3PEAA

Crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor'
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
b'MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFSAGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDGREGVAAFLEKRKPSFSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase family protein
publication title Crystal structure of enoyl-CoA hydratase from Bacillus anthracis str. 'Ames Ancestor'
rcsb
source organism Bacillus anthracis
molecule tags Isomerase
total genus 94
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3peaA00
3TLFA 2VSSE 4QFEA 1JXZA 4G2RA 1UYTA 3L3SA 3R9TA 1OD2A 3PE8A 4OG1A 4K2NA 4WCZA 3ZW9A 5E0SH 4Z0MA 3R9QA 3WG5A 3HP0A 2IEXA 3U9SB 2F9IB 1TG6A 1J7XA 4EMPA 2VREA 1HNUA 3ZWAA 3NJBA 3H0JA 5C90A 2F6QA 3M6MA 1X0UA 2F9YA 3ZWCA 4ZDFA 2NP9A 1OD4A 3RSIA 2A81A 2Q35A 2F9YB 3H0UA 2X24A 1YG8A 2J5GA 3DORA 4NEKA 4JOTA 4B3HA 2D3TA 3GLMA 2HW5A 1XNVA 1FCFA 3OC7A 4I4ZA 4L8KA 4ELWA 3BEZA 3ISAA 3JU1A 4EMLA 3MYBA 3U9TB 3PZKA 1WZ8A 1PJHA 3STAA 3KTKA 5G1RA 3HINA 1YG6A 2EJ5A 3P85A 3H0SA 2Q34A 1ON3A 4B3JA 3FF6A 1EY3A 5DTPA 5DUCA 4RYFA 4LK5A 4KD6A 5G1SA 3PEAA 5MGBA 2DUBA 3QXZA 3OMEA 4WYOB 3MOYA 3BF0A 1DUBA 1RJMA 3BPPA 4FNDA 2X58A 3QWDA 4JCQA 1XO6A 1FC7A 4FN8A 3MT6A 3VIVA 5FUSA 3ZWBA 4OLQA 2ZL0A 1WDKA 3IB9A 3LAOA 4ZDEA 3IBBA 1RJNA 3QMJA 4MXIA 3U9RB 1EF9A 1DCIA 5DTWA 2DEOA 3Q1TA 3TVWA 3I47A 3Q0JA 5DU4A 5INGA 4GHNA 4WZ8B 4GM2A 3TT7A 1EF8A 3TVUA 3T88A 4MOUA 4OMRA 5DU6A 3PGQA 4JFCA 1SZOA 1O8UA 4QIJA 3HE2A 2PBPA 3DJAA 3HLN1 2FBMA 2FZSA 1K32A 4RYFH 4JJTA 3T8BA 4JCRA 3IAVA 4K3WA 4QIIA 4U18A 3RSTA 3SLLA 3H02A 3LKEA 1NZYA 4I52A 4IZDA 4HNKA 5CTCA 4ZU2A 2PG8A 2J5GD 1NZYB 3R9SA 3M6NA 4ELSA 2PPYA 1XX4A 5DUFA 4Q0GA 3R0OA 3V5EA 3P5MA 1UYSA 5KDRA 4U19A 1Y7OA 3H81A 3SWXA 3T89A 2C8TA 3FDUA 4JCTA 4Q1IA 1WDMA 3TZ3A 1PIXA 1W2XA 4JVTA 3T3WA 1N6DA 4U0HA 1FC9A 1SG4A 4KWBA 4U0GH 5INIA 3QXIA 3GMAA 2VSSA 3KTGA 2WTBA 2GTRA 2J5IA 2A7KA 5INFA 3QYRA 4FB8A 5DL1A 4IZBA 4F47A 3RRVA 1UIYA 1UYVA 3Q7HA 3QK8A 2UZFA 4JWVA 3GKBA 4ELXA 3K8XA 5DKPA 2ZL3A 2W3PA 2ZL4A 4FZWC 4FZWA 4FN7A 4MI2A 3GF3A 4U0GA 1TYFA 2VSSF 3P2LA 3N6RB 3GF7A 2F9IA 1XNYA 3ST9A 1N6FA 4YLHA 5C9GA 4NNQA 5DZKA 4JYLA 4B3IA 2VX2A 3OT6A 3TV5A 2ZQQA 3TDCA 2QQ3A 4K29A 4EMMA 3KTHA 2A7SA 2VSUA 2VSUC 4JSBA 2J5SA 5E0NX 5KJPA 1K39A 1HNOA 5E0SA 4RCNA 1WDLA 1UYRA 3Q0GA 2BZRA 5IKLB 5FIFA 3K50A 3T8AA 3QREA 2FW2A 4ASIA 2VSUE 1HZDA 4JYJA 3KQFA 1VRGA 4FJWD 1Q52A 2ZL2A 2ZQRA 2VSUF 3HRXA 3ZW8A 4ZDBA 3MFMA 4KPKA 3KTJA 4FNBA 5KDRB 5DU8A 3V5IA 4ZDDA 1MJ3A 1ON9A 2CBYA 4I42A 1Q51A 2CE3A 4IZCA 2J5II 3H0QA 5JBWA 4HC8A 2Q2XA 1N6EA 4KNPA 3TT6A 3KTIA 5CTBA 3QKAA 3G64A 3R6HA 2F6IA 4U1AA 5JBXA 4ZDCA 4JCSA 3NJDA 5DZKH 2J5IB 4DI1A 3TRRA 1FC6A 1XNWA 4L6WA 5G1QA
chains in the Genus database with same CATH superfamily
3TLFA 2VSSE 4QFEA 1JXZA 4G2RA 1UYTA 3L3SA 3R9TA 1OD2A 3PE8A 4OG1A 4K2NA 4WCZA 3ZW9A 5E0SH 4Z0MA 3R9QA 3WG5A 3HP0A 2IEXA 3U9SB 2F9IB 1TG6A 1J7XA 4EMPA 2VREA 1HNUA 3ZWAA 3NJBA 3H0JA 5C90A 2F6QA 3M6MA 1X0UA 2F9YA 3ZWCA 4ZDFA 2NP9A 1OD4A 3RSIA 2A81A 2Q35A 2F9YB 3H0UA 2X24A 1YG8A 2J5GA 3DORA 4NEKA 4JOTA 4B3HA 2D3TA 3GLMA 2HW5A 1XNVA 1FCFA 3OC7A 4I4ZA 4L8KA 4ELWA 3BEZA 3ISAA 3JU1A 4EMLA 3MYBA 3U9TB 3PZKA 1WZ8A 1PJHA 4NARA 3STAA 3KTKA 5G1RA 3HINA 1YG6A 2EJ5A 3P85A 3H0SA 2Q34A 1ON3A 4B3JA 3FF6A 1EY3A 5DTPA 5DUCA 4RYFA 4LK5A 4KD6A 5G1SA 3PEAA 5MGBA 2DUBA 3QXZA 3OMEA 4WYOB 3MOYA 3BF0A 1DUBA 1RJMA 4J2UA 3BPPA 4FNDA 2X58A 3QWDA 4JCQA 1XO6A 1FC7A 4FN8A 3MT6A 3VIVA 5FUSA 3ZWBA 4OLQA 2ZL0A 1WDKA 3IB9A 3LAOA 4ZDEA 3IBBA 1RJNA 3QMJA 4MXIA 3U9RB 1EF9A 4HDTA 1DCIA 5DTWA 2DEOA 3Q1TA 3TVWA 3I47A 3Q0JA 5DU4A 5INGA 4GHNA 4WZ8B 4GM2A 3TT7A 1EF8A 3TVUA 3T88A 4MOUA 4OMRA 5DU6A 3PGQA 4JFCA 1SZOA 1O8UA 4QIJA 3HE2A 2PBPA 3DJAA 3HLN1 2FBMA 2FZSA 1K32A 4RYFH 4JJTA 3T8BA 4JCRA 3IAVA 4K3WA 4QIIA 4U18A 3RSTA 3SLLA 3H02A 3LKEA 1NZYA 4I52A 4IZDA 4HNKA 5CTCA 4ZU2A 2PG8A 2J5GD 1NZYB 3R9SA 3M6NA 4ELSA 2PPYA 1XX4A 5DUFA 4Q0GA 3R0OA 3V5EA 3P5MA 1UYSA 3BPTA 5KDRA 4U19A 1Y7OA 3H81A 3SWXA 3T89A 2C8TA 3FDUA 4JCTA 4Q1IA 1WDMA 3TZ3A 1PIXA 1W2XA 4JVTA 3T3WA 1N6DA 4U0HA 1FC9A 1SG4A 4KWBA 4U0GH 5INIA 3QXIA 3GMAA 2VSSA 3KTGA 2WTBA 2GTRA 2J5IA 2A7KA 5INFA 3QYRA 4FB8A 5DL1A 4IZBA 4F47A 3RRVA 1UIYA 1UYVA 3Q7HA 3QK8A 2UZFA 4JWVA 3GKBA 4ELXA 3K8XA 5DKPA 2ZL3A 2W3PA 2ZL4A 4FZWC 4FZWA 4FN7A 4MI2A 3GF3A 4U0GA 1TYFA 2VSSF 3P2LA 3N6RB 3GF7A 2F9IA 1XNYA 3ST9A 1N6FA 4YLHA 5C9GA 4NNQA 5DZKA 4JYLA 4B3IA 2VX2A 3OT6A 3TV5A 2ZQQA 3TDCA 2QQ3A 4K29A 4EMMA 3KTHA 2A7SA 2VSUA 2VSUC 4JSBA 2J5SA 5E0NX 5HUQA 2YJGA 5KJPA 1K39A 1HNOA 5E0SA 4RCNA 1WDLA 1UYRA 3Q0GA 2BZRA 5IKLB 5FIFA 3K50A 3T8AA 3QREA 2FW2A 4ASIA 2VSUE 1HZDA 4JYJA 3KQFA 1VRGA 4FJWD 1Q52A 2ZL2A 2ZQRA 2VSUF 3HRXA 3ZW8A 4ZDBA 3MFMA 4KPKA 3KTJA 4FNBA 5KDRB 5DU8A 3V5IA 4ZDDA 1MJ3A 1ON9A 2CBYA 4I42A 1Q51A 2CE3A 4IZCA 2J5II 3H0QA 5JBWA 4HC8A 2Q2XA 1N6EA 4KNPA 3TT6A 3KTIA 5CTBA 3QKAA 3G64A 3R6HA 2F6IA 4U1AA 5JBXA 4ZDCA 4JCSA 3NJDA 5DZKH 2J5IB 4DI1A 3TRRA 1FC6A 1XNWA 4L6WA 5G1QA
chains in the Genus database with same CATH topology
3TLFA 2VSSE 4QFEA 1JXZA 4G2RA 1UYTA 3L3SA 3R9TA 1OD2A 3PE8A 4OG1A 4K2NA 4WCZA 3ZW9A 5E0SH 4Z0MA 3R9QA 3WG5A 3HP0A 2IEXA 3U9SB 2F9IB 1TG6A 1J7XA 4EMPA 2VREA 1HNUA 3ZWAA 3NJBA 3H0JA 5C90A 2F6QA 3M6MA 1X0UA 2F9YA 3ZWCA 4ZDFA 2NP9A 1OD4A 3RSIA 2A81A 2Q35A 2F9YB 3H0UA 2X24A 1YG8A 2J5GA 3DORA 4NEKA 4JOTA 4B3HA 2D3TA 3GLMA 2HW5A 1XNVA 1FCFA 3OC7A 4I4ZA 4L8KA 4ELWA 3BEZA 3ISAA 3JU1A 4EMLA 3MYBA 3U9TB 3PZKA 1WZ8A 1PJHA 4NARA 3STAA 3KTKA 5G1RA 3HINA 1YG6A 2EJ5A 3P85A 3H0SA 2Q34A 1ON3A 4B3JA 3FF6A 1EY3A 5DTPA 5DUCA 4RYFA 4LK5A 4KD6A 5G1SA 3PEAA 5MGBA 2DUBA 3QXZA 3OMEA 4WYOB 3MOYA 3BF0A 1DUBA 1RJMA 4J2UA 3BPPA 4FNDA 2X58A 3QWDA 4JCQA 1XO6A 1FC7A 4FN8A 3MT6A 3VIVA 5FUSA 3ZWBA 4OLQA 2ZL0A 1WDKA 3IB9A 3LAOA 4ZDEA 3IBBA 1RJNA 3QMJA 4MXIA 3U9RB 1EF9A 4HDTA 1DCIA 5DTWA 2DEOA 3Q1TA 3TVWA 3I47A 3Q0JA 5DU4A 5INGA 4GHNA 4WZ8B 4GM2A 3TT7A 1EF8A 3TVUA 3T88A 4MOUA 4OMRA 5DU6A 3PGQA 4JFCA 1SZOA 1O8UA 4QIJA 3HE2A 2PBPA 3DJAA 3HLN1 2FBMA 2FZSA 1K32A 4RYFH 4JJTA 3T8BA 4JCRA 3IAVA 4K3WA 4QIIA 4U18A 3RSTA 3SLLA 3H02A 3LKEA 1NZYA 4I52A 4IZDA 4HNKA 5CTCA 4ZU2A 2PG8A 2J5GD 1NZYB 3R9SA 3M6NA 4ELSA 2PPYA 1XX4A 5DUFA 4Q0GA 3R0OA 3V5EA 3P5MA 1UYSA 3BPTA 5KDRA 4U19A 1Y7OA 3H81A 3SWXA 3T89A 2C8TA 3FDUA 4JCTA 4Q1IA 1WDMA 3TZ3A 1PIXA 1W2XA 4JVTA 3T3WA 1N6DA 4U0HA 1FC9A 1SG4A 4KWBA 4U0GH 5INIA 3QXIA 3GMAA 2VSSA 3KTGA 2WTBA 2GTRA 2J5IA 2A7KA 5INFA 3QYRA 4FB8A 5DL1A 4IZBA 4F47A 3RRVA 1UIYA 1UYVA 3Q7HA 3QK8A 2UZFA 4JWVA 3GKBA 4ELXA 3K8XA 5DKPA 2ZL3A 2W3PA 2ZL4A 4FZWC 4FZWA 4FN7A 4MI2A 3GF3A 4U0GA 1TYFA 2VSSF 3P2LA 3N6RB 3GF7A 2F9IA 1XNYA 3ST9A 1N6FA 4YLHA 5C9GA 4NNQA 5DZKA 4JYLA 4B3IA 2VX2A 3OT6A 3TV5A 2ZQQA 3TDCA 2QQ3A 4K29A 4EMMA 3KTHA 2A7SA 2VSUA 2VSUC 4JSBA 2J5SA 5E0NX 5HUQA 2YJGA 5KJPA 1K39A 1HNOA 5E0SA 4RCNA 1WDLA 1UYRA 3Q0GA 2BZRA 5IKLB 5FIFA 3K50A 3T8AA 3QREA 2FW2A 4ASIA 2VSUE 1HZDA 4JYJA 3KQFA 1VRGA 4FJWD 1Q52A 2ZL2A 2ZQRA 2VSUF 3HRXA 3ZW8A 4ZDBA 3MFMA 4KPKA 3KTJA 4FNBA 5KDRB 5DU8A 3V5IA 4ZDDA 1MJ3A 1ON9A 2CBYA 4I42A 1Q51A 2CE3A 4IZCA 2J5II 3H0QA 5JBWA 4HC8A 2Q2XA 1N6EA 4KNPA 3TT6A 3KTIA 5CTBA 3QKAA 3G64A 3R6HA 2F6IA 4U1AA 5JBXA 4ZDCA 4JCSA 3NJDA 5DZKH 2J5IB 4DI1A 3TRRA 1FC6A 1XNWA 4L6WA 5G1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLF A;  2VSS E;  4QFE A;  1JXZ A;  4G2R A;  1UYT A;  3L3S A;  3R9T A;  1OD2 A;  3PE8 A;  4OG1 A;  4K2N A;  4WCZ A;  3ZW9 A;  5E0S H;  4Z0M A;  3R9Q A;  3WG5 A;  3HP0 A;  2IEX A;  3U9S B;  2F9I B;  1TG6 A;  1J7X A;  4EMP A;  2VRE A;  1HNU A;  3ZWA A;  3NJB A;  3H0J A;  5C90 A;  2F6Q A;  3M6M A;  1X0U A;  2F9Y A;  3ZWC A;  4ZDF A;  2NP9 A;  1OD4 A;  3RSI A;  2A81 A;  2Q35 A;  2F9Y B;  3H0U A;  2X24 A;  1YG8 A;  2J5G A;  3DOR A;  4NEK A;  4JOT A;  4B3H A;  2D3T A;  3GLM A;  2HW5 A;  1XNV A;  1FCF A;  3OC7 A;  4I4Z A;  4L8K A;  4ELW A;  3BEZ A;  3ISA A;  3JU1 A;  4EML A;  3MYB A;  3U9T B;  3PZK A;  1WZ8 A;  1PJH A;  3STA A;  3KTK A;  5G1R A;  3HIN A;  1YG6 A;  2EJ5 A;  3P85 A;  3H0S A;  2Q34 A;  1ON3 A;  4B3J A;  3FF6 A;  1EY3 A;  5DTP A;  5DUC A;  4RYF A;  4LK5 A;  4KD6 A;  5G1S A;  3PEA A;  5MGB A;  2DUB A;  3QXZ A;  3OME A;  4WYO B;  3MOY A;  3BF0 A;  1DUB A;  1RJM A;  3BPP A;  4FND A;  2X58 A;  3QWD A;  4JCQ A;  1XO6 A;  1FC7 A;  4FN8 A;  3MT6 A;  3VIV A;  5FUS A;  3ZWB A;  4OLQ A;  2ZL0 A;  1WDK A;  3IB9 A;  3LAO A;  4ZDE A;  3IBB A;  1RJN A;  3QMJ A;  4MXI A;  3U9R B;  1EF9 A;  1DCI A;  5DTW A;  2DEO A;  3Q1T A;  3TVW A;  3I47 A;  3Q0J A;  5DU4 A;  5ING A;  4GHN A;  4WZ8 B;  4GM2 A;  3TT7 A;  1EF8 A;  3TVU A;  3T88 A;  4MOU A;  4OMR A;  5DU6 A;  3PGQ A;  4JFC A;  1SZO A;  1O8U A;  4QIJ A;  3HE2 A;  2PBP A;  3DJA A;  3HLN 1;  2FBM A;  2FZS A;  1K32 A;  4RYF H;  4JJT A;  3T8B A;  4JCR A;  3IAV A;  4K3W A;  4QII A;  4U18 A;  3RST A;  3SLL A;  3H02 A;  3LKE A;  1NZY A;  4I52 A;  4IZD A;  4HNK A;  5CTC A;  4ZU2 A;  2PG8 A;  2J5G D;  1NZY B;  3R9S A;  3M6N A;  4ELS A;  2PPY A;  1XX4 A;  5DUF A;  4Q0G A;  3R0O A;  3V5E A;  3P5M A;  1UYS A;  5KDR A;  4U19 A;  1Y7O A;  3H81 A;  3SWX A;  3T89 A;  2C8T A;  3FDU A;  4JCT A;  4Q1I A;  1WDM A;  3TZ3 A;  1PIX A;  1W2X A;  4JVT A;  3T3W A;  1N6D A;  4U0H A;  1FC9 A;  1SG4 A;  4KWB A;  4U0G H;  5INI A;  3QXI A;  3GMA A;  2VSS A;  3KTG A;  2WTB A;  2GTR A;  2J5I A;  2A7K A;  5INF A;  3QYR A;  4FB8 A;  5DL1 A;  4IZB A;  4F47 A;  3RRV A;  1UIY A;  1UYV A;  3Q7H A;  3QK8 A;  2UZF A;  4JWV A;  3GKB A;  4ELX A;  3K8X A;  5DKP A;  2ZL3 A;  2W3P A;  2ZL4 A;  4FZW C;  4FZW A;  4FN7 A;  4MI2 A;  3GF3 A;  4U0G A;  1TYF A;  2VSS F;  3P2L A;  3N6R B;  3GF7 A;  2F9I A;  1XNY A;  3ST9 A;  1N6F A;  4YLH A;  5C9G A;  4NNQ A;  5DZK A;  4JYL A;  4B3I A;  2VX2 A;  3OT6 A;  3TV5 A;  2ZQQ A;  3TDC A;  2QQ3 A;  4K29 A;  4EMM A;  3KTH A;  2A7S A;  2VSU A;  2VSU C;  4JSB A;  2J5S A;  5E0N X;  5KJP A;  1K39 A;  1HNO A;  5E0S A;  4RCN A;  1WDL A;  1UYR A;  3Q0G A;  2BZR A;  5IKL B;  5FIF A;  3K50 A;  3T8A A;  3QRE A;  2FW2 A;  4ASI A;  2VSU E;  1HZD A;  4JYJ A;  3KQF A;  1VRG A;  4FJW D;  1Q52 A;  2ZL2 A;  2ZQR A;  2VSU F;  3HRX A;  3ZW8 A;  4ZDB A;  3MFM A;  4KPK A;  3KTJ A;  4FNB A;  5KDR B;  5DU8 A;  3V5I A;  4ZDD A;  1MJ3 A;  1ON9 A;  2CBY A;  4I42 A;  1Q51 A;  2CE3 A;  4IZC A;  2J5I I;  3H0Q A;  5JBW A;  4HC8 A;  2Q2X A;  1N6E A;  4KNP A;  3TT6 A;  3KTI A;  5CTB A;  3QKA A;  3G64 A;  3R6H A;  2F6I A;  4U1A A;  5JBX A;  4ZDC A;  4JCS A;  3NJD A;  5DZK H;  2J5I B;  4DI1 A;  3TRR A;  1FC6 A;  1XNW A;  4L6W A;  5G1Q A; 
#chains in the Genus database with same CATH topology
 3TLF A;  2VSS E;  4QFE A;  1JXZ A;  4G2R A;  1UYT A;  3L3S A;  3R9T A;  1OD2 A;  3PE8 A;  4OG1 A;  4K2N A;  4WCZ A;  3ZW9 A;  5E0S H;  4Z0M A;  3R9Q A;  3WG5 A;  3HP0 A;  2IEX A;  3U9S B;  2F9I B;  1TG6 A;  1J7X A;  4EMP A;  2VRE A;  1HNU A;  3ZWA A;  3NJB A;  3H0J A;  5C90 A;  2F6Q A;  3M6M A;  1X0U A;  2F9Y A;  3ZWC A;  4ZDF A;  2NP9 A;  1OD4 A;  3RSI A;  2A81 A;  2Q35 A;  2F9Y B;  3H0U A;  2X24 A;  1YG8 A;  2J5G A;  3DOR A;  4NEK A;  4JOT A;  4B3H A;  2D3T A;  3GLM A;  2HW5 A;  1XNV A;  1FCF A;  3OC7 A;  4I4Z A;  4L8K A;  4ELW A;  3BEZ A;  3ISA A;  3JU1 A;  4EML A;  3MYB A;  3U9T B;  3PZK A;  1WZ8 A;  1PJH A;  4NAR A;  3STA A;  3KTK A;  5G1R A;  3HIN A;  1YG6 A;  2EJ5 A;  3P85 A;  3H0S A;  2Q34 A;  1ON3 A;  4B3J A;  3FF6 A;  1EY3 A;  5DTP A;  5DUC A;  4RYF A;  4LK5 A;  4KD6 A;  5G1S A;  3PEA A;  5MGB A;  2DUB A;  3QXZ A;  3OME A;  4WYO B;  3MOY A;  3BF0 A;  1DUB A;  1RJM A;  4J2U A;  3BPP A;  4FND A;  2X58 A;  3QWD A;  4JCQ A;  1XO6 A;  1FC7 A;  4FN8 A;  3MT6 A;  3VIV A;  5FUS A;  3ZWB A;  4OLQ A;  2ZL0 A;  1WDK A;  3IB9 A;  3LAO A;  4ZDE A;  3IBB A;  1RJN A;  3QMJ A;  4MXI A;  3U9R B;  1EF9 A;  4HDT A;  1DCI A;  5DTW A;  2DEO A;  3Q1T A;  3TVW A;  3I47 A;  3Q0J A;  5DU4 A;  5ING A;  4GHN A;  4WZ8 B;  4GM2 A;  3TT7 A;  1EF8 A;  3TVU A;  3T88 A;  4MOU A;  4OMR A;  5DU6 A;  3PGQ A;  4JFC A;  1SZO A;  1O8U A;  4QIJ A;  3HE2 A;  2PBP A;  3DJA A;  3HLN 1;  2FBM A;  2FZS A;  1K32 A;  4RYF H;  4JJT A;  3T8B A;  4JCR A;  3IAV A;  4K3W A;  4QII A;  4U18 A;  3RST A;  3SLL A;  3H02 A;  3LKE A;  1NZY A;  4I52 A;  4IZD A;  4HNK A;  5CTC A;  4ZU2 A;  2PG8 A;  2J5G D;  1NZY B;  3R9S A;  3M6N A;  4ELS A;  2PPY A;  1XX4 A;  5DUF A;  4Q0G A;  3R0O A;  3V5E A;  3P5M A;  1UYS A;  3BPT A;  5KDR A;  4U19 A;  1Y7O A;  3H81 A;  3SWX A;  3T89 A;  2C8T A;  3FDU A;  4JCT A;  4Q1I A;  1WDM A;  3TZ3 A;  1PIX A;  1W2X A;  4JVT A;  3T3W A;  1N6D A;  4U0H A;  1FC9 A;  1SG4 A;  4KWB A;  4U0G H;  5INI A;  3QXI A;  3GMA A;  2VSS A;  3KTG A;  2WTB A;  2GTR A;  2J5I A;  2A7K A;  5INF A;  3QYR A;  4FB8 A;  5DL1 A;  4IZB A;  4F47 A;  3RRV A;  1UIY A;  1UYV A;  3Q7H A;  3QK8 A;  2UZF A;  4JWV A;  3GKB A;  4ELX A;  3K8X A;  5DKP A;  2ZL3 A;  2W3P A;  2ZL4 A;  4FZW C;  4FZW A;  4FN7 A;  4MI2 A;  3GF3 A;  4U0G A;  1TYF A;  2VSS F;  3P2L A;  3N6R B;  3GF7 A;  2F9I A;  1XNY A;  3ST9 A;  1N6F A;  4YLH A;  5C9G A;  4NNQ A;  5DZK A;  4JYL A;  4B3I A;  2VX2 A;  3OT6 A;  3TV5 A;  2ZQQ A;  3TDC A;  2QQ3 A;  4K29 A;  4EMM A;  3KTH A;  2A7S A;  2VSU A;  2VSU C;  4JSB A;  2J5S A;  5E0N X;  5HUQ A;  2YJG A;  5KJP A;  1K39 A;  1HNO A;  5E0S A;  4RCN A;  1WDL A;  1UYR A;  3Q0G A;  2BZR A;  5IKL B;  5FIF A;  3K50 A;  3T8A A;  3QRE A;  2FW2 A;  4ASI A;  2VSU E;  1HZD A;  4JYJ A;  3KQF A;  1VRG A;  4FJW D;  1Q52 A;  2ZL2 A;  2ZQR A;  2VSU F;  3HRX A;  3ZW8 A;  4ZDB A;  3MFM A;  4KPK A;  3KTJ A;  4FNB A;  5KDR B;  5DU8 A;  3V5I A;  4ZDD A;  1MJ3 A;  1ON9 A;  2CBY A;  4I42 A;  1Q51 A;  2CE3 A;  4IZC A;  2J5I I;  3H0Q A;  5JBW A;  4HC8 A;  2Q2X A;  1N6E A;  4KNP A;  3TT6 A;  3KTI A;  5CTB A;  3QKA A;  3G64 A;  3R6H A;  2F6I A;  4U1A A;  5JBX A;  4ZDC A;  4JCS A;  3NJD A;  5DZK H;  2J5I B;  4DI1 A;  3TRR A;  1FC6 A;  1XNW A;  4L6W A;  5G1Q A; 
#chains in the Genus database with same CATH homology
 3TLF A;  2VSS E;  4QFE A;  1JXZ A;  4G2R A;  1UYT A;  3L3S A;  3R9T A;  1OD2 A;  3PE8 A;  4OG1 A;  4K2N A;  4WCZ A;  3ZW9 A;  5E0S H;  4Z0M A;  3R9Q A;  3WG5 A;  3HP0 A;  2IEX A;  3U9S B;  2F9I B;  1TG6 A;  1J7X A;  4EMP A;  2VRE A;  1HNU A;  3ZWA A;  3NJB A;  3H0J A;  5C90 A;  2F6Q A;  3M6M A;  1X0U A;  2F9Y A;  3ZWC A;  4ZDF A;  2NP9 A;  1OD4 A;  3RSI A;  2A81 A;  2Q35 A;  2F9Y B;  3H0U A;  2X24 A;  1YG8 A;  2J5G A;  3DOR A;  4NEK A;  4JOT A;  4B3H A;  2D3T A;  3GLM A;  2HW5 A;  1XNV A;  1FCF A;  3OC7 A;  4I4Z A;  4L8K A;  4ELW A;  3BEZ A;  3ISA A;  3JU1 A;  4EML A;  3MYB A;  3U9T B;  3PZK A;  1WZ8 A;  1PJH A;  4NAR A;  3STA A;  3KTK A;  5G1R A;  3HIN A;  1YG6 A;  2EJ5 A;  3P85 A;  3H0S A;  2Q34 A;  1ON3 A;  4B3J A;  3FF6 A;  1EY3 A;  5DTP A;  5DUC A;  4RYF A;  4LK5 A;  4KD6 A;  5G1S A;  3PEA A;  5MGB A;  2DUB A;  3QXZ A;  3OME A;  4WYO B;  3MOY A;  3BF0 A;  1DUB A;  1RJM A;  4J2U A;  3BPP A;  4FND A;  2X58 A;  3QWD A;  4JCQ A;  1XO6 A;  1FC7 A;  4FN8 A;  3MT6 A;  3VIV A;  5FUS A;  3ZWB A;  4OLQ A;  2ZL0 A;  1WDK A;  3IB9 A;  3LAO A;  4ZDE A;  3IBB A;  1RJN A;  3QMJ A;  4MXI A;  3U9R B;  1EF9 A;  4HDT A;  1DCI A;  5DTW A;  2DEO A;  3Q1T A;  3TVW A;  3I47 A;  3Q0J A;  5DU4 A;  5ING A;  4GHN A;  4WZ8 B;  4GM2 A;  3TT7 A;  1EF8 A;  3TVU A;  3T88 A;  4MOU A;  4OMR A;  5DU6 A;  3PGQ A;  4JFC A;  1SZO A;  1O8U A;  4QIJ A;  3HE2 A;  2PBP A;  3DJA A;  3HLN 1;  2FBM A;  2FZS A;  1K32 A;  4RYF H;  4JJT A;  3T8B A;  4JCR A;  3IAV A;  4K3W A;  4QII A;  4U18 A;  3RST A;  3SLL A;  3H02 A;  3LKE A;  1NZY A;  4I52 A;  4IZD A;  4HNK A;  5CTC A;  4ZU2 A;  2PG8 A;  2J5G D;  1NZY B;  3R9S A;  3M6N A;  4ELS A;  2PPY A;  1XX4 A;  5DUF A;  4Q0G A;  3R0O A;  3V5E A;  3P5M A;  1UYS A;  3BPT A;  5KDR A;  4U19 A;  1Y7O A;  3H81 A;  3SWX A;  3T89 A;  2C8T A;  3FDU A;  4JCT A;  4Q1I A;  1WDM A;  3TZ3 A;  1PIX A;  1W2X A;  4JVT A;  3T3W A;  1N6D A;  4U0H A;  1FC9 A;  1SG4 A;  4KWB A;  4U0G H;  5INI A;  3QXI A;  3GMA A;  2VSS A;  3KTG A;  2WTB A;  2GTR A;  2J5I A;  2A7K A;  5INF A;  3QYR A;  4FB8 A;  5DL1 A;  4IZB A;  4F47 A;  3RRV A;  1UIY A;  1UYV A;  3Q7H A;  3QK8 A;  2UZF A;  4JWV A;  3GKB A;  4ELX A;  3K8X A;  5DKP A;  2ZL3 A;  2W3P A;  2ZL4 A;  4FZW C;  4FZW A;  4FN7 A;  4MI2 A;  3GF3 A;  4U0G A;  1TYF A;  2VSS F;  3P2L A;  3N6R B;  3GF7 A;  2F9I A;  1XNY A;  3ST9 A;  1N6F A;  4YLH A;  5C9G A;  4NNQ A;  5DZK A;  4JYL A;  4B3I A;  2VX2 A;  3OT6 A;  3TV5 A;  2ZQQ A;  3TDC A;  2QQ3 A;  4K29 A;  4EMM A;  3KTH A;  2A7S A;  2VSU A;  2VSU C;  4JSB A;  2J5S A;  5E0N X;  5HUQ A;  2YJG A;  5KJP A;  1K39 A;  1HNO A;  5E0S A;  4RCN A;  1WDL A;  1UYR A;  3Q0G A;  2BZR A;  5IKL B;  5FIF A;  3K50 A;  3T8A A;  3QRE A;  2FW2 A;  4ASI A;  2VSU E;  1HZD A;  4JYJ A;  3KQF A;  1VRG A;  4FJW D;  1Q52 A;  2ZL2 A;  2ZQR A;  2VSU F;  3HRX A;  3ZW8 A;  4ZDB A;  3MFM A;  4KPK A;  3KTJ A;  4FNB A;  5KDR B;  5DU8 A;  3V5I A;  4ZDD A;  1MJ3 A;  1ON9 A;  2CBY A;  4I42 A;  1Q51 A;  2CE3 A;  4IZC A;  2J5I I;  3H0Q A;  5JBW A;  4HC8 A;  2Q2X A;  1N6E A;  4KNP A;  3TT6 A;  3KTI A;  5CTB A;  3QKA A;  3G64 A;  3R6H A;  2F6I A;  4U1A A;  5JBX A;  4ZDC A;  4JCS A;  3NJD A;  5DZK H;  2J5I B;  4DI1 A;  3TRR A;  1FC6 A;  1XNW A;  4L6W A;  5G1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...