3PEFA

Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
287
structure length
286
Chain Sequence
SQKFGFIGLGIMGSAMAKNLVKAGCSVTIWNRSPEKAEELAALGAERAATPEVVESCPVTFAMLADPAAAEEVCFGKHGVLEGIGEGRGYVDMSTVDPATSQRIGVAVVAKGGRFLEAPVSGSKKPAEDGTLIILAAGDRNLYDEAMPGFEKMGKKIIHLGDVGKGAEMKLVVNMVMGGMMACFCEGLALGEKAGLATDAILDVIGAGAMANPMFALKGGLIRDRNFAPAFPLKHMQKDLRLAVALGDRVGQPLVASAAANELFKGARAAGFGDEDFSAIFKTYER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, NAD-binding
publication title Structural characterization of a beta-hydroxyacid dehydrogenase from Geobacter sulfurreducens and Geobacter metallireducens with succinic semialdehyde reductase activity.
pubmed doi rcsb
source organism Geobacter metallireducens
total genus 117
structure length 286
sequence length 287
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3pefA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pefA01
3C7CB 1H6DA 3S2IA 4D0SA 1ZXLA 2Z5LA 1P45A 1MXHA 4EITA 4R4JA 1PIWA 3AWDA 4FFOA 3ETEA 1CETA 4DLLA 1E3EA 1TXGA 5CEJA 2PLAA 2Q4BA 4RZHA 1QYCA 1R4MB 3AJRA 3OHSX 3FR7A 2GN8A 4M55A 1DRUA 2J5RA 1BDMA 3O9ZA 2OOSA 1H94A 4LCJA 4A7PA 4GH5A 4DLAA 2IODA 4IDBA 3EVTA 3RUAA 2GGSA 2YHIA 3ABIA 3HUDA 1BWSA 1VKOA 5IF3A 5C5IA 4HWKA 3L0DA 1I2ZA 2EP5A 2Q46A 3FHLA 3OJ0A 4XGNA 4LN1A 3LDHA 3UW3A 1XG5A 4M86A 4E0BA 2CVOA 1X13A 1H0KA 4M8SA 2PKQO 4WCFC 3OIDA 1N1EA 5LDGA 1NR1A 3RC7A 4PLYA 4PRKA 1IZ9A 1PL8A 2O2YA 4UEKA 1GEGA 5FYDA 2D59A 4I08A 1SEPA 3KETA 1UP7A 2YY7A 2WD7A 3GK3A 5JYEA 2AXQA 2Q45A 5BNFA 5DCYA 4MP3A 3TN7A 4JJFA 1U8FO 3AOEC 3BTVA 4JP3A 4CQMA 5G0SA 1Y6JA 1UJMA 3GZNB 3DBHB 3KYDB 4JCOA 9LDBA 1XA0A 2G82A 2VZ0A 1U9JA 1QYVA 4IMRA 5DF1A 2LDXA 1LX6A 4GX0A 1XSEA 3I9KA 5U9CA 4N54A 4DUPA 1XYGA 3C1AA 2PD3A 4GGPA 4BQPA 1S7CA 3IP3A 2EXXA 5U4QA 1GUZA 3DMTA 3MZ0A 4PRLA 4IQ8A 5A9TA 5B1YA 5G0UA 2YFHA 4XQ9A 2C07A 4L8VA 5A4DA 1LSOA 2FN7A 2EP7A 3NTOA 5KNLA 4QTZA 3GVIA 3ZCXA 4TQGA 3H5RA 5AXCA 3ADOA 3VDRA 4D0RA 3JD3A 3KTDA 1AGNA 5L9AA 4XJTA 2Q2QA 4OXNA 2DFDA 2Y1EA 5DCUA 4E33A 4BB6A 4MVJH 1DJNA 1UR5A 3FNGA 3PGJA 1ZMOA 3OM9A 4EW6A 3NKLA 1P33A 5EIOA 4YDRA 4BNLA 1VJ0A 4YEDA 5IN5A 3UN1A 1PR9A 3ULKA 2Q2VA 1MFZA 4IINA 1SEVA 3KSZO 4YAEA 5IXSA 4XQEA 4BNGA 5JXWA 2G17A 1UAGA 3KHUA 5DP1A 3RQSA 4FCCA 3LLVA 1I3KA 1N92A 4XGKA 3K30A 3WICA 1I3LA 4GX1A 4OOFA 1Q7GA 1GCUA 3DFUA 3T4EA 4TZTA 4J90A 4IM7A 3VZQA 3LT4A 4OKIA 4GBJA 1EE2A 4GQAA 4TMFA 2O4CA 1UXJA 1NPTO 2ZTUA 4L4SA 2ZKLA 3AUSA 5KVQA 1TT7A 3GQVA 4CM6A 2DLDA 4P38A 1N1GA 4KUHA 1ONPA 2VRBA 1DC5A 2JFHA 4GX5A 1PEDA 1N2SA 4I5EA 4WOKA 1EK6A 1A7AA 1AHHA 3F1KA 4KMSA 4W9NA 1BMDA 3AI2A 3INRA 4YWJA 3STHA 5COAA 4EUEA 3A4VA 3DOOA 1LEHA 2CMDA 4PG5A 4A5OA 3BMCB 1K5HA 2Y99A 5B4UA 4DVJA 1MG5A 1YJ8A 2PGLA 3WFIA 4YT4A 2P9GA 3M2PA 3LU1A 4RV9A 5JC1A 1A4UA 4XJSA 3DZKA 1DLIA 3BHIA 4XQCA 5AYVA 4ZRNA 1H2BA 3OJOA 3M1LA 2R2GA 4U6QA 3K31A 2Y68A 4BKPA 1GFSA 3DMYA 2HCTA 3GVXA 3RROA 3TOZA 4ALNA 4EYEA 3W6UA 4A27A 1LRKA 4QO7A 3BMNA 4OSPA 3DZBA 1P31A 5IDQA 3ASVA 2I99A 4CL8A 4BNJA 3OSUA 4L73A 1ZH8A 3AFNA 4PLZA 4R5HA 3U4IA 4M87A 4L75A 2DQ4A 4XA8A 4GVLA 3SJUA 1SAYA 3RFXA 3WSVA 2BFAA 2R00A 3LT0A 5DCWA 3ZWNA 2ZATA 4TRJA 4BO5A 2HQ1A 3EGOA 2BD0A 3VH2A 1XHLA 5AVOA 3WSWA 3DTTA 3OEWA 1R4MA 2JKVA 3CMMA 4NU6A 2BELA 3TZ6A 2D3TA 3PIIA 3FRJA 1WPQA 2WDZA 1HE5A 4HFRA 4BV8A 1J49A 3SX2A 4CMIB 4PLCA 2B37A 3DO5A 2HLPA 3FI9A 4UVEA 4J1TA 2J3KA 2ZK7A 3TOXA 1GUFA 2AE1A 2X0RA 4EJ6A 1DC3A 1YS4A 5CG1A 5A9SB 4R1UA 1ISJA 2I9PA 3AI3A 4YJHA 3C7DB 1TB4A 2QIOA 3E6AA 4CM7A 4J9VA 4PLGA 2HSDA 2PD4A 1ZEMA 3TL3A 1PQPA 4WLVA 1LLUA 4WLUA 1C3VA 2J8ZA 4DIBA 2IZ0A 4QXMA 3PZRA 2ZYGA 1LRLA 1XR3A 3G3EA 3ICPA 4QFCA 2B0JA 4R16A 1H9BA 3AM4A 3DBHA 1LLCA 3KYDA 3UGKA 5JYDA 1F0YA 3NT2A 4IZHA 1Y8RA 3U9LA 3M1AA 4E2ZA 3C1OA 5I7SA 1JW9B 3RBVA 4D7AA 3RJ9A 1A9ZA 3OICA 4U0KA 1UDAA 4LSMA 4YAGA 2GLXA 2VWHA 2PFGA 4HY3A 4J49A 4MDHA 4FW8A 4CLHA 5BNTA 3VH1A 4YT2A 4JQCA 1LTHR 3GGOA 4CLOB 3BMOB 2D5CA 3NJ4A 3UAGA 2D2IA 1BW9B 3INGA 4B4OA 4CR7A 3C85A 2FR1A 3IMFA 4BO6A 4TSKA 2EJVA 4AJJA 4R1NA 4CV1A 1M67A 4IDEA 2E82A 4M89A 3I9JA 4WOJA 1VC2A 3MCVA 4OXYA 2WSBA 1GAEO 2OBYA 4J3FA 4NJOA 4DPLA 5FI5A 3ON5A 2A9FA 4UVDA 5T64A 3ZWVA 3GG9A 4JBGA 2Y1FA 4DBVO 1U4SA 1HT0A 1GEEA 5U1PA 1BDBA 2BRUA 3O4RA 1LSSA 4DPKA 1UP4A 1TI7A 1Q1NA 4W6ZA 3H5NA 4YQZA 4BO4A 3GAZA 4O5OA 4NH4A 2V6GA 4BS9A 1PGPA 4RL6A 4OL9A 1ZXBA 3ZV4A 2BI8A 3MOIA 4Q3NA 4CMCA 1E1NA 3IP1A 3UXYA 2FZWA 4CPDA 3U09A 4LVCA 3ADPA 3GVCA 4EUFA 4ZJUA 2DBZA 5L7WA 1T4BA 1HZZA 3C24A 2AQHA 1Y9AA 4IUYA 1T2FA 1X0XA 5TT0A 3V5NA 1H2HA 3VC7A 4Y8VA 3EAGA 3JD4A 3CZRA 4Z0HO 4K28A 3BMCA 3LT2A 1YBVA 3AY3A 3EDMA 5DOZA 4OIMA 3JQ8B 4R54A 1XIVA 1UZMA 2UUOA 4BNKA 3OQ1A 1JKFA 2Y93A 1LJ8A 1DJQA 1IHXA 2ET6A 2GD1O 2GRAA 4QQRA 4RPKA 3AUAA 3Q9NA 1ZSNA 2P91A 4B4UA 2C59A 5AQ1A 1SPXA 1Z7EA 4TRNA 3H9UA 5CHEA 2P4QA 3GPDG 4WEOA 3QQPA 1XU9A 2C0CA 2VT2A 4RF4A 2I3GA 4WLNA 4AJOA 3JQBC 5C7OO 4W7IA 5F1PA 4JBHA 4CJXA 3GH3A 3K2BA 2B83A 1B7GO 3KM0A 5JO9A 1PZHA 4K26A 4RQUA 3RJ5A 4MP8A 3S8MA 1F12A 1XQ6A 3LYLA 3JQ9A 4RVUA 1ISFA 1I3MA 3C1TA 1V3TA 1VLLA 1BHSA 3DMTC 1Z82A 3MOGA 3E5MA 4CM5A 4YRBA 4XYBA 2SCUA 3GC6A 4CM1A 3AUTA 1N9GA 3RBZA 4CMIA 4L76A 3NDJA 3ROQA 3S2FA 5BR7A 3UCFA 5EN4A 4BMSA 2B5WA 4W7HA 3LSYA 3WQSB 4FSHA 2QRKA 1YDEA 3PVZA 4NU5A 2VYNA 1PSDA 4GKVA 2VNSA 1I24A 4DREA 4E32A 1ENYA 1DC6A 1ID1A 3EZLA 3BTSA 2OXIA 4CM3A 1YO6A 2CDAA 2JFFA 2Y0EA 5ADHA 1W8DA 2P5YA 3GFBA 4JGBA 4GI2A 4Z9FA 2P2SA 1RM5A 1BXGA 3E48A 3RFTA 3GNQA 4BNXA 4CLDA 4GPD1 1JAYA 3B1FA 1GV1A 5JY6A 5ITVA 4ND2A 4LGVA 4U0JA 1ZO8A 1KVTA 1PQWA 3PYXA 3Q2KA 3DOJA 5JO0A 1HSZA 3H5AA 3I9NA 1JLLA 2FPGA 5EJ2A 5BSEA 1X7HA 1JVBA 3QWHA 3VVCA 3ZWWA 3EVNA 3DTYA 3RWBA 2E48A 2NUAA 4ILKA 1GPDG 3GEGA 3NTRA 1D7OA 3N58A 5JLAA 1XWFA 5BSGA 1EZ4A 4XB1A 2NVBA 1YJQA 3I6IA 4YJGB 3RC9A 4W9NC 2NU6A 3O26A 4Q3AA 5CDTA 4YJFA 5KKCA 1BW9A 2VN8A 1C1XB 4HXYA 4UREA 3E1KA 3QRWA 4NR0A 4WASA 1J5PA 1U7HA 1L7DA 4R9SA 1TT5B 1U5CA 4RO0A 3VPHA 3CIFA 3OIFA 3DB2A 4L4XA 5A9RA 1RPNA 3ITKA 4I5GA 3LF1A 1OBFO 1MC4A 2E6UX 4FOSA 3D5QA 3NGLA 2FY8A 1HLDA 3P7MA 4DLBA 2UV8A 3D1LA 4KOAA 2DPHA 4E2XA 4AJEA 4DWVA 1BTOA 5T6BA 4GX2A 1BXZA 2DBRA 3CE6A 4RPHA 1DPGA 1EVZA 1O6ZA 1P1RA 1HDRA 1P3DA 5A03A 2GR9A 3MJEA 2C7GA 4ZQBA 3JQ6A 1LDYA 3PGXA 1VL0A 1R0KA 2GZ2A 3MJ4A 3LZ6A 4H15A 5H81A 1DIHA 1ZK1A 4E5PA 4WUVA 4LK3A 3ZWOA 4ALIA 4NK4A 3IKTA 1GCOA 1TLTA 3L9WA 1N5DA 4FJ0A 3CZMA 4O59O 1M75A 5I7FA 1M6HA 3V2GA 1FMCA 1MV8A 1SB8A 5EERA 3DEYX 3ZDFA 1A27A 1ZFNA 2X9GA 4JN6B 1DAOA 3ASUA 2YHUA 1VL6A 2V65A 1KBZA 3H2ZA 5TX7A 2Y1OA 3WTCA 4E2YA 5T8KA 1N7HA 5TNXA 2HMTA 1ZJZA 4L9RA 3JQ8A 3AI1A 3AM3A 4YA6A 2WTBA 1E7QA 2GYYA 1K2WA 1LC3A 2RH8A 3GEMA 3NDRA 3P5SA 3WNQA 1CQJA 4OHUA 1PQUA 4W82A 3FPLA 3FSRA 1ISGA 4E12A 1LDNA 3CXRA 5MGBA 1P74A 2DTDA 1NQOA 2PZKA 1GADO 5CDYA 2CVQA 1D1TA 1KEWA 2UAGA 1ORRA 2NADA 5A05A 4B8WA 5MDHA 1MX3A 4HKTA 2RIRA 2GPTA 4ITUA 3VPGA 3HG7A 4HFJA 4KUGA 2FR0A 2FPPA 3FF4A 5FFFA 5JFOA 2FRDA 4JP2A 1IPFA 4YT5A 5IDYA 4BMVA 3FCOA 1CRWG 4YCAA 2JCXA 1NVGA 5TT1A 2BGMA 3VHRA 3SLKA 3OFSA 3QVSA 4IS3A 4OQZA 3TRIA 1PGQA 2OO5A 3F9IA 5JBIA 1R66A 2DTXA 2Q3EA 3WGQA 1YH3A 2VOEA 4PVCA 2X8LA 3K5PA 3CINA 4Z3KA 4GLLA 4NBUA 3PP8A 3SVTA 2PD6A 3MJSA 1UXKA 2ZIZA 1QR6A 3V2HA 2ZQYA 3MEQA 1GQQA 1TVEA 3RKRA 1EFKA 3UUWA 4B3IA 4CMEA 4IPTA 3ZH2A 3ZHZA 4CLXA 3GN1A 5CDUA 2AHRA 2D4AA 4BNZA 2BF7A 4CV0A 4UVHA 3S1LA 5EQDA 1MG0A 2CVZA 1DIAA 1UXIA 3GMDA 4WE3A 3D3EA 3UH1A 4HFMA 4D3FA 4PN3A 2QQ5A 3NYWA 1WWKA 4TVOA 5I9NA 1I0ZA 3RVDA 3D3WB 1NFFA 2JD2A 1QLJA 5B4VA 4NK5A 4A73A 3GA0A 2DAPA 3E5RA 3U62A 1ZVMA 1S6YA 2JJYA 1F8FA 1AXEA 1RM4A 1VI2A 3KSDO 1YE3A 3WYBA 3CPSA 1X1EA 1EBUA 1WVGA 1NASA 4WLFA 1U8XX 2W2KA 3ZNPA 1ENZA 4LRSB 1FDUA 1OAAA 2POQX 5JSFA 4ALMA 1ZK2A 5CEEA 1HE2A 4YJGA 4BGVA 2NU7A 3PYMA 2NVUA 4FR5A 2DT5A 1G1AA 1LDEA 2CUKA 3U4HA 2VYND 2X0JA 3WXBA 4R68A 1C1XA 2X23A 1CEQA 2GCGA 1TT5A 5AOVA 4CV3A 4BNHA 1DB3A 1JVSA 2Y1GA 2VHVA 1V6AA 2YW9A 4MVJP 2Y05A 1NQTA 2Q50A 3BXXA 1HDOA 5TJ9A 1DIRA 2VHWA 3JTMA 4IDCA 4S1VA 4UEOA 1V3VA 2H5LA 2RHCA 4C7KA 2X7HA 4R69A 4FN4A 1LC0A 4A10A 4BO2A 1ISMA 3ORFA 2I67A 3H2SA 4FQ8A 2V6MA 2NQTA 5HRUA 3I5MA 3JSAA 1ARZA 3HDQA 1LUAA 2DM6A 4NBWA 2HRBA 3ENNA 5TS3A 4IJWA 3QHAA 4FGSA 2GZ1A 1DIBA 2BLLA 2AEMA 2D1YA 1PTJA 3HNPA 3F5QA 1CERA 4HNGA 4RF2A 3EUWA 4IBOA 5ILGA 3ANLA 4BKRA 3AW9A 4MJLA 2FWMX 2DTEA 4R1SA 1B26A 5CEFA 3PXXA 3KEOA 2DBVO 3W1VA 4JXKA 3DBLA 4L4RA 2GN4A 1PJSA 3DHYA 1DFIA 4TVBA 1WW8A 1UH5A 4HUJA 1XLTA 3R1IA 3WTBA 3ZN2A 1H6BA 3GPIA 5JMPA 3UICA 4DRYA 4RDIA 4CQLB 2VCYA 2X86A 1YWGO 4OKNA 1HEUA 1PZFA 3ZI0A 3IQDB 4YAKA 1FK8A 1SC6A 4RVGA 1Z6ZA 4FJ2A 2IXBA 1DRWA 2E49A 4Y98A 2VHXA 3LF2A 1MGOA 4N5MA 2JCVA 3FNFA 5ENVA 5THQA 5L4NA 2P68A 3NRCA 1HTBA 3EYWA 1CWUA 2P4HX 3ONDA 5C7IO 1K89A 4XYMA 3BA1A 3ZU4A 4A0SA 4J91A 1V0JA 4DL9A 4XIJA 2FHSA 9LDTA 1B2LA 5HBRA 3EMKA 1JAXA 2PTGA 4WECA 3JQGB 3DZFA 1T24A 3BTUA 4J1NA 1HSOA 1CJCA 1NP3A 3PJFA 2OUIA 3KBOA 1DHTA 4MO2A 1T1SA 1VSVA 2WE8A 3Q3CA 3HN2A 3QSGA 3H65A 4BKQA 5LDHA 5C7LO 2IEBA 4CV2A 1ULUA 1WAMA 4ND3A 1Q0HA 5HTOA 4D42A 2JFGA 3L4SO 4B7XA 1T4DA 1Q7CA 3I9MA 2XOXA 3G0OA 4GWKA 1P1KA 2ZTVA 4RF3A 4AJIA 5EPOA 4Z9YA 5GZ3A 1F8GA 1O5IA 3CEAA 3PQFA 2HDHA 2EG9A 2JD1A 3OJLA 5DNAA 3WX0A 1U4OA 1PJ2A 3DHNA 4M49A 8LDHA 2YDXA 5KKAA 1EVIA 3FWZA 3L4BC 5G0VA 4FFMA 1M66A 4ZVVA 1KVUA 3D3WA 4WCDA 1LLQA 2ZCVA 4RQTA 5TF4A 5JDIC 1G0OA 2J5KA 4MIOA 3SBOA 4DQVA 3NV9A 4MIYA 4JLWA 4RPLA 3B70A 1E1KA 5CPBA 4R5MA 1CF2O 2CF6A 1YKFA 1X7GA 3JYNA 3IDSA 3VAZA 3VPSA 3RUCA 1WDMA 5L45A 2DFVA 5T57A 1HDCA 1LRJA 1BVRA 3W4KA 1CIVA 5TSDA 3Q0EA 2JCYA 2O4UX 1RJWA 3GGPA 5EINA 1ZCJA 3ETGA 1U5AA 1VL8A 5ITWA 2HK7A 1HWYA 1H6AA 1L7EA 3C7AA 1AUPA 1OZAA 5JW6A 2I6TA 2PGJA 4LISA 4FGWA 5C3MA 3WGZA 2J3IA 4ND4A 1P1FA 3I6QA 1LU9A 2QRJA 5LCXA 2CZCA 4XZ3A 5A3VA 1ZK0A 1PGJA 3E9QA 4HV4A 2J5QA 2YQ4A 5A3JA 4FPXA 1PL6A 1E6WA 1DDOA 4WKGA 3JV7A 1GR0A 3JQFC 5K9ZA 4IDFA 2NTVA 1LI4A 2VWPA 3UVEA 1H5QA 1H9AA 2JD0A 3E8XA 2QW8A 4I9HA 4QEDA 5G2OA 3T7EA 4YPOA 3ZV5A 5CDGA 1FF9A 3DFZA 4D41A 3AY7A 1CDOA 1Y5RA 3T4XA 4TZKA 3X2FA 1O9BA 4J4TA 1GV0A 3PHIA 2DC1A 3JYPA 3MTJA 4FJ1A 4RVSA 3F46A 5IZ4A 3ZGYA 3ZWBA 2O3TA 5F5LA 4XYEA 5DBIA 3NGXA 4OAQA 4RLHA 3P2OA 5JAQA 1V9LA 3VZSA 5JAIA 3PFWO 5L53A 2Q49A 1ENOA 1AE1A 1KYQA 4JJGA 1KEVA 5CPFA 3RAJA 4RJTA 2X58A 1YOVB 1DRVA 5AXBA 2DKNA 3GF4A 3GMSA 4B4VA 2CDBA 3UCEA 5IZCA 1WDLA 1Y8QB 1PJLA 4NHEA 4EZBA 4P22A 2PH3A 3NDIA 3Q1LA 5I9MA 4ZQGA 1EVJA 3CMCO 5HWSA 2PV7A 3DC2A 4WCFB 1YB4A 1QMGA 1U28A 2E4AA 1ZKMA 4CMEC 1H6CA 1GYQA 4XRRA 2W2LA 3EHEA 3WBFA 5L95A 4CM4B 4E6PA 4YRAA 2JAHA 4E2WA 2B69A 2GF2A 3GG2A 1RYEA 3HQ4O 3GZNA 3O38A 4PZCA 1DEHA 4FFLA 4MVJF 4CQLA 4BMNA 2VNAA 4LSWA 4GLOA 2FR8A 4KZPA 2OZPA 4A26A 1A7KA 4UAGA 4YAJA 2DUWA 3GVHA 2WE7A 1PJTA 3QWIA 5KJ6A 4KQWA 2TMDA 3VH4A 2BGLA 3ZWPA 2JHGA 5JDCA 5ICSA 3GUCA 3KB6A 2Q1UA 3HDYA 4PG8A 5TLSA 4WGGA 3WGTA 2CY0A 2CSUA 4YBZA 1Q0LA 1ZEJA 2AQ8A 3R0IA 4YXFA 1U2GA 2GN6A 5F3RA 4R41A 2NWQA 3QVXA 1ONOA 3ZWXA 4UVIA 2BKAA 1ZK3A 3HN7A 4BNNA 4PG7A 1ZBQA 3WGOA 2ZJ1A 4NBVA 5I7VA 3MTGA 4ESOA 3ETDA 1E3JA 1VJ1A 2IDZA 2NSDA 3WGGA 1IHYA 3TNLA 2EV9A 3IUPA 4WLOA 2EW2A 1QYWA 3HFSA 2O7QA 3ZWMA 1NPYA 1EQ2A 4Y6RA 1NVMB 1Q0QA 1HF3A 2RCYA 5KJFA 3QE3A 5JCXA 1NXQA 3EW7A 4I5FA 3L6DA 1Q2XA 1NNUA 4NFSA 4R3NA 4IXTA 1ULSA 3BMQB 3G79A 3LVFO 4FD3A 5KVVA 2EERA 4MPDA 4Q3BA 3H4VA 4OM8A 1YL7A 1NX6A 4ZQHA 1P1IA 4WK6A 3K9QO 2VHZA 2B4RO 3LC7O 1N7GA 1E6UA 3S55A 4H16A 1ZIDA 3MJVA 4BNYA 2ZYAA 2J3JA 1E92A 3B1KA 5ER6A 5I7EA 3I1JA 1GYPA 1ZJYA 1J6UA 1IL0A 1T2DA 3TZKA 1EMDA 4BB5A 4IIUA 4E21A 2IXAA 3VVBA 1M6WA 2QZ9A 4FFRA 3JCZA 1B15A 2X5JO 3O03A 1GPJA 3PWZA 4GMGA 4LMPA 4MVJE 3R3SA 4RLSA 3PFFA 3OA0A 3Q11A 2GN9A 1JTVA 3GDFA 5KCZA 1LBEA 4KDEA 3CTVA 4Z0PA 3WGIA 1K6XA 3ZWAA 5IJZA 4I9NA 5L7TA 2HK8A 3I4CA 3FPCA 4TWRA 2GSDA 4YYZA 3BZUA 3JD1A 1YGYA 3UFXA 3B6ZA 4TROA 4RPGA 2AE2A 4QUKA 1JN0A 1LDBA 2PKQP 3BIOA 3DZJA 2OFPA 4ZN6A 3DR3A 1WXDA 1TA4A 3F6YA 1IPEA 2O50A 3ONFA 1Y7TA 3Q6IA 5B4TA 1NYTA 5A02A 2I5PO 1R4NB 1FDSA 4CR6A 3LC2O 3RUHA 4G65A 5F1KA 3H8VA 2D0IA 3D0OA 1YBAA 5BQFA 1WDKA 2PGDA 1E7YA 3PDJA 3ST7A 3FBGA 1R16A 5A9SA 1KIFA 1LDGA 1YOVA 3S2EA 4DMLA 1A71A 1UXGA 1Y8QA 3WQRA 4EJ0A 1SOVA 4G2NA 4J4HA 1HRDA 3PLNA 4U6SA 5COQA 4L0QA 4YVFA 3PQDA 1XQ1A 1VKNA 4WCFA 4BGIA 1U3WA 2YV3A 1PJBA 3MJCA 2Q2WA 3IKVA 4CLRB 1X0VA 3JQCA 4AJHA 4C7JA 3DBRB 3QVOA 4RORA 4CM4A 4BQRA 1SB9A 4QX6A 4F45A 4HFNA 2I76A 4OXKA 2HJRA 3AOEA 5BNIA 2B5VA 2EF1A 1X14A 3QJ5A 3K2EA 3WJ7A 3GT0A 2FZEA 3UOGA 5J23A 4MOWA 3K96A 4ZQFA 3CH6A 3HB4X 2X6TA 3WOHA 3U49A 1T26A 1SO8A 3DONA 3IUSA 1GL3A 3FNHA 1Z73A 4MKXA 2ZB3A 3GLQA 3ZHYA 4J0FA 5GY7A 1KEUA 1YL6A 4CM9D 3HZZA 1MP0A 3H9QA 3BMOA 4CLOA 1D3AA 5B12A 3BTOA 5H83A 5TC4A 3ZZNA 1B8UA 1I01A 3JQ7B 1KERA 5TQVA 4QFDA 1E3IA 8ADHA 5DULA 2W8ZA 4AG3A 3SEFA 4BO8A 1DLJA 3V1UA 2O3JA 3NT4A 2OGUA 1NWHA 2VRCA 3U4DA 4DIFA 4NQZA 2Q1SA 4LCEA 1YQGA 3QVWA 1ADGA 3UHAA 2PKRA 3DBVO 1HKUA 3IIEA 2FOIA 3RFVA 2W2LD 3E03A 1IYZA 4UUNA 1XKQA 4PLPA 2VWQA 3GRPA 4ALKA 1QSGA 1PS8A 4IDAA 1ISIA 2H63A 1BGVA 2OORA 3VTFA 1M2WA 2AEJA 4OQYA 4O0LA 3KO8A 4O1MA 3COSA 4D79A 5L7YA 4AJ1A 3JYOA 3BMQA 1LSJA 4AJKA 3L77A 3D4OA 3OIGA 1KC1A 2R00C 7MDHA 4IGFA 3ZWCA 4J2OA 1J0XO 2J6IA 5BSFA 3F1LA 3FR8A 3A14A 3GGGA 1D1SA 1D8AA 2RBEA 3F4BA 1GTMA 4I9UA 3VPFA 4CLEA 4CODB 2G1UA 3GEDA 4RCVA 3KYCB 3E9MA 5IXYA 4P8RA 1HE4A 2Q4EA 4BOYA 5IZCC 3PYLA 4UVGA 1UUFA 3DXFA 4XIYA 3TPCA 4D45A 4F3YA 3RUFA 3QV1A 4A03A 4XB2A 1KEPA 2WWRA 4Q39A 4EI2A 5I8WA 4J1SA 4Y6PA 3LK7A 4GKBA 3IC5A 2XXBA 4XDZA 3VZPA 1XELA 3WWYA 4ONEA 2IZZA 4FS3A 4PLWA 5F21A 2DUUA 4PLVA 2UDPA 2CFCA 3H9JA 1GZ4A 2H1SA 4XX0A 2A92A 2VOJA 4DPMA 1FDWA 2H6EA 2QYSA 1RWBA 3HHPA 4CQMB 3H6KA 1Y81A 4FC7A 1W0CA 5EL0A 1KVRA 1I33A 1SZJG 1HETA 4YAIA 3I52A 3W4JA 1K6IA 1GZ3A 3HSKA 4CL3A 1BSVA 4NMHA 4AFNA 5HS4A 1QV6A 2FSVA 4ALJA 1EEHA 3PLRA 5I8ZA 5ES3A 1GQYA 1U3VA 3G49A 3PWKA 2HK9A 1UZLA 4OSOA 4TRMA 1LSUA 1PX0A 4OGWA 1MA0A 1WZEA 1Z7BA 1SBYA 4EGFA 5COBA 1ZW1A 2NQ8A 1WMBA 2HO5A 2ZCUA 3PRJA 4YACA 4F6CA 1KC3A 4BVAA 3OQ6A 2HMUA 1PGOA 1VSUA 2HUNA 3BHMA 2V7PA 2WJPA 4F46A 4J2HA 4E31A 3CSDA 5ER9A 4KWHA 5C37A 2NNLD 1T25A 1T2EA 4Z3DA 4NI5A 3D4NA 3A28A 1F14A 3JD0A 3BYZA 3TL2A 1T1RA 2J3HA 4YB8A 2Z1MA 3ICCA 1DBVO 1ADCA 3OETA 3M2TA 3BHJA 4IXWA 1RM3A 3TWOA 1MFPA 4URFA 5ENDA 1IULA 1DO8A 1RKXA 4XEHA 3OQBA 3QWBA 3PHLA 4WNIA 3MWEB 4BO9A 4I5DA 1G0NA 1PZGA 1JWBB 3WIDA 4CMHA 3ZNNA 1RM0A 4J16A 3WG9A 4K1LA 4YQYA 3L6OO 3A06A 7ADHA 3PIDA 2PA3A 3E18A 1Q7BA 1ADFA 3JYLA 2VTDA 2HKIA 2RAFA 3ZHBA 5IDXA 3PHHA 2Q1WA 1C0PA 1MLDA 1SOWA 4PG4A 2O3QA 2NV6A 2NU9A 3IJPA 4PVDA 4E5MA 5AXAA 4CMKA 3A1NA 4CR8A 1YONA 3WIEA 3GHYA 3IS3A 3E9NA 3ONEA 3VKUA 1I2CA 4E5NA 5GZ6A 5TGDA 4FDAA 1O8CA 1VPDA 2VWGA 2A35A 3DL2A 4INAA 5L40A 2I66A 4Y67A 3LQFA 3AFMA 3Q2IA 3GZ4A 5DZSA 4BGUA 4C4OA 1SMKA 3HDJA 4X54A 3KYBA 2B4TO 5K6AA 2Z1NA 4Z6KA 1Z75A 1K3TA 2WEKA 2Y1CA 2EHDA 5JMWA 1D4FA 1QXSA 1T2CA 3OBBA 4ZICA 3VTZA 3DHEA 3EC7A 5G4KB 5ICMA 3B20A 3R6DA 1OFGA 1Y5MA 5DBFA 4QSMA 3O8QB 2NTJA 1GU7A 1PR3A 1KVSA 1ENPA 6LDHA 5KOIA 1BXKA 1EDOA 1K6JA 1HE3A 3AUUA 3JQ9C 1PU2A 3FD8A 1E0DA 3OF2A 1MB4A 3FN4A 5H82A 4OO3A 3RSHA 4FFPA 3IAHA 1P0FA 1EUCA 3ANMA 3WBBA 4NBTA 2IRWA 3CUKA 3RD5A 3HB5X 4B7UA 2HMWA 3KYCA 1JQBA 2PK3A 2F00A 2XXJA 4G81A 5F1OA 2I65A 2VRCD 4D46A 4DA9A 3RIHA 1HDGO 4R3WA 3H7AA 2VUSA 3RI3A 4U7WA 3F5SA 5TRTA 4YJHB 3KRTA 1QLHA 4BO0A 2FSSA 5BT9A 3OH8A 3LLSA 2DBQA 2EIHA 3GDGA 1PJCA 3GR6A 3C3XA 3ZW9A 5FEUA 4OOEA 4BIIA 4DQUA 5B37A 1JKJA 4W4TA 3GY0A 4E4YA 4YTEA 5DN9A 2PZLA 2HAEA 4B3HA 3RCBA 2C20A 3WGHA 4AJNA 3GHHA 5JY1A 1A72A 1NBOA 2NACA 3C8MA 4J43A 3JQBA 3FWNA 3PHJA 3HE3A 3WDSA 5A06A 4HADA 1KETA 1T2AA 4BHTA 4DC0A 4Q9NA 4E13A 1Y8RB 2O48X 2IZ1A 4U5QA 3ZW8A 3HADA 1R0SA 4U8GA 2E37A 4XYGA 2BH9A 1ML3A 4IY1A 1NQ5A 1VRWA 3RUDA 3ZWYA 1BG6A 3I9OA 3INTA 3LT1A 5T67A 3PJGA 3GNTA 3HFGA 3PHGA 4DXHA 3TF5A 1U3UA 2GDZA 3S2GA 4KP7A 3NAQA 2IE0A 3QWAA 2PY6A 4BNFA 1FJHA 5HA5A 2ZQZA 3FBTA 3ZV3A 2YYYA 5THKA 5KJEA 4HX5A 4G5HA 3ANNA 3AOGA 2TMGA 1PZEA 2YJZA 4NJMB 3WMWA 4ZGWA 3N7UA 3D64A 3K92A 3DZGA 3MJTA 2GUGA 2ZB4A 4ZA2A 1YXMA 3TSCA 4P4NA 1NR7A 4IJVA 4CUJA 1WZIA 1R15A 1W4ZA 2W98A 2QRLA 1E7RA 1F17A 2CDCA 1N8KA 4YT8A 1HYGA 2UVDA 3OP4A 2F1KA 1B8VA 1UAYA 1E3SA 1Y9EA 5DBGA 1H93A 5EQFA 3RBXA 3TZQA 4HBGA 3E82A 4MINA 4HNHA 4IIVA 1LQUA 1I30A 2BFPA 3K8ZA 4M1QA 5A04A 1A5ZA 5CAEA 1YB1A 3PQEA 5JAZA 3JD2A 2C29D 2DU8A 3WGYA 3F3SA 1E3WB 2C5AA 2HU2A 4AJ4A 2EGHA 4IDDA 3D7LA 3DZIA 2P5UA 4WPGA 2EWMA 3ROPA 1E77A 3L6EA 2I3AA 4GVXA 3QIVA 5FWNA 1R0LA 4DC1A 3QVTA 1W73A 1Z74A 3HJAA 2FPIA 3QY9A 4BNWA 4EJMA 5T8KC 4JJIA 2X5KO 4IQ0A 3NUGA 4XDYA 1EFLA 1BVUA 4KUEA 1HZJA 2WYWA 3JQAB 4K6CA 5GMOA 3GN2A 4E5YA 1U2DA 4K9DA 4XQGA 2AQIA 4GSLA 4ID9A 4R01A 3I9LA 2V6BA 4II3A 4UUPA 1VE9A 1UXHA 1U7TA 1P44A 1AHIA 1IB6A 2XAAA 4BNTA 3GUYA 4R1TA 4QT0A 4KQXA 5JE8A 4CMGA 2VZ9A 1LLDA 2PH5A 2C2XA 1P0CA 5G4KA 1IE3A 6ADHA 3FNEA 4GAEA 4DQXA 2OHXA 5BSHA 2D8AA 4MVJG 1C0KA 3KLPX 3NX4A 3O8QA 1CQIA 4J7UA 4MP6A 3TQHA 4BGEA 4BNUA 1KY4A 1NTOA 4PGFA 4MIEA 4CM9A 1ZZEA 3RC2A 2C2YA 4H3VA 5CFZA 3RUIA 2WYVA 1HXHA 1ZK4A 2IYOA 4H7PA 4P4LA 4RVFA 3PJEA 2Y67A 2ZYDA 4OMUA 3DWFA 4QECA 3SC4A 3F4LA 3PDUA 4D3SA 2QYTA 4B3JA 3KV3O 4QO8A 1GQ2A 1X7DA 2EEZA 1N9GB 5DT9A 4ZD6A 4BKUA 3U3XA 1GD1O 1IY8A 1JKIA 1V35A 3OJFA 3W8FA 1EUDA 1KS9A 1IUKA 1R12A 2XPCA 4M54A 1E7WA 3CKYA 2NLOA 4JK3A 5L3ZA 2VUUA 3WS7A 3WQQA 3GFGA 1U1IA 2W4QA 3IL2A 3A9WA 2AW5A 2QZZA 3G1TA 1IZ0A 1E7MA 3M6IA 1P1HA 1QV7A 2PR2A 2VTEA 1LDMA 3TDKA 3FTNA 2R6JA 1BXGB 3VPXA 1W6UA 1C0IA 4CMJA 1NAHA 3AK4A 4MVJM 2RHRA 4CLRA 3OJEA 3AU9A 4A2CA 1YQXA 3VOSA 4BNIA 5A5EA 3ZNOA 3G17A 1EDZA 2A94A 2GERA 1EBFA 2C7VA 1DAPA 3JQGA 3P19A 1R6DA 3ROMA 2ZTMA 3HWRA 1C1DB 1VM6A 1P9LA 2EKQA 4D44A 1DHRA 2X9NA 3WWZA 5I9LA 1J4AA 5L51A 1GDHA 2C5EA 2AQKA 2P9CA 1I32A 1GZ6A 1HDZA 1EQUA 1ZSVA 4Y9DA 2QHXA 3QLJA 3PTZA 3ENKA 4DYDA 2BFMA 4YJFB 2X9VA 5JPIA 3EK2A 4EEZA 1FDVA 1NPDA 4NJMA 2DVMA 4LW8A 1DIGA 3I4FA 4JROA 2PWZA 2G5CA 5IN4A 2NTNA 3TZCA 1UZNA 2CNBA 3UF0A 4BUCA 5TJHA 1WNTA 2ILTA 1RYDA 4I1IA 5K6AC 3ITDA 2BI7A 2NVWA 1I36A 1NHWA 4CQMD 4II2A 3RKUA 4AVYA 2LDBA 1MC5A 2OP0A 3WJAA 1ZNQO 1I5RA 1ZUD1 3ZHXA 4J9UE 5DOVA 3PZBA 5IAAA 4NPCA 3JQDA 4GWGA 4ALLA 4BO1A 2PNFA 3OEYA 3DDNA 2UYYA 4J0EA 1B0AA 1JA9A 1EVYA 4RZIA 3UKOA 1E3WA 2VUTA 3OA2A 4UULA 4BV9A 4XYLA 1A4IA 4LMRA 4F6LA 3U0BA 2QG4A 1CYDA 4ZQEA 5JS6A 1B8PA 1NHGA 3RUEA 2GNAA 2WMDA 2Y1DA 1DSSG 3VKVA 4FIZA 3IOYA 2X0NA 2H9IA 4J6FA 1LXCA 4JIGA 1OC2A 5KIAA 2YDYA 3DAPA 4DMMA 3JQAA 1DXYA 4XR4A 4MVJI 1KY5A 1GYRA 1KOLA 1EE9A 4XKJA 2AG5A 4IJKA 4E5KA 3K73O 4B8ZA 4DIOA 4WLEA 3KLMX 4N18A 3ZU3A 4XRGA 3H3JA 5HS6A 5L4SA 1LNQA 1WP4A 5T5QA 3TJRA 4XGIA 4PFJA 1HYHA 1FDTA 3WMXA 2Q99A 4DYVA 4CMAA 4RDHA 2CD9A 3DAFA 1E6EA 1NFQA 4FOOA 5JCJA 4K6FA 2OMEA 2G76A 5LC1A 1X1TA 4R51A 1V3UA 1QORA 5JNLA 3KUXA 4BNMA 3JQEA 1QYDA 4Q3DA 2X0IA 4MVJA 3H3FA 4RF5A 5AXDA 1PWXA 1DFHA 1XEAA 4E30A 4ZRMA 4IQGA 2VYVA 1O94A 4NZ9A 4FBGA 4N5LA 4Y6SA 1HDXA 1X15A 1O0SA 2NU8A 4B79A 4KDFA 2Y66A 2YFQA 3AY6A 3EY4A 4JX8A 2EKPA 2HMVA 2PZJA 4D3DA 4W99A 2WYUA 3VZRA 3EZYA 1L1FA 4NDNE 4EEXA 2HMSA 2GZ3A 4P4GA 2BGKA 3PJDA 2AA3A 2Y0CA 5FF9A 2BFOA 5CP8A 2DPGA 1PL7A 4HP8A 1PS0A 2JHFA 2ZB8A 1G6KA 4PG6A 4PIVA 2YUTA 1B14A 1DFGA 2RH4A 4O63O 3SJ7A 3RASA 3AM5A 4RVHA 3SLGA 4IZIA 4IDGA 2UUPA 4KTVE 3RU7A 4BO3A 4J4BA 4GMFA 4NFHA 2EGGA 4RGBA 2WD8A 4CUZA 1NFRA 3N74A 1F06A 1QP8A 1PS9A 1P1JA 2BMAA 5G0TA 1PJQA 3GNSA 3KVOA 3V2UA 1Z45A 4B4WA 2ZTLA 5TIIA 1PGNA 1B3BA 2YZ7A 4TRRA 1YQDA 3WYEA 1C1DA 1P77A 4BNVA 1E7SA 1OMOA 4ZU3A 3VH3A 2YQ5A 4WNCA 2W2KB 3DQPA 1I3NA 1YL5A 2IYPA 1HDYA 4L74A 1C0LA 4LRTB 4GGOA 4BL5A 2C54A 1AN9A 3I83A 4XCVA 3TFOA 4AJPA 4OYRA 2OL4A 3L07A 3U5TA 2FMUA 2NVUB 1SCUA 1MUUA 1UDBA 2WM3A 3B1JA 3KEQA 4BO7A 1XU7A 2AMFA 3QA9A 4PCVA 1OOEA 4PLFA 5DP2A 3P2YA 4CMBA 1B16A 1ONNA 4NG5A 4CM8B 4N5NA 3HDHA 5K0ZA 2VZ8A 5ILOA 1HYEA 4PZEA 1ZMTA 3R3JA 3H9EO 4B7CA 1IOLA 4UEJA 1I10A 4E3ZA 3T7CA 2B4QA 5KVSA 1E5LA 2HRZA 4FB5A 5CG2A 1M76A 2IEDA 3L4BA 2HJSA 2X22A 5GZ1A 3GOHA 3ZU2A 4ZHSA 3WR5A 1I2BA 4J7XA 1AXGA 4J1QA 3AU8A 5L4LA 1PWZA 2O2SA 3U4CA 5JDIA 4O6VA 5A1TA 1HLPA 5CDSA 1QG6A 2PZMA 2VT3A 1JDJA 1VJTA 1QYXA 2AG8A 3UCXA 1A9YA 2NM0A 4ND1A 3V1YA 4FFNA 4OH1A 4DBZA 5G4LA 4JNKA 3V8BA 1E1LA 2FP4A 2YHIB 3GVPA 3JYQA 3KOUA 1E3LA 2O3RA 3H9GA 3WLFA 3X2EA 4UUOA 4Z0TA 3Q9UA 4PLTA 5IFLA 2Y0DA 5F5NA 3D4PA 3ZU5A 4J7CA 4NNJA 1SNYA 3OECA 4YJDA 2X1HA 5G0WA 3K6JA 1FXSA 2B36A 1YRLA 2EKLA 2P9EA 3I3OA 4AICA 1LA2A 2WD7B 3DBLB 1DC4A 4WEQA 3WLEA 3W6ZA 3LC1O 4IMPA 2A4KA 3JQFA 1QRRA 1NWCA 1EUZA 3PEFA 4KWIA 3VDQA 2D5AA 5JDCC 5DDIP 5KJCA 2O7SA 3NEPX 2AEFA 3DAGA 4DTIA 4S3MA 4TKMA 1GY8A 1R4NA 4XD2A 3I23A 4UUMA 1C14A 2JL1A 2V6FA 1B3RA 4FC6A 3NT5A 4IS2A 3NJ8A 4ROSA 1PJ4A 2YV1A 5JC8A 1O89A 1O95A 4TKLA 2EJWA 4MKRA 4AJLA 1QKIA 5FI3A 4Q3EA 5IDWA 3F47A 4EBFA 3SC6A 1ZSYA 4PLHA 5KJ1A 2O23A 2YV2A 3OMLA 2Z95A 2QX7A 4RVDA 4XWYA 2JAPA 2O3SA 4PZDA 3GRKA 2W90A 5EMHA 1EK5A 1LQTA 2O3UA 1UP6A 4XR9A 3QW2A 5EESA 4AJ2A 4IJUA 3IJRA 3JQAD 3PI7A 1R37A 3QP9A 4JBIA 4NFYA 2B35A 2X5OA 3KSUA 4RPJA 3ZV6A 1OI7A 3DBRA 3GAFA 3CTMA 3TZHA 5JAMA 2Q1TA 2BHLA 1YDWA 3D5TA 3W4IA 2GO1A 5KVCA 1NM5A 1WLYA 4IGEA 3WB9A 1TEHA 2C82A 2OBNA 3PWSA 3QWFA 4WJZA 3NTQA 4NBRA 2X4GA 3G1UA 1YBMA 2OP1A 5KWEA 2ZJ0A 1YB5A 1KVQA 1MXFA 1NAIA 1NQAO 5JCJD 4I8XA 3W8EA 5HM8A 2G0TA 3DOCA 4YRDA 1BRMA 2ZB7A 1U3TA 2XF8A 1GUYA 3ROKA 3JQ7A 4NIMA 5A5FA 4Q3CA 4LVUA 4YR9A 3MWDB 4EUHA 4MVJD 4D43A 4EDFA 3V1TC 2VHYA 4Z9XA 3TFQA 5IG2A 4MKZA 1NVTA 2VYVD 1ADBA 3BAZA 1WMAA 1ISHA 3WYCA 1OC4A 1DOHA 1PJ3A 3PPIA 4GL4A 3KZVA 1JU9A 1YVEI 1XGKA 2EW8A 4BKOA 1Y1PA 3DZHA 3FTPA 5KTKA 4N7RA 3KXDA 4R9RA 4KTTE 1E5QA 4ND5A 3RU9A 4CM8A 3RC1A 1I8TA 1JWAB 4OJNA 1V8BA 4CUKA 2GASA 3SXPA 1HL3A 3ZNQA 1UDCA 4AL4A 4DGSA 3L9XA 3WFJA 3W8DA 1XCBA 4GSKA 3WNVA 2CF5A 1K0UA 3BMNB 2VQ3A 3GDOA 3PK0A 1E1MA 1XDWA
chains in the Genus database with same CATH superfamily
1WZCA 3DYIA 3EXHA 2V7QD 1H6DA 2H1VA 1ZGZA 3HO6A 1UJ5A 1G9TA 3IAM6 4Q1DA 1P45A 4TWIA 3KV1A 4EITA 4D0SA 2VZEA 4DV4B 1GNTA 4C0AC 4B32A 2GVDC 1E6MA 1RJFA 3WRYC 2FEXA 1CETA 1T0PA 2CL0X 2WLTA 3VHQA 2PLAA 1CSEE 3ZGZA 5C8XA 4B47A 4BZQA 1AUQA 3AEZA 1PT8A 1Y4DE 3OHSX 5BORA 1DRUA 2FYTA 2J5RA 4FHZA 4X00A 4CGZA 5DRYA 4LJLA 5AI9A 1E3TA 1OX5A 3AY0A 3HXOA 4LCJA 1JDPA 1Z5PA 3RUAA 1QO0A 3BM5A 5F7ZA 2YHIA 3K0BA 2IXTA 3DAYA 3KZOA 4RMGA 4ZV7A 2ZRIA 4ERNA 1W88A 4G2TA 3CO0S 3NTUA 3R5XA 5C5IA 3M5DA 3GPBA 2P6PA 3CVUA 3FHLA 2QR2A 1NBMA 1OLSA 5DTMA 4E0BA 4UHFA 4M86A 6GPBA 3I9V6 1LTKA 4BY9E 5JMPA 3WHIA 3NVAA 4AP9A 2DE0X 3E4CA 3KL2A 4DLUA 4PLYA 5KREA 4J0CA 4W6QA 4AF7A 2XOEA 3PXCX 3HYSA 1RKVA 2O2YA 2VSOA 2HA5A 2ZRHA 3IV7A 4UEKA 2D59A 1OWOA 4L3WA 2FRVA 2ZVPX 4LTDA 2BDEA 4NEGA 2JANA 3R5HA 1HQDA 4RS4A 3R5KA 1QCDA 2PL5A 3ZJ4A 2AXQA 4Q4JA 2PX5A 3OFKA 1DUIA 1KYIA 5E3IA 5BNFA 4URYR 5J59A 4CQMA 3AOEC 4KLNA 2A59A 3BD9A 2NAPA 1R7RA 1YVPA 1NJ2A 1UJMA 2JA1A 3DBHB 3KYDB 1XA0A 3REGA 1U9JA 2XQIA 3QVMA 1FSGA 3HJTA 4PSKA 4MUEA 4EO9A 2ZP1A 2LDXA 3CX7A 2Q3JA 1YZLA 3I9KA 3F6RA 5U9CA 4N7BA 3HNRA 1K66A 4HSEA 4Q66C 4AMYA 2AZDA 3FGNA 4NYMR 1EG2A 2IF0A 4TLMB 1RBMA 1LQ2A 2XE8A 1TCBA 2XWJI 2LCQA 2QXYA 3P9PA 1WSDA 2H57A 2C07A 4L8VA 1K7CA 4TLEA 5A4DA 5FOQA 1LSOA 2FN7A 2YZ2A 3CVXA 2EP7A 1KJNA 1VE7A 2BFWA 3GVIA 3OPVA 3SHVA 4WAUA 1MO6A 1UZUA 2J6BA 1NSTA 3G9QA 4XSGA 1TRHA 1AQUA 1YFKA 3ADOA 3OFNA 4J0HA 2L19A 1PF7E 2IEAA 3SSOA 1LW7A 1GT6A 4O4JF 4QGGA 5D1HA 4XJTA 1SQSA 3FH0A 4OXNA 5IJ0A 2DFDA 4XSHA 2Y1EA 421PA 2NIPA 1DJNA 1UR5A 4BB6A 1T6NA 3JVEA 4BNDB 3A32A 2H4HA 2M6RA 2X8WA 2QUKA 4NE9A 4PIMA 4BFVA 4LTNA 4BNLA 3OPNA 4XQ0A 5IN5A 5FUQA 1PR9A 4O4HA 3ACDA 1RD4A 2ETVA 4IINA 1SEVA 4YAEA 5IXSA 3OT1B 2REBA 1J8FA 2IGBA 4BNGA 3TB4A 1YI0A 1CUVA 5DP1A 4OXRA 2GK4A 5LWQA 5FTKA 4ZV4A 5MN5A 1I3KA 1N92A 2CZGA 4OQMA 4DLZA 4OQQA 1I3LA 2X19A 3HXKA 1A0OA 1KMNA 1TZCA 4J90A 2QGNA 2VIIA 3FWPA 3KLOA 1JG7A 4IBOA 4AI6A 1W5TA 2F3RA 2FPUA 4GBJA 4RHFA 2R1TB 1FP4B 1CEXA 4GQAA 1KYWA 2VKQA 2FA9A 2GF9A 6REQA 3Q8MA 5ALKA 5EHGA 2WU8A 1ZQ9A 1ZW6A 2ZTUA 2RARA 2ZKLA 4L4SA 2BJWA 2C58A 3AF1A 4O2AB 4PSUA 3GQVA 2ZZKA 3U1VA 4P38A 1EHCA 1EZZA 2OC4A 2P7HA 3K8YA 4IKEA 1ONPA 4CM6A 5CB4F 1B1AA 3GIWA 1XNQB 1KO8A 2YJNA 3CBGA 2LIVA 3CUWA 1FFHA 5FLKA 4WOKA 5EWLB 1OB5A 2WOOA 2IYWA 3QPAA 2QW0X 2PX3A 3F1KA 1G6HA 3CRRA 4M1SA 2IWHA 3SAJA 1ULTA 2JCBA 2DPLA 3STHA 3WJ2A 2C9YA 5CW1A 4DMUB 5C1BA 1Y7LA 2GEDA 4BBPA 2JVIA 1RLTA 2V98A 3GJ0A 2L42A 2DH6A 3O0TA 5FNVF 4ZZIA 3WFIA 1RQPA 2PXAA 4I9FA 4AZWA 4YT4A 1QTIA 3Q85A 3LU1A 4RV9A 2EF0A 1A4UA 1WTCA 4XJSA 4CU2A 1DLIA 4DQLA 2JLUA 1N4AA 4C4TA 5AYVA 4ES6A 1H2BA 3MTBA 4OHXA 4ZTZB 2DMRA 1OD6A 3CWZA 4RZ2A 2R2GA 4U6QA 3RAFC 4HWSA 2GK6A 3PXDA 3GVXA 2F62A 3WHPA 3I12A 5FLEX 1M2VA 1ZJWA 4Q7LA 3CUYA 5AJHA 4ZANA 1JR2A 1LK7A 4XVHA 4CL8A 2R7AA 3OLWA 3E9CA 4L73A 1JU3A 3G2IA 4GR5A 1R5OA 4MWTA 3INYA 1HKHA 3FZGA 4PQFA 2ZYIA 3PFNA 2BMJA 4ZVKA 4TMKA 4YO7A 3GLFE 3L79A 2IXDA 1Y6RA 1P4RA 4EY6A 3N0WA 3QE4A 3QKSB 4KAJA 4F4CA 2IJGX 5B53A 3EGOA 2BD0A 1TTPB 1XHLA 3PNYA 5KQGA 3ANXA 3O8OB 1O95C 4ZREA 1L3CA 4KAXA 3PIIA 4AKTA 1BU5A 3RRZA 4CMIB 3CLUD 3MA0A 4WH0A 4L8FA 1KJZA 4GQBA 4D97A 4E09A 5IKEA 2B37A 3VI3B 1ZGJA 2HLPA 3LD9A 5LYYA 2BSQA 2IS6A 2ZWPA 4UBIA 2J3KA 3WBJA 3QU9A 1E9FA 4YP0A 1GUFA 4FHDA 3ML1A 4Y3UA 1GZUA 1ISJA 3H5OA 1UKEA 3ZKAA 2QTLA 4JLPA 2VDPB 1H4TA 1GZ5A 2A84A 3E6AA 4EI8A 1TGVA 2WMYA 3C6ZA 1TU3A 1PFGA 1SCJA 2V97A 4RANA 3PL1A 2UUAB 4EG0A 2NV2B 2VP2A 3D4BA 4WY8A 3V8MA 1LLUA 6NULA 1C3VA 1N6RA 2ES4A 1CDZA 3S27A 3KXPA 3FFBA 3UOWA 2ZYGA 2BMFA 2ZTHA 4R16A 2I55A 2RJOA 4RCZA 2Q0HA 1HV8A 3AM4A 3DBHA 3DEFA 3KYDA 4TTSA 4YO8A 1KDPA 5D5PA 5JYDA 2J6HA 4MJ7A 3MGKA 4IZHA 3SG0A 4RMHA 5H70A 4J16C 3UB4A 2WM8A 3VSCA 3AVWA 5HCNA 2FPGB 1C50A 2V55B 3CA8A 3IB3A 3RBVA 3OICA 2XNCA 4U0KA 4AXXA 4D9MA 1IJFA 2K7ZA 1AKWA 4HH3C 4MV4A 5FWXA 5ADVA 1UODA 3QVKA 4DSNA 1CJKC 2VWHA 4HY3A 3P9SA 2VAWA 4J49A 1VMIA 1K4MA 1VKRA 2QQEA 5FOUA 4DLWA 2WJVA 1OA0A 1FUYB 5DVZA 4H1VA 4P3KA 3TL6A 1ESNA 1XQXA 2CHQA 1R50A 2F67A 3A6DA 1LTHR 3LUPA 3TQTA 3FNQA 2D5CA 3NJ4A 1VHLA 3K1TA 2LZ0A 3O21A 5F2NA 1BW9B 4CR7A 1NBMD 1JIXA 2Q8NA 3BT7A 4BO6A 1DDIA 3N07A 3W7BA 1M67A 4IDEA 1TQ8A 3IJ5A 5HDQA 4ZWNA 3OWXA 4RZUA 1AKNA 5FPKA 5F51A 4Z4HA 4B3RB 2P40A 1RHKA 3U16A 1NNSA 1QB7A 4BNDA 3GFTA 2JIMA 4GYYA 1A8HA 3MCVA 1NSFA 3CLHA 4UMVA 5AD1A 2WSBA 2OBYA 3EIWA 3F7OA 4G09A 4DJJA 2BZ0A 5KZMB 4BDTA 5KTPA 2C4MA 4H27A 2WRZA 3ON5A 2A9FA 5T64A 1F7VA 2AJLI 2R65A 1YZFA 3OT1A 3AI7A 3PD0A 1OAOA 2XMZA 5JG7A 3Q87B 2HPHA 5AK5A 4CIYA 3TLCA 1FVHA 3I1IA 3ET4A 3M4NA 3TLGB 3CVWA 2BRUA 4FUQA 4PNZA 4Q12A 4S2EA 2HT1A 3MAAC 3H5NA 4BO4A 4HPWA 4HQRA 3GAZA 4A82A 1RIIA 1FRVA 2MR5A 4C07A 2JHPA 1L5SA 2R1TA 1FP4A 2V6GA 5HFJA 1G6OA 4OK3A 4YFVA 4X62B 1PT7A 3SWWA 1JHQA 1ZXBA 1IN1A 1VE6A 3HJCA 2LE0A 3UBMA 1NKTA 3OQOA 3MIIA 1E1NA 2RKWA 6YASA 4OXXA 4XUGB 4IX9A 5EWLA 2DBZA 2PAAA 4GIBA 4KPYA 1F2TB 1HZZA 1T4BA 4ZALA 3CG4A 2FMIA 3C24A 3EEBA 3PQ2A 2IW1A 3OFND 5LP6B 3SYKA 4NCBA 1U1GA 1GIAA 4RJ2A 1H2HA 3KS9A 4Y8VA 4KHZA 4HAZA 3EAGA 3A6LA 4Z0HO 5IYZF 3U7QB 4YRQA 2L0XA 1G2PA 3IIJA 3VYVA 4GYWA 3H1TA 3LT2A 3QE9Y 3B9PA 4O3FA 3IVMA 3VJRA 5DOZA 1R0YA 4HN9A 4KQIA 3ORHA 4OIMA 2QQ0A 3JQ8B 3KOMA 4R54A 4NAHA 3WK9A 3O7MA 3WYDA 4XJVA 4BX9A 5IH7A 4EB6B 2UUOA 4UOEA 3F5FA 3OZCA 3DV0B 5TARA 3VR5H 1E6LA 3QPVA 2RAVA 3AUAA 4BFSA 1FNCA 4C4XA 3SIXA 2H1IA 4JC4A 1OXSC 16PKA 3V1NA 4G24A 4CZ2A 2CV2A 3H1AA 1L1QA 4QTTB 3QQPA 4JJEA 3DBOB 2VT2A 3ID6C 4LHZA 4XUEA 2I3GA 1GR1A 3F6EX 1PZNA 1SGWA 3JQBC 4QYIA 4DSAA 1T43A 4D80A 5JASA 1A96A 4LV8B 3UMGA 1X1SA 4IWNA 2PPLA 2WYOA 1YZHA 4ICIA 4RDXA 1PZHA 4LI3X 2FZGA 2P2GA 1ZHFA 2YYAA 4Y6OA 3P45A 1F12A 3AR2A 3LYLA 1O6GA 3A31A 2P6RA 1JJVA 4MS1B 2WHYA 3QKSA 1V3TA 1BHSA 3WWEA 2IYLD 1E9SA 1Z6XA 4EKNB 3KKQA 4YASA 1ZR4A 1XKXA 1M8JA 3E5MA 1H4SA 1YZGA 3O8OA 4ETWA 1N9GA 2AD1A 2W0MA 1MV5A 3G13A 4EY8A 1FP7A 3RBZA 4CMIA 3NHFA 1L1RA 1N4DA 1S7GA 1ZESA 3V7NA 3S2FA 4DWOA 4KR6A 2GZDA 5BR7A 5EZYF 4URXR 3BUSA 4MI1A 5KSPA 3M89A 4TXNA 3LSYA 4Q93A 4W7HA 1OW3B 2QRKA 3WQSB 1YNSA 3KZ1E 5EJ8A 1AUOA 2FEOA 4NU5A 2K6GA 2VYNA 2J85A 5C0OE 1N1DA 2G8NA 3BRQA 2IKSA 2X4DA 2EYUA 4GKVA 5JNRA 1B43A 5CD1A 4NCAA 3CLSC 1WDWB 5DGXA 4E32A 1DC6A 3NV7A 5BO5A 2PM8A 3EZLA 2OXIA 3NRBA 1RYBA 2ZI7A 3GRAA 5AICA 3DVRX 1YO6A 3EOAI 3W7AA 4CM3A 1SFRA 2Y0EA 4P7JA 5ADHA 4AS3A 4RA9B 1N1MA 2XIQA 4JGBA 2P2SA 1GP2A 2A1TR 4BNXA 3C3PA 3ETJA 1E9AA 2W9XA 3JPYA 4EVRA 5KQMA 5IAOA 2YXPX 3REFA 1ZNWA 1V95A 5ITVA 4I66A 4ND2A 1PFKA 1ZO8A 3Q2KA 1OE0A 3T8YA 1TFUA 2VEOA 1H2RS 3H5AA 3A1CA 4DCUA 2FPGA 2E0IA 5BSMA 3G9XA 5DX0A 1VG8A 3GMTA 3AW8A 4KZKA 4EI7A 2NUAA 4HEJA 5JYCA 4PCLA 1YR3A 2I7VA 4WFJA 4X0EA 1IHPA 2WFMA 5EVCA 3N58A 1KYYA 1KRWA 4Q4AB 1Z5ZA 1EZ4A 1IHOA 2W4IA 4XSVA 3NANA 4ZO4A 1NY5A 1AKUA 2FFQA 4W9NC 1LVUA 3H4TA 4Y9UA 1BW9A 3T6KA 3F97A 1UEXC 1YJCA 2ZYUX 4B74A 3QRWA 3DPIA 4URHA 3B7PA 3ZE6A 3EXG2 4RTNA 2BGRA 5DNVA 2LVBA 2YJTD 1K6MA 3V7WA 3O47A 3HA3A 3O1IC 4RO0A 2GN2A 4MRAA 3KNZA 1UKAA 4HDCA 3VPHA 5KYKA 3OIFA 3ONVA 2Z6AA 4N49A 1IHDA 1YRYE 1H5NA 1MC4A 1TK9A 1Y3CE 1OYYA 1LI5A 2XVYA 3D5QA 3NGLA 4Y1FA 2FY8A 3Q8XB 2DHQA 5JJ5A 5K3EA 2UV8A 4B4KA 3TIFA 1EXDA 4E2XA 1SHTX 4JELA 3EA5A 4AJEA 5C8VA 2GQ0A 1P7PA 3MT8A 3O2NA 4DLNA 5A4FS 3OCZA 1I6LA 1GQRA 4MHSA 4QJ4A 3TLGA 4BXOB 4GWLA 1I7LA 3NDPA 3EQ7A 3KE8A 1O6ZA 1KI9A 1P1RA 1SWVA 1P3DA 2G72A 2VNHA 3FJYA 2B61A 2PSSA 3F2VA 3IFSA 3LOUA 4FGUA 4O5AA 1KJ8A 5JROA 2C7GA 4HQNA 2ZWAA 2Q6LA 3EZFA 1GTJ1 4PAOA 3NOVA 4DW8A 4AYWA 1LDYA 2ATEA 1VL0A 4GXRA 2PJRA 4CCSA 2C84A 3MJ4A 3VSBA 3LZ6A 4D4JA 4WNYA 2Z2IA 1CV2A 5A4AA 5HQTA 5A3QA 3O2JA 1AMUA 2R25B 1DBWA 3IKTA 3VMMA 4HZUB 1I5EA 4MGKR 3RVQA 2PZBA 4D8WA 1JWLA 2E4WA 4O59O 1Z0DA 1M75A 3GA7A 4MEBA 1FMCA 2QU7A 5LP6A 5M04A 1IQRA 3KK0A 3LNTA 3VSDA 4F12A 4EMTA 3FUVA 1OXVA 1L5MA 3COYA 3Q5EA 2YHUA 1WB5A 2BR3A 3FJ1A 5E9QA 4DDWA 4NXMB 2PYIA 4E2YA 1HURA 3UPDA 3SBXA 3P4UA 1N7HA 4A8JC 1M2OB 3JQ8A 3AI1A 5CFMA 3AM3A 3CJTA 4YA6A 1YR7A 3OTHA 4EB6A 1XZPA 5TQ2B 5JD3A 3DLAA 4RGVA 2I2CA 1FNSA 5HTKA 3DV0A 4LXUA 1KOGA 4OHUA 1Q3TA 4P9NA 4ZYZA 5C35A 4CEHB 4W82A 4E12A 2D0PB 3C5CA 1RWNA 3DQZA 2QL6A 1SIBE 3CXRA 3IEKA 1HDIA 3PEUA 2PUBA 2DTDA 3K1YA 4C7OA 1Z07A 4GOOD 5LQNA 4IIJB 1NQOA 4V24A 4V0NA 4CNQA 2A9KA 5GQSA 1KEWA 2ZIEA 4P82A 3GQBB 5EIFA 3HCWA 5MDHA 2BMVA 2IDKA 2G09A 4RJKA 3HVHA 3PDCA 2O8FB 3HCEA 4W5QA 2C83A 2FR0A 2FPPA 2QX4A 3MB8A 4EKIA 5JFOA 1E2EA 4X1KB 2AI3A 3G2HA 2ZT8A 3EEOA 3NIDB 3FCOA 4ZVUA 4MS1A 2I3ZA 1H2XA 1O7JA 2X7JA 4MHOA 1NVGA 2GFHA 2RGBA 3S8YA 2FPSA 3SLKA 1WLSA 1K98A 3OFSA 1PGQA 1WXQA 2GEUA 2C5HA 2ZCJA 2FEKA 1CUGA 1R66A 1UBFA 2DTXA 2OV3A 4PQEA 4MUJA 3SPXA 3NIFB 1YH3A 2ZOSA 4G8DA 4PVCA 3K5PA 3E3LA 4TM8A 4Z3KA 3PP8A 1W44A 1GTZA 2WV9A 3N2YA 4JEHA 3O4FA 1YZQA 3MJSA 1UXKA 2ZIZA 2QUZA 5LB2A 5EIWA 4QUDA 1Z06A 2HHJA 4PU0A 4NCHA 3OOYA 1WCYA 3LLUA 3UUWA 5DGCA 4CMEA 2FETA 3L18A 4IPTA 3ZH2A 1TADA 3D2LA 2ZSIA 2VJAA 4CV0A 1MOQA 4RVOA 5BRNA 4IIHA 3S1LA 1XV5A 1YCFA 4F5WA 5AVTA 1GNVA 3VA7A 3ZQJA 2NNWB 4XIIA 4DAEA 4K9NA 5CX4A 4WE3A 3RHTA 1UKYA 1GKUB 2FPOA 4FEAA 4G86A 1QQ5A 4HFMA 3WJ1A 4E5UA 3AKDA 3ZEIA 3KXLA 1RP1A 2GAIA 2QQ5A 3NYWA 5D84A 4AY6A 4MYCA 4TVOA 1PEAA 3EUAA 1GT91 5I9NA 3RVDA 4KW7A 3D3WB 2ONYA 4CKCB 1FMTA 4U1RA 1T9KA 4NK5A 4OLFA 2ZI6A 5JRZA 3GA0A 3PDHA 5AJWA 1DTWB 1ZVMA 2C57A 5EMJA 4ZOAA 1YJ5A 4MITA 1S6YA 3TLJA 1F8FA 1HFWA 3F9CA 1RRMA 3H7IA 1RM4A 5F78A 3TNFA 2M6LA 1VI2A 4L28A 2CWWA 1VCHA 2AUTA 2H9YA 3W90A 1X1EA 2GXSA 4IUCS 4RHUA 2AVDA 1QVWA 3MUEA 2P0EA 3ZCSA 1Q22A 2R5FA 1NC1A 4LRSB 5JRJA 1OAAA 2POQX 1QX4A 3P2IA 4Q4AA 3AVVA 1NF9A 1QIMA 2UYCA 1P5HA 3H5IA 2BC9A 4KJXA 2JFQA 5ISMA 1Q83A 2NU7A 1MRZA 2C97A 1QGAA 2V54A 4FR5A 4QVGA 4GS5A 2CUKA 4DJDC 2E3JA 2VYND 4P7FA 4R68A 4L4YA 5JAPA 1OXUA 3DCIA 2YHBA 4BX3A 1SZCA 5JXHA 3TQSA 2B34A 2GN0A 5IM4F 2VHVA 4E5VA 3I5YA 3QBVA 2Y05A 1MAAA 4HLQB 2Q50A 2GK3A 4DLXA 3WLAA 1HDOA 1G3UA 4L7VA 4IDCA 4S1VA 2IELA 1V3VA 1AZWA 3KUDA 3P5BA 2H5LA 1U9IA 3WK4A 2FJ0A 1GG8A 3T95A 5EIBD 3DYBA 3PGVA 4K9MA 2E21A 3IBFA 4FN4A 2RDMA 1WX1A 2CXPA 4R98A 4UFNA 4N47A 1ACJA 4A10A 4DMGA 4C03A 3GD7A 3H2SA 5AKEA 4FQ8A 3CVOA 2QOEA 4RTLA 1NVXQ 1JXMA 2WY2D 1W52X 1MTOA 3I5MA 9ABPA 3LX4A 3T9EA 1F4VA 1OVGA 3ADKA 3NBZC 4EHIA 4B6OA 2HCJB 3WYAA 1U3CA 1NXSA 4Y18A 5TS3A 5E4TA 3BE4A 3WMRA 3V4LA 4MRVA 2DT8A 4Q5IA 4QEZA 2XXAB 3QHAA 4D8UA 3MLEA 3TCXB 1DIBA 2BLLA 4UHJA 4UM5A 3DQQA 2W2TA 4HZUA 2C77A 2D1YA 2AFHB 1PTJA 3BVPA 3DE1X 3BXEA 3DKIA 2FCRA 4GMHA 1TLLA 3GFOA 4C7VA 2CV1A 3WGHA 3K6KA 4LFBB 5E6RA 2FZ5A 3AL0C 4IP0A 1GL7A 4ENTA 1FX0B 3B2NA 1HQYE 3I4LA 4WD3A 5FWYB 2CXNA 2HSZA 2F3UA 3GYBA 5A7HA 4MJLA 2P65A 1PDOA 3GU3A 5LIPA 4R1SA 2BBOA 3U6KA 3DT8A 2VL7A 2YUIA 2PXHA 4C2TA 5LNK1 3E81A 4TTRA 3PS9A 2CBZA 1EFVB 2PKWA 1M2OA 4L4RA 1Z18A 4FTWA 4AC9A 4PN7A 1FPQA 1FTYA 1XZCA 5TQ2A 3DTNA 1EWQA 3K15A 4NEHB 3ETLA 4DV7B 1H6BA 5AMXA 4DRYA 4OB7A 5HE8A 4CEHA 4CQLB 1FTGA 1FFAA 4R8MA 4YUAA 1HEUA 1RJDA 4V03A 1SC3A 3CU5A 3ISVA 4F3TA 4LG1A 1DBSA 1SC6A 1SJ9A 3GB9A 2AB0A 3R5SA 2GPWA 2CHVA 1QHYA 2VDJA 2E49A 1B8NA 1FL9A 2H18A 2XR1A 2W43A 3GQBA 3HJRA 3LF2A 2H4YA 1A2QA 1W30A 1MGOA 2JGKA 1JFVA 1MABB 2JCVA 4KFUA 4PC2A 4ESEA 4D3XA 4KFCA 3DAOA 2O8FA 3ONDA 3TE7A 3FKQA 3S70A 2CMKA 3EWAA 2DQZA 2JAQA 2JAXA 4WZBA 3VV3A 4BZPA 4YRNA 2OK7A 5ILQA 5GTDA 4C4SA 2CV0A 3GCGA 3E3OA 2E4VA 3QUAA 5FTJA 1T34A 1B2LA 1G5HA 2I7TA 4FLEA 3EMKA 1JAXA 1XLUA 4R8KA 4PHGA 3E22B 4MCIA 1E4OA 4LX0A 2FFRA 1CJCA 1NR5A 1J70A 3D8BA 5ALFA 4GI3A 3TUZC 2G36A 3BJZA 3KBOA 2SKDA 4J07A 4LZOA 4B7ZA 5IAEA 2Q5OA 3G0GA 2WE8A 3SIWA 5BQOA 3HRIA 1L4FA 3TLBA 4UW9A 5C7LO 2NSLA 1UBTS 2EZUA 1WAMA 2XNSA 3KB1A 2ZRJA 3KJXA 2HK6A 5HTOA 2CXSA 1TK3A 5HE9A 1CUFA 2G5GX 2QPTA 4IEFB 1PYDA 1Q7CA 1T4DA 3A3YA 3MWKA 1Q0ZA 2B8NA 1N78A 4E88A 5JZ9A 1YZVA 1C3LA 2A9PA 3T3HA 4F3CA 3QI7A 3OJLA 2JD1A 3NAGA 5DNAA 5FR2A 1QF7A 2NZ8A 3DKRA 3WDLA 3DHNA 4HEA1 1MMFB 4M49A 3EFBA 4PC7A 1E2BA 5KKAA 2R8EA 1NXXA 3FWZA 2RK6A 2CNKA 5ESDA 1KVUA 1BX1A 2PDAA 2WAYA 4TX1A 5EAIA 2EJTA 3AF3A 5AI5A 3D3WA 3PF8A 4N7JA 1UBEA 1QKJA 1QQTA 3R7BA 1NNI1 1DKQA 2J5KA 3D81A 3DP7A 3GYGA 4DQVA 4DY4A 4U7HA 3KD3A 1BWQA 4NP6A 1BD3A 1E1KA 5B2FA 1PN3A 3OTIA 2XYVA 2AYZA 2P62A 4ZOLF 2Y92A 3JYNA 4IIEA 1ZD3A 2GI4A 1P29A 3FDXA 3RUCA 2GO7A 3VAZA 3VPSA 2IEIA 1LRJA 2NZUG 1QR2A 3AMVA 3O6VA 1KEZA 2X9QA 2QWXA 2ALJA 3T9BA 2DF8A 2O4UX 4Z4IA 3GEHA 1E63A 5EINA 1XZFA 4LWPA 1HWYA 4L8LA 4DNFA 4PYOA 1TCVA 5LUBA 5J4LA 2PGJA 4X97A 5FBZA 1J0AA 3CE9A 2EX4A 3CCBA 3U3KA 2J3IA 3VMFA 3WGZA 4N76A 2DKFA 3I6QA 5LCXA 3QGMA 2ADFA 3PUVA 1ZK0A 1DEXA 4IV5A 5HPYB 5KS2A 3E9QA 4HV4A 5ECWA 5A3JA 3BSYA 1Z28A 3CLTD 3RUPA 1E6WA 1DDOA 1H65A 4WKGA 4HDKA 1GR0A 4X61A 5AKGA 3UFXB 3W3ZB 1B6SA 4UU1A 2RONA 3JQFC 4V0MA 5K9ZA 4IDFA 1SUIA 5AOBA 2EKDA 4HQKA 2VWPA 1VZ2A 1BEUB 1SBCA 5ALQA 1DI0A 4QEDA 2QW8A 2A9RA 3OFVA 5L3SB 1YQUA 3DFZA 4D41A 3UA4A 2I7DA 4G89A 1N2XA 1FY2A 3BE5A 3OPMA 4JL5A 1Y5RA 3A6EA 4QRHA 2J48A 4H77A 4TZKA 1SUSA 1GV0A 3PHIA 2NYRA 2DC1A 4R1LA 2YWBA 2WV7A 3NHAA 2A78A 4I7EA 4XLZA 5IZ4A 2XMRA 1C9KA 2GK7A 4ZYLA 2PWAA 1JFLA 3NGXA 3EEQA 1U6IA 5JAIA 1APBA 1T8TA 2ZUUA 1SVLA 3OPXA 1VPEA 1P2DA 3A6GA 3QPCA 4MRPA 3R7AA 4ESHA 5KYTA 2XXAA 1TTHA 2D2VA 1MVLA 2YX1A 2B7CA 3Q9SA 2OCIA 2W6NA 1HNWB 3RAJA 2AFHA 4FFDA 4RJTA 1ODTC 1YOVB 2O57A 5EQJB 2XGGA 5CHYA 4M36A 1FX0A 5EMMA 1N25A 5JZBA 1PK9A 3NDIA 3ZYZA 3N6VA 4KXXA 1L6RA 4ZQGA 1EVJA 4R8VA 3J7AC 3A1EA 2R8YA 4IGAA 4TMZA 3DC2A 4WCFB 4DNPA 1BZYA 1ISSA 1U28A 1NI4A 4F8EA 1K68A 1EFVA 1EGHA 1UJCA 1GYQA 4XOIA 4AUNA 4YV7A 5HYVA 5KPDA 4NEQA 3DDWA 3KJIA 3EHEA 4F2GA 3NLLA 2EGUA 5FOXA 4O33A 2P9FA 4MX8A 3K9NA 2VPQA 4A6PA 2B69A 5A4MS 3L8FA 3VR6H 4CG0A 8MHTA 3HQ4O 2FMXA 5GJBA 1DEHA 1HT1E 1E94E 4OQFA 4CQLA 2WLSA 2QTFA 2IIPA 4BPBA 4GLOA 4YAJA 2DUWA 3GVHA 2H17A 1EQAA 2WE7A 3QWIA 3SIPA 4X7RA 2W6OA 1R1DA 2EOAA 3ABQB 4UE3S 3W5JA 4F8JA 4OFBA 5ETJA 3KJZA 4OHWA 4QPCA 3IUEA 4XB6B 2XMPA 2Q1UA 4DIMA 5TLSA 4WGGA 2GETA 1A9XB 1TMYA 1DAIA 2CSUA 4YBZA 1CQPA 1JZSA 1MABA 3AP3A 3VOTA 5ICEA 1DWOA 1F4LA 1QFYA 3FHCB 1W49A 4LNHA 4OQLA 3KB2A 1E79A 4W63A 4YLEA 5SY9A 4PNHA 5JD4A 2WP8J 2GYWA 4IKOA 1T29A 4ZGGA 1XRQA 5LDDC 3G0DA 2HZBA 2SICE 2Y71A 3CC8A 1AVTA 5E9AA 1BE6A 1QFZA 1YZUA 2QF7A 2YTZA 2ZIWB 3CLUC 4A8PA 3K0CA 3MGCA 2BKAA 1ZK3A 3ICOA 2C5LA 4XUCA 4AWAA 3IE1A 4PG7A 3CF2A 4E51A 2B2XA 1CBUA 2KMLA 1KP9A 2KYRA 4ENVA 2C95A 5AP9A 3WWPA 1UWCA 4JT4A 4WY2A 1PW5A 2B8WA 3TW6A 1E8DA 2ASEA 1RLIA 2BFCA 4TWZA 5CU7A 5AJXA 1IWPB 1QO7A 3HCPA 1CX9B 1DBQA 2NSDA 1NBHA 4FI3F 1IHYA 4O1IA 4GVPA 3KB8A 2WTMA 2G5TA 3S99A 3N0TA 2FK8A 1XPJA 5J4VA 2EW2A 3UA3A 1GFZA 2G88A 3MGGA 1CJVC 1Y3DE 2O7QA 4TLDA 4CTKA 4X8LA 1EQ2A 2VVTA 1DEAA 5AVYA 4DV3B 3SQWA 1RBQA 5FTLA 4FT2A 3QE3A 5CFNA 1ZJ6A 4IDHA 1Z56C 5JQGF 5JECA 1SXGA 2A3RA 2FJUA 1POXA 4I5FA 4TXMA 2NO9A 1NNUA 1ZUNB 1HI9A 2DOKA 2CXXA 3BMQB 3G79A 3OWHA 1L4MA 4JLKA 4FD3A 2W7TA 5FJJA 5KVVA 4UZEA 3IKJA 4EOGA 1G3IA 4J3NA 1YL7A 1OIXA 1R6UA 3BILA 3FBWA 2WF9A 3FWYA 4O2BF 3LC7O 1N7GA 5EE1A 2Q5CA 4URZR 4YDSA 5FH9A 5HHTA 1QP7A 1KMHA 2WK1A 4LF5B 2ZYAA 1UIMA 2AUNA 2J3JA 3D6TB 4DB2A 5ER6A 1AQIA 2AJBA 2MMGA 1J8MF 2GKSA 1OKKA 3M6MD 2V4ZA 2VBIA 1P2FA 1J6UA 1Z7YA 1SKAA 1OZGA 1HTWA 2IA5A 2UYQA 1OGIA 3CW9A 5YASA 4ZYVA 1UINA 4IIUA 4E21A 3VVBA 1RIFA 2UVQA 3LPNA 3ZZTA 5LKRA 4Q19A 3JCZA 4CKWA 4MVJE 1KTIA 1GPJA 4LMPA 4QU8A 1GNSA 1P9NA 1JTVA 1X8LA 3GDFA 4G67A 4D5EA 5KCZA 4YV2A 3JVVA 5A6SA 4OQ4A 1T8SA 1Z4NA 2C96A 4CDRA 2HF9A 4I9NA 3NWOA 2BN4A 2OGTA 4I46A 4LXXA 4TV8F 1L4LA 3KVVA 4NF2A 5ALWA 4YYZA 5CBPA 3UFXA 1DKRA 1GN9A 3AESB 3B6ZA 4RPGA 2HF7A 1JMKC 2B2NA 2AE2A 1JN0A 1LDBA 3BIOA 3S8EA 2I62A 1W5BA 2X2OA 2YS7A 1N5LA 3KDAA 3PQCA 5L3SA 4COKA 3A1UA 2G8LA 1VLVA 3RSZA 4Q48A 1VHDA 4WESB 5HIIA 3NTLA 1DINA 3ONFA 4JLJA 1RXVA 1E0SA 1T1IA 3MJDA 3QM1A 3H2KA 4XVCA 2B20A 5CJPA 5JAHA 5LZ5A 3CLRD 2MMCA 2ZAGA 5TGZA 2CB9A 4BFWA 1FQWA 1O6BA 2ACVA 2B9VA 3CNNA 2WYHA 4GE3A 4G65A 4S2UA 5AI8A 5AW5A 4QD3A 2Q9CA 3D0OA 1YBAA 1XZGA 4XFDA 1FRZA 4XD7A 1GGEA 1WDKA 2QU8A 4P08A 3ZQKA 4EEKA 1E7YA 2CLEB 3QOWA 4IVNA 1RTTA 4MDYA 1ZVJA 5ARCA 3RRNA 4AXBA 2O6HA 5AM5A 3UWMA 1FVXA 2OE2A 2HU8A 3LWBA 1V8FA 4EG7A 1FXUA 4RU1A 9GPBA 1YOVA 1Q57A 3C16C 1OJLA 4X3CA 1PEKE 4WQMA 2EDAA 2CNOA 2WAAA 1SOVA 3WQRA 1X9GA 4YRTA 4L50A 3WLNA 2ODTX 2IHZA 1GPH1 3PLNA 5COQA 3ZXSA 5BR4A 4D74A 1AKYA 2R8ZA 1B0PA 3E0XA 4ZZ0A 2Y9ZA 4WCFA 2YV3A 1G5IA 3R74A 3VYUB 3DDZX 4OKSA 1KBOA 2Q2WA 4KXYA 1AX9A 1X0VA 1T0HB 1XN1A 4C7JA 5ITZB 4G5FA 4JXZA 3A4LA 3QVOA 4OBWA 4RORA 2RGXA 4PANA 1SB9A 3N53A 3U56A 3R0JA 4IVPA 2YVAA 4QX6A 1BC5A 4HFNA 2I76A 4OXKA 5EUCA 5CXQA 4LBYA 4KO8A 4PHHA 3ORRA 3V32A 1FIUA 1NMYA 1L5NA 2Q9BA 1SUDA 4HMQA 2R62A 4J94A 4V38A 3V6LA 2EBHX 2VK4A 4KO1S 2WJZB 3WJ7A 1PV1A 1JB1A 2RHWA 2Q0SA 1M2EA 2WSMA 3FY4A 4M22A 4UHDA 4ZQFA 3CH6A 3S5UA 3WOHA 1T26A 1WY5A 1WXGA 3IUSA 3O73A 1AA9A 1A9XA 3G1WA 4MKXA 5TMEA 4GI5A 2ZRCA 3ZHYA 4H3SA 2JI8A 3Q6NA 1Y9DA 4MMZB 3A27A 4BN5A 1MP0A 3DG9A 3BMOA 3H9QA 3MAJA 1D3AA 5B12A 5TC4A 3TXXA 2VXYA 1I01A 3JQ7B 1D2EA 3U3MA 1KERA 3M0EA 2AL7A 1VL1A 2D54A 2FPKA 4U2EA 1XJ5A 5T4HA 4S1PA 3VYSB 2W8ZA 2IY9A 2O8NA 3G2JA 3PUYA 1SY7A 4BO8A 1FZQA 4NYJQ 2DHRA 2Z5FA 3NT4A 2OGUA 3BRSA 2VRCA 4WADA 5EWMB 2F1OA 4M8IA 3U4DA 1R8YA 4OP2A 4DIFA 4H3KB 1DAKA 2I8AA 2VAVA 3UJBA 1QU3A 3GGDA 1G8HA 5ELXA 4LNUB 1E2QA 5JVDB 5KEIA 5DHTA 1V8PA 2PO5A 3KSMA 5K0NA 1H2YA 4UUNA 1WMSA 3GRPA 2E4ZA 1UM9B 5M34A 1RXCA 1X7ZB 1OPRA 3T9DA 1WPGA 3RS5A 1YBFA 1DKMA 1A04A 4IOKA 5I4KA 4OQYA 2COKA 5K2MA 5EKTA 1G5QA 1RP7A 3COSA 4PFQA 5B57C 4ENWA 4TL9A 1NN1A 4AJ1A 3BMQA 2Z8YA 2AG0A 1LSJA 1AC5A 4FOTA 2VDWA 3IIMA 5I4BA 4IGFA 621PA 1ZH2A 2CL7X 1V6SA 2R86A 2BGIA 2XGSA 3WRVA 1E79D 4J2OA 1J0XO 2J6IA 2VPPA 4QFMA 2WIGA 3BDVA 4Q6BA 2ZUFA 3GGGA 3RYHB 3SDZA 4YUWA 4L6IA 4GZMA 4C6TB 2RBEA 1JR3A 4PNEA 2JEZA 1GTMA 3WLQA 3EIHA 2B2CA 2ZEJA 4RCVA 1N77A 3VR6A 2GOYA 2PEZA 3HBNA 5JZOA 5ESXA 2IHJA 2ID4A 3CNHA 3CSSA 4EAQA 2GZSA 1RCUA 5TPZA 1PD0A 3UGJA 2C7PA 4UVGA 1QE5A 3DXFA 4J29A 4XIYA 3TPCA 3GDWA 3SHFA 3LTEA 4D45A 4ER0A 3EBLA 3OSZA 1N8SA 1GZ7A 4XB2A 4R05A 2CJFA 4AK9A 4QPJC 4X6UA 2JJ2A 3DW3X 1SCIA 3LK7A 4Y6PA 2XXBA 3WMEA 1H0RA 4TTPA 1Z15A 4DSOA 2V6IA 5CT6A 4FOLA 4RD3A 4ONEA 4WN3A 5B64A 3LG2A 4IIFA 4QDUA 1QHHB 3AESA 2UDPA 4JQYA 2H2WA 4TTJA 1J9ZA 1QDLB 4KVAA 1ODCA 1QIDA 2PRJA 2YVUA 4KQHA 2XV1A 1AZTA 3N6XA 4MZDA 2WNSA 2B8EA 1V41E 1XZIA 1ZD9A 2P6UA 1FDWA 4OMDA 2D06A 2QYSA 3IV6A 3QG1A 4DZTA 5HQ3A 1P6UA 3OC0A 4MMXB 1Q0PA 3QFTA 4FC7A 5I45A 5EL0A 3IR7A 3QEMB 3I53A 4KVZA 4WESA 1Z2OX 4YAIA 2OBXA 3I52A 3IR6A 2ZIFA 1I80A 1PI3A 4ZQIA 4ZHQF 1V5WA 3IDFA 4DANA 2H85A 1X7YB 4CHGA 5I8ZA 5ES3A 1GQYA 1U3VA 5LLSA 4KPGA 3LBNA 2W2OA 3TLEA 4DOMA 1GAWA 3RYFB 4TRMA 5L8VA 2O2XA 2PQMA 2C03A 1P91A 4P3YA 4Z4CA 4C7XA 1MA0A 1Z7BA 1DX6A 2PLNA 4M0CA 5LZ2A 5COBA 3RS8A 4EGQA 5H8WA 2QENA 1O6FA 1WMBA 4PZUA 3PRJA 5BXYA 3THWB 3PC4A 1MC1A 2CUNA 3K5IA 4M0MA 4YECA 5WRFA 4KR0A 2P9ZA 1TAUA 2V7PA 1EP2B 2WJPA 4F46A 1N3IA 3MM4A 4Y2UA 4E31A 2NOGA 1ECLA 2N42A 2QMZA 3CSDA 2IIQA 5HZGA 3ZJVA 4CN8A 5C37A 1HOXA 5H7XA 5J4KA 1OWLA 2G0NA 3NH9A 1C8KA 1T25A 1T2EA 4Z3DA 2VP5A 3DJFA 2XMBA 1DWPA 3JD0A 3L84A 4HR7A 4E4RA 1U2SA 2FEMA 2WPDA 3L01A 2PUFA 5ITZA 2J3HA 3C2QA 1F7UA 3ICCA 3D8RA 3EGEA 3KQYA 2BRUC 2PGIA 2Q5JA 4FDTA 3O3OB 3CF4G 2XYHA 4M83A 2AD5A 2NT3A 2P6MA 2PA0A 3VUFA 1RKXA 3FW1A 3NIWA