3PE3A

Structure of human o-glcnac transferase and its complex with a peptide substrate
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
701
Chain Sequence
b'SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structure of human O-GlcNAc transferase and its complex with a peptide substrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 268
structure length 701
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pe3A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 3pe3A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3pe3A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pe3A03
3E3LA 4Z5XA 4N3BA 1C8KA 2LSUA 1C3JA 4NEQA 4BFCA 4WNEA 4GZ5A 4G23A 3BD6A 3RSCA 4EL0A 1XKXA 3OT5A 3CX4A 3KAEA 1YGPA 4XIFA 2YJNA 2C0LA 2AMVA 2R68A 4BQIA 3UYKA 2WPVA 1Y6GA 3Q4AB 3ASFA 4GA0A 1PYGA 3WAGA 1HZ4A 3RIBA 1FU4A 3MRXA 3ZPJA 4B94A 2KS6A 3S7FA 4FZRA 2VYIA 2VG8A 4W6QA 2ACWA 2QN1A 3RO2A 3OXGA 4YVOA 3MS4A 3NPAA 3CV0A 3ESKA 4I1AA 3ZFWA 4N2SA 3DDSA 3CUVA 2OOEA 2ATIA 5HXAA 3AS4A 3CUTA 4CGVA 3G2HA 2HY7A 4MI6A 1SXPA 3BEOA 2IV7A 2PRIA 4HOSA 4RIFA 1FA9A 1P5QA 2VCHA 2YHCA 2IW1A 3SF4A 2HO1A 5ENZA 3Q3EA 1P4HA 3L01A 2FI7A 2GPBA 5GPBA 1ELWA 1WUTA 1E4OA 3SYRA 3OXLA 3VTXA 1F0KA 3URZA 3FWVA 4IN3B 4YVQC 3NP7A 2Q7FA 4GPBA 2FF4A 2L6JA 2PRJA 4F97A 3OKCA 3TG4A 4UQXA 4GYOA 5EX0A 4X7PA 1OUVA 2F3PA 5DU2A 4GA1A 1P4JA 2LSVA 2Y4UA 1E1YA 3H4TA 2R66A 1Z6PA 5HQ8A 2F3QA 2QRPA 2SKEA 1L7XA 1FU8A 3EDTB 5DIZA 1LWNA 4W9RA 1A17A 1NOIA 2QNBA 3ZCRA 2VGXA 3OKPA 3RSZA 3RT1A 3FFLA 3CV3A 3ASHA 3IEGA 3NAZA 1K06A 4I17A 3OTGA 3S7DA 1JG6A 1H5UA 2G9QA 4UQZA 3LY9A 4JA9A 2C0MA 3MV3B 3QOUA 4JA7A 1Z6QA 2AV6A 3Q3HA 4WACA 5TMEA 3RHZA 1KT0A 4Y6WA 4GCNA 2F3SA 1LWOA 4G2TA 1FU7A 3BD7A 4KBQA 5BW8C 3GW4A 2P58C 4KXKB 3T3DA 2HYZA 3RO3A 1PNVA 2XGMA 2C9ZA 3MQFA 4GZ6A 4M7PA 3CVPA 3U3WA 4XI9A 4EKEA 4BQEA 2OFFA 4WUYA 4UI9J 1HXIA 2BGTA 1V4VA 5LCWJ 3VUFA 4GPKA 2VGXB 5DXFA 3PE4A 4RIGA 2PQ6A 3T3HA 3GUHA 3ZCPA 3O48A 4RG6A 1SXQA 3D0QA 3GPBA 4RIHA 5LQDA 2AVPA 4U0ZA 4RENA 2XGSA 1NLMA 5BT1A 3MT9A 3VUEA 3H4IA 4JL0A 4N5CA 3ASGA 3TSAA 2JLBA 3ZHEA 2XEVA 3UUXA 2R4UA 1B89A 3DZCA 4CTOA 3MS7A 1PN3A 4KQMA 1XC7A 3T3IA 8GPBA 1EXVA 3RJVA 4G24A 4KQ1A 3Q3IA 3KS2A 4NC9A 4X7MA 2QRMA 2XPIA 1NOKA 2XCCA 4ME2A 4EQFA 3ZGQA 3CVNA 3CUWA 3C4VA 1XOIA 4GCOA 3S28A 1ELRA 4N3AA 4G25A 4I2WA 1EM6A 1WV1A 3NCHA 4N2QA 2BISA 4MHSA 1P4GA 4MRAA 1IIRA 4LEIA 3CUYA 3CEJA 4N9WA 4EKYA 2XA9A 3SYMA 2GEKA 3OTIA 3GYZA 3ZHEB 3OXFA 5HI7A 5M72A 4HLNA 1RZVA 3LKUA 5TMDA 1M5RA 2YQ8A 2WQHA 3MV2B 2KCLA 2XCUA 4BWRA 3MTAA 4KQ2A 1FS4A 2IEGA 4BTBA 2C2LA 5KJKA 5D00A 3AMVA 1QQEA 2KCVA 4F3VA 1NVKA 2AW3A 4AM9A 4PQGA 1AHPA 3CKCA 3AS5A 4N39A 2O6LA 2QN7A 1XNFA 2MHKA 3KD7A 1WUYA 1QKJA 1XL0A 1FCHA 2QLNA 3CEMA 1ABBA 2UWJG 1GGNA 1HH8A 3ASDA 3D1JA 1IXYA 6GPBA 4RBNA 2X6RA 3MA5A 1GPBA 2X0DA 3S29A 1KTIA 5TVGA 4F96A 4MI9A 1L6IA 5JJ7A 1IYGA 3ZCQA 2PQNA 3ZCTA 4YI5A 4UI9K 5TMBA 2QRHA 1GPYA 2JZCA 4BT9A 5DBKA 3BD8A 3MKRA 2DBAA 5FZSA 3MEKA 5JTTA 4I2ZA 5G05C 3WC4A 4UQYA 2XCIA 4LDPA 2QN3A 1NZDA 4FKZA 3UYLA 4U0UA 3LPZA 2IEIA 3PE3A 1E96B 3Q47B 5DLDA 2IV3A 1QM5A 5FT9A 1Z62A 2XGOA 2IYFA 3WXXA 3CK8A 1L5WA 5JTUA 1L5VA 1TJCA 2QZSA 3OTHA 4HOTA 3EBOA 4RELA 1RRVA 2BUGA 3G2LA 5D0OD 4I9CA 4G2VA 3TG5A 1P2DA 4NRHB 5KJLA 4M60A 4G26A 4HORA 1GZ5A 5I45A 1Y6FA 2PYIA 3QWVA 5ARGA 3L7CA 1Z8DA 3E4BA 4YNDA 1L5RA 1JG7A 3MRTA 4L22A 3C48A 2G9VA 5BNWA 2C4MA 1W3BA 3CEHA 1KLXA 4J8DA 3TGOA 2G9RA 4KYOB 4RIIA 1UQTA 4NESA 4ABNA 4AY6A 4Y6CA 1WW3A 5C1DA 3LYAA 3CEQA 2X0FA 4J8EA 1UQUA 5LCWC 3MTBA 3FROA 2KC7A 1PSWA 1Y8MA 4H7YA 2R60A 2ASVA 5IKOA 3WADA 5G04C 4APOA 3LY8A 3U4TA 7GPBA 2BGUA 2H1HA 5EKQD 2QN2A 4HWGA 3QWPA 9GPBA 2AZDA 2C1ZA 1UZUA 1VGVA 1WM5A 4WNFA 3QKYA 4REMA 5ARFA 3HBMA 4CTNA 2IF4A 5EX3A 2GEJA 3S7JA 4X7RA 3TAXA 2ONDA 3T5TA 1L5SA 2QN8A 4NQ0A 2Y4TA 4LEUA 3T3GA 4CGWA 2F3UA 3BCSA 5D01A 4H7XA 2FO7A 3DD1A 2IUYA 2IFUA 1C8LA 3G2NA 3L79A 5A6CA 1K08A 3C4QA 3JYSA 5JJ6A 1NZFA 4O6FA 2QLMA 3G2JA 4I9EA 1WV0A 1FTWA 3LY7A 3K9IA 5CHEE 3SZ7A 2KATA 5KJNA 4A1SA 3MSCA 1PC2A 1AXRA 3VTYA 2R4TA 3ZCUA 4AMBA 1ZU2A 3MT7A 2UY1A 2FETA 2X0EA 1NOJA 2FBNA 1BX3A 5FJYA 3O3CA 5KJMA 3E3OA 3OKAA 3EBPA 3UPVA 4F9FA 1F6DA 2WTXA 1GFZA 2VGYA 5FTPA 4XI0A 3L7AA 3NP9A 3E3NA 1WAO1 2FFRA 1JIXA 4GYWA 4WNGA 5IKPA 3Q5MA 2PQRA 2VQ2A 3NB0A 5D0QD 4AY5A 1XL1A 2ECPA 5A7DB 5CCMA 2XCBA 3GZ2A 3NC4A 3CVLA 4WHMA 4GA2A 4MI3A 2PL2A 3Q49B 5CCLA 2G9UA 4EL5A 1P2GA 3CKBA 3MRVA 1YA0A 4N3CA 2QRQA 3VDMA 1L5QA 4JHRA 5FZRA 1KT1A 3L7BA 2UY1B 4HOUA 3AS8A 5FZQA 2J9QA 1IHGA 3DDWA 3ULQA 2QN9A 4J0UA 2XA2A 3BDAA 2ACVA 1O6CA 3CVQA 1JIUA 3QHPA 1RZUA 2VSNA 4YI3A 4RIEA 1P2BA 3FP3A 3HYMB 3S7BA 3TOVA 1P29A 2KCKA 2BFWA 3ZN3A 2H1FA 4G1TA 5G05J 4HOQA 5AYWD 3T3EA 1ZBPA 4AIFA 3QDNA 4BT8A 2QRGA 2F9FA 3RKVA 2PZIA 1J39A 1HLFA 2XA1A 3IA7A 3L7DA 1JEJA 1NZNA 1QZ2A 4AMGA 4U0SA 4RG9A 2JJMA 2GW1A 1FTYA 3BEEA 4AN4A 3N71A 4X6LA 3HBFA 4QLBA 3NF1A 2R5SA 2GT1A 4MICA 2VCEA 2VSYA 4EJ2A 2FEZA 3S0JA 3MT8A 3ZCSA 2FF5A 2QLLA 4WNDA 3HBNA 1C50A 4BTAA 3CUUA 4GYYA 3LCAA 1YA6A 2ZB2A 1B4DA 2SKDA 3OY2A 2SKCA 3T7DA 3GZ1A 5JJTA 3ZCVA 2E2EA 1NA0A 4CDRA 4UI9C 3G2KA 3OY7A 4WADA 4U07A 3MTDA 2XMPA 3QKWA 3CK7A 1FC0A 2C1XA 2GM9A 2X6QA 4MHOA 2QFCA 1Y8ZA 2V5FA 3BCUA 2IYAA 2NC9A 3Q15A 3D0RA 2PYDA 3G2IA 1FTQA 3IAAA 3S2UA 1GPAA 5G04J 2Q6VA 1A8IA 3BCRA 1JIVA 3QWWA 4GZ3A 4M83A 2GJ4A 2P6PA 3HBJA 4CTMA 1XV5A 3S27A 4YUAA 1WW2A 1NA3A 2HR2A 3R9AB 3COPA 2LNIA 2GPAA 3RU0A 3UQ3A 3CK9A 1GG8A 3PDNA 4U04A 2GPNA 3MBOA 3VDNB 3MS2A 2I6HA 4BQFA 4J8FA
chains in the Genus database with same CATH superfamily
2VCYA 4DM4A 1QJ4A 4HDKB 621PA 1W73A 4P6VF 5CT9A 3M5WA 5C4MA 2A1TS 4KFCA 3EWSA 1EVJA 5DI9A 1P1CA 2XWBF 1S1MA 1SIWA 4UEWA 3UMVA 2WFLB 3G6KA 4B48A 1J7KA 1DE0A 4XEIG 2J5XA 2HY7A 1SXHA 2WWYA 1P4AA 5ANRB 3AY3A 1K8XB 1KAEA 2G17A 2PGLA 1NHGA 2FRVA 2CLEB 1U90A 3WNBA 2DG2A 1OUVA 2REBA 3A6FA 3TE7A 2IOFK 3O94A 4R0NA 2H8KA 4WLFA 3UJ6A 1VRWA 1L1FA 1EE2A 3EXIB 1D1QA 2GOYA 4Y2YA 3LXMA 4YUWA 1Y6GA 5AQ9A 2WFAA 1XTIA 1HWYA 1U9YA 2BMAA 2VHQA 4KTTE 4MIYA 3TQIA 4OP1A 2NUTB 3WIVA 1L7DA 2VHZA 3HPQA 1LI4A 3FYSA 5JXIA 5U4QA 1PDVA 3H5AA 1I51A 1LRKA 2VJ8A 5P21A 4BQQA 3BBPA 4RXTA 1VHQA 4D3ZA 4J1TA 3HY4A 1N6KA 2KZTB 1NPYA 3BK1A 4A8JC 3NRJA 1H8EA 3AKEA 3KV1A 2GDZA 4YNBA 1I3NA 1UBMS 3CVNA 1RT9A 3REQB 3F5SA 2H31A 1B6RA 2M32A 1Q0PA 5CVEA 2M6RA 4CM3A 4Q9NA 3EXHB 3A8TA 1LDGA 1M8JA 4D4JA 1S0UA 2QT9A 4H17A 2PCLA 1QQEA 1MTOA 3UCFA 2NO4A 4JV5B 2VDPB 3HKDB 4H0NA 2N46A 3MIZA 2KMLA 4XQCA 4ATZD 1PT5A 2CLIB 5DBOA 3AR2A 1OXTA 1YVPA 5EUQB 4AKGA 4DMUB 2XOXA 2IHVA 2ZM5A 4DLYA 2QPLA 2P9QA 4WK0B 1I3CA 1B73A 1Y4AE 1BGXT 4M9SA 3FGOA 4B4VA 4KKXB 4FPXA 2WMDA 1PR4A 1KYYA 1QCDA 4PTLA 4F4UA 3RTAA 2JAXA 4J0HA 3ETJA 1IVSA 4YY3B 4H2DA 1U0JA 3NWPA 3FA2A 1XWIA 2UAGA 3ZDZB 5E1OA 4FN5A 2ISSD 4J4HA 5MN5A 3V6LA 3C3EA 4D9IA 3FROA 3TD2A 4B3GA 1M2OA 1IPEA 1X1TA 1UG3A 4PC7A 2PNFA 3VH2A 2IHJA 2JARA 1DV2A 4ZYVA 4PFQA 4L4XA 2HSGA 1WMBA 2D8MA 5P8WA 3PXGA 2QYOA 1GLNA 2QMHA 3QQ5A 3KWJA 1DT3A 4MVJD 5KWSA 3C4QA 3MA0A 2Z2KA 2IYZA 3U3XA 3TEMA 1X1BA 5FJYA 1OCZE 2EIXA 2GBFA 5AM5A 5ERXA 2F8TA 2P2GA 1UOOA 2BGWA 2C5HA 4ZYWA 2W37A 3QOWA 1D7AA 3MERA 1IONA 3MMXA 3QYPA 3X1XA 2P9LG 3D02A 1XRJA 1ZW1A 3EQ8A 3IPAA 3R0IA 3ZUVB 4HWPA 2Z30A 5E2IA 4HB3A 4GAAA 1XQVA 4HI8A 4HRYA 1UBNA 1EB9A 3THXB 1ZM7A 3D8TA 3JWGA 5LQSA 1TIKA 3CEPB 5BVGA 2P3SA 2A14A 3H2SA 3D0OA 4MYRA 3CHMA 3ILVA 3FSJX 4BEWA 1Y8QB 1IK4A 3UA4A 1J09A 4DUZB 4HDKA 3SDZA 1AY0A 3PV0A 4QYTA 3FYUA 4YAKA 1QP4A 2J9RA 3NOQA 1OHHD 2HR2A 2ROQA 4TWBA 5LP6F 3K9WA 3KKOA 4MQ6A 2HYDA 3U48A 4WK4B 4ZQFA 3TU3B 3KEMA 4ND3A 4D79A 1B42A 5REQA 4A0HA 2IRWA 3OEWA 1R6AA 2C0LA 4B75A 5ANRA 3PK0A 4MEJA 4GTQA 3FUHA 3TLYA 1CF4A 4X8HA 1H0AA 3E4DA 1PU2A 1PYGA 4N5DA 1A9QA 4XW2A 4CZ2D 2BEKA 3H5TA 4DX1A 2R7KA 1TVEA 3PGVA 2Q7DA 2QVYX 1U8EA 3OIWA 1XVTA 2ZWPA 3PRHA 1W19A 2C77A 5DRTA 2YW9A 3X44A 2IUUA 1I5EA 3IC5A 2R00A 3RH0A 3B1WA 3GAMA 1RNLA 1RWQA 2HMVA 5AUPB 1JYSA 1U1IA 5LB4A 5JALA 1J56A 3DV2A 3HA2A 3EDTB 3A26A 1XLUA 1KA9H 4CKWB 3U4IA 1LBQA 2BMVA 3T61A 5JANA 1RPTA 1VYHA 4I17A 1ECPA 4XUDA 1KJZA 1P0IA 4BASA 3PUKA 2R6ZA 1MIHA 5DX8A 1FLVA 4X7BA 1OX5A 3P2IA 2Y1LA 2UXDB 3U7FB 2KZTA 1BX0A 2O54A 2F3RA 1U6KA 5AI9A 4JBIA 3OMXA 2OHGA 2A67A 4YP0A 3REQA 4LCTA 4S1NA 4C07A 1UEIA 5K51A 2QTTA 4A36A 1R64A 3EXHA 2HMUA 1U28A 3OBBA 4HZUB 3BMXA 1S8AA 5EL0A 4NQZA 3C4VA 4Q69A 1Y8AA 1EU1A 4E5DA 2B4TO 2EL7A 5CDFA 3IRUA 1F4VA 4IDGA 3UXGA 2YYSA 2JCBA 1M0WA 1SVOA 2BUCA 3BMQB 3I0ZA 1Q57A 3F6PA 4ZOBA 3TWTA 4E85A 1J2UA 3AF5A 4CYMA 3I76A 4LQ4A 2ZYHA 5DN6D 2R1VB 1T5DX 2ZU6A 4BKQA 3U5TA 4J6FA 4DX2A 1RAEA 2RHGB 3F3KA 3E7PA 4DWVA 1DQRA 3P1JA 2XYHA 2H2HA 1KC3A 1FSZA 4EJSB 1FUUA 1TJ5A 3K6SB 2UVQA 4LHEA 2XPCA 3VTZA 5SZHB 5YASA 2QTHA 3FHOA 2IIVA 3EQ6A 3N0WA 4QXRA 4U2DA 3RFXA 4QC2A 1YZFA 2PXHA 2VYND 1ZAYA 1GZ5A 2HIMA 3VV2A 3X1DA 2J5QA 2F8YA 3OZSA 3HGTA 2ICAA 4FINA 1RM5A 1RQLA 3UT5A 5DM2A 1T0PA 5KC9A 5MN6A 5C52B 1ST3A 4DMMA 2FSSA 2X0IA 2IOYA 3WL4A 3X1KA 4U8HA 3TJRA 4XVCA 3OP4A 4QUKA 1QFJA 2VA9A 1VIMA 4ZMSA 3QNUA 2I8LA 3WAJA 1L1QA 4IXWA 1ORDA 4YLGA 4EP1A 1HNZB 1E3TA 3AUXA 3TL5A 3GAAA 3EIWA 4O59O 3B60A 3GPCA 1UBSB 1R5JA 1MQ9A 4QBKA 2JJ1D 3HJNA 3Q5MA 3Q1LA 5FV4A 3I4RB 2HJRA 3AFHA 3DVAB 4EYEA 2Q4RA 3ENNA 3TNDA 3QKUA 1E7YA 5FZQA 4A82A 5DI3B 1T13A 1K4MA 3WGTA 4A2QA 2DBZA 3AW9A 2AX3A 3FDZB 3RS5A 3PUHA 1T9HA 2GERA 2VTEA 5KMGB 1THZA 2Z3ZA 3L06A 4WNYA 5TF4A 4O4HA 1OU0A 1S4QA 1VJCA 2X19A 1ZGGA 3P2BA 3AOGA 2FUG1 5KYXA 3SJUA 4BXOB 1D04A 5GM2A 1QBKC 2AEJA 1NBME 1KY2A 3BWCA 2VQEB 1OZAA 5B6PA 3DMNA 1GEGA 1F6WA 1SVSA 1NJGA 4KGZA 1RP1A 3LT4A 1NPDA 5CFLA 3F8WA 5I01A 1WXGA 3UEOA 5BV2P 3WRXC 1L7AA 2FSVC 2GRNB 2HA7A 2X7XA 2QLTA 5BUSA 3W79A 4E32A 1G3NB 1CEXA 1JPVA 3SAJA 5A3JA 4LJSA 3AINA 4XKCA 4G23A 1DVPA 1U2DC 1I4OA 1V8DA 5ALJA 1IXVA 1XK7A 3TCKA 4WXYB 2XNSA 4UU0A 2OECA 3DKPA 3SF0A 3ZPJA 1HE8A 3PZBA 2FLVA 1KRXA 2ON6A 2VZ9A 2F8LA 2FX5A 4FCCA 2OY0A 2GEVA 1X1CA 4EF6A 2HDWA 2I80A 4Z3KA 1D6SA 2GD1O 3QEMA 4JBYA 1ZGHA 2NSZA 5DULA 5AJHA 2QUKA 3ZH2A 4HYEA 5KNBH 3GO4A 1LPMA 4XLTA 3CPEA 1C30A 2DR0A 5HKKD 1TMKA 2VSXA 4DLSA 2VOJA 1V95A 3HG0D 4NJOA 1IN8A 4KXKB 3GI1A 1Q0SA 4Y2PA 1RWXA 1FNBA 3RRFA 3VSAA 2QM3A 4MQEA 4RZIA 4GMXA 3FFAA 4GBJA 3EZLA 5F77A 2FFQA 1T4BA 5LCWJ 2AI3A 4NV1A 2VGXB 4PAOA 1TNYA 5KHLB 2PGIA 5SICE 3OTOB 2IBTA 1ISMA 4PN3A 5LMZA 3TGWA 2HJHA 4C0EA 1I9CA 3LUHA 1XUOA 3BMQA 4JXTA 3R3HA 1GTSA 2O1WA 2QG9A 3AF0A 1NOKA 3M81A 2FEWB 3MRSA 4GOXA 2D00A 3CUWA 4IHKA 4BQPA 2R1VA 4WWNA 3DTVB 5BR4A 1DPFA 1S89A 2IOHA 2OGTA 1KOJA 3SKVA 1EA7A 2WXMA 3P1UA 3QJYA 4BMZA 4E07A 3DMTC 3AKYA 3K6SA 4Q7JB 3KZXA 2CHWA 1DKUA 1YVUA 3OJXA 3WL6A 3JXIA 1HRKA 4AF8A 4DL9A 1EDUA 3LP6A 2K4NA 1A50B 4TN5A 1UKZA 1ZJYA 4WERA 4HPJB 1OV6A 4WGGA 1JEEA 4RZQA 1UR5A 2ZZKA 1N8KA 4ZFNA 4INOA 4NU8X 3C3PA 3H5RA 1OIWA 4B35A 5LWHA 2JBAB 2WMNB 4YDQA 2L82A 2FSFA 1UJMA 5DYYA 4ON9A 1KARA 1M33A 4YNDA 4ENRA 2JEZA 3CEHA 4KYOB 4ND6A 3M34A 5AW7A 4EYGA 2C3UA 2W22A 4XWOA 3RJMA 4Q1CA 3V48A 1BE1A 4GLJA 1B8OA 1G6KA 4K5QA 2UZ1B 1S9HA 3OLQA 3VKHA 3G02A 4JUFA 4KDFA 3DPSA 3JQBC 4G41A 1GW6A 1GTVA 1XKLA 3WGNA 3TJMA 3DVAA 1QIMA 3S81A 1ODSA 3FETA 1HDZA 1W94A 5DI3A 1DRWA 4EBFA 3FDZA 2GCPA 2MSEB 1UDAA 2WXGA 3EAFA 4PX5A 4MMZB 4MUXA 5KTRA 4RTRA 1EVZA 4TXJA 4S1VA 3LWBA 1UZNA 4B6GA 3A37A 4BXOA 2BJVA 5CMWA 2UYCA 3F9IA 3WYBA 4DYDA 2YZNA 2QRZA 3CB4A 3S55A 3HXEA 4E03A 5JNSA 3ZN2A 3AVWA 2GYVA 2D7CA 1GQSA 3HYCA 4FJ1A 2FPGB 5FPYA 4WLUA 5KOIA 3V4FA 2QTVB 3IAS6 4Z8XA 2Z5LA 1UAAA 3D59A 1SRQA 5FNVB 1KPHA 2W93A 5CM2Z 3JD1A 4YDYA 3UGQA 3VAAA 4J0EA 4LJKA 3FY4A 3CK7A 4MIEA 4OQYA 4CR8A 2DWQA 4W82A 1FFXB 4HAWA 4E33A 2OV8A 2P6PA 4MGKR 3FULA 3L4EA 3HDGA 1W46A 1BDMA 2P75A 1NYQA 2VDQB 1Y4UA 1JZQA 2ZXUA 2P91A 3UWOA 4P08A 1QFSA 1RQ7A 4DDKA 2JIDA 4TN1A 1W85B 3Q7AA 3HVRA 1E64A 1XTTA 3BQNB 1P45A 2IHTA 3W5DA 3F6YA 1Y5RA 2V7VA 4Q7QA 2W9JA 1DWPA 3SVZA 4HRLA 4G0OA 3S1AA 3N5CA 3KYDB 4LX8A 1Y7TA 3C43A 3JR7A 3MPOA 1U3WA 4H35A 4NOLA 4EFLA 1E8WA 2FW1A 1XCGB 2FU5C 1U7UA 1CUAA 3UIPC 2HB6A 4EKIA 4BMOB 1HK7A 2VGXA 5GONF 3OP1A 4JLVA 1Z5UA 3X1YA 2YNQA 3VPDA 4RHTA 5KB3A 1JE1A 4KUEA 4EA6A 1C8VB 2O8FB 5JU6A 3AUKA 3RO3A 4Q9HA 2GXQA 1W75A 4G65A 3C85A 4B7ZA 1Z56C 3OMWA 1YZTA 3WJ1A 2IELA 5E8JA 3DTVA 1BI7B 4EGFA 1C7QA 4EW6A 2J41A 3FUJA 1PN3A 1X14A 4O0LA 4YR7A 5CB8A 5GV8A 3IUYA 4MRVA 2J4CA 3CHYA 4QBFA 4PBSA 3F97A 3LD9A 3V1YA 4FJ2A 5BT9A 4GQBA 3TIXB 2YQZA 4RVBA 4YO8A 3OI7A 1QIEA 1ZNXA 1A8PA 1THGA 1XTRA 1ULBA 1KK0A 1XFDA 3PWTA 1E3WB 4IEIA 4JYZA 2OK7A 1EUZA 5BWCA 4WKGA 3I9LA 1CPYA 1QYCA 1YR3A 1G6Q1 5FTKA 2R1UA 2WMNA 3MMZA 3QHAA 4NKRA 2P69A 4GUAA 4BNXA 1X39A 1N2GA 2WG0A 4WWOA 2EBWA 5LOVA 2VJYA 4FKZA 2GROB 2MWMA 4ARAA 1Q1GA 3ZD6A 5C7YA 4NFHA 4QNMA 2OFWA 1JH9A 3G6WA 1N7JA 4UM5A 5JCOA 2R6R1 4YXWA 1AK1A 3CQ9A 3C6QA 5ILOA 1JWAB 2C4VA 4I4NA 1DELA 3ZV5A 4DEXA 1WDTA 2OE2A 2VNAA 6NULA 1T9DA 2NVUB 1V8ZA 1IY1A 2YFQA 2BKEA 2R8EA 3N2GB 3CVOA 3NTLA 4QBHA 1TCCA 1Y3BE 4ND2A 5BPFA 2A1UB 3RIYA 5CAEB 1QQ7A 4GNKA 4M2LA 3W3AH 1ZR4A 3DLTA 2B8TA 2WYWA 5BUCA 3AJRA 1I2DA 3E8MA 2C03A 2P4UA 2J3KA 3MBIA 2Z8ZA 2R1ZA 4RMIA 3ZXXA 4DOMA 1M5TA 1NFRA 3IAFA 3WYNA 5LJLA 1WAO1 1D9ZA 2CD7A 3AG5A 1Z3XA 4TKUB 2GJSA 1Q0HA 2FPGA 3KT3A 3AS8A 5A02A 4ZZ0A 4QDXA 1DLJA 1JHXA 1JMKC 5FNVA 3OIYA 4LYGA 1SCJA 1UP7A 1J8FA 3P32A 4Q7MB 3HH8A 3B2QA 1CEYA 2UUBB 3RGWS 4MUBA 1N92A 4E2FA 5D3MB 4K5AB 3U64A 4K9PA 4ZCIA 1D2AA 3J81k 4DTIA 4IDBA 3HWWA 1FFXA 4YB8A 3FDIA 2HKIA 5KYVA 1C4WA 1BWSA 3Q8KA 4R7TA 4KPFC 2RG1A 1OZ0A 4HTFA 3O8OB 4A1FA 2NNLD 3EW9A 3EZ7A 4C04A 1POXA 3R5HA 4W5NA 1UFQA 2P30A 4EKDA 1QYXA 1W85A 1YZ3A 5EPOA 4MKFA 2MOKA 4BMXA 1U5BB 2IXDA 1MZPA 3FTQA 1T3SA 5AIAA 4NULA 3FOEC 1PP4A 4HFGA 3ONVA 3KYDA 5C1IA 1JEQB 1OFTA 4FYHA 2PH5A 3NBAA 2BONA 3FD8A 4N5LA 4UNQA 3PR1A 1TT5B 3BZWA 4TSFD 3ZTYA 2OENG 2VZLA 2CUTA 5JMTA 2Q6LA 3H05A 2Q3CA 3HLYA 4BX8A 4IOMA 3S2GA 1Q7GA 3KSMA 4JW1A 2V6BA 3FH8A 2IDKA 2B3TA 1OH6A 4XSHA 4OMUA 1K3FA 3NDIA 2HZBA 3G0GA 3HDJA 5CECB 1LC3A 1J23A 3RK6A 1NOIA 1RPAA 2PPLA 4B2PA 4V0OA 4N76A 4FYIA 4HS2A 3A1VA 1ZH2A 3KJGA 4KUGA 5ALIA 2CUZA 2IE8A 4YMIA 2PZFA 4YMVA 4OI0A 4KAFA 1PNVA 1Z26A 1NI1A 4XUCA 3BORA 1H6KA 4MARA 4R3NA 1NL3A 3SFZA 2Q07A 3WHPA 2XZTG 1J22A 1N8TA 4BFYA 4MIOA 4QWMA 5EG5A 4M9QA 3KUCA 2QVGA 5CMLA 2E55A 1U9IC 3ADCA 2IO2C 5HCNA 4F93B 3MC1A 1XKTA 1YYHA 2EKLA 3PVZA 3GNQA 1T4MA 3ZLBA 1E3WA 4PAGA 2AJTA 1XZDA 3LPNA 1NBHA 1VG9B 5ICGA 2YQ8A 5A5EA 1AQIA 2MMGA 5IFLA 1SC4A 3C3XA 4HWTA 1HDCA 1X7ZB 4ZOLA 1OSNA 4V1CB 3OOJA 2CFRA 1SELA 2AJCA 1AO3A 2P9NG 1ZI8A 1Q6YA 5C1OA 3FJOA 4ND7A 4B89A 2KXPC 5EJAA 4CU2A 1U7ZA 5ILQA 4ZK6A 3HEMA 2LW7A 3ICCA 4FMCB 4ZA2A 3M9XA 3U2QA 2EXXA 2ODAA 1KMCA 5K3AA 4C0BA 3PHHA 5JJLA 2A1UA 4RK0A 5J5CA 2JL1A 5CAEA 4D41A 1RKQA 3DEPA 2A88A 4J7XA 1EG7A 2ZJ2A 4PLHA 3JQRA 4AY6A 3WKAA 5JXHA 1XRSB 1GNLA 4Y9TA 5IC4A 1U8ZA 1USVA 1XPJA 4ZDJA 1YJBA 1KZ1A 8ABPA 3R5JA 2EFYA 1GOTA 4F3TA 5D7NA 2PX5A 2IYEA 4GGPA 3EHDA 2PQ2A 4LUCA 3EAQA 1XU9A 1RJWA 3WL8A 5DNUA 3ADDA 2X2FA 3F8SA 4YUYA 1GGVA 3HKBA 3ZLUA 3LX5A 5AW4A 4H7DA 1KK1A 4GKJB 1OZFA 3PXAA 2P78A 5A7DB 2FWPA 4HS9A 4L4ZA 3KE9A 2YFKA 4K26A 3WLSA 3VDMA 5D3MA 1MQAA 2PUWA 2GRMA 1ZDMA 1FP7A 4QOHA 3GXBA 1QFYA 4ARZB 3D4PA 2K6GA 1WWKA 2ILRA 1O9BA 4NZZA 4JHXA 4WESA 2FUNB 1RHRA 3HFJA 1ATIA 4FS3A 4ND1A 1NY6A 1IULA 1PKEA 4I5IA 1GTG1 3O8OA 4MYUA 4US0R 1JB1A 1QGYA 5AN8A 2CJWB 3HBNA 3EUVA 4HLQB 1ZOPA 1U5BA 4UYJA 4RX1A 2OWDA 2Y3IA 3HA3A 5T4YA 3H5LA 4Z9XA 1TYQG 4L78A 3PL1A 1C3XA 1TO2E 1EVEA 3O95A 4HNVA 1JEQA 4G89A 2NG1A 4WLEA 4EPYA 3BRCA 1N0RA 2EFJA 4EO9A 4DA4A 5SY4A 4WNCA 1N0HA 1Q1QA 4ZIRB 1TT5A 2JH9A 1VE1A 1ZIOA 3WOHA 1R6VA 4DUGA 4N3BA 3E18A 1P2UA 2BT4A 4Q4JB 3K4PA 3Q6MA 1RIFA 4BEVA 1U7IA 3EY4A 1E3IA 5CGZA 4AG6A 2ERCA 4KE8A 1NC3A 1U2TA 2R05A 4OKNA 1PEYA 3K30A 5CXQA 4BLSA 1TJPB 2NNWB 3VAZA 1CRWG 3ESKA 4C48B 2ATIA 4XQEA 2LR0A 1T3ZA 3NRCA 2ZWOA 3HBLA 4F2GA 5T4BA 1NI5A 5A5GA 3DEZA 4IIHA 3MOIA 3WGYA 4D9NA 2FOLA 5K5EA 2FEOA 5BW8A 1N2ZA 1B3BA 2C61A 4L8LA 3EF1A 2VPXA 3H2JA 2SKEA 4KR3A 3RSZA 5JRDS 3FFLA 2NT3A 2YOFA 3IEGA 5FL7D 1X94A 2QR2A 1K06A 4I2VA 3LY9A 4K9OA 4FHFA 1QIJA 3OZIA 4KVAA 2YWBA 1X8XA 3DNMA 4ZI2A 4OK5A 3RUDA 4O4IB 1YC5A 3RRNB 2KM4A 3KUDA 3CKMA 3ONLA 3G7SA 3CVVA 1BA3A 1NF2A 3PNVA 4MW5A 3UJAA 2RGNA 4NV3A 1KMQA 3SQLA 5ALXA 2C4NA 3OJLA 1OX4B 1PZFA 2EJCA 4JUIA 1ZSNA 4QUIA 5IJ9B 4TLMB 3PQDA 4KKVA 3EHMA 3A2MA 5IF9A 3KSUA 1HFJA 3EHNA 2WU0A 4WPGA 1M1YA 4AFNA 2ZI4A 3QM1A 4INJA 3Q7PA 1FPMA 1X7ZA 1KS9A 4V1CA 5J2UF 2BFDB 3PCRB 2RHOA 3R0VA 1O5MA 1VFNA 4NATA 3ZYMA 1M6NA 4N1AA 1W7AA 4KITB 3LKUA 3ZV7A 2WQHA 1GARA 4JLSA 1YS4A 2CF6A 5CHEA 4TUUA 1I3OA 2NT4A 2HA5A 2XUQA 3CINA 4HFRA 1BGWA 4NCBA 1WNFA 1E0JA 1NX9A 1VCMA 3QIVA 3DE2X 4DSNA 1RMYA 3L54A 2OZEA 3KSAC 2JEOA 1R3DA 3LVQE 2IX9A 3FWNA 3ISTA 4MLPA 3RSOA 2VQDA 5LZ9A 3R6WA 1Q6ZA 4MROA 4R8VA 4I4TB 1K63A 1FUIA 4N0DA 1JSCA 3NWJA 2EJVA 2BFEA 4G6ZA 3F1KA 4RDCA 1MT3A 4M38A 1CY6A 3ZHUA 4QFCA 2PD4A 1XTQA 5U1PA 1U2VG 2CC2A 1HG1A 3F3YA 3G1TA 2KLBA 1UN8A 2JHCA 4Y6CA 1S8FA 3D3JA 3DVRX 3WMFA 3I9KA 4BGUA 1ICEA 2K7ZA 4QDJA 4M7CA 4D9JA 5KNCD 2QUHA 2J6IA 4CODB 5IEJA 1IN5A 2H52A 2RGYA 3DLBA 1WXHA 2BKVA 2SNIE 3G13A 4QTTB 3LHIA 1D8EA 5KKCA 4DQXA 3JXJA 3BJRA 5JYEA 1O58A 1NV9A 4AP5A 3W0LB 2B0CA 3MF4A 3UPVA 3LC2O 4GO1A 3CHPA 2JIMA 1WB4A 1OIXA 5KVSA 4I1PA 4JP5A 3OFSA 5D0QD 4ZALA 2GSWA 4EELA 1FT2A 4L9AA 3ICOA 1K75A 1COWD 3PBKA 4OLHA 3LKVA 2CJWA 2JK1A 3IMCA 3D2AA 1I3MA 4DCPA 4GIBA 3WGVA 1DHTA 3ZIUA 4IQFA 1K88A 3T3EA 4JBXA 4D8VA 4P35A 2AIRA 2GCNA 1E63A 3RUIA 4TRNA 3BFVA 4BP8A 1LUAA 2I7CA 4ZV4A 3GLTA 3U3JA 3F90A 3L43A 2G04A 4ZT2A 1SKAA 4CKXA 2CHXA 1Z29A 2O8CA 2ZB2A 2BEJA 2E4WA 4ZIRA 4I8IA 1MP0A 1KZ6A 1CQJB 3C8HA 4D4HA 3BS4A 2OZLB 4Q4JA 2GM9A 4CDMA 3PA6A 2RKWA 3FAKA 5AJZA 2NC9A 1FFEA 1ZN9A 2R6FA 4CKCA 3WFIA 4PHFA 1XU4A 1NJ8A 4K6CA 1QRTA 3LKDA 2GO1A 4JLOA 4NJEA 3QI7A 4MCIA 1E69A 3PNQA 4XIFA 1DCTA 3I58A 4RETA 5KX5A 4QXPA 4Y6QA 2WA1A 2GCGA 2LE0A 2KS6A 3D9QX 2QN1A 1CIVA 3ZZMA 4JFRA 2LTAA 1NP3A 1EGHA 4GMRA 4U4AA 1N5MA 2XUKA 2QVBA 5GPBA 3FYHA 3J5PA 3E15A 3OXLA 4Q7EA 4LW8A 1EEXB 3F49S 2RGXA 3QVXA 2YYZA 3KPVA 4O4IA 2PL5A 2UYYA 2BD0A 3A31A 3STWA 3HJHA 3RRNA 3HBAA 2ZJ5A 2DFLA 2V7WA 2X0NA 4RCZA 3EX7C 3AWDA 1NW7A 1JLLB 2FFJA 3Q7EA 4MI1A 3AI2A 5A6SA 1OCRE 2AD5A 2NU9B 3TBKA 3BERA 2ZBRA 3ZVNA 7MDHA 5H4GA 1PJ2A 1CUXA 3DT9A 1P1IA 3KR0A 1LK5A 1V4VA 3VUFA 5ETJA 3Q0TA 2J32A 3OQBA 1J5XA 3D2BA 5FI3A 4RH3A 4JK3A 5D6NA 5HRAA 1LJLA 2D7DA 1L7NA 3VR5H 4B76A 1VHTA 3B38A 1HO3A 2ETBA 4C3OB 1HG2A 3PUWA 2J4FA 2EIKE 2XODA 3GMIA 2XCLA 1J9ZA 4ISCA 1EFRD 4FULA 3GLFB 2DFDA 3B9PA 4YP7A 3E53A 3LUAA 4AJ4A 4E2XA 1F0YA 5ALPA 3CLJA 5KTPA 3QEBZ 1ZLXA 4BEBA 4I4TA 4ER3A 1YMQA 3D8NA 3WWDA 1UEJA 5IH7A 4QPNA 4JI1B 3L6AA 3M1IA 2DWZA 2TMKA 4Z4EA 3T35A 3TZCA 4MP6A 1PBTA 2XCTB 3KAJA 4QQNA 4PZPA 3HFRA 2IWHA 3IMKA 3PE3A 2AXNA 3ODGA 4Z3DA 2RJ3A 3QXXA 3AHCA 2AFIB 3A2LA 3AJ9A 3AVOA 3ENEA 3IBTA 3H87A 1DCQA 1W6RA 2ZSUA 1IIBA 4AJLA 3GXOA 2G9VA 3IQDB 3ZIAA 2WE7A 3TGOA 3WGGA 3TL2A 2ZIFA 1I7PA 2C3OA 1NUPA 4D5EA 5IT5A 3ONKA 3UNXA 5E6SA 3DE1X 3DQQA 3E84A 4G5GA 3TXNA 1U02A 4JUCA 2NZXA 3NXSA 4DJAA 2I91A 1V2GA 4W5QA 2NUAB 2Y4TA 4H7KA 1JZTA 1T9ZA 4DFDA 4N5MA 4ZAXA 4Q7KA 1RBQA 2Z5VA 3JYSA 1RE0A 4YAIA 4J03A 4IGIA 1B7GO 2XQIA 1OGIA 1R00A 4KX3A 4O08A 1XEXB 4MVJF 4PNZA 3HP4A 1XZNA 2YY5A 4DMGA 5C3UA 1VL6A 1CXZA 3ELBA 3EQ2A 4QYWA 1GCGA 3FUEA 2BHTA 1X7XB 3LQ2A 2H5LA 2QG4A 2BKKB 4FDLA 4AAYA 3CLKA 5KBYA 4RTKA 4FP7A 1NE7A 1O96B 1WG0A 4I8XA 1LXCA 4RWZA 1TKBA 2D74A 4PRLA 1BDBA 2Y0BG 3U1BA 3GHYA 5EP3A 1CQJA 2XQKA 3NOVA 2OZLA 3I62A 2EZUA 1JXQA 2C9YA 1BH2A 2I9KA 3HR7A 5EKDA 4KAJA 2X8WA 3PNMA 5E7MA 2EERA 3B53X 1N6RA 5T6BA 1X7YA 5HDBB 4HG2A 1A82A 4FYJA 3FSRA 3W6UA 4FEYA 2RB5A 4DEYA 4YECA 1R18A 4F8YA 1H22A 2YMMA 4R7ZA 1OAKA 5BNTA 5H5JA 1KOLA 1QP0A 3QJGA 2PZJA 3MX3A 4HAVA 3W5BA 3NIDB 4WKPA 3ELYA 4F53A 5CB4F 3ESXA 5IVDA 1SC9A 4JJ4A 2QL7A 1E66A 3AYXB 4WNEA 4ES6A 1CY2A 3GBSA 2JLXA 3CB2A 5A4IS 1N5IA 1GVHA 1YVDA 4P83A 4WZBB 3AR3A 3M0EA 2BE7A 3KJIA 3N6XA 3DLIA 1ZICA 3RIBA 1BQ4A 3LI2A 1UT5A 1SUDA 3MJSA 3MS4A 1KC1A 4D56A 4GTTA 2RI1A 3G2MA 1QYRA 3KJQA 2W8ZA 4O63O 5K0LA 1SHUX 2H3EA 2UZAA 3CEAA 1P8JA 4V0QA 2WXRA 1X1AA 3OCWA 4BFVA 3KOUA 4JUBA 2ODNA 3RVBA 3WDLA 1N7IA 1VI2A 4RSHA 2VJPA 3B20A 1XLTC 3IMEA 2ZT6A 2RHRA 5EJIA 4MYCA 5ENDA 1XMVA 5TS3A 1Y4SA 2BR3A 4P22A 4RVFA 1W87A 1Z6YA 3Q75A 5L7TA 3DMGA 2ZXEA 2VYVD 3EFEA 5TLSA 1Y34E 5G53C 1TRKA 1RRKA 2UUAB 3HJGA 4S1TA 3LLSA 1SZPA 4EQFA 4FK8A 3OAWA 2GRAA 2UZ0A 4IRUA 3OE7D 4C4TA 5EJMA 3OLZA 4R1SA 4KSBA 2BISA 5D5HA 4IIEA 1XDUA 3U4QB 4MYHA 1VIVA 1KDRA 4A0GA 2VEDA 4KCGA 4MLZA 3FGPA 4KQ2A 3GP8A 2ZSJA 2IU1A 3M8KA 4ZZIA 3ZQ6A 1A4RA 4RZHA 1E99A 1UQRA 3A9WA 2XLCA 1QCCA 2ZUBA 3PDWA 2AFIA 1BXRB 3GCGA 4NX2A 5T4FA 4CEJA 1OFUX 4IEEA 1PJLA 1TAHA 3R3JA 1X86B 4PLGA 4IEFB 4HRNA 1V2HE 4R6WA 5I7OA 1KDPA 1IOZA 2BV3A 2VHYA 1XJWA 5EHNA 3WGQA 1ZEMA 3CRW1 3LBAA 3V9PA 1JEDA 1KU6A 3HXKA 4CN8A 3B52X 5F5LA 1VJ1A 3OU2A 3EC7A 2QY7A 3R40A 2CVOA 2NUAA 3CX6A 2G9RA 3SHFA 1WW3A 3QELB 3L4BA 1PR9A 1SUEA 3ZZ0A 2WG2A 5FO1A 3TQSA 4N03A 2C5AA 2DPLA 2BI8A 4CQJA 2AOVA 1UP4A 3A4IA 4PGMA 2IYXA 3RADC 1DWUA 3WWZA 5KO2A 2Q3DA 1CUFA 1AHHA 1Q2ZA 2WFLA 3FBTA 3NTUA 2ZE5A 5MHTA 1NVAA 3GJQA 5I7HA 3GK3A 3AEYA 1L3IA 4UU1A 1O96A 5K0TA 2VK2A 1F8FA 4OGLA 2P41A 3EPJA 3TIFA 2FWMX 3OU6A 1JXMA 4IXTA 4BC0A 5T5QA 4GKBA 4ZZ3A 3KV3O 3ZTTA 3QFSA 3EXIA 1E59A 3MMNA 3FHCB 1WXFA 2ZETA 3NHYA 3EE6A 2F8MA 2Q5HA 4A10A 2GETA 4JSYA 3SG0A 5I47A 2YJGA 5EJ7A 2NUTA 1S5PA 1AD2A 1D8AA 3V2GA 1Q91A 4QTZA 3IIIA 4OQMA 5M29A 4R31A 2XUHA 4RQIA 1NXPA 2C0CA 1Y33E 2XS8A 4KQCA 4TL7A 4EI7A 5IUJC 3BWVA 2UUPA 4PS1A 2ZU0C 4S1PA 3ZE7A 4AUNA 1P7YA 1J0BA 3TVDA 4WZBA 3CU5A 4HZIA 3C7DB 5AQEA 1EUDB 5GY7A 4ASUD 2OP0A 3UQYS 1E6KA 1QVAA 2I71A 3R9KA 5A4DA 1OXBB 1XB2A 1GPNA 3RSCA 1G17A 3HKDA 5ENSD 4PCVA 4R2KA 1UN9A 1T29A 5DTRA 3ZD7A 3PITA 3ZVRA 3G2SA 1E2EA 2G1KA 3W3ZB 1GL7A 4NBRA 1VDMA 2HWKA 4NLLA 3W9UA 2XUIA 2OLKA 3HCEA 1JG3A 3VXKA 4GZLA 4GM0A 2DY0A 1DXQA 2GNPA 5LU9A 4JLDA 2IFTA 2FZEA 2QT0A 2IW1A 1OPXA 4HXYA 4JVOA 5DCYA 1YCFA 5KINB 3QMWA 1SK9A 1A0OA 3EEYA 4IICA 1CFJA 1QH9A 1OGJA 2VHUA 4YDEA 3GAFA 3L6UA 3GUCA 1N0UA 3GT0A 3HCBA 1XVAA 3COYA 1SCUB 5IULC 1JKXA 2PH1A 2QD2A 4NFYA 3O7MA 3UA3A 4F11A 2G9QA 1WY7A 4KIJA 1FZTA 1LZKA 2GRQB 3V2XA 1XMPA 2D2VA 1JT2A 1XMSA 3HB1A 1R5NA 1OREA 3CZRA 4M98A 1ISRA 2I78A 2VDNB 1ZK1A 3PZ2A 2ATVA 4Q1VA 4H7FA 4FMDF 3WK8A 3IO5A 4B4UA 4QTXA 3TNYA 1RZ3A 3D9IA 1WZCA 4KMOA 5HS4A 1J2YA 1PHRA 3KR1A 2XMBA 3T7IA 3VOAA 2ZSFA 4JDUA 3GLGB 2WJGA 4MV7A 1H2HA 3FPBA 1JWGA 3PDUA 4H1UA 2R6HA 3D6HA 4Q47A 2H85A 3E32A 1N0QA 1CWUA 3OTIA 3LA8A 1JJVA 4TZTA 2PKQP 5M5BA 5AVRA 2X0KA 3MTAA 5IVPA 4J0FA 1XYVA 1FX0B 3OX3A 5TPZA 1BMDA 3HXDA 3UPTA 3AG4E 2Q2WA 1E2GA 2PANA 4JBGA 2ZJ8A 3B78A 5BRAA 2WNSA 3U56A 1U98A 1OASA 3PPIA 4RPLA 2WB2A 3FFWA 5JHGB 2CXTA 2PXAA 2JDID 3QG5A 1KDOA 3IOYA 5DH9A 1G98A 4CGYA 3KC2A 3THXA 2OV4A 2MT9A 1H2BA 1PNQA 3W1WA 4Z2YA 4HSEA 2ZT7A 1H94A 3OCXA 2IV3A 5D6OA 2Y0PA 2ZIZA 1RXWA 1Y8QA 4GPZA 4CJXA 4M1YA 4TYWA 1RLMA 1TEZA 1Z0SA 1I30A 5K0JA 3ZHBA 4RKEA 3SEAA 3GU3A 2G36A 4AWBA 4DKXA 3T7SA 3L7CA 3VZSA 3A1SA 2CSUA 1JF8A 1FPPA 4H15A 5CFRA 5IN4A 4XD7D 1CIJA 5JYDA 4I1OB 1PSWA 2ASVA 1L9KA 3BYZA 3K5PA 2D1TA 2DKFA 3HDXA 2F62A 5JSHA 3N3BC 5THQA 4OGGA 2OPHA 3GGSA 1NYRA 1DG3A 3E3MA 2IYQA 3O3MB 2J5BA 1EYZA 1AO0A 2QLMA 1D2NA 5KJMA 1BQ3A 1PL7A 2VATA 3V4OA 1O89A 1E1DA 3RRXA 4JWTA 1A5EA 2OXRA 1P2GA 2YQ4A 4G56A 4DANA 4DRYA 4HYQA 4CKWA 4E4RA 3PF9A 5TV2A 4FW8A 1TPZA 3FWYA 4EVRA 4LAFA 4MV6A 3K1JA 3GLIE 3T9DA 3TOVA 3SYNA 4JITA 5B1YA 1WF6A 2HCRA 3U6BA 1ZBPA 2CNBA 4OQ4A 4QBIA 2GZ2A 5K0SA 3P20A 3KR9A 1IEWA 4DZTA 5K9ZA 4OHVA 1U04A 5JC1A 4NV0A 5AJWA 3BEEA 2VKQA 4OL9A 1SZAA 4KFSA 1VG8A 2VHVA 2B1JA 4E7OA 1APBA 1RCUA 1SOAA 1XJQA 2WUWE 2QQFA 4JEHA 5EFZA 4Q6BA 2OORC 2H11A 4RULA 2RFAA 5LQMA 1W36C 2FPMA 2NGRA 4HZUA 1F0PA 4QXOA 4LRSB 2XZTA 5G4LA 2C4TA 3E9ZA 3RSQA 4MR9B 2P68A 4XJSA 1BJKA 4MYSA 2J07A 4WRRA 4HB4A 5K3SA 3PDNA 2DFVA 3GUZA 2OXEA 2I4OA 5CU7A 4RLYA 2QSYA 2XF8A 3S7ZA 2NXJA 3PX3A 4DRXB 4M0LA 2CHQA 4ZJZA 3VPHA 1PT9A 1N1DA 2DPYA 3QPAA 3OURA 3K09A 4W1PA 5CEJA 2Y8EA 4DC0A 2VZEA 1K5DA 2NYVA 1IH8A 3H5WA 5CNIA 3EHQA 4EA9A 5CM8B 1UK9A 3GLHB 1SCUA 4EJSA 4B7XA 3KJHA 2CL7X 5KBAA 4JLUA 3L04A 2IEAA 2ZIGA 4IIDA 3GELA 3RVRA 2VP3A 1B3RA 1KKUA 1F3LA 3ESAA 1HXHA 3NZSA 4ZREA 1IMOA 3LNTA 3COJA 1V47A 1QFMA 1PR1A 1LS1A 1WUJS 1GPH1 1JKJB 4ROSA 2V7TA 4W9RA 4YXFA 2WRZA 3PQFA 4YT5A 3QE4A 4FBLA 4HX5A 5DNEA 5C8YF 1ODKA 3M6AA 2C0MA 5JAHA 4Y6WA 4G5YA 1LDYA 1CRZA 5FTNA 4KBQA 5DPMA 4FEEA 3WA6A 2P9JA 1W4ZA 2OBMA 1XCBA 1FFSA 1O4WA 3P8ZA 1WDYA 3Q6NA 4TKVB 2XOKD 1RKVA 4PH4B 2H9AA 4LXUA 2V65A 1E2MA 4X71A 3K0EA 4CVNA 3HUTA 1EXWA 2AF3C 5L8VA 4P0TA 5TVKA 1SBYA 1XZCA 5AICA 2G5CA 5IBRA 4BO3A 3ZGQA 5AK4A 4UNIA 1JJAA 1P75A 5DYNA 4KE9A 4XVRA 4MV1A 2KHZA 2ZUVA 2OTCA 5KNDH 1YB6A 2Z43A 5SV2A 3CEJA 4YMTA 1AVTA 5CRIA 2BFMA 5CT5A 3KT8A 2C99A 4M87A 4ZMBA 2JLVA 1BMQA 2CDAA 3GJSA 5KOJB 3PT5A 2ES4A 3D4LA 3HFGA 2JS7A 3WLFA 5KMGA 3KNZA 3RUAA 4LNAA 1PAQA 3ASDA 2WC1A 1YD7A 3O73A 5FBKA 3VSCA 3EBLA 4CM4B 3O1LA 4CM8B 4NCJA 3AHJA 2YDYA 1KVQA 2NVBA 1GM5A 4JP3A 3F78A 5A1TA 1B0ZA 4Y0NA 1N5DA 1BXZA 5AHOA 1TA9A 2A5DA 3Q9UC 1XRLA 3LWNA 1SK8A 4NCXA 3BRQA 3AU4A 2PUAA 5EHIA 3KHSA 2Y4OA 5K8CA 2ORWA 3OT1B 4HDMB 2PRZA 3DWFA 4FD3A 1F3OA 1QS0B 2HK6A 3PPVA 5CW2A 4L5BA 5AOXB 2A59A 2I1KA 4GBED 1I0LA 4G5HA 4EB0A 2EKBA 4Q4AB 4BNZA 3DOIA 4DC1A 4EG3A 2GF9A 4ECEA 3EGCA 1FIUA 1KDZA 4QPZA 3WK9A 2O0HA 5I4CA 4R05A 3IJRA 2NXCA 3VNUA 5D01A 2R5FA 4F85A 1JN0A 2HI0A 1XRRA 1QG2A 3WRYC 1Z36A 4BFLA 4ZYZA 2ZBPA 2CKDA 2R87A 3LEWA 1E3EA 3FRHA 5K0BA 2XUOA 4KMMA 2RGRA 3SJ7A 5HZGA 2B6HA 1GQYA 3WZ2A 1OA0A 3VLFA 1PR2A 2BFFB 4IDAA 1Q77A 3LDAA 1I2MA 4C4RA 3G9TA 2J9QA 3WXBA 4X1IB 1USKA 5CH8A 3DFKA 1CRLA 1N4RA 1P4RA 4M0UA 2HHAA 5TX7A 4RPJA 3PIIA 1DAPA 3FPLA 1MEJA 1TLFA 4H7EA 4YFVA 4ZCMA 3OFNA 2QD5A 3MJFA 3UI2A 3LXUX 4OQQA 4Q9AA 3JVUA 2OSVA 4C14A 3FKSA 2GD2A 4MR9A 4ACBA 3P2EA 2WJAA 1KOFA 2RARA 4DA0A 4E6PA 2EZ4A 2NLOA 2BFAA 2OAP1 4C1NA 2RAPA 3HUEA 4OIFA 2QPAA 4DRXA 5KYGA 3JQ0A 1ZK2A 3QWWA 3D4OA 3CUSA 3HVIA 1HDIA 1HO8A 4GD3Q 3UCEA 2IY9A 4O33A 4DI3A 3WRWA 2UZIR 3E3LA 4B2YA 2Y3AA 3GJXC 4BFCA 3L8MA 1QRSA 3GLHA 3F73A 3QX7A 2DTEA 4IDNA 5LSAA 3LT1A 3SJCA 4RVDA 2XR1A 1B1CA 2CLKB 5GZ6A 1JCSA 1Y9DA 4BTEA 1O5TA 4I3FA 4TWZA 2C20A 3BTUA 1E2DA 1JKJA 4MUYA 3CF4G 5BWNA 2QM0A 3HXTA 2HSWA 5K3EA 3VVCA 4P3YA 1IATA 1IBSA 3U3RA 1RYYA 3PVSA 2HC9A 4OQFA 4KQ6A 2WJ4A 2JBAA 2LSVA 3AJDA 2BTQB 5AJVB 3HB9A 2B20A 5K0GA 1GN9A 4MTLA 4E21A 1UPAA 1MORA 1ZO8A 4TKVA 4NG5A 5AJTA 1CEQA 4WXRA 3S7DA 5AMXA 3PYMA 1D5CA 1JHVA 4WD3A 1IYZA 2ZRPA 3Q6IA 2V45A 2UZ1A 1RQXA 2FQYA 2VXOA 4HT3B 3CGWA 2HU5A 3ASGA 1QVWA 3ZDFA 1LU9A 2W6OA 3CLTD 5MGBA 1Z0JA 5FWNA 3RAGA 2PUJA 4IY1A 5KOJA 4G4SO 3DQZA 2CSXA 2G76A 1ZRHA 3ENZA 1Q74A 3L6EA 4NK5A 4RD6A 4JENA 3AXSA 4J0CA 4LE1A 1ESZA 3E6AA 4LPKA 4J0QA 3I6QA 1GRVA 1KH2A 1VTKA 2R02A 4E22A 4CM8A 1Z82A 1RYDA 3R9XB 4D9KA 2Z9CA 1G16A 4ENWA 3GD5A 1ZIDA 4D0SA 3SEQA 2G7MC 3IR6A 2PMDA 4G01B 2HK8A 4O2LA 2H08A 5JWHA 3RTBA 2JLWA 1TM7E 4X8OA 3I6ZA 3T7EA 2B9VA 2J45A 4LQDA 2QTVA 4YJKA 4YI5A 2XZPA 5HZHA 2QQ0A 4QJ4A 2BN4A 2BM0A 5EE3A 1YF3A 2YRFA 3PD7A 1QS0A 1ZJ4A 2VT6A 2LXNA 4C0WA 5G05C 2CWDA 3RTDA 1CHDA 2FN9A 3C8MA 2PX6A 2JJYA 1Z73A 1ZD5A 2Y1LE 2BCJQ 4J75A 4D6YA 2YHAA 1N0VC 4TQUS 4MIKA 1EUQA 2YMQA 3DV0B 4RPHA 1QQ6A 1RRMA 1E8XA 3FAZA 3G1UA 2OQIA 4OGFA 1Y9AA 1Y7HA 3EQZA 3R6LA 4WNIA 2SICE 3D8HA 5JROA 1UZUA 2JCXA 2BCGY 4L51A 1P1RA 4HEQA 2ONDA 3T5TA 1HMYA 4QECA 2BZ0A 1M9NA 4OJKA 4IYJA 1Y7IA 4RK4A 5CDFE 3ZBQA 1MAUA 4Y6LA 4A6DA 3H9QA 4IPTA 4PO1A 3K70C 4AJHA 3EG5A 3F4KA 3RHTA 3E48A 3A1DA 1YBHA 1UMBB 1C3EA 4F8EA 1XK6A 2VDLB 4N8EA 4GNRA 3OECA 3DZKA 4N0MA 2GCOB 1CY7A 5I4KA 4NBVA 5AVQA 4F3YA 3KOXA 2JEYA 2PQ0A 2DK6A 1F8GA 4ZEMA 2XENA 4S0XA 3K0CC 1O6CA 4A3VA 4OHPA 2HGZA 2DQYA 3CNOA 1UXJA 1PFWA 2CZCA 2O8FA 5JISA 2DUNA 3KSDO 1MT0A 1WCIB 1A9OA 5LDGA 3P94A 1USGA 2OOSA 3BGOS 4RV5A 3RUCA 5EP2A 5EXEA 1NW8A 2K87A 4ZGGA 1YWGO 3UWMA 4Z6KA 2QP3A 4LOHA 1FFWA 4R1MA 3OY7A 3OIVA 2R0QC 1DQNA 1E2KA 1S7CA 4L57A 3K35A 4Q1DA 1VLVA 4FU3A 1NUUA 721PA 3FF4A 1Q15A 4MUKA 1RC8A 4FDAA 4ZVSA 1N2JA 3NUZA 1I5RA 5AKZA 1WD5A 1UKCA 1EX6A 1YZHA 4EHLA 3LX6A 3QRWA 4DCVA 2JIOA 2PQMA 4XYMA 4NZPA 4FILA 3BUSA 2P9TA 4C7VA 3ZW9A 4U00A 3P9NA 3CGGA 4Z1OA 3Q0EA 3ZNNA 4W7HA 5H7PA 3H9CA 1H6CA 5AOBA 2HHJA 1IDOA 4WSOA 5FBZA 2RD0A 3OZBA 1SHJA 1NM5A 1Z8FA 2J30A 4JXXA 1CY8A 2BM8A 5F3RA 3R5TA 3GZNB 3DBRB 2HRRA 3URZA 1RHJA 4IN3B 1NZJA 2A9QA 2JFZA 4F7DA 1SCKA 3VC7A 2VP5A 1VJTA 3DDCA 2OCIA 5SZKB 4HL6A 3A70A 5JD5A 3QQPA 3UOGA 1U2RA 1E60A 4F9EA 3EVFA 2XMQA 1R66A 2JASA 1ISIA 1YOBA 4WZAB 2Q1SA 2NVUA 2O8NA 1QVRA 4WY8A 1BD8A 2ZE6A 4V0MA 1OU4A 4CM9D 3LQQA 3N2GA 1TA0A 2PRKA 4IF4A 3SBSA 3ABIA 2D1YA 3H5OA 3B13B 4K6GA 4XVUA 5LJIA 3EXAA 1J42A 4WLVA 3MFQA 5EKSA 1C41A 1JA1A 4G0WA 3LJKA 3FFTA 3LO5A 4MVJH 5IDVA 5KWDA 1R27A 3C87A 1J07A 2J0UB 5IJAA 3R9XA 4LWQA 4ME2A 1DU4A 2PE5A 3N5KA 4TKUA 3CLUD 1NUHA 3GWGA 2YWCA 5KYTA 2KQUA 4YLEA 3BH0A 2P4HX 4ADSG 5F9MA 1N75A 2PWBA 4OJNA 5HG0A 1VC2A 1E3QA 2PBRA 3AS5A 4L28A 3Q7IA 2B4QA 2G09A 4NG4A 3ZWNA 1QYMA 3KM0A 2QTLA 3AU8A 5D66A 3H9EO 3ZCTA 5JNVA 2NX2A 2PWAA 1NLZA 2B61A 2CBXA 3DV0A 4AT1A 3KCQA 2CMDA 1S2GA 2VSXE 3GLVA 5C34B 2BI4A 2OO5A 1VZ2A 1G2QA 4DLPA 4WOCA 2Y0BA 3WMWA 3OPNA 3BDIA 4D3SA 4LJRA 4PRKA 1KO8A 4GX1A 4PAMA 3ZXYA 2JLYA 1R0RE 5LWQA 3IJPA 4KW7A 4JT8A 2CXXA 2WKWA 1N6IA 2I1WA 1RJDA 2FP3A 2VDUE 3B3QA 1J0DA 3CSSA 3EF0A 5E3HA 2BHLA 1SB8A 4QG3A 3S2IA 1MDFA 1UAYA 3L0IB 1TQDA 1ZSYA 1SD5A 4I6EA 2H65A 1ND5A 1AXGA 1R1DA 3ZE8A 4GLLA 2F3UA 2GCOA 1O95D 4QREA 4BP3A 1WZIA 2NO9A 2IXGA 5GJVC 1GLGA 4PBTA 4XYGA 2EG5A 1KYIA 2ZSEA 1F2DA 2NQ2C 4D46A 4CF7A 2QX7A 4TXHA 3W8FA 3H9JA 3JARB 2HXSA 2Z6VA 1NKSA 3Q49B 1OF1A 1BS1A 1Q17A 1JUQA 1X9HA 2X6FA 2BJWA 5J23A 3HVHA 1HZZA 3UCXA 5DKFA 2WF5A 3G2TA 4RU1A 4LECA 1OCCE 3G3EA 9ABPA 4W1SA 3QFCA 2Y0DA 4L6AA 4JJ7A 3RTEA 1BCSB 4EKNB 4XKBA 3GNLA 4IXDA 1F12A 1R8JA 4FN4A 1CUWA 3DPYA 1JDNA 3SIRA 2P2CP 3DH0A 4TTVA 3MWKA 4GP6A 5HIKA 3WO0A 1BE8A 3EVEA 3K15A 1NA0A 1YCDA 3OTNA 1OXVA 4Z0PA 2UYQA 2HNAA 2Z6AA 1RU3A 4HGRA 1NP6A 4B84A 1G8SA 3C7KA 3K72B 4LKOA 4GL2A 2LNDA 2YOHA 1N6OA 1N6PA 3LPCA 3UWSA 3DOHA 3I8SA 4FFDA 4R9SA 4BQFA 1CYDA 5L3QB 1CIPA 3VLEA 5AJDA 1TIPA 1CUUA 2P9IG 4U7FA 2JRCA 2Z95A 2X23A 2IZ6A 4AUKA 4HPWA 2WPVA 3GZNA 3DBRA 3E03A 1ZU5A 1HQCA 4NPAA 2BDUA 2XMDA 3K0AB 3OXGA 4E3WA 1Z5GA 1E1QA 3NYIA 2DETA 1SHZA 3DJYA 3ZU6A 1Y5IA 5K4GA 5JVDB 2I2OA 3RU2A 4WZAA 1ETHA 1OX6A 1UDWA 2FSGA 3H86A 2WR8A 3SEFA 2QM7A 2Q7FA 4AICA 1N2XA 1JR4A 4B40A 1JR3D 3B13A 1AUPA 1BVRA 4WGFA 5BN3B 1HETA 4RHXA 4HCJA 3E9RA 5G0SA 1IVYA 5BYBA 5BVHB 1Q16A 2OZPA 5ELMA 3FUUA 4MWTA 1OY3D 1VB3A 3PXUA 4N0PA 1RI5A 4OQEA 2J0UA 4L9RA 2Z2XA 4GPKA 2X77A 1FE8A 3GPBA 5JSUA 1DNPA 3IAEA 3ZDRA 3UHAA 4LXYA 1RVDA 4YDWA 5K3BA 3AZPA 1TTPB 4BYMA 4MVJM 4BGVA 2BSAA 4J2OA 4D9MA 4KQ1A 5CX1B 1ZN7A 3DOCA 1E5QA 4BNUA 1BFUA 3AUSA 1E7QA 2BEUB 1ML3A 3D4NA 5C1PA 4WJLA 3TO5A 2VIIA 1KO7A 4HH1A 3VMFA 2IKQA 1QIDA 1Y5LA 3JQ9A 4KWEA 1TMOA 2GASA 3HZOA 2DHEA 3PVLA 5D00A 4ARZA 4LI3X 4OVUA 2C8VA 2L17A 4TROA 2V5AA 4DABA 2PV0A 1M34B 4NCIA 1N2CB 3D1JA 2BTEA 4NOKA 3UB2A 4PYNA 3ITDA 1QIIA 1PDWA 2PUTA 2Q2OA 4I36A 1KFKB 1XQWA 2CHVA 3CLSD 1HE2A 5CDUA 1JKFA 4WX2B 1QTNA 5CVDA 3UK2A 1VRVA 4RLHA 1EFCA 7YASA 3AG2E 3GRFA 1I1OA 4CLEA 3L77A 4QOJA 2NW6A 1GHTA 2XB8A 2OD2A 3WDMA 1KAHA 2WHXA 2VQ3A 1ZRMA 4A15A 2YNMD 5KJLA 2VA8A 3UJDA 3V34A 3ND9A 1EFLA 1TVKB 4K7JA 1LBEA 2NO7A 2Y76A 4EK9A 2PS1A 1W1UA 2GF2A 4PNEA 4DLTA 3KUKA 1DRUA 3AEKB 4JJZA 4ERXA 1DRJA 4QX6A 2EW8A 3M2TA 3U1VA 3A04A 4HNQA 1LDNA 2Z2ZA 5JWRA 4RZUA 4MUJA 2YINA 4EPRA 3B70A 1NY5A 2BPOA 1ZXLA 3OKAA 3EBPA 1ETUA 3TKAA 3RJTA 4FI3F 1TEVA 3N2IA 3ZEIA 2DBYA 2NZJA 4DVJA 5K0CA 1ISHA 4DMCA 4BNYA 4A9AA 1K8KG 5ULLA 4LXGA 3PEVB 1H0KA 1WMDA 1YAHA 2NV0A 4NRDA 1YAJA 3QK7A 2BWJA 4RY0A 3KRTA 4J2TA 4B32A 2RK4A 5JI3E 4RIEA 4RGYA 4KB5A 3OPQA 1QG0A 3AXTA 3H1BA 2WM8A 3VKVA 3QA9A 3Q9NC 4X6LA 4XDZA 3SM3A 1O6GA 3BIFA 1E2JA 4GDFA 4PF1A 1OX4A 3GGDA 3G8BA 3PGJA 4F2WA 5IJ9A 2GBGA 4LVCA 5L3QA 2LUHA 4BE9A 3QTBA 3ZHZA 4RPCA 3M3DA 2CDCA 1A8IA 2OG1A 2QJOA 2GA8A 2BFDA 2ORYA 2ZAMA 3GJYA 2Z83A 3EMBA 1C81A 1DC4A 3K0AA 1P7CA 3PJGA 3H2YA 3FUWA 1G21B 1UFRA 2CXQA 3IP5A 3OLXA 2IW3A 1ZPDA 3P0FA 3DCJA 2OILA 1W93A 1R6TA 1L3BA 4H16A 3D8SA 4CW7A 1FDUA 3FOFC 1QOZA 5ALOA 4HKTA 3WAGA 1JL3A 4N54A 2D5CA 4OK3A 3AKCA 3WGKA 3QWBA 4CFYA 5CFOA 2WYIA 2XYVA 4FU0A 1MTZA 4EZLA 1K3TA 4G4GA 3SOZA 2ZTUA 1YDHA 2Z8YM 3R6GA 1A8UA 2OCXA 7AT1A 4CCYB 1WQ1R 2BI7A 1L5KA 1TIBA 3NUGA 4GR4A 4AYXA 3C98A 3TRHA 5G1PA 3QEJA 2W6ID 5CDHA 3GJTA 1OE0A 2R66A 4C01A 3ZUPA 1E3SA 1E7VA 5JIBA 3JRXA 1EAMA 1BYUA 1E1RA 3H97A 3DT6A 4ZN6A 2X6TA 3UIEA 1T43A 3OPYB 3ONNA 1E4YA 1CE8B 2HM7A 4ALIA 1PQ4A 1TF7A 2FWJA 4TQAA 5FH9A 4FUQA 7MHTA 4P4LA 2XBLA 1NDQA 1KDVA 5FOXA 3SFVA 5EIBE 3UJCA 3KT0A 4P53A 3RC1A 1D1TA 5IEBA 1F8UA 4B6FA 4I9HA 1U1EA 3ZHCA 5LCXA 3U9WA 3IXLA 1ZIPA 1IQPA 4J9UE 2LAHA 4AKSA 3Q8WA 1J33A 3W7VA 1W2GA 4R2LA 4E12A 1PWEA 5LMUB 3OO0A 4O4LF 5BSMA 3SIWA 3WIEA 3MEQA 3DUWA 1BVUA 3PR3A 2AYZA 1LZLA 4Y2VA 3ZDEA 2GEKA 3ILHA 4AZSA 1YOVB 1RSZA 3A1WA 1QVVA 1WNTA 4Q4DA 4JJFA 4B45A 1UWCA 5I3CA 4ZI7F 2Q3JA 4JI7B 4X97A 5I8PA 2GPTA 3VR2D 3SE7A 5TGTA 3U60B 5FUXA 2ZWAA 5EPUA 4KZKA 1SQMA 1FP4B 3RRYA 1J0XO 5IG2A 1WCV1 1D1SA 2ESRA 4DYHA 3UH1A 1C0PA 1AKWA 1TVKA 3EVNA 2HA3A 5AYVA 4ILEA 4OXYA 3U31A 4MAMA 3ZLJA 4HOTA 1NQAO 3B1KA 4KNWA 3F2VA 1OFIA 3MUNA 1I36A 2BCEA 4BYGA 1W6UA 2IQCA 3Q1KA 1X87A 4X93A 5KNBA 3FTXA 5JNTA 2AF4C 5B1HA 3EIOA 2FVYA 2OO3A 5BMVB 1UC9A 1Z68A 2Z5GA 1PT8A 1JNXX 3ZU7B 3OQ1A 4UWGA 1R6DA 2QLJA 4N0EA 1KPGA 3BCSA 3ROXA 3PEVA 1P91A 2AT1A 5JZ9A 3R5FA 4ZAVA 3ADOA 2RH8A 2XMZA 1TM2A 4HTAA 5KI6A 1N52A 4PFSA 2Q1YA 2UUCB 5A0VA 1OCOE 1VCOA 1QPZA 3MHTA 3IUEA 4OY3A 3HRAA 1YCSB 3KPJA 4CLHA 5H1YA 4V02A 2H2AA 3AR4A 4D8TA 1S02A 3REGA 1JLLA 1SKBA 4ZYXA 5KAMA 1P2BA 1CJVC 4MGEA 1X1EA 4QUHA 5TGZA 2NU9A 1QU2A 1UBEA 5B2EA 4CU5A 3QBDA 4TLEA 4F56A 2IV2X 2G40A 3C39A 2POQX 2QYHA 3A05A 4IDDA 1C1YA 5FOWA 1Q14A 3LCCA 1U1DA 3X0DA 2YVAA 1QH1B 3KSZO 4YACA 1WSBA 2AD1A 4PW0A 3WQQA 2HK9A 1KH1A 3FUVA 4RTNA 3CNNA 3FDJA 4M1MA 4FFMA 3D6AA 2OCKA 3O5AA 1NA3A 1GZVA 1C9JA 3UXYA 521PA 3PEYA 3GLFA 3QV1A 1IVNA 1NASA 2QMYA 3WLTA 3CK9A 2VPYA 3DBHB 2HBYA 3IGFA 1VCIA 2RHTA 5IMSA 3JTEA 4DIEA 4AG3A 3KQVA 1RKBA 2HHCA 5AI5A 4CCYA 5I48A 3WDSA 3B7BA 5AKLA 4FZRA 4W6QA 4FHDA 5E0KB 7ABPA 2I55A 4HVLA 3NBNB 3ORRA 3VKGA 1SUCA 5JAIA 1EQ2A 5AIJA 1C29B 1H4SA 4FFRA 4F3CA 4YV2A 3OPYA 1WXXA 1ZJ5A 4DW8A 2OM2A 3WYAA 1MAAA 1ONSA 3VBCA 5DU2A 1C7FA 3EFBA 1KH3A 1YUBA 1A2QA 4EZJA 5IW8A 3R3VA 1ZIXA 1HT3A 2PZ8A 1L8AA 4IV8A 4KGXA 3RNOA 2RJNA 1DEHA 4ZOQI 3MJHA 4F1SA 2ZQYA 1UT6A 3SSMA 2QE7D 4RQTA 3MELA 1DMRA 2EWWA 4TVBA 2QX6A 3G0CA 1LDBA 4WE3A 2JLZA 2XEHA 2AJ8A 4LY0A 2IBSA 5AXBA 2OVFA 4F5EA 4QASA 2I4NA 4COOA 3EHRA 4IHJB 3GV0A 3B51X 4LMRA 1CW2B 1FOEB 4GSYA 4XRGA 1XEXA 4F91B 1N9GB 3WSTA 4RMNA 1YOVA 4Z2AA 3RRJA 2VT7A 3S6JA 2XCCA 1C0EA 3LT0A 1M2JA 3W5AA 1LTHR 3ESDA 3IOEA 3KL2A 3GEBA 1VM6A 1X7XA 4EFMA 1SO8A 1T0HB 4OJTA 3PGMA 5JLAA 1EFVB 4UHEA 5CFNA 4BCCA 5CLJA 4DWWA 3CVJA 1FP4A 2KCLA 2C4KA 1GZSA 3V8EA 1S6YA 4X54A 1XAHA 1RAAA 3ZR4B 2RFLA 1RW2A 1HH8A 3SXUB 2RE8A 3OZDA 4LY3A 5KU1A 4BKMA 4TT3A 2VI5A 4TZ6A 3GJ8A 2JIRA 1LK0A 1E6EA 3DKRA 5A05A 4J7WA 1JJFA 2E5FA 1GXSB 3V8MA 2HZ7A 3MMSA 3GDWA 3IESA 3UX4A 3ADPA 1DQSA 2XYPA 4QDKA 3MCTA 5BMVA 4YUZA 3MTJA 4CV3A 4ZT4A 4MBGA 2EZ8A 1KAMA 5TT0A 4FB5A 1BOFA 1WX1A 4LF8B 5A7GA 2XI4A 4ZJYA 3I2YX 2RG8A 5F1PA 1B8UA 8AT1A 1QIFA 3WBBA 4WH0A 1JBEA 1MX5A 4FKMA 2PY6A 3EGXB 3CG4A 5ITWA 1V71A 5KUTA 2N47A 3JQAD 1TNBA 1VDYA 3K92A 4BBPA 1XZHA 1MEOA 4V38A 1ORVA 4CL8A 3GT7A 1E1CB 5AKKA 1M1YE 4LYDA 2ZCJA 2ZXFA 1UJ5A 5THXA 2BBTA 2BLNA 3PD1A 5CHEE 3KXLA 1PQWA 2B8EA 3UGJA 1ZUHA 3FPGA 4RMGA 1WTAA 3LJ3A 3AEQB 3L7AA 5FUVA 2HO5A 1UJ6A 3OZGA 5KYWB 1QO0A 3TTVA 3KEZA 3NB0A 4A23A 2NYAA 1P9LA 4B93B 4WBNB 1XL1A 2EIHA 2PXXA 4LJLA 4F3KA 4Q21A 3MM4A 3DOUA 3U62A 3FNHA 1MRZA 5ITZF 1AV6A 1RPJA 3OSZA 1L0BA 4ETNA 1NT2A 1KIAA 1H19A 3VZPA 2QIOA 2V9CA 1UDCA 4CV2A 2PK3A 1WLSA 3SS8A 2BF7A 3UPUA 3ZGXA 3CZAA 2ZR8A 3EOAI 2NV6A 3IOBA 1H05A 3UMFA 5AYWD 1QH1A 1TUBB 3QV2A 4ZGWA 4I66A 5DM70 2DHCA 3LO8A 4BUJA 1U0BB 1M1NB 1UFVA 1MO2A 5AI0A 4MICA 4RNCA 4Q7LA 3SFYA 2W6PA 3TNJA 3AHDA 3T7DA 3WNQA 2NQ8A 1MB9A 3LPMA 2EILE 2AG8A 5JY6A 2JD0A 1W1WA 3KELA 1YS7A 5AFSA 4LZLA 5LXTB 1ZCFA 3D4IA 4B0PA 2JIZA 3NORA 2ZRJA 3U4QA 3U37A 3ELDA 3N0XA 1UPXA 4XVQA 4X41A 4RA6B 1Y8RB 4TUYB 5I7VA 3BGWA 4U2CA 4FSDA 2EVWX 4PLVA 4TXPA 2KPOA 2KJQA 5IU6A 4CMEA 1TZJA 2C5BA 4UW9A 3GMDA 2JI8A 4M21A 4D5GA 5CNKA 4HLUA 2RG7A 5HVNA 1BXRA 1ZMOA 4HH3C 1H8HA 2GGSA 3GX1A 4ZYLA 4KVGA 1ZI6A 1KVRA 3SYKA 4D97A 4LYJA 3STHA 1KYVA 4YJ3F 3W3AA 1J8QA 4AQYB 3BEOA 2PZBA 2WTUA 3I3SR 4RVNA 1FA9A 3RABA 1R7RA 3U19A 3IR5A 1T8UA 2ZKLA 1OMOA 4J49A 4MUHA 4V1CI 5EMHA 3KZKA 1W581 1F2UB 3BZBA 3KXPA 1FDTA 3T15A 2ZE8A 2DFKB 1TW3A 4YJ2F 3TPFA 2VN8A 3TWSA 1HE3A 3F7MA 3I9V6 3SLGA 5KWJA 4IHJA 3DBIA 3QELA 4W9NA 1DI0A 2ZXWE 2I6FA 2NUPB 3TSZA 1P1FA 3G7NA 4JXJA 5D3KA 3JCKC 3F5FA 1LSUA 2XGSA 3WJAA 3NV7A 1X19A 3R4VA 2QL6A 2AJAA 2VDRB 1ADYA 4KQFA 4ZAZA 1EFVA 3DE5X 3JVDA 3WLHA 4XFDA 3B1FA 4YROA 4P2GA 1O0SA 3T1NA 3KDAA 1OYYA 5HIIA 4I2WA 3G2UA 5KS2A 3TTUA 3CT4A 1SQGA 4YRPA 3ROMA 2JW5A 5FB3A 3KKQA 2ZJ0A 5BV0A 4EMUA 2NWQA 2LCQA 5AOAA 3AV3A 5HOQA 2GRRB 1GXSA 4PSKA 3HV0A 1HYQA 2W4QA 4BBAA 2XPYA 3ZOZA 4KZCA 3GMSA 2O2YA 1DJOA 3TLXA 1IXYA 4QOIA 1U1CA 2JFNA 3NETA 4K2HA 2AUNA 4ZCPA 2DU8A 4F0JA 1IYGA 2COEA 4MQBA 2WSYB 2XKKA 3L92A 3E30A 1QR6A 1E2PA 4J90A 4JAVC 3UANA 2N3ZA 4B83A 1IUKA 3HLTA 3RAEC 4JB3A 5GP1A 4UUQA 1SPBS 3IUJA 3EGXA 1N6NA 4D4KA 3LAWA 2SHKA 5MDHA 5GIPE 1OZGA 3L6RA 4HAXA 4G26A 3UBTA 4HWKA 1E1CA 3I4FA 1D2HA 1M76A 4CCWA 1EUDA 2LD4A 3SZLA 3LP5A 2EX0A 3OQNA 4AULA 1R8SA 1MGOA 3ITNA 1O94D 2IP1A 3QVTA 4JBWA 4JLBA 1Z06A 4MV0A 1XVUA 1PUXA 4CMKA 2ZUWA 3MCZA 4OXRA 5HDQA 2R8XA 2Q7XA 3AEQA 4RZ2A 1O1TA 4WBNA 1K1AA 3C1AA 1SKQA 3ND8A 1PIWA 3BSYA 4LFCB 1KFCB 1CD5A 3I5PA 2RGAA 1HYGA 4L6CA 4I7EA 1E89A 5CCMA 1TUBA 2V7QD 1UBRS 4C08A 5CCLA 1H0HA 1C80A 4H0CA 1T2VA 5HBGA 1U94A 3L49A 1G9SA 1M1NA 2B8JA 1YZLA 3H2HA 1N5KA 4Y8VA 3MG9A 4B8YA 1ZJZA 5KDOA 4RY9A 1QHXA 2OXFA 4HXEB 4LXQA 3A32A 3OOYA 1XE3A 3VO2A 2C7PA 1DAGA 2ZRMA 1QC5B 2EKZA 5LXTA 4YCDA 3FUNA 3AH8A 1IQRA 1QX3A 4LY6A 2I9CA 3OQ6A 1G8AA 3MJDA 5BXQC 4EMSA 2V59A 3LQYA 1Y6IA 5KREA 1Y8RA 3Q8XB 3B1XA 4TUYA 1VIDA 4TLLB 3F7NA 4K5CA 2XNKA 5BQ5A 3GLGA 3ZDCA 1FTQA 4OB7A 1YTUA 4QPCA 3ZK7A 2PV7A 4AJNA 1ORHA 4M1TA 4IVPA 2BDTA 4ND4A 5EYPF 3TFQA 3IE2A 3R1IA 3OAAA 1JI3A 1XD2B 4R51A 1TMGE 4XYLA 1FX0A 3U4CA 3GA0A 1HUQA 4L8VA 4RK6A 1OXSC 4IV5A 4OHUA 1Z3YA 3SXJA 3WMRA 1A4IA 1ZC3A 4BZZA 3FYUC 1BKDR 3C7TA 5ALUA 2PLRA 3QI2A 1CZOA 5ALMA 5IWCA 1Q0UA 3TG8A 5IAEA 1F2UA 4DG5A 3I2FA 1KI4A 5LP6B 1CZUA 4I9UA 2M2IA 2RHCA 1T2CA 4Q3OA 3ETDA 2GK7A 1XMIA 2XH8A 1ST2A 1DBQA 1ZK0A 2OHVA 1XTBA 1K5HA 3IEXA 1DOZA 3O31A 4E5UA 1U0LA 2F1KA 2NUPA 4DIBA 4DSOA 4UD6A 2AQKA 1TZMA 1QHNA 2QTMA 3Q85A 1YIOA 2C29D 4OP3A 2JAHA 3TW4A 4LYEA 1SEVA 4XGKA 2ET6A 2VHXA 2M63A 3MJCA 1JG6A 3NBKA 5BR7A 5B36A 4I1OA 1K66A 1QHGA 4DQKA 5EJ4A 1EX1A 2W43A 3OQPA 4DLZA 3HB0A 1W5FA 2QQEA 2H1VA 2VP9A 1MHPA 5BSVA 5KNCH 3AIOA 4CEHB 2YJ3A 3I28A 5LQDA 1E3DA 5KTTA 3KLNA 5E9WA 4DA9A 1IOLA 2Q29A 5CFQA 4EARA 3KD3A 2WSBA 2D2FA 3VU9B 2JHAA 5FTWA 2YV1A 5JSQA 2DOKA 1ZGAA 4BMSA 3B5IA 3CR8A 1PFGA 1Y3IA 2QU7A 2ZQZA 2WQ7A 1LVUA 5COAA 4C4XA 1USWA 4YRRA 2PVCA 3ZW7A 3TTYA 1HR0B 5HKLA 3SYMA 3RASA 1JHDA 2I6SA 4ER0A 2LDXA 4Q00A 5CLGA 2ZRNA 1E90A 2OD7A 1G66A 3WGHA 1U28C 3DXFA 1DAOA 1FNMA 1DC7A 4FE3A 1X92A 4HNAD 1LBHA 4G5QA 2ZFUA 3HI4A 3H42B 2A9RA 3ONWA 1DV1A 3UM2A 3GOHA 2XTNA 1AGRA 2ACEA 4OM7A 2W83A 3K71B 1V1RB 4KDCA 1LV8A 2PKWA 3OHMA 4G84A 3UTDA 2CL0X 5HTKA 5A9TA 2HF2A 3NVAA 3WQBA 3K0KA 1MD9A 4RELA 1PGQA 2QTNA 4I99A 4A5OA 3FVQA 5TC4A 3VV3A 4MPTA 2ISQA 2YN4A 5IAAA 4DJFC 2LP4Y 3IHYA 3WB9A 1P5JA 4R1OA 3L9TA 3GROA 1ZX1A 5JJKA 3TXXA 3NAMA 3PDJA 2OQ2A 4JJAA 1AURA 3KVRA 1FMJA 1ZA2A 1CJMA 2A90A 2ECKA 3RQIA 4RFSB 5CG2A 2G67A 4DA6A 1PUIA 5HYVA 2GN8A 5JOQA 3BICA 5EHQA 2ZWIA 1ZW6A 5IKPA 5AOVA 3J5QB 4W5JA 4NCKA 3TRIA 2JEKA 3GZ2A 2AFIE 4WHMA 2Z56A 3I6IA 1IHGA 1DG9A 1FCJA 1QC5A 1CUIA 3EULA 2WG1A 4B33A 4OOFA 1BVHA 1PSDA 3PUXA 3IAUA 1X9IA 3E9YA 2QR3A 2JJMA 1M67A 2NTVA 2LO6A 2VLIA 1C50A 4UFPA 4Z51A 1EWVA 2ZSKA 4CETA 1CZRA 1TAUA 2P2NA 1UW4B 5L6LB 1GFIA 1VJDA 2VUHB 1U8TA 4IINA 3QKWA 5H68A 3QVSA 1FNNA 2JZNA 4C6RA 1Y8ZA 2XZLA 1BQEA 4YWJA 3S2UA 1WBDA 3PC7A 4HUJA 2NPIA 1YB7A 2YYAA 4BMCA 4Z4QA 2IF0A 3LLCA 3BJIC 1W96A 3VHXB 4EX6A 2WYVA 3ETLA 4F1JA 2XCIA 3O3OB 1XCMA 4FS8A 4Q02A 3U7QB 1C3JA 4FGJA 3FUDA 3C6KA 3CIAA 4NIMA 2VF7A 4K9MA 2AMVA 4HAUA 4UNSA 1JBKA 3UXHA 4C7OB 4DJDC 3U4HA 2PA3A 2QM8A 3DP9A 2JVJA 4KLNA