 1T5HX 1E3WA 4OHUA 3CVWA 1IZ7A 2CSUA 1IM5A 3G17A 4FD3A 4L4YA 3RU0A 3AM3A 5DHPA 5DHSA 4ZOLB 5TQ0B 3VDXA 4U7FA 1SG0A 4ZYVA 3DMDA 1LSSA 4QUDA 4ATZD 2Y1CA 4C89A 1GL6A 5FAKA 3VUFA 2KX7A 4PAGA 1ATIA 1XC7A 1Q44A 1NJ1A 2C0QA 1CDDA 2IUTA 4JQOA 5LZ2A 2O8DB 4RSRA 3HSYA 4PS1A 2C77A 3GFPA 1Q1QA 1J5EB 3Q79A 5LD2C 4FZ3A 2B6NA 2R11A 2YNMA 5HQTA 4FD2A 3LTEA 1GSAA 4G5OA 5B53A 3GW8A 3S2AA 4A1OA 4LF8B 2FH5B 4D02A 3ESKA 4U5XA 1W1WA 4JGGA 1BDJA 3SEAA 3FIJA 3LQKA 3WYFA 3PQ8A 4CFYA 5A4DA 2OP0A 2IP4A 1U3DA 4QPNA 3WNCA 4UM9B 3WGKA 1D5WA 2I9CA 1DC4A 4WFJA 4J1QA 4GECA 5IXJA 1CY2A 3E48A 4WX2B 4A3TA 1RAGA 3OCUA 1RJEA 5CM9C 1QH0A 4GRIA 4DB2A 3KCNA 5AKEA 2MSKA 4DHWA 4DV3B 1II9A 3ICEA 1SKQA 1J22A 1ZRMA 4CQNA 4GPD1 2HDNB 1NOKA 2RGWA 4M0UA 5AI8A 3TL3A 3KKEA 2GYVA 4BV9A 2P58C 4F85A 3WOHA 4U0SA 2JIDA 1WRBA 3UM0A 4GI7A 1X1DA 4BLWA 3NNNA 4Q24A 2J85A 1U3VA 1W4CA 2ZIGA 1XRQA 1DIRA 2PA0A 3IQEA 4PIVA 1V11A 1Z6YA 1R0KA 1ZLXA 4TT8A 4X6LA 3W6UA 2JAUA 4LNUA 4EG3A 5C3UA 1Y5LA 3MJHA 1BPOA 1ZRHA 3ZHEA 1E2GA 3FVTA 3L6BA 5EMKA 4B6RA 1QU2A 3B7RL 1YS9A 1U7ZA 2R60A 1FDUA 3CH4B 1NN1A 4I66A 4DW8A 5KTKA 3VTYA 1DEXA 1DQPA 2GN4A 4QPDA 1EFDN 2F64A 4OSOA 1N4QA 1F2VA 1QHSA 1W5EA 1U2QA 2AUMA 1POWA 1KTVA 3L5KA 3CUTA 4HDKA 3T1YB 2Q9AA 2Q3DA 1ZD8A 3PKZA 2IYTA 3O2NA 3ROQA 3SX2A 5BN3A 5JI3E 1HTWA 5LQNA 3CJTA 4MVXA 4E07A 2OXTA 4XYLA 1JXAA 2OZVA 2VYVD 3B85A 3H8VA 3WLJA 2LDBA 1OCZE 1XHEA 2Q6IA 4OK6A 3ABLE 4RZSA 3V4OA 4JJ6A 1XBTA 4GI2A 5B1BE 1DJOA 2CB9A 2FQXA 3SFZA 2J5BA 3FRHA 3MZ0A 3TQOA 2BN4A 4TWIA 3U5TA 3H5VA 4B8AA 5CX4A 4OHCA 4BERA 4WBXC 3RUAA 3VSDA 1UWVA 3U3ZA 1VBMA 4RE5A 3ANTA 1K8XB 4I5GA 2FHPA 3M5CA 5AKKA 3LNTA 5DP2A 3DL2A 4CTOA 3L92A 3PR2B 4X1IB 1LD3A 4YDHB 3MINB 3R74A 4WL0A 2GAFA 1UIMA 5L7YA 2PX2A 3EF1A 1TDJA 2FFHA 2A7QA 2GM3A 2CUTA 3C4VA 3QPUA 2NM0A 5AKZA 1JWAB 3L7NA 2RI6A 1BS9A 3EOBI 4DI3A 1HH4A 1YB4A 2G5GX 3DV9A 4LGCA 2W22A 3DFMA 3M4YA 3KV1A 3WKAA 1XTIA 3PCTA 3LLSA 1IHXA 3BE5A 2ZVQX 3TQHA 4CPDA 1TA0A 3L9WA 2AEJA 4RYDA 3DWEX 5JSZA 1X70A 3IP6A 1KJZA 1QH1B 3O0DA 3OIYA 2CHUA 5ULLA 3RS0A 1KU6A 2BCEA 2Q1UA 3AOEC 4MHOA 3RF6A 3SFTA 2RE8A 3R8FA 2QDKA 4NFSA 2A14A 5A9TA 3TZLA 3NDIA 4X44A 3UPUA 5T3YA 1ORTA 3IVMA 1I7QB 4G1TA 4ZU3A 4J8YA 3A1NA 2WJHA 2EKDA 1QDLB 2NW6A 3A4LA 3S2UA 1YQ9A 1EXMA 1ZI9A 4A0QA 3GP5A 4WEOA 4P22A 3AS5A 4ZGWA 1IY2A 5AK5A 1JP7A 1XXHE 5DNEA 3PRYA 2Q6TA 5EHIA 4G0MA 1D0VA 1Q1AA 2HAEA 2VP2A 4RGBA 4DG9A 1T0HB 3TXYA 4LF9B 4HZIA 4I9CA 2BFOA 4EA7A 5IT0A 5C2JB 1WIWA 2QJTA 1SK9A 4Q9LA 1BH6A 5JQGB 1NLMA 1MPTA 1NBEA 3AOGA 3BXEA 3LWDA 4BFZA 3OTOB 4ILGA 2A3NA 2WXHA 4GZ3A 2ECKA 1SKUA 5EFZA 1OXVA 3M6XA 2R8RA 2JHCA 4PICA 5HF6A 2M1ZA 2R2LA 3U7QB 1X7YA 1ECJA 2XOKD 4GDFA 1QHGA 4FFRA 4HXGA 4LVNA 2QN1A 3F6RA 4F21A 4N6OA 1L9KA 3SS8A 2EKQA 1WZIA 3GJSA 3PWZA 2PNJA 2VEOA 3U39A 1WLSA 3IULA 4J9VA 1GU1A 3HVEA 1U98A 2C1EA 3LYUA 4CKWB 1XEXA 2VTKA 3UM3A 2NVOA 1WBDA 3FOFC 1ISSA 3GJ0A 2NXPA 2A7XA 2VKQA 2AXZA 3CH5A 1WBBA 1UODA 1J33A 4IHKA 3TWOA 3LCRA 3VBEA 5F23A 5IXYA 4KZ0A 2I2AA 1K9SA 5HCIA 4WNAB 4NNOA 3W90A 4KPUB 5FULA 3G88A 2Q3CA 3E4CA 1S2NA 2I87A 1XALA 1LLDA 2GZ2A 4L95C 4ZVSA 3K0BA 3VNUA 4HUQB 4WKBA 3ETGA 2Q21A 2EIJE 2PX4A 1XQ9A 1ZEJA 2F3SA 2DSNA 2E4YA 3KOZA 1GW6A 3KJNA 3K71B 3U44B 3RLFA 1NTOA 3CNEA 3BSWA 1A5SB 5LQMA 4ZCIA 4IDPA 2R2AA 3DMYA 1ENOA 4U6SA 2ENUA 5ENNA 4C5BA 3O91A 4CWAA 3FEXA 1LJUA 2GZMA 2WWGA 5H3CA 2A35A 3L4EA 1SH7A 4JLNA 1X1TA 5CJPA 5FOQA 4ACLA 1MOZA 1R12A 4JJ8A 4I19A 3UUGA 4YCCA 3O90A 5KTOA 3G5LA 3THXA 1KP3A 2HSJA 2NQ8A 1TLLA 3QKRB 1BXRB 3F7TA 3T41A 1ONNA 2PMDA 3AKYA 3UV7A 3T7SA 4EW2A 4F4JA 1G8HA 4GTRA 1ISIA 2JJ2A 4OBBA 1LTXA 1RYDA 1TQDA 4F0JA 3ZR4B 5TMPA 1CJBA 2JCYA 4PYIA 1W36D 2CWWA 3U5ZB 4BZWA 5BW8A 3VHLB 3R0QA 4RGQA 4B7CA 1VPTA 2PYDA 2AMVA 4KDEA 1RPJA 1Z75A 2C54A 2D2XA 2QZ9A 2V4UA 3IJRA 3W8DA 2VK2A 5ANRB 4EB3A 3D5TA 2WSSD 4X41A 3IHKA 2F9LA 4RVHA 1UBMS 2O7NA 3CEHA 4XGNA 2W93A 3CE6A 3Q7TA 5FOSA 1KY4A 4BJ1A 2MYOA 4D9NA 4AN0A 4KTVE 4WZ6A 5DBFA 1QX4A 2IDKA 3SU8A 4AB1A 3RTDA 3DM5A 1H2TC 3DP7A 2Y69E 1VRCA 2Z8XA 4JQSA 4Z9YA 1N2CA 3R0XA 3BCSA 4M0DA 2XB6A 3VU9B 4N41A 2OBYA 2P3LA 3NHSA 2WJPA 3W7BA 1D4ZA 3IAS6 5CVVA 1G5RA 2PMBA 4RE6A 3T4PA 4ILHB 4RD2A 1SFRA 1AP7A 1XRLA 4Q3DA 4DJTA 5EQTA 3FHJA 3TR0A 5AM3A 2HRDA 5KHOC 1TJYA 1SC6A 5K99A 3GT4A 5JATA 4CBVA 2WV7A 2ZIVB 2QN6A 3U3RA 3I9V6 3MGAA 1PTJA 1QKKA 4ALIA 4H15A 1SCJA 2OGZA 3CG4A 5HDQA 3ZBTA 4W5QA 3JD3A 1OTHA 3B95A 2CLOB 3HVRA 2WYWA 2Z3ZA 1VGQA 3JCZA 1UDWA 4Q3NA 5ILQA 5KREA 1R6UA 1B7GO 1I1QB 2OE2A 1SXIA 1UINA 5FRDA 2J3IA 4RVSA 3SM3A 3T4XA 1UBEA 2HF7A 4DIOA 3F2VA 3HMKA 1WAO1 2DLNA 2QMUA 1TUEA 1B0UA 4G11A 2ZT5A 3HB9A 4OM7A 4D8TA 2P4UA 1JBEA 1SC4A 1XN1A 4F6CA 2JFOA 3WGUA 3ISVA 3RHFA 1TYDE 4M87A 2CMFA 4EPRA 4JEIA 3WNBA 1P19A 3K9FC 4U95D 4KKVA 1CY7A 4NVRA 5HKLA 2GB4A 3LBNA 1V1RB 1HWYA 2PD3A 4R16A 2X0KA 1CLUA 2ZANA 1PHPA 1E69A 1WS6A 1BX0A 2WZBA 4IW3B 4KXVA 4BN0A 3RFTA 2FFAA 2PEYA 3I05A 2PS9A 1L3IA 1U7PA 3COPA 3F6SA 3FDJA 1SUBA 4EMSA 2F55A 4ZZ1A 3RUFA 4MMXB 3JQQA 4GICA 5EA2A 3RM3A 4ALKA 1P9WA 5KHLB 1PJAA 2P3SA 2VT7A 5FV7A 3AF6A 2PQRA 1R8YA 3GROA 4ER6A 3ZHOA 2Q0QA 1VBNA 1CR1A 4W99A 4Z99A 3R7AA 2HSEA 4D56A 5FZRA 3GZNA 2FFJA 2JZNA 1X80B 3OFSA 4RTKA 1DC6A 4HJXA 4DCOA 2R97A 1Y4UA 1YS1X 5DNWA 5I3CA 1MD9A 4RLYA 2J6CA 2WSMA 4N7BA 3BQMB 2ODPA 3D3WB 2AXVA 2Q2VA 3BERA 3UJ7A 1NRWA 1E7QA 2E4WA 3REQB 2R4UA 5T8IA 4DZZA 5CDUA 4JY7A 3ZWCA 3OMSA 1Z6PA 2NTYC 1QFSA 5LQAA 2JI7A 3CVNA 1TU4A 3SI5A 3SJUA 1RC1A 2ID9A 4GIBA 1BA2A 1YI1A 1UFRA 3T7RA 3CY6A 5KQSA 1L7EA 1R8XA 5SZIA 2Q29A 1C80A 2Q4TA 2GD0A 3AZPA 3IODA 2D4AA 1KVRA 3BWEA 3CKYA 1IPEA 1JUDA 2YS6A 3I4LA 3MOSA 1S9HA 2GK3A 2JKYA 3JAWA 3GJXC 1N2BA 3TIXB 2E4UA 3VYSB 3JVUA 1BYUA 3DEIA 2WMDA 2I2XB 4HF7A 4WADA 4RPCA 4KJXA 3U0VA 3V8BA 4DLBA 3TLKA 3S7DA 2D7CA 2VLIA 2INGX 2ZBDA 2QPTA 2AG0A 5FJYA 3EAGA 4S1NA 5LBTA 4BNNA 4NNPA 6LDHA 1CEYA 3R44A 1Z5PA 4GVLA 2PA3A 5JEEA 3KSMA 1MKYA 1O08A 2ALJA 4W5OA 3DZKA 3MRSA 1Z88A 3J5QB 3NTOA 4QU9A 3V3KA 1QQBA 3NOGD 2Q4OA 1OXXK 1ZISA 5IYZB 1KGDA 2GCNA 3PXBA 4UREA 2NXJA 4BKUA 3NHYA 1WEHA 1WA5A 3IVXA 1D2RA 2JBHA 4A63B 5BURA 2X0FA 4RXMA 2XOEA 5EYPB 2IV2X 4L6CA 1FSFA 2F0YA 3M5DA 4LE1A 3GNLA 1AQ6A 5EDSA 4XI9A 2YICA 1IC6A 1VKNA 2FO1E 1N11A 2ZRNA 4WJZA 4DAEA 3A6EA 4FLFA 2FWNA 5D0QD 1CG6A 3AONB 1GYPA 3BRWD 4BMSA 3NDBB 1UJ6A 3JX9A 4FFVA 1N57A 4C30A 5JCXA 3HJAA 1ZL2A 3RBXA 4PBRA 3DMPA 4JC8A 2GZHA 2Q5LA 2VTDA 2ZI3A 3T8YA 2ZQYA 5CX1A 3KAQA 2HRCA 3E58A 4GWLA 3V2GA 1Z5UA 3CSSA 4TPKA 1YZFA 3TEJA 5HKAA 5K3EA 4RKEA 1BXGB 1TPYA 1RLJA 3DOFA 1K3TA 2E1PA 1CJCA 2G77B 3FYUC 4EKYA 1OWLA 1PP4A 2CD9A 2QXUA 1EX9A 3EGIA 4MULA 3T3IA 3JWEA 1MB4A 3BOSA 5GIPE 4O0MA 5AXBA 4G0VA 4PBTA 1PL0A 3DVRX 2GHTA 3VPHA 4C76A 1N1MA 2BDEA 2FKNA 3M4XA 4AZ0B 2ZPTX 3K9IA 1OT5A 4GP9A 4Y1FA 5BORA 3B9QA 3IRUA 1EDUA 4E14A 4BX9A 2MRIA 4LNUD 4B4VA 4D9IA 3V9PA 5K05A 4CMHA 3GZ2A 3Q9LA 4M9ZA 4KW7A 2YHUA 1TNBA 2BM1A 4C21A 3HP4A 1YJ8A 3FU5A 2G80A 3JQBA 3NANA 4A73A 3ZBQA 3NVKI 2BHLA 1DBQA 2HSGA 2JFGA 2YS7A 3IKJA 4YRJA 1CQIB 3NYWA 3QKYA 2X42A 4QYMA 5BWNA 1QZ2A 5JAOA 4LJLA 3QX3A 4R1LA 4NDNE 3IAS1 2QN3A 4PO8A 3VOTA 2Y1LE 2W2LA 3L0BA 3P27A 2WUEA 2CDAA 3OZFA 5TMBA 5J23A 1UKBA 2AN4A 2V45A 1WXWA 3EZYA 4OL0A 3N1UA 4LVUA 1YRWA 3S44A 4AWBA 4B31A 3U7GA 1HE3A 4D0GA 1TJFA 3R75A 1Z63A 3U26A 1YB2A 3DAOA 2A5FA 2R00A 4P3OA 4H35A 4GPBA 5DHFA 1SB8A 5KYUA 1PQPA 4J8PA 4NCNA 3WLEA 5LYJB 4PIMA 1XGKA 4LSGA 3VKVA 1GGHA 2QTWB 4R7TA 3D4NA 3PS9A 1HH8A 2Q0XA 5AFSA 5AVYA 2JLXA 4KXMA 1H0KA 3A3KA 1K66A 2WA2A 3FWZA 1Y1RA 4FMCB 3ZZ0A 5LD2B 3NB2A 3O1HB 1CUDA 3SFVA 3RANA 1V1RA 1JF8A 3B3JA 1QIEA 4DR6B 2ZBRA 3WZMA 2RI0A 2JC3A 1K4YA 3JSAA 4RMJA 3PA8A 2OYCA 3DE0X 3KSRA 3OCZA 4YAEA 5EAIA 3GN2A 2F3QA 4WJLA 4B6FA 4DIKA 2D1FA 1FS4A 3D8TA 1E2EA 3GHYA 3JTEA 3VYWA 1QGUA 1IXYA 1XPUA 1A88A 4YYZA 4OSEA 3DFFA 1SCUB 3G8AA 5LSAA 1JDJA 4YWHA 3QKSB 3VR3A 1Z15A 2QHXA 4CG2A 1LS1A 1YR2A 2VG8A 1E9BA 1U8UA 1ZIYA 3F4BA 4DEYA 5JS6A 1QRUA 2Q7FA 1KDPA 3AKEA 4ZCQA 1KE1A 2XTAA 3RSQA 5A6SA 3H2KA 4BKRA 3RARA 1LFAA 5IJ9B 2O8BB 3JQ6A 1LDYA 1CZOA 4I9NA 2J30A 3VO9A 8ABPA 2A5UA 2Q0HA 3AYZB 5CYFA 2W6PA 1NHWA 1FFAA 2WUVA 3TX6A 1CU1A 3Q3IA 5DTRA 1WUTA 4FW8A 3DEKA 3RU3A 3NHKA 2FY8A 4B43A 4COOA 4QTYA 3AJEA 2WDPA 5FAXA 3O1JC 4RBNA 1BOFA 4LMRA 4YJFB 3DL7A 1ZX1A 4GX5A 1GAEO 3LX4A 4H7JA 1GPYA 1N3YA 1XF1A 1GD1O 4PLFA 2QRGA 3M81A 2P6PA 5D5QA 1S96A 2B1IA 2CVOA 1T2EA 2IDMA 3N7TA 1N2CB 2NNWB 3EEQA 3LWZA 3RIGA 3SC2B 4KU4A 1MC4A 1DWPA 2RFMA 4MKRA 5GOZA 2VTVA 3MWKA 2P9IG 4MV9A 2IDZA 3P9XA 1NT4A 4IWYA 4EHLA 2R66A 1V3VA 3IUJA 1PZGA 5KYWB 2BSQA 1C2YA 4FR5A 4WCVA 2F8SA 1I0LA 5DBKA 1FLDA 2KATA 1GYQA 1O3YA 3VR5H 4CGZA 1QIMA 2ZR7A 4WOCA 5JNUA 3L77A 4KVGA 5BR4A 4O4LA 1E7MA 1HDZA 2OQIA 2QSUA 3KBBA 4UM8B 3C6YA 3DPUA 1X5BA 1ONPA 3JARB 2R1ZA 4L9WA 1PFWA 2IZ7A 2YMLA 3IIKA 1JNZB 5CVDA 5AJDA 2ZVDA 3HYCA 5BVHB 4QYIA 4OQPA 4FJZA 4CIYA 2QAGA 3DNFA 2B69A 3K5HA 4J2TA 2DY1A 3FDXA 3TE6A 4KNYA 2JHFA 3KVRA 3V34A 4HI9A 1J7JA 4FC6A 3A31A 4XRGA 3BWBA 2ZXFA 1BS2A 3ITKA 4JEMA 4YDRA 4ZOBA 4K8RB 3G0BA 1L8OA 1P2UA 2W6QA 2YDXA 4Q3CA 2V74B 1HYGA 2QORA 1C0KA 4OD0A 1LZKA 2HCRA 3IKLA 1Z7BA 2Z6AA 3EIOA 4MO2A 4CDGA 4S2UA 1FU4A 2YIMA 2OA0A 2QYHA 2WINI 5IJWA 3G79A 1C3OB 1UP4A 1E0SA 1SQ5A 2IEAA 1L7QA 5KJKA 4LY3A 4I6JA 4ZAFA 2FJAB 1MU0A 2OMKA 1CTQA 2FPXA 3BB1A 1DP4A 4TMXA 2O50A 4EZLA 1VHQA 2QVXX 1JVBA 4KXQA 4PYKA 1V55E 3PFGA 3WGLA 4KWCA 4EMBA 4KMMA 4HSEA 1OX4B 2FEKA 2WHPA 3OTGA 4YJ3A 2R6CA 2AZ4A 4AECA 4E2FA 3KJHA 4RHXA 4R2HA 5IEBA 3TAXA 1KEWA 3U7EB 3AS4A 4AN1A 2WJZB 4PPGA 3CF4A 4XUCA 3EQ6A 1YFLA 3ER9A 4GVPA 1GL3A 1KNQA 2V1XA 3T3NA 5CA0A 3A4NA 4BCCA 2J5XA 3NB0A 3NYRA 4XUGB 4BVKA 2PYZA 1TLFA 5L4SA 4MWOA 1MAAA 2CUZA 3DVLA 2WJIA 1M0SA 1Z4MA 2DHCA 2QZZA 3WRWA 3M33A 2RHOA 4A0FA 4GPAA 1T4MA 1H66A 2ECOA 2VUUA 4J1TA 1E2HA 5DULA 3T7DA 1MX6A 4F3TA 3LO8A 2OV4A 1APBA 3ODGA 4DM7A 1HG2A 4HEHA 3O8DA 2XT6A 4C22A 1MG5A 1TUBB 4N0QA 2JGLA 3OE5A 1IBMB 1DKOA 4YLGA 1LRKA 1GPMA 4C5AA 3FLAA 1DADA 2O54A 1Z0ZA 3PC6A 4AWXA 1NX9A 4BB6A 1RP1A 3B7GA 3LT4A 1E90A 4U3JA 1SIUA 3K53A 2KI5A 4DCNA 2RHGB 1DG1G 2HK7A 3U4AA 1WMFA 1RM0A 3HO6A 5F4ZA 5IUKC 4R6WA 1H2XA 5FLKA 3PI6A 4Y6RA 4C3VA 1IEWA 4HFNA 5CDFE 1K4KA 2W2KA 2ZE5A 4NHEA 4PX9A 1YMQA 1Q7TA 2C2WA 2JVIA 2PPVA 4YJDA 3U1BA 4MAFA 1PDVA 1Q1GA 3MX3A 1E8OA 2XYRA 3Q1KA 1HMPA 5AKJA 1HE2A 5A04A 3ENWA 5AVVA 3ERCA 2GW1A 4KQ6A 3W6OA 1P61B 1XEWY 4IIJF 1ZGBA 1NXOA 3FYDA 1ONBA 3T5CA 3SZLA 5IEJA 5M2QA 1ZKMA 1II8B 1TZJA 5G1NA 4NRHB