3PECA

Siderocalin recognitin of carboxymycobactins: interference by the immune system in intracellular iron acquisition by mycobacteria tuberculosis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
176
structure length
176
Chain Sequence
b'STSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Siderocalin Recognitin of Carboxymycobactins: Interference by the immune system in intracellular iron acquisition by Mycobacteria tuberculosis
rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
total genus 41
structure length 176
sequence length 176
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3pecA00
1SY2A 2NNQA 2RCQA 2E4JA 3EBWA 1E5PA 5HCEC 2WWPA 4M6SA 1CBIA 1HQPA 2Q39A 5IO7A 4NNSA 4ALBA 5HCCC 3WJGA 3UEVA 4ZGUA 1FE3A 3B2IA 1YIVA 3KFIA 1CBQA 1I04A 4WBKA 1IFBA 1LIBA 4BOEA 3NP1A 1BWYA 4GNWA 1EQDA 1QY0A 3KFFA 1HMRA 4ARHA 4IB8A 3UEXA 1LIFA 5H9AA 3VG4A 4TLJA 3FR5A 1KT7A 2P8GA 1RBPA 3APVA 4OS0A 2Q2PA 1KXOA 1T68X 2RD7C 2XSTA 1S7DA 4TNNA 1ERXA 5DG4A 3PH6A 4ZHFA 5KHPA 4NYRA 4TKBA 1OEKA 4XMGA 1BSOA 2ALLX 2ANSA 3VG5A 4ORXA 3AKMA 5IO5A 2R73A 4IBAA 2CZTA 2A3FX 4OS3A 3I0AA 4O9SA 4QZUA 1KGLA 1FELA 1HMSA 5D45A 2HZQA 2HMBA 3CQRA 2OVAA 4HPCA 5F58A 2WEWA 4A1YA 2FTBA 1ZNDA 3O2YA 5LKFA 3FIQA 4XMHA 5F6ZA 1YP7A 3NQ9A 1VYGA 1Z24A 4YDBA 5B29A 2ACPX 2AT8X 4ORYA 2HZRA 5HZ9A 5EPQA 3UEWA 1HBQA 1ZNKA 1SXUA 1ZRYA 3D95A 4A8ZA 4K19A 2CBRA 1BBPA 5L8OA 1KQWA 4QAEA 4ORUA 4RUUA 4YBUA 4R0BA 1LIEA 3AKNA 3APUA 2LKKA 5HZ8A 1ZNGA 2W2FA 1GX9A 2Q2MA 1S44A 4QGXA 1JJXA 4LKTA 4ORSA 1QFVA 2X46A 4A1HA 4TKJA 1B4MA 1OPBA 3G7XA 1G74A 1AVGI 3NR3A 4AW8A 1DV9A 5LJDA 1OBUA 1GT5A 5F6BA 5H9NA 1E02A 3F8AA 1FENA 2FS6A 4Y0RA 1B8EA 3TZSA 1KZXA 5CE4A 2AT5X 3IFBA 5EEEA 4YFRA 3WBGA 1EPBA 1TXLA 3APXA 2G78A 4AZMA 1P6PA 1BRPA 5DPQA 2PY1A 3SAOA 2CM9A 1EUOA 2JN3A 2WEXA 1BM5A 4ZHCA 4AZQA 1LFOA 2AKQA 2CZUA 3NADA 2QO6A 5K06A 2QOSC 1FTPA 3FENA 3KFGA 4ORWA 2FLJA 3ELXA 1QY2A 1G5WA 4YBPA 2MM3A 4YKMA 1ACDA 3RSWA 4BVMA 1OEJA 2X45A 2XKLA 4MVKA 1LIDA 1LKEA 1BSYA 1ZNEA 2LB6A 5HZQA 4ZHDA 1U0XA 1DZPA 1X89A 4N7DA 3VG3A 4XMFA 5LJGA 3CQNA 4TKHA 4ALOA 1JJJA 3U9PC 4YCEA 1JYJA 1A2DA 1H91A 1UZ2X 4IAXA 4YH0A 5D47A 3STNA 1QWDA 1KZWA 4XMDA 5HCDC 2OVEA 3B2LA 1QABE 2KT4B 4OS8A 3T1DA 3O22A 1I06A 1NP4A 3CBCA 3B2KA 3FA6A 1AB0A 5JR8A 1X8PA 1KT5A 2L5PA 3JSQA 3MVFA 3DSZA 4QGVA 1O8VA 1L6MA 5LJHA 5FENA 3PEDA 4YGGA 4YFQA 4DQ4A 3FLLA 1R0UA 5EZ2A 1UREA 5LJCA 3RZYA 4CK4A 2EU7X 1T0VA 1EXSA 3FEPA 4Y0SA 5HBSA 1SY1A 3GAQA 4D6AA 3U03A 1CJ5A 5D8JA 4DQ3A 3F9DA 4ZH6A 1X8OA 1TOUA 1DZKA 1IKEA 1IIUA 1DZJA 2K62A 4GETA 1GXAA 1ALBA 4UU2A 3BY0A 2Q9SA 1G85A 3JS1A 4OMWA 4XMEA 2W2BA 1DFVA 5HA0A 1LNMA 2HYSA 3STMX 3ZUOA 1AELA 2AT0X 2A0AA 2FT9A 1JV4A 3WJCA 2FS7A 5HZ5A 4YCHA 1TOWA 3OJYC 2OZQA 2CM4A 5EDCA 3P6HA 4QGWA 1B56A 4LZUA 4WFVA 1OEEA 4D6BA 4QZTA 3CBSA 2F73A 3UEUA 3EM0A 3HWDA 3WVMA 1DF3A 4AYHA 4EDEA 3P6DA 5HA1A 2RQ0A 3NQ3A 2GC9A 4GNYA 1IKJA 1JYDA 1MUPA 1ADLA 1T8VA 1GKAB 1NGLA 2OFRX 2AH7X 1PM1X 1GT3A 4ES7A 1O1VA 2L9CA 2R56A 1MDCA 4YFPA 5F7GA 3ELZA 5L8IA 2HLVA 4GKCA 3BX8A 4HPDA 4NLIA 5HTEA 3D97A 3CR6A 5EDBA 3WJEA 3BSZE 1EW3A 2OVDA 1YWBA 1HN2A 1KT3A 2JU3A 1TW4A 2BLGA 4OMXA 2FR3A 1N0SA 1A57A 3VG2A 2A13A 2FR2A 2MO5A 4A60A 1MX8A 3EYCA 3FW5A 5H8TA 1ERBA 1HBPA 2GTFX 1YWDA 5HAEA 3BDRA 1PMPA 4RUNA 1FEMA 3PH5A 4AZPA 1QFTA 2WQ9A 3MBTA 1U17A 1G7NA 2L68A 3HWFA 5BVTA 1HMTA 1YUPA 3BLGA 1IW2A 3TGAA 1AQBA 4MVIA 4ZHGA 4UU3A 4ZH9A 1GX8A 1SXXA 4MVLA 5B27A 1PEEA 3NX2A 3DTQA 3C76X 3FA7A 4I3BA 1D2UA 4GE1A 3HK1A 4ZFXA 1MVGA 2WSJA 1KOIA 1CBRA 4M7MA 4IB9A 2NP1A 4ODDA 1GT1A 1SY0A 4NLJA 2IFBA 3QKGA 4TJZA 3C77X 1GM6A 3FR4A 4YGZA 4EFGA 2AT6X 5C0NA 3FMZA 3P6GA 1SXWA 2QO5A 3B2HA 2AL0X 1GKAA 5D4AA 3S26A 2CBSA 2RA6A 3FA8A 4TQ2A 4HPAA 3TF6A 1EPAA 1LICA 5F1EA 1ML7A 3PP6A 1B0OA 4HFOA 1YP6A 2AMMX 3BRNA 2WR6A 3Q6LA 4IMNA 1TVQA 1OBQA 3C78X 4AZOA 3P6EA 2QM9A 3D96A 3NX1A 2YG2A 5HZ6A 5BVSA 2FWVA 4EXZA 1BJ7A 2OFMX 4I9RA 3CMPA 2KTDA 2Q4NA 3APWA 2ASNX 3K3LA 5H9KA 1O1UA 4NYQA 1SA8A 1E06A 4I9SA 3PECA 1YWCA 3HWEA 5BVQA 2G7BA 1VYFA 3KQ0A 4ZCBA 5HWZA 1CBSA 1GGLA 3ZQ3A 3TGBA 2A2GA 1KT6A 2QO4A 1PBOA 1XKIA 2R74A 5H9LA 5IO6A 2LFOA 2WQAE 1CRBA 3FA9A 4AZNA 1ICNA 1QG5A 1OBPA 2L67A 5LKEA 3TGCA 1U18A 2POAA 3BU1A 4QYNA 3EBKA 2AT3X 4IB6A 4YGHA 4WFUA 3BS2A 4IMOA 3FW4A 3L4RA 3NPOA 2HNXA 2LBVA 1QQSA 1X8QA 1ZNLA 4LZVA 2JU8A 2MJIA 3ZUIA 4GRJA 4ORRA 4NP1A 2W2AA 1D3SA 1MX7A 1I4UA 1BSQA 3WXQA 1KT4A 2A2UA 3O19A 5AQ6A 4BQUA 1LF7A 4YKOA 5LJBA 1IFCA 1I05A 3EMMA 4LKPA 5KICA 2O62A 1QY1A 2N93A 3CWKA 1RLBE 1X71A 1A18A 3BU9A 3P6FA 3WJDA 4AZRA 1ICMA 3FELA 1EIIA 1VPRA 5D48A 5LJEA 4HPBA 2WUTA 2RCTA 4EEJA 1XCAA 4PSQA 4NNTA 3BX7A 3VG7A 1SY3A 1BLRA 5L8NA 5FFHA 1JZUA 2DM5A 4N7CA 4KIIA 3FR2A 4QYPA 1BRQA 5LJKA 1OPAA 1X8UA 2LBAA 3STKA 1DZMA 5FAZA 1SXYA 4YDAA 1KQXA 1GT4A 4ZJ0A 4IB7A 1EIOA 3U0DA 2NNEA 3VG6A 1S2PA 2K23A 1EALA 1YWAA 4Y0PA 4I3CA 4I3DA 1FDQA 1X8NA 1ZNHA 2ACOA 3FEKA 3I17A 4YMYA 2JOZA 4ZHHA 2NNDA 3P6CA 2G79A 2FRSA 5HTDA 1NP1A 3KFHA 4XMCA 2GJ5A 3IA8A 3WJBA 1DC9A 5EEDA 4IAWA 1A3YA 3HWGA 3KZAA 1JBHA 3WJFA 5KIDA 4GH7A 4ZR2A 2JU7A 1E00A 3B2JA 1BEBA 1LPJA 3PPTA 4Y0QA
chains in the Genus database with same CATH superfamily
1UYNX 1SY2A 2NNQA 2RCQA 2E4JA 1JIWI 3ZW0B 3S60A 3EBWA 1E5PA 5HCEC 3HOLA 1HY2A 2WWPA 4M6SA 4CPEA 1CBIA 2BC3A 4PJ2A 1HQPA 1DF8A 2Q39A 4NNSA 1VWGB 5F2BA 4ALBA 5HCCC 1VWMB 5IO7A 3WJGA 3WZPA 3HTYA 1IJ8A 3UAQA 3UEVA 1LDOA 3S5VA 2Y3EA 3T2WA 1FE3A 2OFAA 3B2IA 4ZGUA 1YIVA 3KFIA 1CBQA 1I04A 4WBKA 4L3RA 1IFBA 1LIBA 4BOEA 3NP1A 2OY8A 2JW1A 1BWYA 4GNWA 1EQDA 1QY0A 2OL8O 3KFFA 1HMRA 4ARHA 4IB8A 1NDJA 3UEXA 1FJ1E 1LIFA 5H9AA 3VG4A 4TLJA 3FR5A 1KT7A 2P8GA 1RBPA 1SWFA 3APVA 4OS0A 2Q2PA 1KXOA 1T68X 2RD7C 2GTLN 2XSTA 1S7DA 4TNNA 1ERXA 5DG4A 3PH6A 4ZHFA 5KHPA 4NYRA 3Q34A 1VWQB 4TKBA 1K24A 1OEKA 2RTAA 1BSOA 4XMGA 2ALLX 1VWBB 2ANSA 4U3QA 3VG5A 2C1QA 4ORXA 3AKMA 5IO5A 2R73A 3EW2A 4GUZA 4IBAA 2CZTA 4GDAA 1VWDB 2A3FX 4OS3A 3I0AA 4O9SA 4QZUA 1KGLA 1KL5A 2BSZA 1SWGA 1FELA 1HMSA 5D45A 2HZQA 2HMBA 2OY5O 1Y9LA 3CQRA 2OVAA 2HKDA 4HPCA 5F58A 2WEWA 4A1YA 3ZW2A 4Z28A 3PQSA 2FTBA 1ZNDA 3O2YA 4FBOA 3FIQA 4XMHA 5F6ZA 1MOYA 1YP7A 5LKFA 3NQ9A 4EKVA 1VYGA 1Z24A 3P02A 5IRAA 2RTDB 1Y0GA 4YDBA 5B29A 2ACPX 2AT8X 4ORYA 2C4IA 2HZRA 4ZHGA 5HZ9A 2GTLO 5EPQA 1UYOX 3UEWA 1HBQA 1ZNKA 1SXUA 1ZRYA 4O49A 3ZW0A 3WOVA 2JMBA 3D95A 4A8ZA 3ZW1B 4ID2A 4BCSA 4K19A 5FQ8E 2CBRA 2RTGB 3SLJA 4BBOA 1BBPA 3RE6A 4B55A 2UYWA 5L8OA 1KQWA 4QAEA 4ORUA 4RUUA 2A5CA 4R0BA 4YBUA 1STRB 4C5PA 1LIEA 3AKNA 3APUA 1VWRB 2LKKA 5HZ8A 2OF9A 1ZNGA 2W2FA 1GX9A 2Q2MA 1S44A 4QGXA 1JJXA 4LKTA 4ORSA 1QFVA 1E2TA 2X46A 4A1HA 5K68A 4TKJA 2RTOB 1B4MA 1SRFA 1OPBA 3G7XA 1G74A 1AVGI 4Z2PA 1VWCB 4KH8A 3NR3A 4AW8A 1DV9A 5LJDA 1OBUA 1GT5A 5F6BA 5H9NA 1E02A 1NQNA 3F8AA 1FENA 2FS6A 1HQQA 1B8EA 4Y0RA 3OD9A 3TZSA 1KZXA 1VWJB 5B5GA 5CE4A 2AT5X 1N7YA 3IFBA 5EEEA 3STNA 4WHIA 3WBGA 4YFRA 3HPEA 1EPBA 4JGLA 1TXLA 5B3MO 1N9YA 2RTMA 3APXA 2G78A 4U8UO 3EW1A 2RTLA 1VYOA 4AZMA 1N4JA 1P6PA 1BRPA 5DPQA 3RY2A 1SWAA 2PY1A 2FHNX 3SAOA 2CM9A 1EI5A 3RWXA 4YVBA 1EUOA 2JN3A 2WEXA 2QMIA 1BM5A 4ZHCA 4AZQA 1LFOA 2AKQA 3SZIA 2CZUA 2OFBA 3T2XA 2OF8A 3NADA 1N9MA 2QO6A 3P24A 1SWPA 2QOSC 1FTPA 5K06A 3FENA 3KFGA 4ORWA 2FLJA 3ELXA 4MIRA 1QY2A 1G5WA 4YBPA 4LQZA 2MM3A 2X4MA 4YKMA 3VHHA 1ACDA 1OSPO 3RSWA 5CHKA 4BVMA 1OEJA 3ZW1A 2CAMA 2X45A 2XKLA 4MVKA 1LIDA 2IZKA 1LKEA 1BSYA 1ZNEA 2LB6A 5HZQA 3CKGA 4ZHDA 1U0XA 1HXLA 1SWSA 1DZPA 1X89A 3VHIA 3QQ2A 4N7DA 3VG3A 1K3BA 2ZAGA 4XMFA 2I5VO 3LV4A 5LJGA 2GTLM 3CQNA 4TKHA 5CSEA 4ALOA 1JJJA 3U9PC 4YCEA 1JYJA 1A2DA 1H91A 1UZ2X 3CKFA 4IAXA 4YH0A 5D47A 1QWDA 5FQ6E 4BX6B 1KZWA 4BX5B 4XMDA 5HCDC 2OVEA 2BS6A 3B2LA 2IZBA 4IRWA 1Y55X 3KVNA 5AJCA 2FKGA 3X00A 1QABE 2KT4B 4OEMA 4OS8A 3T1DA 2BHVA 3SLOA 1W6FA 3O22A 2FKJA 1I06A 1NP4A 4GDZA 1VWPB 3CBCA 3B2KA 3FA6A 3NQKA 1SWQA 1AB0A 5JR8A 4GK9A 4BJ8A 1PBYA 1KT5A 1X8PA 1JQPA 2L5PA 3WZQA 3JSQA 3MVFA 5AJBA 1KL4A 1AVEA 3DSZA 4QGVA 1O8VA 1L6MA 1W5RA 2BT9A 3PK2A 5LJHA 5FENA 3PEDA 4YGGA 3AUMO 3H3IA 4YFQA 3SZHA 1SWDA 4DQ4A 3FLLA 1R0UA 5EZ2A 1JMXA 1UREA 1LELA 1RXKA 2IZCB 5LJCA 3RZYA 4CK4A 4GJSA 1PTSA 2EU7X 1T0VA 1EXSA 2YMSA 2RTRB 3FDCA 3FEPA 4Y0SA 5HBSA 4CPFA 1SY1A 4U8UM 3GAQA 1SMPI 4KT5A 2OY1O 5K67A 4D6AA 3U03A 1CJ5A 3FYFA 5D8JA 1WUBA 2RTPB 4Y5DA 3F9DA 4DQ3A 5BYPA 4ZH6A 4O3ZA 1SRIA 4NV7A 1X8OA 4EQAC 3VGWA 2VDFA 1TOUA 2FGSA 1DZKA 1IKEA 5FQ7E 2RTNB 1IIUA 4DNEA 1DZJA 2K62A 1MK5A 4GETA 3RDSA 3D4RA 1GXAA 5L3YA 1ALBA 4UU2A 1SWUA 3BY0A 5H9KA 2Q9SA 1G85A 3JS1A 4OMWA 4XMEA 2W2BA 3HOEA 1DFVA 2OL7A 5HA0A 1LNMA 2HYSA 4BX6A 3STMX 3ZUOA 1AELA 4U8UN 2AT0X 2A0AA 4BGFA 2FT9A 1Y52X 2KD2A 2A5BA 3OBLA 4BX5A 1SWHA 2PI3O 1JV4A 1SWOA 1SWEA 1RAVA 2I5ZO 3WJCA 3VHMA 2FS7A 5HZ5A 4YCHA 1TOWA 3OJYC 2OZQA 2OYBO 2CM4A 1WBIA 5EDCA 1SLFB 3P6HA 1B56A 4QGWA 3NBXX 4LZUA 4WFVA 1OEEA 4D6BA 4QZTA 3MX7A 3CBSA 2F73A 3UEUA 4FBVA 1JJUA 1LCVA 3EM0A 3HWDA 4ON1A 3WVMA 3RE5A 1DF3A 4AYHA 4EDEA 2RTHB 1VWKB 3P6DA 5HA1A 1VWIB 2RQ0A 3NQ3A 3OE3A 2GC9A 4GNYA 1IKJA 1SWRA 1JYDA 1KFFA 2F01A 1MUPA 1ADLA 1T8VA 5IRUA 1GKAB 1NGLA 2OFRX 2AH7X 1PM1X 1GT3A 3WZNA 4I60A 1O1VA 1SRGA 4ES7A 2DJFA 2L9CA 2R56A 1MDCA 3VE1A 2AF5A 4YFPA 5F7GA 5JD2A 3ELZA 5L8IA 2HLVA 2IZGB 4GKCA 3BX8A 3GE2A 4HPDA 4NLIA 5HTEA 3ZI8A 3D97A 3CR6A 3PQUA 5EDBA 3WJEA 3BSZE 1EW3A 1SLGB 2IZDB 2OVDA 1YWBA 4BX7B 1HN2A 1KT3A 5B11O 3VE2A 2JU3A 1TW4A 1Y53X 2BLGA 2F09A 2FR3A 4OMXA 3T6LA 2ZAIA 4GD9A 1SLEB 1N0SA 1A57A 3VG2A 4GGZA 1VWOB 2A13A 2FR2A 2MO5A 4A60A 1MX8A 3EYCA 3FW5A 5H8TA 1ERBA 1NC9A 5B2AO 5IRWA 3AEHA 1HBPA 2GTFX 2OL6O 1LDQA 1YWDA 3BDRA 3PDFA 5HAEA 3T6FA 1PMPA 4RUNA 1SWJA 1Y9TA 1FEMA 2G8CO 4GZVA 3PH5A 4Z2VA 1VWEB 1QFTA 4AZPA 2WQ9A 3MBTA 1U17A 1G7NA 1KL3A 2L68A 3HWFA 5BVTA 1HMTA 1YUPA 3BLGA 1IW2A 4CDDA 3TGAA 1AQBA 2RTEB 4MVIA 4I95A 4UU3A 1RSTB 4ZH9A 1GX8A 1SXXA 3JQOA 4MVLA 5B27A 1PEEA 3NX2A 4JHQA 3SLTA 3DTQA 1SRJA 3C76X 3FA7A 4O3YA 4I3BA 1W4TA 1D2UA 4GE1A 3HK1A 4ZFXA 1VWLB 1MVGA 2WSJA 2X32A 4OELA 1KOIA 1CBRA 2X34A 2Y3FA 4CDFA 4M7MA 4IB9A 2NP1A 3MM0A 3N91A 4ODDA 1GT1A 1SY0A 4NLJA 4CPIA 2IFBA 1VWFB 3QKGA 4TJZA 3C77X 1GM6A 4JNJA 1SWTA 2IZLB 1SWLA 3FR4A 3S5XA 4ML7B 4YGZA 2AT6X 4EFGA 5C0NA 2DJGA 1STPA 2WPUA 2RTIB 3FMZA 3P6GA 1SXWA 2QO5A 1SWCA 3B2HA 2AL0X 1GKAA 2RTFB 2IZEB 4GGTA 5D4AA 3S26A 2CBSA 1JMZA 1LUQA 2RA6A 2UZ2A 3D9WA 3FA8A 3V8UA 4TQ2A 4HPAA 4QNIA 3SOTA 3LTWA 1EPAA 1LICA 4O3XB 5F1EA 3TF6A 4OKAA 1ML7A 3PP6A 4FBRA 1B0OA 2KW1A 1YP6A 2AMMX 3BRNA 4FQBB 2WR6A 2MWHA 1VWNB 3Q6LA 4HFOA 4IMNA 2X55A 4BX7A 1TVQA 3LHNA 4NV8A 1OBQA 2MF6A 3C78X 3EC5A 4AZOA 3P6EA 1MM9A 4Z6JA 3E3CA 2QM9A 3D96A 3NX1A 4HWMA 2YG2A 4IABA 5HZ6A 5BVSA 2FWVA 4KCAA 4CDCA 4EXZA 1BJ7A 2RN4A 2OFMX 1RSUB 1LCZA 4I9RA 3CMPA 2KTDA 2Q4NA 3APWA 2ASNX 3K3LA 4KC8A 4MVEA 4QRLA 5B10O 1O1UA 2AVIA 4NYQA 4ZGFA 1SA8A 2QOMA 1E06A 3FIDA 4NW4A 3RBYA 3RY1A 4I9SA 1EALA 3PECA 1YWCA 2X8TA 3HWEA 5BVQA 2A8GA 2G7BA 2ZSCA 4FGIB 1VYFA 3KQ0A 4ZCBA 2JGSA 4CPHB 1CBSA 5HWZA 2VFBA 1GGLA 3ZQ3A 4CV7A 3TGBA 2A2GA 2KTSA 2MHDA 1KT6A 2QO4A 1PBOA 1XKIA 2R74A 5H9LA 5IO6A 2LFOA 2WQAE 1CRBA 2Z4IA 3FA9A 4AZNA 1ICNA 1QG5A 2Z4HA 1OBPA 2L67A 5LKEA 3RDMA 2VFCA 3TGCA 1U18A 2POAA 4CSBA 2RTKA 3BU1A 4QYNA 3EBKA 2AT3X 4IB6A 4YGHA 4WFUA 2FHLA 3BS2A 4INNA 1HXZA 3FW4A 3L4RA 4IMOA 3NPOA 4KC7A 2HNXA 1MEPA 2LBVA 1QQSA 1X8QA 1ZNLA 4LZVA 2JU8A 2MJIA 2OY7A 3ZUIA 4GRJA 4ORRA 2GH7A 4NP1A 2W2AA 1D3SA 1MX7A 1NQMA 1I4UA 4DCBA 1BSQA 3WXQA 1KT4A 2A2UA 2RTQB 3O19A 4U46A 5AQ6A 3VPJE 4BQUA 4O4SA 1LF7A 4YKOA 5LJBA 1IFCA 1I05A 3EMMA 4LKPA 5KICA 2O62A 1QY1A 2N93A 3CWKA 1RLBE 1I78A 1X71A 1A18A 3BU9A 3P6FA 1RXHA 1STSB 3WJDA 1ICMA 3WYQA 4AZRA 3FELA 3RKGA 3WZOA 2LA7A 1EIIA 1VPRA 5D48A 5LJEA 4HPBA 4Y59A 1LCWA 3WYPA 2WUTA 2RCTA 4JO6A 4EEJA 1SWNA 1XCAA 4PSQA 2IZFB 3BX7A 4NNTA 2X8FA 1SY3A 4L1NA 3VG7A 5AEOA 5L8NA 5FFHA 1BLRA 2DM5A 2IZIA 4N7CA 1JZUA 3MG5A 4O3WA 4KIIA 3FR2A 2OVSA 4I6SA 3RDQA 4QYPA 1BRQA 2X8SA 5LJKA 2IZAA 2IZJA 1OPAA 1X8UA 3F6ZB 2LBAA 4U9CA 3STKA 1DZMA 4MEEA 4COTA 5FAZA 4GU8A 1SXYA 4YDAA 2RTBB 3ZWEA 1KQXA 4CPHA 4Z27A 1GT4A 4ZJ0A 4IB7A 3VU1A 1SLDB 4O4UA 3RDOA 2M4LA 2IZHB 1EIOA 3U0DA 2X56A 3RDXA 1SWBA 2NNEA 2QCBA 4QQ1A 3VG6A 1S2PA 2K23A 3ZZVA 1I9HA 1YWAA 4GJVA 4Y0PA 4I3CA 4I3DA 1FDQA 1X8NA 1ZNHA 4Z2OA 2ACOA 3FEKA 3I17A 4YMYA 2JOZA 2RTJA 4ZHHA 4CDEA 2NNDA 1VWAB 3P6CA 5CYBA 2G79A 2FRSA 5HTDA 5IXGA 1NP1A 3KFHA 2G5LA 4XMCA 2GJ5A 3IA8A 1SREA 1DC9A 1SWKA 5EEDA 4O4OA 3WJBA 1AVDA 1N43A 4GGRA 4IAWA 1NBXA 4O4XA 1A3YA 3HWGA 3RDUA 3KZAA 1JBHA 3WJFA 5KIDA 4GH7A 1VWHB 5B5FA 2BS5A 1RXJA 2RTCB 4ZR2A 2JU7A 2Y32A 1E00A 1SRHA 2C1SA 1BEBA 1GX3A 1LPJA 3B2JA 3PPTA 3SZJA 4MISA 4Y0QA
chains in the Genus database with same CATH topology
1SY2A 2NNQA 2RCQA 2E4JA 1JIWI 3ZW0B 3S60A 3EBWA 1E5PA 5HCEC 3HOLA 2WWPA 4M6SA 1CBIA 4PJ2A 1HQPA 2Q39A 5IO7A 4NNSA 4ALBA 5HCCC 3WJGA 3HTYA 3UAQA 3UEVA 3S5VA 4ZGUA 1FE3A 3B2IA 1YIVA 3KFIA 1CBQA 1I04A 4WBKA 4L3RA 1IFBA 1LIBA 4BOEA 3NP1A 1BWYA 2JW1A 4GNWA 1EQDA 1QY0A 3KFFA 1HMRA 4ARHA 4IB8A 3UEXA 1LIFA 5H9AA 3VG4A 4TLJA 3FR5A 1KT7A 2P8GA 1RBPA 3APVA 4OS0A 2Q2PA 1KXOA 1T68X 2RD7C 2GTLN 2XSTA 1S7DA 4TNNA 1ERXA 5DG4A 3PH6A 4ZHFA 5KHPA 4NYRA 4TKBA 1OEKA 4XMGA 1BSOA 2ALLX 2ANSA 4U3QA 3VG5A 4ORXA 3AKMA 5IO5A 2R73A 4IBAA 2CZTA 2A3FX 4OS3A 3I0AA 4O9SA 4QZUA 1KGLA 1FELA 1HMSA 5D45A 2HZQA 2HMBA 1Y9LA 3CQRA 2OVAA 4HPCA 5F58A 2WEWA 4A1YA 3ZW2A 3PQSA 2FTBA 1ZNDA 3O2YA 4FBOA 3FIQA 4XMHA 5F6ZA 1YP7A 5LKFA 3NQ9A 1VYGA 1Z24A 3P02A 4YDBA 5B29A 2ACPX 2AT8X 4ORYA 2HZRA 5HZ9A 2GTLO 5EPQA 3UEWA 1HBQA 1ZNKA 1SXUA 1ZRYA 4O49A 3ZW0A 3WOVA 2JMBA 3D95A 4A8ZA 3ZW1B 4ID2A 4K19A 5FQ8E 2CBRA 1BBPA 5L8OA 1KQWA 4QAEA 4ORUA 4RUUA 4YBUA 4R0BA 1LIEA 3AKNA 3APUA 2LKKA 5HZ8A 1ZNGA 2W2FA 1GX9A 2Q2MA 1S44A 4QGXA 1JJXA 4LKTA 4ORSA 1QFVA 2X46A 4A1HA 4TKJA 1B4MA 1OPBA 3G7XA 1G74A 1AVGI 4KH8A 3NR3A 4AW8A 1DV9A 5LJDA 1OBUA 1GT5A 5F6BA 5H9NA 1E02A 3F8AA 1FENA 2FS6A 4Y0RA 1B8EA 3TZSA 3OD9A 1KZXA 5CE4A 2AT5X 3IFBA 5EEEA 4YFRA 3STNA 4WHIA 3WBGA 1EPBA 4JGLA 1TXLA 3APXA 4U8UO 2G78A 4AZMA 1P6PA 1BRPA 5DPQA 2PY1A 3SAOA 2CM9A 1EI5A 3RWXA 1EUOA 2JN3A 2WEXA 2QMIA 1BM5A 4ZHCA 4AZQA 1LFOA 2AKQA 2CZUA 3NADA 3P24A 2QO6A 5K06A 2QOSC 1FTPA 3FENA 3KFGA 4ORWA 2FLJA 3ELXA 4MIRA 1QY2A 1G5WA 4YBPA 4LQZA 2MM3A 4YKMA 1ACDA 3RSWA 4BVMA 1OEJA 3ZW1A 2X45A 2XKLA 4MVKA 1LIDA 1LKEA 1BSYA 1ZNEA 2LB6A 5HZQA 4ZHDA 1U0XA 1DZPA 1X89A 4N7DA 3VG3A 2ZAGA 4XMFA 3LV4A 5LJGA 2GTLM 3CQNA 4TKHA 4ALOA 1JJJA 3U9PC 4YCEA 1JYJA 1A2DA 1H91A 1UZ2X 4IAXA 4YH0A 5D47A 5FQ6E 1QWDA 1KZWA 4XMDA 5HCDC 2OVEA 2BS6A 3B2LA 5AJCA 1QABE 2KT4B 4OS8A 3T1DA 2BHVA 3O22A 1I06A 1NP4A 4GDZA 3CBCA 3B2KA 3FA6A 3NQKA 1AB0A 5JR8A 4GK9A 1X8PA 1KT5A 2L5PA 3JSQA 3MVFA 5AJBA 3DSZA 4QGVA 1O8VA 1L6MA 2BT9A 5LJHA 5FENA 3PEDA 4YGGA 3H3IA 4YFQA 4DQ4A 3FLLA 1R0UA 5EZ2A 1UREA 5LJCA 3RZYA 4CK4A 2EU7X 1T0VA 1EXSA 2YMSA 3FEPA 4Y0SA 5HBSA 1SY1A 4U8UM 3GAQA 1SMPI 4KT5A 4D6AA 3U03A 1CJ5A 3FYFA 5D8JA 4DQ3A 3F9DA 5BYPA 4ZH6A 4O3ZA 4EQAC 1X8OA 1TOUA 1DZKA 1IKEA 5FQ7E 1IIUA 1DZJA 2K62A 4GETA 3D4RA 1GXAA 1ALBA 4UU2A 3BY0A 2Q9SA 1G85A 3JS1A 4OMWA 4XMEA 2W2BA 3HOEA 1DFVA 5HA0A 1LNMA 2HYSA 3STMX 3ZUOA 1AELA 4U8UN 2AT0X 2A0AA 2FT9A 2KD2A 3OBLA 1JV4A 3WJCA 2FS7A 5HZ5A 4YCHA 1TOWA 3OJYC 2OZQA 2CM4A 5EDCA 3P6HA 4QGWA 1B56A 3NBXX 4LZUA 4WFVA 1OEEA 4D6BA 4QZTA 3MX7A 3CBSA 2F73A 3UEUA 4FBVA 3EM0A 3HWDA 4ON1A 3WVMA 1DF3A 4AYHA 4EDEA 3P6DA 5HA1A 2RQ0A 3NQ3A 3OE3A 2GC9A 4GNYA 1IKJA 1JYDA 1MUPA 1ADLA 1T8VA 1GKAB 1NGLA 2OFRX 2AH7X 1PM1X 1GT3A 4ES7A 1O1VA 2L9CA 2R56A 1MDCA 3VE1A 4YFPA 5F7GA 3ELZA 5L8IA 2HLVA 4GKCA 3BX8A 3GE2A 4HPDA 4NLIA 5HTEA 3ZI8A 3D97A 3CR6A 3PQUA 5EDBA 3WJEA 3BSZE 1EW3A 2OVDA 1YWBA 1HN2A 1KT3A 3VE2A 2JU3A 1TW4A 2BLGA 2F09A 2FR3A 4OMXA 2ZAIA 1N0SA 1A57A 3VG2A 2A13A 2FR2A 2MO5A 4A60A 1MX8A 3EYCA 3FW5A 5H8TA 1ERBA 1HBPA 2GTFX 1YWDA 5HAEA 3BDRA 1PMPA 4RUNA 1Y9TA 1FEMA 4GZVA 3PH5A 4AZPA 1QFTA 2WQ9A 3MBTA 1U17A 1G7NA 2L68A 3HWFA 5BVTA 1HMTA 1YUPA 3BLGA 1IW2A 3TGAA 1AQBA 4MVIA 4ZHGA 4I95A 4UU3A 4ZH9A 1GX8A 1SXXA 3JQOA 4MVLA 5B27A 1PEEA 3NX2A 3DTQA 3C76X 3FA7A 4O3YA 4I3BA 1D2UA 4GE1A 3HK1A 4ZFXA 1MVGA 2WSJA 1KOIA 1CBRA 4M7MA 4IB9A 2NP1A 3N91A 4ODDA 1GT1A 1SY0A 4NLJA 2IFBA 3QKGA 4TJZA 3C77X 1GM6A 3FR4A 3S5XA 4ML7B 4YGZA 2AT6X 4EFGA 5C0NA 3FMZA 3P6GA 1SXWA 2QO5A 3B2HA 2AL0X 1GKAA 5D4AA 3S26A 2CBSA 2RA6A 3FA8A 3V8UA 4TQ2A 4HPAA 4QNIA 3SOTA 4O3XB 1EPAA 1LICA 5F1EA 3TF6A 1ML7A 3PP6A 4FBRA 1B0OA 2KW1A 1YP6A 2AMMX 3BRNA 4FQBB 2WR6A 2MWHA 4HFOA 3Q6LA 4IMNA 1TVQA 3LHNA 1OBQA 3C78X 4AZOA 3P6EA 3E3CA 2QM9A 3D96A 3NX1A 4HWMA 2YG2A 4IABA 5HZ6A 5BVSA 2FWVA 4KCAA 4EXZA 1BJ7A 2RN4A 2OFMX 4I9RA 3CMPA 2KTDA 2Q4NA 3APWA 2ASNX 3K3LA 4KC8A 4MVEA 4QRLA 5H9KA 1O1UA 4ZGFA 4NYQA 1SA8A 1E06A 4NW4A 3RBYA 4I9SA 3PECA 1YWCA 2X8TA 3HWEA 5BVQA 2G7BA 4FGIB 1VYFA 3KQ0A 4ZCBA 5HWZA 1CBSA 1GGLA 3ZQ3A 4CV7A 3TGBA 2A2GA 2KTSA 2MHDA 1KT6A 2QO4A 1PBOA 1XKIA 2R74A 5H9LA 5IO6A 2LFOA 2WQAE 1CRBA 2Z4IA 3FA9A 4AZNA 1ICNA 1QG5A 2Z4HA 1OBPA 2L67A 5LKEA 3TGCA 1U18A 2POAA 4CSBA 3BU1A 4QYNA 3EBKA 2AT3X 4IB6A 4YGHA 4WFUA 3BS2A 4INNA 3FW4A 4IMOA 3L4RA 3NPOA 4KC7A 2HNXA 2LBVA 1QQSA 1X8QA 1ZNLA 4LZVA 2JU8A 2MJIA 3ZUIA 4GRJA 4ORRA 4NP1A 2W2AA 1D3SA 1MX7A 1I4UA 1BSQA 3WXQA 1KT4A 2A2UA 3O19A 5AQ6A 4BQUA 3VPJE 4O4SA 1LF7A 4YKOA 5LJBA 1IFCA 1I05A 3EMMA 4LKPA 5KICA 2O62A 1QY1A 2N93A 3CWKA 1RLBE 1X71A 1A18A 3BU9A 3P6FA 3WJDA 4AZRA 1ICMA 3FELA 3RKGA 2LA7A 1EIIA 1VPRA 5D48A 5LJEA 4HPBA 2WUTA 2RCTA 4EEJA 1XCAA 4PSQA 4NNTA 3BX7A 5AEOA 2X8FA 1SY3A 4L1NA 3VG7A 1BLRA 5L8NA 5FFHA 1JZUA 2DM5A 4N7CA 4O3WA 4KIIA 3FR2A 2OVSA 4I6SA 4QYPA 1BRQA 2X8SA 5LJKA 1OPAA 1X8UA 3F6ZB 2LBAA 4U9CA 3STKA 1DZMA 4COTA 5FAZA 4GU8A 1SXYA 4YDAA 3ZWEA 1KQXA 1GT4A 4ZJ0A 4IB7A 3VU1A 4O4UA 2M4LA 1EIOA 3U0DA 2NNEA 4QQ1A 3VG6A 1S2PA 2K23A 3ZZVA 1YWAA 4Y0PA 1EALA 4I3CA 4I3DA 1FDQA 1X8NA 1ZNHA 2ACOA 3FEKA 3I17A 4YMYA 2JOZA 4ZHHA 2NNDA 5CYBA 3P6CA 2G79A 2FRSA 5HTDA 1NP1A 3KFHA 4XMCA 2GJ5A 3IA8A 3WJBA 1DC9A 5EEDA 4O4OA 4IAWA 4O4XA 1A3YA 3HWGA 3KZAA 1JBHA 3WJFA 5KIDA 4GH7A 2BS5A 4ZR2A 2JU7A 1E00A 3B2JA 1BEBA 1LPJA 3PPTA 4MISA 4Y0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SY2 A;  2NNQ A;  2RCQ A;  2E4J A;  3EBW A;  1E5P A;  5HCE C;  2WWP A;  4M6S A;  1CBI A;  1HQP A;  2Q39 A;  5IO7 A;  4NNS A;  4ALB A;  5HCC C;  3WJG A;  3UEV A;  4ZGU A;  1FE3 A;  3B2I A;  1YIV A;  3KFI A;  1CBQ A;  1I04 A;  4WBK A;  1IFB A;  1LIB A;  4BOE A;  3NP1 A;  1BWY A;  4GNW A;  1EQD A;  1QY0 A;  3KFF A;  1HMR A;  4ARH A;  4IB8 A;  3UEX A;  1LIF A;  5H9A A;  3VG4 A;  4TLJ A;  3FR5 A;  1KT7 A;  2P8G A;  1RBP A;  3APV A;  4OS0 A;  2Q2P A;  1KXO A;  1T68 X;  2RD7 C;  2XST A;  1S7D A;  4TNN A;  1ERX A;  5DG4 A;  3PH6 A;  4ZHF A;  5KHP A;  4NYR A;  4TKB A;  1OEK A;  4XMG A;  1BSO A;  2ALL X;  2ANS A;  3VG5 A;  4ORX A;  3AKM A;  5IO5 A;  2R73 A;  4IBA A;  2CZT A;  2A3F X;  4OS3 A;  3I0A A;  4O9S A;  4QZU A;  1KGL A;  1FEL A;  1HMS A;  5D45 A;  2HZQ A;  2HMB A;  3CQR A;  2OVA A;  4HPC A;  5F58 A;  2WEW A;  4A1Y A;  2FTB A;  1ZND A;  3O2Y A;  5LKF A;  3FIQ A;  4XMH A;  5F6Z A;  1YP7 A;  3NQ9 A;  1VYG A;  1Z24 A;  4YDB A;  5B29 A;  2ACP X;  2AT8 X;  4ORY A;  2HZR A;  5HZ9 A;  5EPQ A;  3UEW A;  1HBQ A;  1ZNK A;  1SXU A;  1ZRY A;  3D95 A;  4A8Z A;  4K19 A;  2CBR A;  1BBP A;  5L8O A;  1KQW A;  4QAE A;  4ORU A;  4RUU A;  4YBU A;  4R0B A;  1LIE A;  3AKN A;  3APU A;  2LKK A;  5HZ8 A;  1ZNG A;  2W2F A;  1GX9 A;  2Q2M A;  1S44 A;  4QGX A;  1JJX A;  4LKT A;  4ORS A;  1QFV A;  2X46 A;  4A1H A;  4TKJ A;  1B4M A;  1OPB A;  3G7X A;  1G74 A;  1AVG I;  3NR3 A;  4AW8 A;  1DV9 A;  5LJD A;  1OBU A;  1GT5 A;  5F6B A;  5H9N A;  1E02 A;  3F8A A;  1FEN A;  2FS6 A;  4Y0R A;  1B8E A;  3TZS A;  1KZX A;  5CE4 A;  2AT5 X;  3IFB A;  5EEE A;  4YFR A;  3WBG A;  1EPB A;  1TXL A;  3APX A;  2G78 A;  4AZM A;  1P6P A;  1BRP A;  5DPQ A;  2PY1 A;  3SAO A;  2CM9 A;  1EUO A;  2JN3 A;  2WEX A;  1BM5 A;  4ZHC A;  4AZQ A;  1LFO A;  2AKQ A;  2CZU A;  3NAD A;  2QO6 A;  5K06 A;  2QOS C;  1FTP A;  3FEN A;  3KFG A;  4ORW A;  2FLJ A;  3ELX A;  1QY2 A;  1G5W A;  4YBP A;  2MM3 A;  4YKM A;  1ACD A;  3RSW A;  4BVM A;  1OEJ A;  2X45 A;  2XKL A;  4MVK A;  1LID A;  1LKE A;  1BSY A;  1ZNE A;  2LB6 A;  5HZQ A;  4ZHD A;  1U0X A;  1DZP A;  1X89 A;  4N7D A;  3VG3 A;  4XMF A;  5LJG A;  3CQN A;  4TKH A;  4ALO A;  1JJJ A;  3U9P C;  4YCE A;  1JYJ A;  1A2D A;  1H91 A;  1UZ2 X;  4IAX A;  4YH0 A;  5D47 A;  3STN A;  1QWD A;  1KZW A;  4XMD A;  5HCD C;  2OVE A;  3B2L A;  1QAB E;  2KT4 B;  4OS8 A;  3T1D A;  3O22 A;  1I06 A;  1NP4 A;  3CBC A;  3B2K A;  3FA6 A;  1AB0 A;  5JR8 A;  1X8P A;  1KT5 A;  2L5P A;  3JSQ A;  3MVF A;  3DSZ A;  4QGV A;  1O8V A;  1L6M A;  5LJH A;  5FEN A;  3PED A;  4YGG A;  4YFQ A;  4DQ4 A;  3FLL A;  1R0U A;  5EZ2 A;  1URE A;  5LJC A;  3RZY A;  4CK4 A;  2EU7 X;  1T0V A;  1EXS A;  3FEP A;  4Y0S A;  5HBS A;  1SY1 A;  3GAQ A;  4D6A A;  3U03 A;  1CJ5 A;  5D8J A;  4DQ3 A;  3F9D A;  4ZH6 A;  1X8O A;  1TOU A;  1DZK A;  1IKE A;  1IIU A;  1DZJ A;  2K62 A;  4GET A;  1GXA A;  1ALB A;  4UU2 A;  3BY0 A;  2Q9S A;  1G85 A;  3JS1 A;  4OMW A;  4XME A;  2W2B A;  1DFV A;  5HA0 A;  1LNM A;  2HYS A;  3STM X;  3ZUO A;  1AEL A;  2AT0 X;  2A0A A;  2FT9 A;  1JV4 A;  3WJC A;  2FS7 A;  5HZ5 A;  4YCH A;  1TOW A;  3OJY C;  2OZQ A;  2CM4 A;  5EDC A;  3P6H A;  4QGW A;  1B56 A;  4LZU A;  4WFV A;  1OEE A;  4D6B A;  4QZT A;  3CBS A;  2F73 A;  3UEU A;  3EM0 A;  3HWD A;  3WVM A;  1DF3 A;  4AYH A;  4EDE A;  3P6D A;  5HA1 A;  2RQ0 A;  3NQ3 A;  2GC9 A;  4GNY A;  1IKJ A;  1JYD A;  1MUP A;  1ADL A;  1T8V A;  1GKA B;  1NGL A;  2OFR X;  2AH7 X;  1PM1 X;  1GT3 A;  4ES7 A;  1O1V A;  2L9C A;  2R56 A;  1MDC A;  4YFP A;  5F7G A;  3ELZ A;  5L8I A;  2HLV A;  4GKC A;  3BX8 A;  4HPD A;  4NLI A;  5HTE A;  3D97 A;  3CR6 A;  5EDB A;  3WJE A;  3BSZ E;  1EW3 A;  2OVD A;  1YWB A;  1HN2 A;  1KT3 A;  2JU3 A;  1TW4 A;  2BLG A;  4OMX A;  2FR3 A;  1N0S A;  1A57 A;  3VG2 A;  2A13 A;  2FR2 A;  2MO5 A;  4A60 A;  1MX8 A;  3EYC A;  3FW5 A;  5H8T A;  1ERB A;  1HBP A;  2GTF X;  1YWD A;  5HAE A;  3BDR A;  1PMP A;  4RUN A;  1FEM A;  3PH5 A;  4AZP A;  1QFT A;  2WQ9 A;  3MBT A;  1U17 A;  1G7N A;  2L68 A;  3HWF A;  5BVT A;  1HMT A;  1YUP A;  3BLG A;  1IW2 A;  3TGA A;  1AQB A;  4MVI A;  4ZHG A;  4UU3 A;  4ZH9 A;  1GX8 A;  1SXX A;  4MVL A;  5B27 A;  1PEE A;  3NX2 A;  3DTQ A;  3C76 X;  3FA7 A;  4I3B A;  1D2U A;  4GE1 A;  3HK1 A;  4ZFX A;  1MVG A;  2WSJ A;  1KOI A;  1CBR A;  4M7M A;  4IB9 A;  2NP1 A;  4ODD A;  1GT1 A;  1SY0 A;  4NLJ A;  2IFB A;  3QKG A;  4TJZ A;  3C77 X;  1GM6 A;  3FR4 A;  4YGZ A;  4EFG A;  2AT6 X;  5C0N A;  3FMZ A;  3P6G A;  1SXW A;  2QO5 A;  3B2H A;  2AL0 X;  1GKA A;  5D4A A;  3S26 A;  2CBS A;  2RA6 A;  3FA8 A;  4TQ2 A;  4HPA A;  3TF6 A;  1EPA A;  1LIC A;  5F1E A;  1ML7 A;  3PP6 A;  1B0O A;  4HFO A;  1YP6 A;  2AMM X;  3BRN A;  2WR6 A;  3Q6L A;  4IMN A;  1TVQ A;  1OBQ A;  3C78 X;  4AZO A;  3P6E A;  2QM9 A;  3D96 A;  3NX1 A;  2YG2 A;  5HZ6 A;  5BVS A;  2FWV A;  4EXZ A;  1BJ7 A;  2OFM X;  4I9R A;  3CMP A;  2KTD A;  2Q4N A;  3APW A;  2ASN X;  3K3L A;  5H9K A;  1O1U A;  4NYQ A;  1SA8 A;  1E06 A;  4I9S A;  3PEC A;  1YWC A;  3HWE A;  5BVQ A;  2G7B A;  1VYF A;  3KQ0 A;  4ZCB A;  5HWZ A;  1CBS A;  1GGL A;  3ZQ3 A;  3TGB A;  2A2G A;  1KT6 A;  2QO4 A;  1PBO A;  1XKI A;  2R74 A;  5H9L A;  5IO6 A;  2LFO A;  2WQA E;  1CRB A;  3FA9 A;  4AZN A;  1ICN A;  1QG5 A;  1OBP A;  2L67 A;  5LKE A;  3TGC A;  1U18 A;  2POA A;  3BU1 A;  4QYN A;  3EBK A;  2AT3 X;  4IB6 A;  4YGH A;  4WFU A;  3BS2 A;  4IMO A;  3FW4 A;  3L4R A;  3NPO A;  2HNX A;  2LBV A;  1QQS A;  1X8Q A;  1ZNL A;  4LZV A;  2JU8 A;  2MJI A;  3ZUI A;  4GRJ A;  4ORR A;  4NP1 A;  2W2A A;  1D3S A;  1MX7 A;  1I4U A;  1BSQ A;  3WXQ A;  1KT4 A;  2A2U A;  3O19 A;  5AQ6 A;  4BQU A;  1LF7 A;  4YKO A;  5LJB A;  1IFC A;  1I05 A;  3EMM A;  4LKP A;  5KIC A;  2O62 A;  1QY1 A;  2N93 A;  3CWK A;  1RLB E;  1X71 A;  1A18 A;  3BU9 A;  3P6F A;  3WJD A;  4AZR A;  1ICM A;  3FEL A;  1EII A;  1VPR A;  5D48 A;  5LJE A;  4HPB A;  2WUT A;  2RCT A;  4EEJ A;  1XCA A;  4PSQ A;  4NNT A;  3BX7 A;  3VG7 A;  1SY3 A;  1BLR A;  5L8N A;  5FFH A;  1JZU A;  2DM5 A;  4N7C A;  4KII A;  3FR2 A;  4QYP A;  1BRQ A;  5LJK A;  1OPA A;  1X8U A;  2LBA A;  3STK A;  1DZM A;  5FAZ A;  1SXY A;  4YDA A;  1KQX A;  1GT4 A;  4ZJ0 A;  4IB7 A;  1EIO A;  3U0D A;  2NNE A;  3VG6 A;  1S2P A;  2K23 A;  1EAL A;  1YWA A;  4Y0P A;  4I3C A;  4I3D A;  1FDQ A;  1X8N A;  1ZNH A;  2ACO A;  3FEK A;  3I17 A;  4YMY A;  2JOZ A;  4ZHH A;  2NND A;  3P6C A;  2G79 A;  2FRS A;  5HTD A;  1NP1 A;  3KFH A;  4XMC A;  2GJ5 A;  3IA8 A;  3WJB A;  1DC9 A;  5EED A;  4IAW A;  1A3Y A;  3HWG A;  3KZA A;  1JBH A;  3WJF A;  5KID A;  4GH7 A;  4ZR2 A;  2JU7 A;  1E00 A;  3B2J A;  1BEB A;  1LPJ A;  3PPT A;  4Y0Q A; 
#chains in the Genus database with same CATH topology
 1UYN X;  1SY2 A;  2NNQ A;  2RCQ A;  2E4J A;  1JIW I;  3ZW0 B;  3S60 A;  3EBW A;  1E5P A;  5HCE C;  3HOL A;  1HY2 A;  2WWP A;  4M6S A;  4CPE A;  1CBI A;  2BC3 A;  4PJ2 A;  1HQP A;  1DF8 A;  2Q39 A;  4NNS A;  1VWG B;  5F2B A;  4ALB A;  5HCC C;  1VWM B;  5IO7 A;  3WJG A;  3WZP A;  3HTY A;  1IJ8 A;  3UAQ A;  3UEV A;  1LDO A;  3S5V A;  2Y3E A;  3T2W A;  1FE3 A;  2OFA A;  3B2I A;  4ZGU A;  1YIV A;  3KFI A;  1CBQ A;  1I04 A;  4WBK A;  4L3R A;  1IFB A;  1LIB A;  4BOE A;  3NP1 A;  2OY8 A;  2JW1 A;  1BWY A;  4GNW A;  1EQD A;  1QY0 A;  2OL8 O;  3KFF A;  1HMR A;  4ARH A;  4IB8 A;  1NDJ A;  3UEX A;  1FJ1 E;  1LIF A;  5H9A A;  3VG4 A;  4TLJ A;  3FR5 A;  1KT7 A;  2P8G A;  1RBP A;  1SWF A;  3APV A;  4OS0 A;  2Q2P A;  1KXO A;  1T68 X;  2RD7 C;  2GTL N;  2XST A;  1S7D A;  4TNN A;  1ERX A;  5DG4 A;  3PH6 A;  4ZHF A;  5KHP A;  4NYR A;  3Q34 A;  1VWQ B;  4TKB A;  1K24 A;  1OEK A;  2RTA A;  1BSO A;  4XMG A;  2ALL X;  1VWB B;  2ANS A;  4U3Q A;  3VG5 A;  2C1Q A;  4ORX A;  3AKM A;  5IO5 A;  2R73 A;  3EW2 A;  4GUZ A;  4IBA A;  2CZT A;  4GDA A;  1VWD B;  2A3F X;  4OS3 A;  3I0A A;  4O9S A;  4QZU A;  1KGL A;  1KL5 A;  2BSZ A;  1SWG A;  1FEL A;  1HMS A;  5D45 A;  2HZQ A;  2HMB A;  2OY5 O;  1Y9L A;  3CQR A;  2OVA A;  2HKD A;  4HPC A;  5F58 A;  2WEW A;  4A1Y A;  3ZW2 A;  4Z28 A;  3PQS A;  2FTB A;  1ZND A;  3O2Y A;  4FBO A;  3FIQ A;  4XMH A;  5F6Z A;  1MOY A;  1YP7 A;  5LKF A;  3NQ9 A;  4EKV A;  1VYG A;  1Z24 A;  3P02 A;  5IRA A;  2RTD B;  1Y0G A;  4YDB A;  5B29 A;  2ACP X;  2AT8 X;  4ORY A;  2C4I A;  2HZR A;  4ZHG A;  5HZ9 A;  2GTL O;  5EPQ A;  1UYO X;  3UEW A;  1HBQ A;  1ZNK A;  1SXU A;  1ZRY A;  4O49 A;  3ZW0 A;  3WOV A;  2JMB A;  3D95 A;  4A8Z A;  3ZW1 B;  4ID2 A;  4BCS A;  4K19 A;  5FQ8 E;  2CBR A;  2RTG B;  3SLJ A;  4BBO A;  1BBP A;  3RE6 A;  4B55 A;  2UYW A;  5L8O A;  1KQW A;  4QAE A;  4ORU A;  4RUU A;  2A5C A;  4R0B A;  4YBU A;  1STR B;  4C5P A;  1LIE A;  3AKN A;  3APU A;  1VWR B;  2LKK A;  5HZ8 A;  2OF9 A;  1ZNG A;  2W2F A;  1GX9 A;  2Q2M A;  1S44 A;  4QGX A;  1JJX A;  4LKT A;  4ORS A;  1QFV A;  1E2T A;  2X46 A;  4A1H A;  5K68 A;  4TKJ A;  2RTO B;  1B4M A;  1SRF A;  1OPB A;  3G7X A;  1G74 A;  1AVG I;  4Z2P A;  1VWC B;  4KH8 A;  3NR3 A;  4AW8 A;  1DV9 A;  5LJD A;  1OBU A;  1GT5 A;  5F6B A;  5H9N A;  1E02 A;  1NQN A;  3F8A A;  1FEN A;  2FS6 A;  1HQQ A;  1B8E A;  4Y0R A;  3OD9 A;  3TZS A;  1KZX A;  1VWJ B;  5B5G A;  5CE4 A;  2AT5 X;  1N7Y A;  3IFB A;  5EEE A;  3STN A;  4WHI A;  3WBG A;  4YFR A;  3HPE A;  1EPB A;  4JGL A;  1TXL A;  5B3M O;  1N9Y A;  2RTM A;  3APX A;  2G78 A;  4U8U O;  3EW1 A;  2RTL A;  1VYO A;  4AZM A;  1N4J A;  1P6P A;  1BRP A;  5DPQ A;  3RY2 A;  1SWA A;  2PY1 A;  2FHN X;  3SAO A;  2CM9 A;  1EI5 A;  3RWX A;  4YVB A;  1EUO A;  2JN3 A;  2WEX A;  2QMI A;  1BM5 A;  4ZHC A;  4AZQ A;  1LFO A;  2AKQ A;  3SZI A;  2CZU A;  2OFB A;  3T2X A;  2OF8 A;  3NAD A;  1N9M A;  2QO6 A;  3P24 A;  1SWP A;  2QOS C;  1FTP A;  5K06 A;  3FEN A;  3KFG A;  4ORW A;  2FLJ A;  3ELX A;  4MIR A;  1QY2 A;  1G5W A;  4YBP A;  4LQZ A;  2MM3 A;  2X4M A;  4YKM A;  3VHH A;  1ACD A;  1OSP O;  3RSW A;  5CHK A;  4BVM A;  1OEJ A;  3ZW1 A;  2CAM A;  2X45 A;  2XKL A;  4MVK A;  1LID A;  2IZK A;  1LKE A;  1BSY A;  1ZNE A;  2LB6 A;  5HZQ A;  3CKG A;  4ZHD A;  1U0X A;  1HXL A;  1SWS A;  1DZP A;  1X89 A;  3VHI A;  3QQ2 A;  4N7D A;  3VG3 A;  1K3B A;  2ZAG A;  4XMF A;  2I5V O;  3LV4 A;  5LJG A;  2GTL M;  3CQN A;  4TKH A;  5CSE A;  4ALO A;  1JJJ A;  3U9P C;  4YCE A;  1JYJ A;  1A2D A;  1H91 A;  1UZ2 X;  3CKF A;  4IAX A;  4YH0 A;  5D47 A;  1QWD A;  5FQ6 E;  4BX6 B;  1KZW A;  4BX5 B;  4XMD A;  5HCD C;  2OVE A;  2BS6 A;  3B2L A;  2IZB A;  4IRW A;  1Y55 X;  3KVN A;  5AJC A;  2FKG A;  3X00 A;  1QAB E;  2KT4 B;  4OEM A;  4OS8 A;  3T1D A;  2BHV A;  3SLO A;  1W6F A;  3O22 A;  2FKJ A;  1I06 A;  1NP4 A;  4GDZ A;  1VWP B;  3CBC A;  3B2K A;  3FA6 A;  3NQK A;  1SWQ A;  1AB0 A;  5JR8 A;  4GK9 A;  4BJ8 A;  1PBY A;  1KT5 A;  1X8P A;  1JQP A;  2L5P A;  3WZQ A;  3JSQ A;  3MVF A;  5AJB A;  1KL4 A;  1AVE A;  3DSZ A;  4QGV A;  1O8V A;  1L6M A;  1W5R A;  2BT9 A;  3PK2 A;  5LJH A;  5FEN A;  3PED A;  4YGG A;  3AUM O;  3H3I A;  4YFQ A;  3SZH A;  1SWD A;  4DQ4 A;  3FLL A;  1R0U A;  5EZ2 A;  1JMX A;  1URE A;  1LEL A;  1RXK A;  2IZC B;  5LJC A;  3RZY A;  4CK4 A;  4GJS A;  1PTS A;  2EU7 X;  1T0V A;  1EXS A;  2YMS A;  2RTR B;  3FDC A;  3FEP A;  4Y0S A;  5HBS A;  4CPF A;  1SY1 A;  4U8U M;  3GAQ A;  1SMP I;  4KT5 A;  2OY1 O;  5K67 A;  4D6A A;  3U03 A;  1CJ5 A;  3FYF A;  5D8J A;  1WUB A;  2RTP B;  4Y5D A;  3F9D A;  4DQ3 A;  5BYP A;  4ZH6 A;  4O3Z A;  1SRI A;  4NV7 A;  1X8O A;  4EQA C;  3VGW A;  2VDF A;  1TOU A;  2FGS A;  1DZK A;  1IKE A;  5FQ7 E;  2RTN B;  1IIU A;  4DNE A;  1DZJ A;  2K62 A;  1MK5 A;  4GET A;  3RDS A;  3D4R A;  1GXA A;  5L3Y A;  1ALB A;  4UU2 A;  1SWU A;  3BY0 A;  5H9K A;  2Q9S A;  1G85 A;  3JS1 A;  4OMW A;  4XME A;  2W2B A;  3HOE A;  1DFV A;  2OL7 A;  5HA0 A;  1LNM A;  2HYS A;  4BX6 A;  3STM X;  3ZUO A;  1AEL A;  4U8U N;  2AT0 X;  2A0A A;  4BGF A;  2FT9 A;  1Y52 X;  2KD2 A;  2A5B A;  3OBL A;  4BX5 A;  1SWH A;  2PI3 O;  1JV4 A;  1SWO A;  1SWE A;  1RAV A;  2I5Z O;  3WJC A;  3VHM A;  2FS7 A;  5HZ5 A;  4YCH A;  1TOW A;  3OJY C;  2OZQ A;  2OYB O;  2CM4 A;  1WBI A;  5EDC A;  1SLF B;  3P6H A;  1B56 A;  4QGW A;  3NBX X;  4LZU A;  4WFV A;  1OEE A;  4D6B A;  4QZT A;  3MX7 A;  3CBS A;  2F73 A;  3UEU A;  4FBV A;  1JJU A;  1LCV A;  3EM0 A;  3HWD A;  4ON1 A;  3WVM A;  3RE5 A;  1DF3 A;  4AYH A;  4EDE A;  2RTH B;  1VWK B;  3P6D A;  5HA1 A;  1VWI B;  2RQ0 A;  3NQ3 A;  3OE3 A;  2GC9 A;  4GNY A;  1IKJ A;  1SWR A;  1JYD A;  1KFF A;  2F01 A;  1MUP A;  1ADL A;  1T8V A;  5IRU A;  1GKA B;  1NGL A;  2OFR X;  2AH7 X;  1PM1 X;  1GT3 A;  3WZN A;  4I60 A;  1O1V A;  1SRG A;  4ES7 A;  2DJF A;  2L9C A;  2R56 A;  1MDC A;  3VE1 A;  2AF5 A;  4YFP A;  5F7G A;  5JD2 A;  3ELZ A;  5L8I A;  2HLV A;  2IZG B;  4GKC A;  3BX8 A;  3GE2 A;  4HPD A;  4NLI A;  5HTE A;  3ZI8 A;  3D97 A;  3CR6 A;  3PQU A;  5EDB A;  3WJE A;  3BSZ E;  1EW3 A;  1SLG B;  2IZD B;  2OVD A;  1YWB A;  4BX7 B;  1HN2 A;  1KT3 A;  5B11 O;  3VE2 A;  2JU3 A;  1TW4 A;  1Y53 X;  2BLG A;  2F09 A;  2FR3 A;  4OMX A;  3T6L A;  2ZAI A;  4GD9 A;  1SLE B;  1N0S A;  1A57 A;  3VG2 A;  4GGZ A;  1VWO B;  2A13 A;  2FR2 A;  2MO5 A;  4A60 A;  1MX8 A;  3EYC A;  3FW5 A;  5H8T A;  1ERB A;  1NC9 A;  5B2A O;  5IRW A;  3AEH A;  1HBP A;  2GTF X;  2OL6 O;  1LDQ A;  1YWD A;  3BDR A;  3PDF A;  5HAE A;  3T6F A;  1PMP A;  4RUN A;  1SWJ A;  1Y9T A;  1FEM A;  2G8C O;  4GZV A;  3PH5 A;  4Z2V A;  1VWE B;  1QFT A;  4AZP A;  2WQ9 A;  3MBT A;  1U17 A;  1G7N A;  1KL3 A;  2L68 A;  3HWF A;  5BVT A;  1HMT A;  1YUP A;  3BLG A;  1IW2 A;  4CDD A;  3TGA A;  1AQB A;  2RTE B;  4MVI A;  4I95 A;  4UU3 A;  1RST B;  4ZH9 A;  1GX8 A;  1SXX A;  3JQO A;  4MVL A;  5B27 A;  1PEE A;  3NX2 A;  4JHQ A;  3SLT A;  3DTQ A;  1SRJ A;  3C76 X;  3FA7 A;  4O3Y A;  4I3B A;  1W4T A;  1D2U A;  4GE1 A;  3HK1 A;  4ZFX A;  1VWL B;  1MVG A;  2WSJ A;  2X32 A;  4OEL A;  1KOI A;  1CBR A;  2X34 A;  2Y3F A;  4CDF A;  4M7M A;  4IB9 A;  2NP1 A;  3MM0 A;  3N91 A;  4ODD A;  1GT1 A;  1SY0 A;  4NLJ A;  4CPI A;  2IFB A;  1VWF B;  3QKG A;  4TJZ A;  3C77 X;  1GM6 A;  4JNJ A;  1SWT A;  2IZL B;  1SWL A;  3FR4 A;  3S5X A;  4ML7 B;  4YGZ A;  2AT6 X;  4EFG A;  5C0N A;  2DJG A;  1STP A;  2WPU A;  2RTI B;  3FMZ A;  3P6G A;  1SXW A;  2QO5 A;  1SWC A;  3B2H A;  2AL0 X;  1GKA A;  2RTF B;  2IZE B;  4GGT A;  5D4A A;  3S26 A;  2CBS A;  1JMZ A;  1LUQ A;  2RA6 A;  2UZ2 A;  3D9W A;  3FA8 A;  3V8U A;  4TQ2 A;  4HPA A;  4QNI A;  3SOT A;  3LTW A;  1EPA A;  1LIC A;  4O3X B;  5F1E A;  3TF6 A;  4OKA A;  1ML7 A;  3PP6 A;  4FBR A;  1B0O A;  2KW1 A;  1YP6 A;  2AMM X;  3BRN A;  4FQB B;  2WR6 A;  2MWH A;  1VWN B;  3Q6L A;  4HFO A;  4IMN A;  2X55 A;  4BX7 A;  1TVQ A;  3LHN A;  4NV8 A;  1OBQ A;  2MF6 A;  3C78 X;  3EC5 A;  4AZO A;  3P6E A;  1MM9 A;  4Z6J A;  3E3C A;  2QM9 A;  3D96 A;  3NX1 A;  4HWM A;  2YG2 A;  4IAB A;  5HZ6 A;  5BVS A;  2FWV A;  4KCA A;  4CDC A;  4EXZ A;  1BJ7 A;  2RN4 A;  2OFM X;  1RSU B;  1LCZ A;  4I9R A;  3CMP A;  2KTD A;  2Q4N A;  3APW A;  2ASN X;  3K3L A;  4KC8 A;  4MVE A;  4QRL A;  5B10 O;  1O1U A;  2AVI A;  4NYQ A;  4ZGF A;  1SA8 A;  2QOM A;  1E06 A;  3FID A;  4NW4 A;  3RBY A;  3RY1 A;  4I9S A;  1EAL A;  3PEC A;  1YWC A;  2X8T A;  3HWE A;  5BVQ A;  2A8G A;  2G7B A;  2ZSC A;  4FGI B;  1VYF A;  3KQ0 A;  4ZCB A;  2JGS A;  4CPH B;  1CBS A;  5HWZ A;  2VFB A;  1GGL A;  3ZQ3 A;  4CV7 A;  3TGB A;  2A2G A;  2KTS A;  2MHD A;  1KT6 A;  2QO4 A;  1PBO A;  1XKI A;  2R74 A;  5H9L A;  5IO6 A;  2LFO A;  2WQA E;  1CRB A;  2Z4I A;  3FA9 A;  4AZN A;  1ICN A;  1QG5 A;  2Z4H A;  1OBP A;  2L67 A;  5LKE A;  3RDM A;  2VFC A;  3TGC A;  1U18 A;  2POA A;  4CSB A;  2RTK A;  3BU1 A;  4QYN A;  3EBK A;  2AT3 X;  4IB6 A;  4YGH A;  4WFU A;  2FHL A;  3BS2 A;  4INN A;  1HXZ A;  3FW4 A;  3L4R A;  4IMO A;  3NPO A;  4KC7 A;  2HNX A;  1MEP A;  2LBV A;  1QQS A;  1X8Q A;  1ZNL A;  4LZV A;  2JU8 A;  2MJI A;  2OY7 A;  3ZUI A;  4GRJ A;  4ORR A;  2GH7 A;  4NP1 A;  2W2A A;  1D3S A;  1MX7 A;  1NQM A;  1I4U A;  4DCB A;  1BSQ A;  3WXQ A;  1KT4 A;  2A2U A;  2RTQ B;  3O19 A;  4U46 A;  5AQ6 A;  3VPJ E;  4BQU A;  4O4S A;  1LF7 A;  4YKO A;  5LJB A;  1IFC A;  1I05 A;  3EMM A;  4LKP A;  5KIC A;  2O62 A;  1QY1 A;  2N93 A;  3CWK A;  1RLB E;  1I78 A;  1X71 A;  1A18 A;  3BU9 A;  3P6F A;  1RXH A;  1STS B;  3WJD A;  1ICM A;  3WYQ A;  4AZR A;  3FEL A;  3RKG A;  3WZO A;  2LA7 A;  1EII A;  1VPR A;  5D48 A;  5LJE A;  4HPB A;  4Y59 A;  1LCW A;  3WYP A;  2WUT A;  2RCT A;  4JO6 A;  4EEJ A;  1SWN A;  1XCA A;  4PSQ A;  2IZF B;  3BX7 A;  4NNT A;  2X8F A;  1SY3 A;  4L1N A;  3VG7 A;  5AEO A;  5L8N A;  5FFH A;  1BLR A;  2DM5 A;  2IZI A;  4N7C A;  1JZU A;  3MG5 A;  4O3W A;  4KII A;  3FR2 A;  2OVS A;  4I6S A;  3RDQ A;  4QYP A;  1BRQ A;  2X8S A;  5LJK A;  2IZA A;  2IZJ A;  1OPA A;  1X8U A;  3F6Z B;  2LBA A;  4U9C A;  3STK A;  1DZM A;  4MEE A;  4COT A;  5FAZ A;  4GU8 A;  1SXY A;  4YDA A;  2RTB B;  3ZWE A;  1KQX A;  4CPH A;  4Z27 A;  1GT4 A;  4ZJ0 A;  4IB7 A;  3VU1 A;  1SLD B;  4O4U A;  3RDO A;  2M4L A;  2IZH B;  1EIO A;  3U0D A;  2X56 A;  3RDX A;  1SWB A;  2NNE A;  2QCB A;  4QQ1 A;  3VG6 A;  1S2P A;  2K23 A;  3ZZV A;  1I9H A;  1YWA A;  4GJV A;  4Y0P A;  4I3C A;  4I3D A;  1FDQ A;  1X8N A;  1ZNH A;  4Z2O A;  2ACO A;  3FEK A;  3I17 A;  4YMY A;  2JOZ A;  2RTJ A;  4ZHH A;  4CDE A;  2NND A;  1VWA B;  3P6C A;  5CYB A;  2G79 A;  2FRS A;  5HTD A;  5IXG A;  1NP1 A;  3KFH A;  2G5L A;  4XMC A;  2GJ5 A;  3IA8 A;  1SRE A;  1DC9 A;  1SWK A;  5EED A;  4O4O A;  3WJB A;  1AVD A;  1N43 A;  4GGR A;  4IAW A;  1NBX A;  4O4X A;  1A3Y A;  3HWG A;  3RDU A;  3KZA A;  1JBH A;  3WJF A;  5KID A;  4GH7 A;  1VWH B;  5B5F A;  2BS5 A;  1RXJ A;  2RTC B;  4ZR2 A;  2JU7 A;  2Y32 A;  1E00 A;  1SRH A;  2C1S A;  1BEB A;  1GX3 A;  1LPJ A;  3B2J A;  3PPT A;  3SZJ A;  4MIS A;  4Y0Q A; 
#chains in the Genus database with same CATH homology
 1SY2 A;  2NNQ A;  2RCQ A;  2E4J A;  1JIW I;  3ZW0 B;  3S60 A;  3EBW A;  1E5P A;  5HCE C;  3HOL A;  2WWP A;  4M6S A;  1CBI A;  4PJ2 A;  1HQP A;  2Q39 A;  5IO7 A;  4NNS A;  4ALB A;  5HCC C;  3WJG A;  3HTY A;  3UAQ A;  3UEV A;  3S5V A;  4ZGU A;  1FE3 A;  3B2I A;  1YIV A;  3KFI A;  1CBQ A;  1I04 A;  4WBK A;  4L3R A;  1IFB A;  1LIB A;  4BOE A;  3NP1 A;  1BWY A;  2JW1 A;  4GNW A;  1EQD A;  1QY0 A;  3KFF A;  1HMR A;  4ARH A;  4IB8 A;  3UEX A;  1LIF A;  5H9A A;  3VG4 A;  4TLJ A;  3FR5 A;  1KT7 A;  2P8G A;  1RBP A;  3APV A;  4OS0 A;  2Q2P A;  1KXO A;  1T68 X;  2RD7 C;  2GTL N;  2XST A;  1S7D A;  4TNN A;  1ERX A;  5DG4 A;  3PH6 A;  4ZHF A;  5KHP A;  4NYR A;  4TKB A;  1OEK A;  4XMG A;  1BSO A;  2ALL X;  2ANS A;  4U3Q A;  3VG5 A;  4ORX A;  3AKM A;  5IO5 A;  2R73 A;  4IBA A;  2CZT A;  2A3F X;  4OS3 A;  3I0A A;  4O9S A;  4QZU A;  1KGL A;  1FEL A;  1HMS A;  5D45 A;  2HZQ A;  2HMB A;  1Y9L A;  3CQR A;  2OVA A;  4HPC A;  5F58 A;  2WEW A;  4A1Y A;  3ZW2 A;  3PQS A;  2FTB A;  1ZND A;  3O2Y A;  4FBO A;  3FIQ A;  4XMH A;  5F6Z A;  1YP7 A;  5LKF A;  3NQ9 A;  1VYG A;  1Z24 A;  3P02 A;  4YDB A;  5B29 A;  2ACP X;  2AT8 X;  4ORY A;  2HZR A;  5HZ9 A;  2GTL O;  5EPQ A;  3UEW A;  1HBQ A;  1ZNK A;  1SXU A;  1ZRY A;  4O49 A;  3ZW0 A;  3WOV A;  2JMB A;  3D95 A;  4A8Z A;  3ZW1 B;  4ID2 A;  4K19 A;  5FQ8 E;  2CBR A;  1BBP A;  5L8O A;  1KQW A;  4QAE A;  4ORU A;  4RUU A;  4YBU A;  4R0B A;  1LIE A;  3AKN A;  3APU A;  2LKK A;  5HZ8 A;  1ZNG A;  2W2F A;  1GX9 A;  2Q2M A;  1S44 A;  4QGX A;  1JJX A;  4LKT A;  4ORS A;  1QFV A;  2X46 A;  4A1H A;  4TKJ A;  1B4M A;  1OPB A;  3G7X A;  1G74 A;  1AVG I;  4KH8 A;  3NR3 A;  4AW8 A;  1DV9 A;  5LJD A;  1OBU A;  1GT5 A;  5F6B A;  5H9N A;  1E02 A;  3F8A A;  1FEN A;  2FS6 A;  4Y0R A;  1B8E A;  3TZS A;  3OD9 A;  1KZX A;  5CE4 A;  2AT5 X;  3IFB A;  5EEE A;  4YFR A;  3STN A;  4WHI A;  3WBG A;  1EPB A;  4JGL A;  1TXL A;  3APX A;  4U8U O;  2G78 A;  4AZM A;  1P6P A;  1BRP A;  5DPQ A;  2PY1 A;  3SAO A;  2CM9 A;  1EI5 A;  3RWX A;  1EUO A;  2JN3 A;  2WEX A;  2QMI A;  1BM5 A;  4ZHC A;  4AZQ A;  1LFO A;  2AKQ A;  2CZU A;  3NAD A;  3P24 A;  2QO6 A;  5K06 A;  2QOS C;  1FTP A;  3FEN A;  3KFG A;  4ORW A;  2FLJ A;  3ELX A;  4MIR A;  1QY2 A;  1G5W A;  4YBP A;  4LQZ A;  2MM3 A;  4YKM A;  1ACD A;  3RSW A;  4BVM A;  1OEJ A;  3ZW1 A;  2X45 A;  2XKL A;  4MVK A;  1LID A;  1LKE A;  1BSY A;  1ZNE A;  2LB6 A;  5HZQ A;  4ZHD A;  1U0X A;  1DZP A;  1X89 A;  4N7D A;  3VG3 A;  2ZAG A;  4XMF A;  3LV4 A;  5LJG A;  2GTL M;  3CQN A;  4TKH A;  4ALO A;  1JJJ A;  3U9P C;  4YCE A;  1JYJ A;  1A2D A;  1H91 A;  1UZ2 X;  4IAX A;  4YH0 A;  5D47 A;  5FQ6 E;  1QWD A;  1KZW A;  4XMD A;  5HCD C;  2OVE A;  2BS6 A;  3B2L A;  5AJC A;  1QAB E;  2KT4 B;  4OS8 A;  3T1D A;  2BHV A;  3O22 A;  1I06 A;  1NP4 A;  4GDZ A;  3CBC A;  3B2K A;  3FA6 A;  3NQK A;  1AB0 A;  5JR8 A;  4GK9 A;  1X8P A;  1KT5 A;  2L5P A;  3JSQ A;  3MVF A;  5AJB A;  3DSZ A;  4QGV A;  1O8V A;  1L6M A;  2BT9 A;  5LJH A;  5FEN A;  3PED A;  4YGG A;  3H3I A;  4YFQ A;  4DQ4 A;  3FLL A;  1R0U A;  5EZ2 A;  1URE A;  5LJC A;  3RZY A;  4CK4 A;  2EU7 X;  1T0V A;  1EXS A;  2YMS A;  3FEP A;  4Y0S A;  5HBS A;  1SY1 A;  4U8U M;  3GAQ A;  1SMP I;  4KT5 A;  4D6A A;  3U03 A;  1CJ5 A;  3FYF A;  5D8J A;  4DQ3 A;  3F9D A;  5BYP A;  4ZH6 A;  4O3Z A;  4EQA C;  1X8O A;  1TOU A;  1DZK A;  1IKE A;  5FQ7 E;  1IIU A;  1DZJ A;  2K62 A;  4GET A;  3D4R A;  1GXA A;  1ALB A;  4UU2 A;  3BY0 A;  2Q9S A;  1G85 A;  3JS1 A;  4OMW A;  4XME A;  2W2B A;  3HOE A;  1DFV A;  5HA0 A;  1LNM A;  2HYS A;  3STM X;  3ZUO A;  1AEL A;  4U8U N;  2AT0 X;  2A0A A;  2FT9 A;  2KD2 A;  3OBL A;  1JV4 A;  3WJC A;  2FS7 A;  5HZ5 A;  4YCH A;  1TOW A;  3OJY C;  2OZQ A;  2CM4 A;  5EDC A;  3P6H A;  4QGW A;  1B56 A;  3NBX X;  4LZU A;  4WFV A;  1OEE A;  4D6B A;  4QZT A;  3MX7 A;  3CBS A;  2F73 A;  3UEU A;  4FBV A;  3EM0 A;  3HWD A;  4ON1 A;  3WVM A;  1DF3 A;  4AYH A;  4EDE A;  3P6D A;  5HA1 A;  2RQ0 A;  3NQ3 A;  3OE3 A;  2GC9 A;  4GNY A;  1IKJ A;  1JYD A;  1MUP A;  1ADL A;  1T8V A;  1GKA B;  1NGL A;  2OFR X;  2AH7 X;  1PM1 X;  1GT3 A;  4ES7 A;  1O1V A;  2L9C A;  2R56 A;  1MDC A;  3VE1 A;  4YFP A;  5F7G A;  3ELZ A;  5L8I A;  2HLV A;  4GKC A;  3BX8 A;  3GE2 A;  4HPD A;  4NLI A;  5HTE A;  3ZI8 A;  3D97 A;  3CR6 A;  3PQU A;  5EDB A;  3WJE A;  3BSZ E;  1EW3 A;  2OVD A;  1YWB A;  1HN2 A;  1KT3 A;  3VE2 A;  2JU3 A;  1TW4 A;  2BLG A;  2F09 A;  2FR3 A;  4OMX A;  2ZAI A;  1N0S A;  1A57 A;  3VG2 A;  2A13 A;  2FR2 A;  2MO5 A;  4A60 A;  1MX8 A;  3EYC A;  3FW5 A;  5H8T A;  1ERB A;  1HBP A;  2GTF X;  1YWD A;  5HAE A;  3BDR A;  1PMP A;  4RUN A;  1Y9T A;  1FEM A;  4GZV A;  3PH5 A;  4AZP A;  1QFT A;  2WQ9 A;  3MBT A;  1U17 A;  1G7N A;  2L68 A;  3HWF A;  5BVT A;  1HMT A;  1YUP A;  3BLG A;  1IW2 A;  3TGA A;  1AQB A;  4MVI A;  4ZHG A;  4I95 A;  4UU3 A;  4ZH9 A;  1GX8 A;  1SXX A;  3JQO A;  4MVL A;  5B27 A;  1PEE A;  3NX2 A;  3DTQ A;  3C76 X;  3FA7 A;  4O3Y A;  4I3B A;  1D2U A;  4GE1 A;  3HK1 A;  4ZFX A;  1MVG A;  2WSJ A;  1KOI A;  1CBR A;  4M7M A;  4IB9 A;  2NP1 A;  3N91 A;  4ODD A;  1GT1 A;  1SY0 A;  4NLJ A;  2IFB A;  3QKG A;  4TJZ A;  3C77 X;  1GM6 A;  3FR4 A;  3S5X A;  4ML7 B;  4YGZ A;  2AT6 X;  4EFG A;  5C0N A;  3FMZ A;  3P6G A;  1SXW A;  2QO5 A;  3B2H A;  2AL0 X;  1GKA A;  5D4A A;  3S26 A;  2CBS A;  2RA6 A;  3FA8 A;  3V8U A;  4TQ2 A;  4HPA A;  4QNI A;  3SOT A;  4O3X B;  1EPA A;  1LIC A;  5F1E A;  3TF6 A;  1ML7 A;  3PP6 A;  4FBR A;  1B0O A;  2KW1 A;  1YP6 A;  2AMM X;  3BRN A;  4FQB B;  2WR6 A;  2MWH A;  4HFO A;  3Q6L A;  4IMN A;  1TVQ A;  3LHN A;  1OBQ A;  3C78 X;  4AZO A;  3P6E A;  3E3C A;  2QM9 A;  3D96 A;  3NX1 A;  4HWM A;  2YG2 A;  4IAB A;  5HZ6 A;  5BVS A;  2FWV A;  4KCA A;  4EXZ A;  1BJ7 A;  2RN4 A;  2OFM X;  4I9R A;  3CMP A;  2KTD A;  2Q4N A;  3APW A;  2ASN X;  3K3L A;  4KC8 A;  4MVE A;  4QRL A;  5H9K A;  1O1U A;  4ZGF A;  4NYQ A;  1SA8 A;  1E06 A;  4NW4 A;  3RBY A;  4I9S A;  3PEC A;  1YWC A;  2X8T A;  3HWE A;  5BVQ A;  2G7B A;  4FGI B;  1VYF A;  3KQ0 A;  4ZCB A;  5HWZ A;  1CBS A;  1GGL A;  3ZQ3 A;  4CV7 A;  3TGB A;  2A2G A;  2KTS A;  2MHD A;  1KT6 A;  2QO4 A;  1PBO A;  1XKI A;  2R74 A;  5H9L A;  5IO6 A;  2LFO A;  2WQA E;  1CRB A;  2Z4I A;  3FA9 A;  4AZN A;  1ICN A;  1QG5 A;  2Z4H A;  1OBP A;  2L67 A;  5LKE A;  3TGC A;  1U18 A;  2POA A;  4CSB A;  3BU1 A;  4QYN A;  3EBK A;  2AT3 X;  4IB6 A;  4YGH A;  4WFU A;  3BS2 A;  4INN A;  3FW4 A;  4IMO A;  3L4R A;  3NPO A;  4KC7 A;  2HNX A;  2LBV A;  1QQS A;  1X8Q A;  1ZNL A;  4LZV A;  2JU8 A;  2MJI A;  3ZUI A;  4GRJ A;  4ORR A;  4NP1 A;  2W2A A;  1D3S A;  1MX7 A;  1I4U A;  1BSQ A;  3WXQ A;  1KT4 A;  2A2U A;  3O19 A;  5AQ6 A;  4BQU A;  3VPJ E;  4O4S A;  1LF7 A;  4YKO A;  5LJB A;  1IFC A;  1I05 A;  3EMM A;  4LKP A;  5KIC A;  2O62 A;  1QY1 A;  2N93 A;  3CWK A;  1RLB E;  1X71 A;  1A18 A;  3BU9 A;  3P6F A;  3WJD A;  4AZR A;  1ICM A;  3FEL A;  3RKG A;  2LA7 A;  1EII A;  1VPR A;  5D48 A;  5LJE A;  4HPB A;  2WUT A;  2RCT A;  4EEJ A;  1XCA A;  4PSQ A;  4NNT A;  3BX7 A;  5AEO A;  2X8F A;  1SY3 A;  4L1N A;  3VG7 A;  1BLR A;  5L8N A;  5FFH A;  1JZU A;  2DM5 A;  4N7C A;  4O3W A;  4KII A;  3FR2 A;  2OVS A;  4I6S A;  4QYP A;  1BRQ A;  2X8S A;  5LJK A;  1OPA A;  1X8U A;  3F6Z B;  2LBA A;  4U9C A;  3STK A;  1DZM A;  4COT A;  5FAZ A;  4GU8 A;  1SXY A;  4YDA A;  3ZWE A;  1KQX A;  1GT4 A;  4ZJ0 A;  4IB7 A;  3VU1 A;  4O4U A;  2M4L A;  1EIO A;  3U0D A;  2NNE A;  4QQ1 A;  3VG6 A;  1S2P A;  2K23 A;  3ZZV A;  1YWA A;  4Y0P A;  1EAL A;  4I3C A;  4I3D A;  1FDQ A;  1X8N A;  1ZNH A;  2ACO A;  3FEK A;  3I17 A;  4YMY A;  2JOZ A;  4ZHH A;  2NND A;  5CYB A;  3P6C A;  2G79 A;  2FRS A;  5HTD A;  1NP1 A;  3KFH A;  4XMC A;  2GJ5 A;  3IA8 A;  3WJB A;  1DC9 A;  5EED A;  4O4O A;  4IAW A;  4O4X A;  1A3Y A;  3HWG A;  3KZA A;  1JBH A;  3WJF A;  5KID A;  4GH7 A;  2BS5 A;  4ZR2 A;  2JU7 A;  1E00 A;  3B2J A;  1BEB A;  1LPJ A;  3PPT A;  4MIS A;  4Y0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...