3PEAA

Crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor'
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFSAGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDGREGVAAFLEKRKPSFSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enoyl-CoA hydratase from Bacillus anthracis str. 'Ames Ancestor'
rcsb
source organism Bacillus anthracis
molecule tags Isomerase
molecule keywords Enoyl-CoA hydratase/isomerase family protein
total genus 94
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3peaA00
2ZL0A 4MI2A 5G1QA 3P5MA 3K50A 2Q2XA 5KJPA 3ZW9A 1NZYA 5DTWA 2CE3A 4Z0MA 3T3WA 2WTBA 4JSBA 4U19A 3IBBA 2PPYA 5INIA 2ZL2A 3ZWCA 2F6QA 3R0OA 3SWXA 4IZDA 4ZDFA 4FNBA 2A7KA 2VSUF 1EY3A 4U18A 2HW5A 2ZL4A 5G1SA 3U9TB 5DKPA 1NZYB 3BF0A 3OMEA 4EMPA 3QMJA 1TG6A 3NJBA 1WDLA 4WZ8B 2J5SA 4YLHA 5E0SH 1VRGA 2GTRA 5FUSA 3H02A 3LKEA 4FN8A 3HP0A 2W3PA 3WG5A 3RSTA 2FBMA 4ELXA 1DCIA 3R9TA 3N6RB 3V5EA 4U0GH 3GF7A 1TYFA 2F9IA 2VSUA 4JFCA 3JU1A 3KTGA 2Q35A 4JYJA 2VSUC 4ZU2A 3ISAA 3QXIA 3TDCA 1FC9A 3M6MA 3T89A 4GM2A 3Q7HA 3TVUA 4JWVA 4IZBA 4K29A 3MT6A 2BZRA 2VSUE 1SZOA 3GMAA 3L3SA 3H0QA 3LAOA 1UYVA 1HNUA 3MFMA 3T8AA 5CTCA 3KTIA 3H0UA 2VREA 4I52A 1N6DA 2ZQQA 4F47A 4JCQA 3QREA 4RCNA 4ASIA 3PEAA 1FC6A 1PJHA 4QIJA 1XX4A 1K39A 3P85A 1O8UA 4FNDA 4JYLA 4U0HA 5C9GA 3G64A 3PZKA 4NEKA 3MOYA 1OD2A 1EF9A 4JJTA 1OD4A 4MOUA 3IAVA 4OLQA 3OT6A 3P2LA 3HRXA 5INFA 4WCZA 1Q51A 3MYBA 4HNKA 2ZQRA 1UYTA 5DL1A 3H81A 5C90A 5CTBA 4WYOB 4RYFA 5DZKA 5INGA 1RJMA 3TV5A 3H0SA 4FJWD 4MXIA 1Q52A 1ON9A 2QQ3A 4JVTA 3KTJA 2X24A 1DUBA 2ZL3A 4U0GA 4NNQA 4FN7A 3HLN1 1EF8A 5FIFA 4JCRA 1XNWA 4OMRA 3I47A 1XNVA 3RRVA 4ZDBA 3U9RB 2VSSA 1UIYA 1K32A 4ZDCA 1YG8A 3ST9A 2J5IB 3TT6A 3DJAA 4Q0GA 4JOTA 5IKLB 2F6IA 2J5GD 4ELSA 1J7XA 3ZWBA 4JCSA 4IZCA 1X0UA 1XO6A 5G1RA 2J5II 5DZKH 1WZ8A 3H0JA 3PGQA 1RJNA 3QK8A 5E0NX 1N6EA 1Y7OA 2IEXA 3BEZA 1YG6A 4I42A 3GF3A 2CBYA 3R6HA 5DUFA 5KDRA 3STAA 3ZW8A 3VIVA 1SG4A 4QIIA 5E0SA 1XNYA 2DUBA 2J5GA 1PIXA 4L6WA 1WDKA 4GHNA 3FDUA 3KTKA 4LK5A 3TLFA 5MGBA 4I4ZA 1HZDA 3PE8A 4B3IA 3BPPA 3Q1TA 1MJ3A 4ELWA 3NJDA 3U9SB 5DU6A 2A7SA 3ZWAA 1JXZA 2X58A 2J5IA 4FZWC 4RYFH 4EMLA 3QWDA 4HC8A 2D3TA 1FCFA 4K2NA 5DU4A 5DTPA 2DEOA 4G2RA 4B3JA 4K3WA 4KNPA 1UYRA 4L8KA 3R9QA 4QFEA 3T88A 4U1AA 3TT7A 3OC7A 2F9YA 4ZDDA 1WDMA 1W2XA 1ON3A 3KTHA 3QKAA 3RSIA 4OG1A 3TVWA 3GKBA 4DI1A 5DU8A 3QYRA 2A81A 2VSSF 4EMMA 5KDRB 3Q0JA 5JBWA 1N6FA 5DUCA 2UZFA 4Q1IA 4B3HA 2FZSA 2C8TA 3QXZA 3TZ3A 1FC7A 3V5IA 1UYSA 2PBPA 3T8BA 3SLLA 4KD6A 3IB9A 3HINA 4JCTA 2F9IB 3TRRA 3DORA 2FW2A 2Q34A 3KQFA 3M6NA 4KWBA 1HNOA 3FF6A 3GLMA 4FB8A 3Q0GA 2PG8A 4ZDEA 3R9SA 2EJ5A 2VX2A 4FZWA 3K8XA 2NP9A 4KPKA 2F9YB 5JBXA 2VSSE 3HE2A
chains in the Genus database with same CATH superfamily
2ZL0A 4MI2A 5G1QA 3P5MA 3K50A 2Q2XA 5KJPA 3ZW9A 1NZYA 5DTWA 2CE3A 4Z0MA 3T3WA 2WTBA 4JSBA 4U19A 3IBBA 2PPYA 5INIA 2ZL2A 3ZWCA 2F6QA 3R0OA 3SWXA 4IZDA 4ZDFA 4FNBA 2A7KA 2VSUF 1EY3A 4U18A 2HW5A 2ZL4A 5G1SA 3U9TB 5DKPA 1NZYB 3BF0A 3OMEA 4EMPA 3QMJA 1TG6A 3NJBA 1WDLA 4WZ8B 2J5SA 4YLHA 5E0SH 1VRGA 2GTRA 5FUSA 3H02A 3LKEA 4FN8A 3HP0A 2W3PA 3WG5A 3RSTA 2FBMA 4ELXA 1DCIA 3R9TA 3N6RB 3V5EA 4U0GH 3GF7A 1TYFA 2F9IA 2VSUA 4JFCA 3JU1A 3KTGA 2Q35A 4JYJA 2VSUC 4ZU2A 3ISAA 3QXIA 3TDCA 1FC9A 3M6MA 3T89A 4GM2A 3Q7HA 3TVUA 4JWVA 4IZBA 4K29A 3MT6A 2BZRA 2VSUE 1SZOA 3GMAA 3L3SA 3H0QA 3LAOA 1UYVA 1HNUA 3MFMA 3T8AA 5CTCA 3KTIA 3H0UA 2VREA 4I52A 1N6DA 2ZQQA 4F47A 4JCQA 3QREA 4RCNA 4ASIA 3PEAA 1FC6A 1PJHA 4QIJA 1XX4A 1K39A 3P85A 1O8UA 4FNDA 4JYLA 2YJGA 4U0HA 5C9GA 3G64A 3PZKA 4NEKA 3MOYA 1OD2A 1EF9A 4JJTA 1OD4A 4MOUA 3IAVA 4OLQA 3OT6A 3P2LA 3HRXA 5INFA 4WCZA 1Q51A 3MYBA 4HNKA 2ZQRA 1UYTA 5DL1A 3H81A 5C90A 5CTBA 4WYOB 4RYFA 5DZKA 5INGA 1RJMA 3BPTA 3TV5A 3H0SA 4FJWD 4MXIA 1Q52A 1ON9A 2QQ3A 4JVTA 3KTJA 2X24A 1DUBA 2ZL3A 4U0GA 4NNQA 4FN7A 3HLN1 1EF8A 5FIFA 4JCRA 1XNWA 4OMRA 3I47A 1XNVA 3RRVA 4ZDBA 3U9RB 2VSSA 1UIYA 1K32A 4ZDCA 1YG8A 3ST9A 2J5IB 3TT6A 3DJAA 4Q0GA 4JOTA 5IKLB 2F6IA 2J5GD 4ELSA 1J7XA 4J2UA 3ZWBA 4JCSA 4IZCA 1X0UA 1XO6A 5G1RA 2J5II 5DZKH 1WZ8A 3H0JA 3PGQA 1RJNA 3QK8A 5E0NX 1N6EA 1Y7OA 2IEXA 3BEZA 1YG6A 4I42A 3GF3A 2CBYA 3R6HA 5DUFA 4NARA 5KDRA 3STAA 3ZW8A 3VIVA 1SG4A 4QIIA 5E0SA 1XNYA 2DUBA 2J5GA 1PIXA 4L6WA 1WDKA 4GHNA 3FDUA 3KTKA 4LK5A 3TLFA 5MGBA 4I4ZA 1HZDA 3PE8A 4B3IA 3BPPA 3Q1TA 1MJ3A 4ELWA 3NJDA 3U9SB 5DU6A 2A7SA 3ZWAA 1JXZA 2X58A 2J5IA 4FZWC 4RYFH 4EMLA 3QWDA 4HC8A 4HDTA 2D3TA 1FCFA 4K2NA 5DU4A 5DTPA 2DEOA 4G2RA 4B3JA 4K3WA 4KNPA 1UYRA 4L8KA 3R9QA 4QFEA 3T88A 4U1AA 3TT7A 3OC7A 2F9YA 4ZDDA 1WDMA 1W2XA 1ON3A 3KTHA 3QKAA 3RSIA 4OG1A 5HUQA 3TVWA 3GKBA 4DI1A 5DU8A 3QYRA 2A81A 2VSSF 4EMMA 5KDRB 3Q0JA 5JBWA 1N6FA 5DUCA 2UZFA 4Q1IA 4B3HA 2FZSA 2C8TA 3QXZA 3TZ3A 1FC7A 3V5IA 1UYSA 2PBPA 3T8BA 3SLLA 4KD6A 3IB9A 3HINA 4JCTA 2F9IB 3TRRA 3DORA 2FW2A 2Q34A 3KQFA 3M6NA 4KWBA 1HNOA 3FF6A 3GLMA 4FB8A 3Q0GA 2PG8A 4ZDEA 3R9SA 2EJ5A 2VX2A 4FZWA 3K8XA 2NP9A 4KPKA 2F9YB 5JBXA 2VSSE 3HE2A
chains in the Genus database with same CATH topology
2ZL0A 4MI2A 5G1QA 3P5MA 3K50A 2Q2XA 5KJPA 3ZW9A 1NZYA 5DTWA 2CE3A 4Z0MA 3T3WA 2WTBA 4JSBA 4U19A 3IBBA 2PPYA 5INIA 2ZL2A 3ZWCA 2F6QA 3R0OA 3SWXA 4IZDA 4ZDFA 4FNBA 2A7KA 2VSUF 1EY3A 4U18A 2HW5A 2ZL4A 5G1SA 3U9TB 5DKPA 1NZYB 3BF0A 3OMEA 4EMPA 3QMJA 1TG6A 3NJBA 1WDLA 4WZ8B 2J5SA 4YLHA 5E0SH 1VRGA 2GTRA 5FUSA 3H02A 3LKEA 4FN8A 3HP0A 2W3PA 3WG5A 3RSTA 2FBMA 4ELXA 1DCIA 3R9TA 3N6RB 3V5EA 4U0GH 3GF7A 1TYFA 2F9IA 2VSUA 4JFCA 3JU1A 3KTGA 2Q35A 4JYJA 2VSUC 4ZU2A 3ISAA 3QXIA 3TDCA 1FC9A 3M6MA 3T89A 4GM2A 3Q7HA 3TVUA 4JWVA 4IZBA 4K29A 3MT6A 2BZRA 2VSUE 1SZOA 3GMAA 3L3SA 3H0QA 3LAOA 1UYVA 1HNUA 3MFMA 3T8AA 5CTCA 3KTIA 3H0UA 2VREA 4I52A 1N6DA 2ZQQA 4F47A 4JCQA 3QREA 4RCNA 4ASIA 3PEAA 1FC6A 1PJHA 4QIJA 1XX4A 1K39A 3P85A 1O8UA 4FNDA 4JYLA 2YJGA 4U0HA 5C9GA 3G64A 3PZKA 4NEKA 3MOYA 1OD2A 1EF9A 4JJTA 1OD4A 4MOUA 3IAVA 4OLQA 3OT6A 3P2LA 3HRXA 5INFA 4WCZA 1Q51A 3MYBA 4HNKA 2ZQRA 1UYTA 5DL1A 3H81A 5C90A 5CTBA 4WYOB 4RYFA 5DZKA 5INGA 1RJMA 3BPTA 3TV5A 3H0SA 4FJWD 4MXIA 1Q52A 1ON9A 2QQ3A 4JVTA 3KTJA 2X24A 1DUBA 2ZL3A 4U0GA 4NNQA 4FN7A 3HLN1 1EF8A 5FIFA 4JCRA 1XNWA 4OMRA 3I47A 1XNVA 3RRVA 4ZDBA 3U9RB 2VSSA 1UIYA 1K32A 4ZDCA 1YG8A 3ST9A 2J5IB 3TT6A 3DJAA 4Q0GA 4JOTA 5IKLB 2F6IA 2J5GD 4ELSA 1J7XA 4J2UA 3ZWBA 4JCSA 4IZCA 1X0UA 1XO6A 5G1RA 2J5II 5DZKH 1WZ8A 3H0JA 3PGQA 1RJNA 3QK8A 5E0NX 1N6EA 1Y7OA 2IEXA 3BEZA 1YG6A 4I42A 3GF3A 2CBYA 3R6HA 5DUFA 4NARA 5KDRA 3STAA 3ZW8A 3VIVA 1SG4A 4QIIA 5E0SA 1XNYA 2DUBA 2J5GA 1PIXA 4L6WA 1WDKA 4GHNA 3FDUA 3KTKA 4LK5A 3TLFA 5MGBA 4I4ZA 1HZDA 3PE8A 4B3IA 3BPPA 3Q1TA 1MJ3A 4ELWA 3NJDA 3U9SB 5DU6A 2A7SA 3ZWAA 1JXZA 2X58A 2J5IA 4FZWC 4RYFH 4EMLA 3QWDA 4HC8A 4HDTA 2D3TA 1FCFA 4K2NA 5DU4A 5DTPA 2DEOA 4G2RA 4B3JA 4K3WA 4KNPA 1UYRA 4L8KA 3R9QA 4QFEA 3T88A 4U1AA 3TT7A 3OC7A 2F9YA 4ZDDA 1WDMA 1W2XA 1ON3A 3KTHA 3QKAA 3RSIA 4OG1A 5HUQA 3TVWA 3GKBA 4DI1A 5DU8A 3QYRA 2A81A 2VSSF 4EMMA 5KDRB 3Q0JA 5JBWA 1N6FA 5DUCA 2UZFA 4Q1IA 4B3HA 2FZSA 2C8TA 3QXZA 3TZ3A 1FC7A 3V5IA 1UYSA 2PBPA 3T8BA 3SLLA 4KD6A 3IB9A 3HINA 4JCTA 2F9IB 3TRRA 3DORA 2FW2A 2Q34A 3KQFA 3M6NA 4KWBA 1HNOA 3FF6A 3GLMA 4FB8A 3Q0GA 2PG8A 4ZDEA 3R9SA 2EJ5A 2VX2A 4FZWA 3K8XA 2NP9A 4KPKA 2F9YB 5JBXA 2VSSE 3HE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL0 A;  4MI2 A;  5G1Q A;  3P5M A;  3K50 A;  2Q2X A;  5KJP A;  3ZW9 A;  1NZY A;  5DTW A;  2CE3 A;  4Z0M A;  3T3W A;  2WTB A;  4JSB A;  4U19 A;  3IBB A;  2PPY A;  5INI A;  2ZL2 A;  3ZWC A;  2F6Q A;  3R0O A;  3SWX A;  4IZD A;  4ZDF A;  4FNB A;  2A7K A;  2VSU F;  1EY3 A;  4U18 A;  2HW5 A;  2ZL4 A;  5G1S A;  3U9T B;  5DKP A;  1NZY B;  3BF0 A;  3OME A;  4EMP A;  3QMJ A;  1TG6 A;  3NJB A;  1WDL A;  4WZ8 B;  2J5S A;  4YLH A;  5E0S H;  1VRG A;  2GTR A;  5FUS A;  3H02 A;  3LKE A;  4FN8 A;  3HP0 A;  2W3P A;  3WG5 A;  3RST A;  2FBM A;  4ELX A;  1DCI A;  3R9T A;  3N6R B;  3V5E A;  4U0G H;  3GF7 A;  1TYF A;  2F9I A;  2VSU A;  4JFC A;  3JU1 A;  3KTG A;  2Q35 A;  4JYJ A;  2VSU C;  4ZU2 A;  3ISA A;  3QXI A;  3TDC A;  1FC9 A;  3M6M A;  3T89 A;  4GM2 A;  3Q7H A;  3TVU A;  4JWV A;  4IZB A;  4K29 A;  3MT6 A;  2BZR A;  2VSU E;  1SZO A;  3GMA A;  3L3S A;  3H0Q A;  3LAO A;  1UYV A;  1HNU A;  3MFM A;  3T8A A;  5CTC A;  3KTI A;  3H0U A;  2VRE A;  4I52 A;  1N6D A;  2ZQQ A;  4F47 A;  4JCQ A;  3QRE A;  4RCN A;  4ASI A;  3PEA A;  1FC6 A;  1PJH A;  4QIJ A;  1XX4 A;  1K39 A;  3P85 A;  1O8U A;  4FND A;  4JYL A;  4U0H A;  5C9G A;  3G64 A;  3PZK A;  4NEK A;  3MOY A;  1OD2 A;  1EF9 A;  4JJT A;  1OD4 A;  4MOU A;  3IAV A;  4OLQ A;  3OT6 A;  3P2L A;  3HRX A;  5INF A;  4WCZ A;  1Q51 A;  3MYB A;  4HNK A;  2ZQR A;  1UYT A;  5DL1 A;  3H81 A;  5C90 A;  5CTB A;  4WYO B;  4RYF A;  5DZK A;  5ING A;  1RJM A;  3TV5 A;  3H0S A;  4FJW D;  4MXI A;  1Q52 A;  1ON9 A;  2QQ3 A;  4JVT A;  3KTJ A;  2X24 A;  1DUB A;  2ZL3 A;  4U0G A;  4NNQ A;  4FN7 A;  3HLN 1;  1EF8 A;  5FIF A;  4JCR A;  1XNW A;  4OMR A;  3I47 A;  1XNV A;  3RRV A;  4ZDB A;  3U9R B;  2VSS A;  1UIY A;  1K32 A;  4ZDC A;  1YG8 A;  3ST9 A;  2J5I B;  3TT6 A;  3DJA A;  4Q0G A;  4JOT A;  5IKL B;  2F6I A;  2J5G D;  4ELS A;  1J7X A;  3ZWB A;  4JCS A;  4IZC A;  1X0U A;  1XO6 A;  5G1R A;  2J5I I;  5DZK H;  1WZ8 A;  3H0J A;  3PGQ A;  1RJN A;  3QK8 A;  5E0N X;  1N6E A;  1Y7O A;  2IEX A;  3BEZ A;  1YG6 A;  4I42 A;  3GF3 A;  2CBY A;  3R6H A;  5DUF A;  5KDR A;  3STA A;  3ZW8 A;  3VIV A;  1SG4 A;  4QII A;  5E0S A;  1XNY A;  2DUB A;  2J5G A;  1PIX A;  4L6W A;  1WDK A;  4GHN A;  3FDU A;  3KTK A;  4LK5 A;  3TLF A;  5MGB A;  4I4Z A;  1HZD A;  3PE8 A;  4B3I A;  3BPP A;  3Q1T A;  1MJ3 A;  4ELW A;  3NJD A;  3U9S B;  5DU6 A;  2A7S A;  3ZWA A;  1JXZ A;  2X58 A;  2J5I A;  4FZW C;  4RYF H;  4EML A;  3QWD A;  4HC8 A;  2D3T A;  1FCF A;  4K2N A;  5DU4 A;  5DTP A;  2DEO A;  4G2R A;  4B3J A;  4K3W A;  4KNP A;  1UYR A;  4L8K A;  3R9Q A;  4QFE A;  3T88 A;  4U1A A;  3TT7 A;  3OC7 A;  2F9Y A;  4ZDD A;  1WDM A;  1W2X A;  1ON3 A;  3KTH A;  3QKA A;  3RSI A;  4OG1 A;  3TVW A;  3GKB A;  4DI1 A;  5DU8 A;  3QYR A;  2A81 A;  2VSS F;  4EMM A;  5KDR B;  3Q0J A;  5JBW A;  1N6F A;  5DUC A;  2UZF A;  4Q1I A;  4B3H A;  2FZS A;  2C8T A;  3QXZ A;  3TZ3 A;  1FC7 A;  3V5I A;  1UYS A;  2PBP A;  3T8B A;  3SLL A;  4KD6 A;  3IB9 A;  3HIN A;  4JCT A;  2F9I B;  3TRR A;  3DOR A;  2FW2 A;  2Q34 A;  3KQF A;  3M6N A;  4KWB A;  1HNO A;  3FF6 A;  3GLM A;  4FB8 A;  3Q0G A;  2PG8 A;  4ZDE A;  3R9S A;  2EJ5 A;  2VX2 A;  4FZW A;  3K8X A;  2NP9 A;  4KPK A;  2F9Y B;  5JBX A;  2VSS E;  3HE2 A; 
#chains in the Genus database with same CATH topology
 2ZL0 A;  4MI2 A;  5G1Q A;  3P5M A;  3K50 A;  2Q2X A;  5KJP A;  3ZW9 A;  1NZY A;  5DTW A;  2CE3 A;  4Z0M A;  3T3W A;  2WTB A;  4JSB A;  4U19 A;  3IBB A;  2PPY A;  5INI A;  2ZL2 A;  3ZWC A;  2F6Q A;  3R0O A;  3SWX A;  4IZD A;  4ZDF A;  4FNB A;  2A7K A;  2VSU F;  1EY3 A;  4U18 A;  2HW5 A;  2ZL4 A;  5G1S A;  3U9T B;  5DKP A;  1NZY B;  3BF0 A;  3OME A;  4EMP A;  3QMJ A;  1TG6 A;  3NJB A;  1WDL A;  4WZ8 B;  2J5S A;  4YLH A;  5E0S H;  1VRG A;  2GTR A;  5FUS A;  3H02 A;  3LKE A;  4FN8 A;  3HP0 A;  2W3P A;  3WG5 A;  3RST A;  2FBM A;  4ELX A;  1DCI A;  3R9T A;  3N6R B;  3V5E A;  4U0G H;  3GF7 A;  1TYF A;  2F9I A;  2VSU A;  4JFC A;  3JU1 A;  3KTG A;  2Q35 A;  4JYJ A;  2VSU C;  4ZU2 A;  3ISA A;  3QXI A;  3TDC A;  1FC9 A;  3M6M A;  3T89 A;  4GM2 A;  3Q7H A;  3TVU A;  4JWV A;  4IZB A;  4K29 A;  3MT6 A;  2BZR A;  2VSU E;  1SZO A;  3GMA A;  3L3S A;  3H0Q A;  3LAO A;  1UYV A;  1HNU A;  3MFM A;  3T8A A;  5CTC A;  3KTI A;  3H0U A;  2VRE A;  4I52 A;  1N6D A;  2ZQQ A;  4F47 A;  4JCQ A;  3QRE A;  4RCN A;  4ASI A;  3PEA A;  1FC6 A;  1PJH A;  4QIJ A;  1XX4 A;  1K39 A;  3P85 A;  1O8U A;  4FND A;  4JYL A;  2YJG A;  4U0H A;  5C9G A;  3G64 A;  3PZK A;  4NEK A;  3MOY A;  1OD2 A;  1EF9 A;  4JJT A;  1OD4 A;  4MOU A;  3IAV A;  4OLQ A;  3OT6 A;  3P2L A;  3HRX A;  5INF A;  4WCZ A;  1Q51 A;  3MYB A;  4HNK A;  2ZQR A;  1UYT A;  5DL1 A;  3H81 A;  5C90 A;  5CTB A;  4WYO B;  4RYF A;  5DZK A;  5ING A;  1RJM A;  3BPT A;  3TV5 A;  3H0S A;  4FJW D;  4MXI A;  1Q52 A;  1ON9 A;  2QQ3 A;  4JVT A;  3KTJ A;  2X24 A;  1DUB A;  2ZL3 A;  4U0G A;  4NNQ A;  4FN7 A;  3HLN 1;  1EF8 A;  5FIF A;  4JCR A;  1XNW A;  4OMR A;  3I47 A;  1XNV A;  3RRV A;  4ZDB A;  3U9R B;  2VSS A;  1UIY A;  1K32 A;  4ZDC A;  1YG8 A;  3ST9 A;  2J5I B;  3TT6 A;  3DJA A;  4Q0G A;  4JOT A;  5IKL B;  2F6I A;  2J5G D;  4ELS A;  1J7X A;  4J2U A;  3ZWB A;  4JCS A;  4IZC A;  1X0U A;  1XO6 A;  5G1R A;  2J5I I;  5DZK H;  1WZ8 A;  3H0J A;  3PGQ A;  1RJN A;  3QK8 A;  5E0N X;  1N6E A;  1Y7O A;  2IEX A;  3BEZ A;  1YG6 A;  4I42 A;  3GF3 A;  2CBY A;  3R6H A;  5DUF A;  4NAR A;  5KDR A;  3STA A;  3ZW8 A;  3VIV A;  1SG4 A;  4QII A;  5E0S A;  1XNY A;  2DUB A;  2J5G A;  1PIX A;  4L6W A;  1WDK A;  4GHN A;  3FDU A;  3KTK A;  4LK5 A;  3TLF A;  5MGB A;  4I4Z A;  1HZD A;  3PE8 A;  4B3I A;  3BPP A;  3Q1T A;  1MJ3 A;  4ELW A;  3NJD A;  3U9S B;  5DU6 A;  2A7S A;  3ZWA A;  1JXZ A;  2X58 A;  2J5I A;  4FZW C;  4RYF H;  4EML A;  3QWD A;  4HC8 A;  4HDT A;  2D3T A;  1FCF A;  4K2N A;  5DU4 A;  5DTP A;  2DEO A;  4G2R A;  4B3J A;  4K3W A;  4KNP A;  1UYR A;  4L8K A;  3R9Q A;  4QFE A;  3T88 A;  4U1A A;  3TT7 A;  3OC7 A;  2F9Y A;  4ZDD A;  1WDM A;  1W2X A;  1ON3 A;  3KTH A;  3QKA A;  3RSI A;  4OG1 A;  5HUQ A;  3TVW A;  3GKB A;  4DI1 A;  5DU8 A;  3QYR A;  2A81 A;  2VSS F;  4EMM A;  5KDR B;  3Q0J A;  5JBW A;  1N6F A;  5DUC A;  2UZF A;  4Q1I A;  4B3H A;  2FZS A;  2C8T A;  3QXZ A;  3TZ3 A;  1FC7 A;  3V5I A;  1UYS A;  2PBP A;  3T8B A;  3SLL A;  4KD6 A;  3IB9 A;  3HIN A;  4JCT A;  2F9I B;  3TRR A;  3DOR A;  2FW2 A;  2Q34 A;  3KQF A;  3M6N A;  4KWB A;  1HNO A;  3FF6 A;  3GLM A;  4FB8 A;  3Q0G A;  2PG8 A;  4ZDE A;  3R9S A;  2EJ5 A;  2VX2 A;  4FZW A;  3K8X A;  2NP9 A;  4KPK A;  2F9Y B;  5JBX A;  2VSS E;  3HE2 A; 
#chains in the Genus database with same CATH homology
 2ZL0 A;  4MI2 A;  5G1Q A;  3P5M A;  3K50 A;  2Q2X A;  5KJP A;  3ZW9 A;  1NZY A;  5DTW A;  2CE3 A;  4Z0M A;  3T3W A;  2WTB A;  4JSB A;  4U19 A;  3IBB A;  2PPY A;  5INI A;  2ZL2 A;  3ZWC A;  2F6Q A;  3R0O A;  3SWX A;  4IZD A;  4ZDF A;  4FNB A;  2A7K A;  2VSU F;  1EY3 A;  4U18 A;  2HW5 A;  2ZL4 A;  5G1S A;  3U9T B;  5DKP A;  1NZY B;  3BF0 A;  3OME A;  4EMP A;  3QMJ A;  1TG6 A;  3NJB A;  1WDL A;  4WZ8 B;  2J5S A;  4YLH A;  5E0S H;  1VRG A;  2GTR A;  5FUS A;  3H02 A;  3LKE A;  4FN8 A;  3HP0 A;  2W3P A;  3WG5 A;  3RST A;  2FBM A;  4ELX A;  1DCI A;  3R9T A;  3N6R B;  3V5E A;  4U0G H;  3GF7 A;  1TYF A;  2F9I A;  2VSU A;  4JFC A;  3JU1 A;  3KTG A;  2Q35 A;  4JYJ A;  2VSU C;  4ZU2 A;  3ISA A;  3QXI A;  3TDC A;  1FC9 A;  3M6M A;  3T89 A;  4GM2 A;  3Q7H A;  3TVU A;  4JWV A;  4IZB A;  4K29 A;  3MT6 A;  2BZR A;  2VSU E;  1SZO A;  3GMA A;  3L3S A;  3H0Q A;  3LAO A;  1UYV A;  1HNU A;  3MFM A;  3T8A A;  5CTC A;  3KTI A;  3H0U A;  2VRE A;  4I52 A;  1N6D A;  2ZQQ A;  4F47 A;  4JCQ A;  3QRE A;  4RCN A;  4ASI A;  3PEA A;  1FC6 A;  1PJH A;  4QIJ A;  1XX4 A;  1K39 A;  3P85 A;  1O8U A;  4FND A;  4JYL A;  2YJG A;  4U0H A;  5C9G A;  3G64 A;  3PZK A;  4NEK A;  3MOY A;  1OD2 A;  1EF9 A;  4JJT A;  1OD4 A;  4MOU A;  3IAV A;  4OLQ A;  3OT6 A;  3P2L A;  3HRX A;  5INF A;  4WCZ A;  1Q51 A;  3MYB A;  4HNK A;  2ZQR A;  1UYT A;  5DL1 A;  3H81 A;  5C90 A;  5CTB A;  4WYO B;  4RYF A;  5DZK A;  5ING A;  1RJM A;  3BPT A;  3TV5 A;  3H0S A;  4FJW D;  4MXI A;  1Q52 A;  1ON9 A;  2QQ3 A;  4JVT A;  3KTJ A;  2X24 A;  1DUB A;  2ZL3 A;  4U0G A;  4NNQ A;  4FN7 A;  3HLN 1;  1EF8 A;  5FIF A;  4JCR A;  1XNW A;  4OMR A;  3I47 A;  1XNV A;  3RRV A;  4ZDB A;  3U9R B;  2VSS A;  1UIY A;  1K32 A;  4ZDC A;  1YG8 A;  3ST9 A;  2J5I B;  3TT6 A;  3DJA A;  4Q0G A;  4JOT A;  5IKL B;  2F6I A;  2J5G D;  4ELS A;  1J7X A;  4J2U A;  3ZWB A;  4JCS A;  4IZC A;  1X0U A;  1XO6 A;  5G1R A;  2J5I I;  5DZK H;  1WZ8 A;  3H0J A;  3PGQ A;  1RJN A;  3QK8 A;  5E0N X;  1N6E A;  1Y7O A;  2IEX A;  3BEZ A;  1YG6 A;  4I42 A;  3GF3 A;  2CBY A;  3R6H A;  5DUF A;  4NAR A;  5KDR A;  3STA A;  3ZW8 A;  3VIV A;  1SG4 A;  4QII A;  5E0S A;  1XNY A;  2DUB A;  2J5G A;  1PIX A;  4L6W A;  1WDK A;  4GHN A;  3FDU A;  3KTK A;  4LK5 A;  3TLF A;  5MGB A;  4I4Z A;  1HZD A;  3PE8 A;  4B3I A;  3BPP A;  3Q1T A;  1MJ3 A;  4ELW A;  3NJD A;  3U9S B;  5DU6 A;  2A7S A;  3ZWA A;  1JXZ A;  2X58 A;  2J5I A;  4FZW C;  4RYF H;  4EML A;  3QWD A;  4HC8 A;  4HDT A;  2D3T A;  1FCF A;  4K2N A;  5DU4 A;  5DTP A;  2DEO A;  4G2R A;  4B3J A;  4K3W A;  4KNP A;  1UYR A;  4L8K A;  3R9Q A;  4QFE A;  3T88 A;  4U1A A;  3TT7 A;  3OC7 A;  2F9Y A;  4ZDD A;  1WDM A;  1W2X A;  1ON3 A;  3KTH A;  3QKA A;  3RSI A;  4OG1 A;  5HUQ A;  3TVW A;  3GKB A;  4DI1 A;  5DU8 A;  3QYR A;  2A81 A;  2VSS F;  4EMM A;  5KDR B;  3Q0J A;  5JBW A;  1N6F A;  5DUC A;  2UZF A;  4Q1I A;  4B3H A;  2FZS A;  2C8T A;  3QXZ A;  3TZ3 A;  1FC7 A;  3V5I A;  1UYS A;  2PBP A;  3T8B A;  3SLL A;  4KD6 A;  3IB9 A;  3HIN A;  4JCT A;  2F9I B;  3TRR A;  3DOR A;  2FW2 A;  2Q34 A;  3KQF A;  3M6N A;  4KWB A;  1HNO A;  3FF6 A;  3GLM A;  4FB8 A;  3Q0G A;  2PG8 A;  4ZDE A;  3R9S A;  2EJ5 A;  2VX2 A;  4FZW A;  3K8X A;  2NP9 A;  4KPK A;  2F9Y B;  5JBX A;  2VSS E;  3HE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...