3PEFA

Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
287
structure length
286
Chain Sequence
b'SQKFGFIGLGIMGSAMAKNLVKAGCSVTIWNRSPEKAEELAALGAERAATPEVVESCPVTFAMLADPAAAEEVCFGKHGVLEGIGEGRGYVDMSTVDPATSQRIGVAVVAKGGRFLEAPVSGSKKPAEDGTLIILAAGDRNLYDEAMPGFEKMGKKIIHLGDVGKGAEMKLVVNMVMGGMMACFCEGLALGEKAGLATDAILDVIGAGAMANPMFALKGGLIRDRNFAPAFPLKHMQKDLRLAVALGDRVGQPLVASAAANELFKGARAAGFGDEDFSAIFKTYER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, NAD-binding
molecule tags Oxidoreductase
source organism Geobacter metallireducens
publication title Structural characterization of a beta-hydroxyacid dehydrogenase from Geobacter sulfurreducens and Geobacter metallireducens with succinic semialdehyde reductase activity.
pubmed doi rcsb
total genus 117
structure length 286
sequence length 287
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3pefA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pefA01
2BLLA 4QTZA 4U5QA 1E5QA 4Z0PA 2C07A 3U62A 3FI9A 1BDBA 5DT9A 4EGFA 1FF9A 3JYLA 4D45A 2WYUA 2XOXA 1UZNA 3ENNA 2ZIZA 1HSOA 1PJLA 1A27A 1XR3A 2BMAA 4GI2A 2Z95A 1PGJA 3WIDA 5HS4A 1E3IA 5HRUA 3KXDA 2CD9A 3RUCA 3S1LA 3GN1A 4FGSA 4E2YA 5K6AC 4CMEC 5DCYA 1DDOA 4M54A 3CKYA 3HFSA 2X9VA 1PJCA 5BSHA 3GMSA 2G17A 3ETDA 1G0OA 1GDHA 5K6AA 4OIMA 3F5QA 4ALLA 4G5HA 4II3A 3LYLA 3JQCA 3GT0A 1BXZA 4AL4A 4CODB 2GD1O 3GK3A 4AJHA 1ZXLA 2NVBA 4EEXA 3H9JA 3M2TA 4RCVA 4BO0A 1BVRA 5JO0A 1H94A 4B8WA 5DNAA 3JQAB 3JQEA 5IN5A 5TC4A 3V2GA 2D5CA 2RH4A 3ZU4A 1SZJG 3W6ZA 1X0XA 5L7WA 2EJWA 3H2SA 3EMKA 3KSDO 2EW2A 5COQA 2G76A 4LGVA 4P4NA 1IPFA 3WGQA 5L95A 1LXCA 4GKVA 3OJEA 4PG5A 1JKIA 3MWEB 1Q7GA 4W9NA 2FSSA 4DBVO 1ZXBA 3CMMA 3TF5A 1NR7A 3KYCB 1LTHR 2NM0A 4MVJG 2VHYA 1ID1A 1ZZEA 4YT5A 3W8DA 2ZYAA 3QSGA 1W6UA 2DTDA 3OIFA 4AJOA 1JLLA 3LC1O 1U7HA 1AN9A 2E37A 1U3TA 1S7CA 2B69A 4DGSA 5IAAA 1CIVA 1YQXA 4AJKA 4JP3A 1I24A 3EAGA 4BO9A 3QWHA 1NTOA 1I3MA 5C37A 4WCFA 3TRIA 3CSDA 3ULKA 2JL1A 3DMTC 3FBTA 4UVGA 2HMUA 1B14A 2VWPA 2Q3EA 5CHEA 1C3VA 1NFFA 4CM7A 5JCJA 4I1IA 1W73A 3T7CA 1DPGA 2FR1A 3I9MA 3RQSA 2AEMA 1LX6A 2GLXA 2BKAA 3K6JA 4WUVA 5DULA 5JW6A 3K96A 5A1TA 2G0TA 1DJQA 3I23A 3T4EA 4OQZA 4CPDA 1I2BA 4GMGA 2C7GA 1EVJA 5KJEA 4CM4A 5H81A 4WCDA 1MGOA 2YFQA 3SLGA 4J1NA 3NEPX 1M2WA 4XGIA 5DBFA 3R6DA 3TFQA 4OGWA 2V6FA 3HWRA 2Q45A 4IMPA 5K9ZA 1QV6A 1IYZA 3PHLA 3VH4A 5TNXA 1KC1A 1E7SA 3DAPA 5C7OO 5L4NA 4IY1A 3ETGA 4WLNA 2VRBA 1MUUA 1C1DA 4O63O 5U4QA 4G65A 1R4MA 3OJ0A 3NDRA 4DUPA 4P4LA 3AOEC 2DTXA 5F1PA 4KTTE 3RJ5A 4J1TA 4CR8A 3VVBA 4L75A 3W1VA 4CQMA 4I5EA 2J3HA 4LSMA 4EJ6A 4UUPA 3O8QB 1NBOA 5IZCA 4RPGA 3L4BC 1YB1A 2JCXA 3TZHA 1MXHA 3AOEA 4R69A 2H6EA 1CDOA 5T5QA 3TZKA 4IBOA 4IZHA 1JN0A 4BUCA 1MB4A 2EWMA 1DFHA 5JO9A 1L7DA 3RSHA 4W7IA 5JFOA 5FYDA 2IDZA 2JHFA 4A5OA 1QSGA 3CE6A 1LDEA 1JVBA 4DYVA 1NPDA 2HK8A 2QZZA 2D8AA 1PWZA 1C0IA 3UW3A 1I30A 3ZW8A 2GPTA 3GRPA 4EW6A 2DUUA 3C1TA 3DZBA 4ILKA 4EEZA 2B4RO 3F6YA 4R3WA 2AQHA 4R4JA 2IYPA 1I33A 1UXJA 2EGGA 2NU9A 5A3VA 4YJFA 3LC2O 4RPLA 1BGVA 1DFIA 4PLTA 3IMFA 5EINA 3JQ8B 2O7QA 3GPDG 4EZBA 4PFJA 2PKRA 1QXSA 1NFQA 1SBYA 1X1EA 2CUKA 4M87A 4XR9A 3JQ8A 1JDJA 2IEDA 4NR0A 2NVUB 5GZ1A 1I3LA 1NVTA 1YBVA 1YOVB 4IXTA 1X7GA 3PFFA 2O3UA 1Y81A 3PJGA 1LLQA 1CETA 4BO6A 5JS6A 1ADCA 2R6JA 3U4IA 2B35A 4EJ0A 4FJ1A 3VKVA 4I9HA 2GDZA 4CM1A 2H1SA 3ORFA 3QW2A 1DRUA 2QHXA 3L6DA 2A94A 1ADBA 4AJIA 4BKRA 2WMDA 3Q9UA 3WWZA 4Y6RA 3BMQA 3ZH2A 1E6EA 4E21A 3ON5A 2E4AA 5IFLA 2XXJA 1DIBA 3L77A 5JCXA 2X9GA 1YL6A 3LVFO 3ROMA 3QRWA 3RFVA 3E1KA 4E32A 2ZTMA 1PS9A 2Q2VA 5LC1A 1PL6A 1WAMA 2UV8A 1NP3A 1SAYA 1PX0A 3EC7A 2WE7A 4TRMA 4E31A 4D43A 1Y5RA 1OBFO 4NFYA 3G17A 3TOXA 1ZEMA 3PYXA 3GPIA 3UH1A 1EQUA 2QW8A 1HXHA 2HJRA 3K2BA 4OKNA 3V2HA 3E18A 3ONEA 4NBRA 1I10A 4XQ9A 4E13A 1FDUA 1N5DA 4IIUA 1U2DA 1CWUA 4OJNA 4K6FA 4CV2A 1E3WB 3I6QA 1PGNA 2EKLA 1HDOA 1I5RA 3DXFA 1MXFA 5DOVA 3NT5A 4MVJI 3PGJA 4BGEA 4EITA 1A4UA 3LK7A 1PQWA 4YQZA 3QIVA 1UZLA 1CF2O 1PR9A 1E5LA 4D46A 2DKNA 2HO5A 3FTNA 3OQ1A 1GAEO 4MINA 4PVDA 2PGJA 3FNEA 4J9UE 3WXBA 1F06A 4AJ4A 4FOOA 3BMCB 2JFGA 3DTYA 4BV9A 1WMAA 3DZKA 5BNFA 2FY8A 4MJLA 3HJAA 1HKUA 4GWKA 3JQ6A 4XB2A 5EJ2A 3PEFA 2I3AA 3H4VA 4CM6A 2AQKA 3PQDA 4YWJA 1L7EA 5TRTA 2P4QA 5AXCA 2X8LA 4FW8A 2YDXA 1CRWG 4YT4A 5TT0A 5HBRA 3STHA 4YEDA 4GSLA 5IF3A 1EZ4A 4XKJA 4K1LA 5C7IO 4B4VA 1VE9A 1ZK0A 1XQ1A 1ZJZA 1GY8A 1HE3A 3NT2A 4CR7A 2PNFA 2J3KA 4JK3A 2RAFA 4E30A 1Y8QB 5F5NA 4O59O 1ZK1A 5KKAA 2IXBA 3AUUA 2O3RA 2PGDA 1EE2A 1E3SA 2QYTA 4R01A 4OQYA 4DREA 3ZWAA 1PZHA 3TSCA 1GUZA 1DLIA 5JYEA 3U09A 4U0JA 3ZWYA 1P1HA 1B26A 4XQGA 1NYTA 2X1HA 4NI5A 1E1NA 3WGZA 3WNVA 3DBRB 4RF3A 8LDHA 3JQGA 5I7EA 1HE5A 5JNLA 1PQPA 2NVUA 3DHEA 3GA0A 4P8RA 1H2BA 4XGKA 1K3TA 3JQBA 4H15A 2RIRA 3GNQA 3MJTA 3HDHA 4XRRA 4XYLA 1HT0A 1QYVA 4LISA 4R54A 2ZTLA 4CM8A 1Q0QA 2HCTA 2GR9A 3JQFA 3CUKA 3U4CA 2RCYA 4DC1A 1P44A 3NJ4A 5JE8A 4W99A 5MGBA 4FFNA 3V1TC 1VKNA 3DWFA 2DT5A 1M75A 4NPCA 3B1KA 4E5KA 2YV3A 4D7AA 4R9RA 2WWRA 5EMHA 4B3HA 3ZHYA 2H63A 5ICSA 4R1NA 3L6OO 5KCZA 3IDSA 4UVHA 2O4CA 2PLAA 2CDAA 4BB6A 5KIAA 3CTVA 1KVRA 3IUSA 3JYNA 4YJGA 3RUHA 1NHGA 4BS9A 1GCUA 5KKCA 3G79A 3K31A 4GQAA 1YDWA 1ZSYA 2C59A 4PGFA 4CMIB 1I2CA 3BAZA 3H9UA 1WPQA 3FF4A 1BW9A 4NNJA 4R9SA 3AI3A 1XSEA 3WFJA 3EHEA 2CZCA 2OUIA 4M1QA 4IZIA 4BO4A 1VJTA 2AE2A 2FPIA 2PZJA 1P33A 3KSZO 2O3TA 3KEQA 1D8AA 3H9QA 1EUDA 3JD3A 1QYDA 1JTVA 1ZSVA 3NAQA 4KOAA 1ZVMA 2Q2WA 4TKMA 3RC1A 3RUEA 3VZPA 3D64A 3WBBA 1WNTA 3VHRA 3GEMA 1ZMOA 4ALMA 4PG6A 2D4AA 4PZEA 4IDBA 1A9YA 4CL3A 5AQ1A 4RPKA 2VCYA 3E5RA 1NVMB 4H7PA 4XX0A 5I9NA 4GVXA 4DYDA 4B7XA 4E6PA 1P0FA 3ADPA 3GNSA 1O5IA 1KC3A 5JYDA 4L73A 2CDBA 4QXMA 3MCVA 4O5OA 5FWNA 1SOVA 4ND2A 2P9GA 5JDCC 1ISGA 3Q6IA 4GL4A 2D0IA 3QV1A 4IJVA 5ER9A 2YFHA 3V5NA 1J0XO 3HFGA 2X0RA 2NV6A 3UVEA 2BHLA 5KVCA 3DTTA 5TT1A 1P1IA 4BVAA 3E6AA 3RKRA 2VHZA 3HB5X 3ONFA 1GV1A 2RHCA 1E3WA 1UZMA 4OXNA 5JAIA 3GVHA 3JQGB 4YA6A 2J5KA 3F9IA 3VTZA 1WMBA 1PJ3A 1F17A 5TIIA 4BNWA 1I0ZA 4WCFB 4YACA 1KEUA 4FS3A 4D3FA 4QFDA 1U5AA 1OAAA 3AI1A 3GOHA 4O6VA 3OA2A 3ZV3A 1SPXA 4M55A 3IOYA 4PLPA 2WYWA 1U4SA 5L45A 2J6IA 4CMEA 2ZJ1A 4D42A 3JD2A 4XYBA 4HXYA 1MFPA 1N1EA 3JD1A 5IDXA 1NR1A 2GGSA 4BNUA 1NFRA 2Q50A 3GUCA 2RH8A 2HRBA 3K8ZA 4I08A 5THQA 4A26A 4J16A 3TJRA 1QKIA 1HWYA 1T4BA 1QMGA 4YVFA 1MC5A 4ND5A 4B7CA 1D3AA 4J91A 1SEVA 3JTMA 4O0LA 3PHJA 1LSUA 3Q11A 4JROA 1XIVA 4DIFA 1PJQA 4UUMA 2FPGA 3NT4A 2HJSA 1YB4A 4I9UA 1AXGA 4L8VA 1GR0A 4MOWA 1UDBA 2O48X 2QQ5A 1HDXA 2D2IA 5T8KC 2CY0A 4YRDA 5DCWA 2BI8A 3PWSA 1CEQA 4F45A 1T1SA 2P4HX 1EBUA 3DBVO 3KZVA 4Y98A 4TZTA 2PZKA 3OP4A 1B8UA 3HSKA 2O7SA 3L0DA 3R3SA 4URFA 3ZU3A 2CNBA 3WGGA 4W9NC 5JDIA 1KEWA 4N18A 1GUFA 5HA5A 3V1UA 3VH3A 3RUAA 2B83A 4DQXA 2BFAA 4IINA 1PWXA 2BD0A 3RUIA 4BGUA 5I9LA 3E8XA 3IKVA 3JQDA 4D3DA 1R4NA 4MP8A 3CZRA 1TT5B 1HZJA 3F4LA 2PWZA 2A92A 2HK7A 2H5LA 2AHRA 2YW9A 3D5TA 3Q2KA 3W4KA 5A9TA 5DCUA 4WCFC 1IHXA 3DMTA 5CDYA 2C0CA 1EVIA 4HKTA 2Q49A 4CM3A 2BFMA 4XB1A 4K9DA 3GAFA 3QVSA 1HDGO 3S2EA 3RD5A 1GZ3A 4FCCA 1J6UA 4NDNE 2ZYDA 4RVDA 3HQ4O 4NU5A 2X6TA 4R5MA 3OICA 2GZ1A 1EUZA 2ZYGA 4LN1A 5EQDA 3ZI0A 2B5VA 3IIEA 1T1RA 4CMHA 1XHLA 1WXDA 1Y8RA 2C2XA 2OOSA 4BMNA 1ZEJA 4JX8A 1W8DA 5FEUA 4F6LA 4JNKA 4TSKA 3B1FA 4ZQGA 5IDYA 3Q3CA 2UDPA 3NGLA 4QFCA 1VM6A 2FOIA 2Y93A 3FCOA 2DM6A 5L3ZA 5TS3A 1X13A 5BNIA 5ENVA 4OKIA 1E7RA 3P19A 5KJFA 3BA1A 4DLLA 1ONPA 3OMLA 1YS4A 4YXFA 4Q9NA 3UUWA 1EBFA 4N5NA 1G0NA 1UP6A 4GPD1 2VHWA 3WBFA 4HBGA 1K6XA 4ZGWA 4ZJUA 1O8CA 1HTBA 4YBZA 4MVJD 3TPCA 3L9WA 2QRJA 3PWKA 4ZQHA 5HTOA 1UR5A 3GLQA 4RF4A 4IS3A 4XDZA 4AJPA 4OL9A 1LNQA 1WDKA 4XIJA 1YRLA 1VJ1A 1DJNA 1E77A 3KV3O 3IUPA 1QYCA 1JQBA 2DBRA 4CM9D 5FI3A 4DQVA 4CMIA 1BRMA 3RI3A 3BMOB 1R4MB 5JAQA 2OZPA 4RGBA 5LCXA 4FDAA 4QQRA 1HDYA 4J1QA 2WE8A 1E7WA 3KYDA 1PTJA 3WNQA 1V9LA 3FRJA 1ZCJA 1EK5A 4WECA 1I3KA 4JBGA 3OFSA 3U3XA 3PJEA 2AG8A 3BTUA 2NVWA 5T6BA 3CXRA 1ENZA 1T2AA 1OOEA 2FMUA 5TSDA 2Y0EA 4NJMB 3WGOA 4ZN6A 4UUNA 4J49A 4RO0A 3WSVA 2HMWA 4CQLB 2O23A 2VZ0A 3VTFA 1Z73A 1ZSNA 4TZKA 1JAYA 4HFMA 2IODA 3C1OA 3F1LA 2WM3A 3TZ6A 3KETA 4DXHA 1E3LA 5IJZA 1U1IA 3AOGA 2EG9A 4R41A 2BI7A 2Q1UA 1BDMA 5COBA 1H93A 3CIFA 2DTEA 3I9KA 2HKIA 1ONOA 1NQOA 1S6YA 2A9FA 3U4HA 4IMRA 4R5HA 2EW8A 4YPOA 4KUGA 1B7GO 3TWOA 1N7HA 4WK6A 1PGPA 1NASA 3BTSA 3O8QA 4JQCA 1BTOA 2HAEA 4C7JA 5IXSA 3ZWCA 3KVOA 2IYOA 5FF9A 4I9NA 4NZ9A 3D3WB 4BQPA 4JBHA 3ZHBA 3A4VA 1V3TA 1YJ8A 3LDHA 3FD8A 3JYQA 4MVJH 1N9GA 2GF2A 5T64A 3PIDA 1F12A 1PS0A 2VT2A 3BTVA 4LRSB 4JLWA 5ES3A 1JVSA 2AMFA 4DTIA 1H5QA 3RUFA 1PZGA 1LJ8A 4J7XA 1FMCA 4OMUA 1PGQA 2UUPA 4WLEA 1B2LA 5A06A 1PGOA 1YJQA 1E3JA 1KIFA 1B8VA 1H9AA 4FFLA 4TRRA 1YQDA 1JWBB 4Q3NA 4A10A 4L9RA 4AVYA 3Q0EA 3IL2A 1K5HA 2PTGA 4R1TA 1AHHA 4KWIA 4BO2A 1EE9A 1V6AA 4BKPA 4FB5A 5IZ4A 1EEHA 2GN6A 1PJTA 1PJ4A 4OSPA 4NK5A 4PCVA 5B4TA 5L51A 3GZ4A 3KOUA 3WGHA 4XCVA 5T67A 3INTA 4DQUA 3M6IA 1EVYA 2EJVA 4S1VA 4CM4B 1DC5A 3GH3A 3MOGA 3ICCA 3H3FA 4PLFA 2XF8A 1PL7A 4L0QA 4YB8A 2I65A 3GG9A 1LLUA 3E9NA 4Y9DA 1KVUA 5A04A 4IJKA 3NDIA 1YOVA 1Z75A 5L7TA 1ORRA 5ENDA 1LEHA 3PHIA 3NKLA 1A4IA 3PLNA 1HDCA 4ZQFA 1D1SA 4B7UA 1BWSA 5ILOA 1T24A 1CQJA 1LQUA 1PIWA 2F1KA 3BXXA 2EGHA 2EF1A 3QP9A 4ZICA 4RPJA 2C7VA 2AA3A 3SX2A 2POQX 2E6UX 4GX2A 4RQTA 1UH5A 3U0BA 2W2LA 1VI2A 5JLAA 3HG7A 2JJYA 2R00C 4S3MA 5C5IA 2AW5A 5JMPA 1R0SA 1YL7A 4MP6A 1AE1A 3KEOA 3FR7A 3A28A 1IOLA 3WLFA 3RBZA 1NWCA 2UAGA 5GY7A 5G2OA 4N5LA 3E48A 3ETEA 2HUNA 1CQIA 1I36A 3H9EO 3S2GA 3WYCA 1FDSA 3LLVA 4ZQEA 3JCZA 4IUYA 5L53A 1TLTA 3KRTA 3EZYA 3GAZA 2VT3A 3O26A 1DIAA 3C24A 3IAHA 4EBFA 3QWBA 4BO3A 5EERA 1B15A 2I76A 4WLFA 1C1XA 1UP4A 1T26A 3I9NA 1GYRA 3H3JA 3ZV4A 3P2OA 3L07A 4GX5A 1UDCA 2OP1A 1XU7A 4BL5A 3UCEA 4NBUA 2JCYA 3Q9NA 4LVUA 3AJRA 2ZB4A 3ZGYA 1TB4A 3NV9A 1I2ZA 2NQ8A 3DZFA 5DBGA 3U4DA 1DC4A 1QG6A 4YYZA 4CM9A 1DC6A 2HRZA 2Q2QA 4O1MA 2WJPA 1JAXA 2C5EA 2Y1GA 3ZNPA 1LDMA 2YDYA 4CLRB 1K6JA 4AJLA 4D0SA 3VZSA 3WQRA 3QWAA 2RBEA 2CDCA 4XYGA 1LSJA 2PD3A 1IY8A 1I8TA 1WLYA 2YY7A 2DU8A 3O4RA 1VC2A 1VL6A 2YHUA 1Y5MA 1ZW1A 2Y1EA 4CUKA 3DZIA 4P38A 1N9GB 3ZWBA 3DFUA 9LDTA 1GFSA 4Z9XA 3OIDA 5IZCC 3ST7A 3GC6A 4P4GA 4ZU3A 1O6ZA 2CF5A 2Y68A 1QR6A 2J3IA 2NSDA 3UICA 1O89A 3H5RA 3MJVA 4NJMA 4Z3KA 4U0KA 4NG5A 5L7YA 4RDHA 4E5MA 3UN1A 3FWZA 1K0UA 2VOEA 3HDJA 4WPGA 1HZZA 1I32A 1SO8A 4UEOA 2EHDA 3JD0A 2DLDA 2JD1A 2NTNA 3C3XA 4CV3A 4CM5A 4E2ZA 5FFFA 1GQ2A 3WG9A 1R15A 3KUXA 4D44A 2GO1A 5CDGA 1V35A 1ZH8A 4KQXA 2ZCUA 3VH1A 2B0JA 4CUZA 1OZAA 1NHWA 2TMGA 3BIOA 4FFRA 1ZFNA 2SCUA 3DBHA 5EL0A 3HDYA 3PDJA 1DSSG 3AU8A 1BG6A 3GR6A 5GMOA 2ET6A 3EY4A 1HE4A 3H9GA 1GEGA 2X0IA 4B4OA 2DBVO 1Y9AA 1VJ0A 1TVEA 3UKOA 4NU6A 3RAJA 1P1JA 3AK4A 2JFFA 3EZLA 3W8EA 4AICA 4ALKA 1X0VA 1VSUA 3KLMX 5IG2A 5IDWA 3QQPA 1VSVA 1N1GA 1LLDA 4FFPA 1GPDG 3INRA 1Q7CA 3F3SA 4F46A 1DLJA 1GL3A 1IHYA 3E03A 2I67A 3X2FA 4E5NA 4CLOA 1U7TA 2I9PA 1EFKA 4I8XA 4CL8A 5KWEA 2HDHA 4OM8A 1KS9A 4JJGA 1AXEA 2NADA 4NHEA 4W82A 3GDFA 5DF1A 1E7QA 3OF2A 4Z0HO 1DAPA 2VHVA 4HWKA 1YONA 3VH2A 3S8MA 3GN2A 5TLSA 3H65A 4MKRA 1DEHA 2I3GA 4FGWA 4ND1A 3HN2A 3AUAA 3QJ5A 2VWHA 3BHMA 1DRVA 1JKFA 1WDMA 1ULUA 1Y9EA 3PXXA 3BMCA 4YRBA 3I5MA 2HLPA 4X54A 3P5SA 4XGNA 5I7FA 1M67A 5TQVA 1RWBA 3A9WA 3X2EA 1Z6ZA 1U28A 3JSAA 4QECA 1W4ZA 2PD4A 1WVGA 1SMKA 3PI7A 4FIZA 1EUCA 4NQZA 2EERA 3DC2A 3QVTA 3H7AA 1ARZA 4YR9A 2NQTA 2PD6A 2LDBA 5LDGA 4IGEA 4YQYA 4R3NA 5JXWA 3PYLA 1UUFA 2IZ1A 3WGTA 3MEQA 3ROPA 3BTOA 3ZWXA 2ZTVA 2GERA 4YT2A 4PZDA 2E49A 3S2IA 1X15A 2W2LD 4IM7A 1H6DA 4IS2A 3KHUA 3TZCA 1WZEA 4ZVVA 1N7GA 1HEUA 2NU7A 1F14A 1XYGA 4PRLA 4CLRA 1YVEI 1KVTA 1NQ5A 3DZGA 4E5PA 2NNLD 3TOZA 1GTMA 3NTOA 3F46A 3GNTA 2AE1A 4CLHA 2W90A 3DR3A 5ICMA 1NXQA 1QV7A 3B70A 3I6IA 4N5MA 2PH3A 2Q1TA 4GKBA 1E1MA 2Y67A 4U6QA 3RASA 5U9CA 4II2A 1P3DA 3CTMA 3PRJA 4CUJA 5DP2A 4BO1A 1N2SA 2Q4BA 4Z6KA 5CP8A 1BXGB 1AUPA 2TMDA 4BNVA 3LLSA 2VYNA 1T2CA 5AXAA 3DBLA 4U8GA 4A03A 4CLDA 4UVIA 1UAYA 3MTJA 2X5JO 3H8VA 4WGGA 2Y05A 1EMDA 1W0CA 3AFMA 1QYXA 5CAEA 1XCBA 1ISMA 5CPBA 5B4UA 4JXKA 3KB6A 3KLPX 1ZK3A 3FPCA 4LCEA 1HDZA 4YCAA 3F5SA 2EP5A 3GMDA 4ALNA 1P1FA 1UXGA 3GVCA 4P22A 2C5AA 3UGKA 3RU7A 3UFXA 2C29D 3QLJA 4HFJA 3C7DB 1Y7TA 3DEYX 1SB8A 3FNFA 3KSUA 3QWFA 3BMQB 1U3VA 2IZZA 3VKUA 3OBBA 5ITVA 3NGXA 1YL5A 1LRKA 3JQ9A 5F1OA 3W4IA 4MVJM 3I52A 4MVJE 2PR2A 4Z0TA 4NFHA 4J2OA 3NUGA 4RZIA 4KUHA 2X9NA 2OXIA 1NAHA 4JIGA 1NM5A 5JY6A 3KYDB 3I3OA 4BO5A 3BMNA 3UOGA 1D4FA 5JSFA 4IQGA 2YHIB 2C82A 1BXKA 4ALIA 4BNYA 5F1KA 3HB4X 2FRDA 4J9VA 1G6KA 3V2UA 4QUKA 5F3RA 5IDQA 1RM4A 3B20A 4N7RA 1C1DB 4CQLA 4INAA 1X7HA 3UF0A 1FK8A 3WJAA 4PG8A 4YJFB 4KP7A 1QLHA 4BNKA 3UAGA 3AM5A 4LMPA 3U9LA 3GF4A 3MTGA 3JQ7A 3QHAA 1I3NA 3HHPA 2QYSA 5BT9A 4KZPA 2P91A 2VTEA 4PLVA 5CEJA 1UDAA 4FC7A 1R6DA 2Y99A 3GUYA 1PU2A 5CG1A 4FQ8A 1J49A 3M1AA 3PP8A 4JP2A 4IDCA 2VQ3A 1LA2A 4FR5A 3QY9A 3HN7A 1HRDA 3OH8A 4BKQA 3W8FA 4BGVA 2Q4EA 3RFXA 4MKXA 4GLLA 1DC3A 4TVBA 2ZQYA 4PLYA 3ZZNA 4J6FA 1E0DA 3B1JA 1U8FO 3K30A 3K73O 4PG4A 4XQEA 2QG4A 3EW7A 3ZHZA 3ICPA 2NU8A 1ZO8A 2ZB8A 2FPPA 3AW9A 4WE3A 3UCXA 4ZA2A 4FJ0A 1DOHA 4Q3AA 1R16A 4RL6A 2W4QA 5AVOA 5KJ1A 5A9SB 3NX4A 3VOSA 4BO8A 3NDJA 3U5TA 4R1SA 4AFNA 2NTJA 4LSWA 3ONDA 1SOWA 4BNZA 3TL3A 2XXBA 2JAHA 1HETA 1C0KA 2XPCA 3OQ6A 2HMSA 3C7CB 4QSMA 2FR0A 1IPEA 2GYYA 1ISHA 4KMSA 1TA4A 1QP8A 3G3EA 3CEAA 4ZQBA 3TN7A 3PPIA 3Q2IA 4N54A 5I9MA 1FJHA 4GGPA 3O03A 5I8ZA 3CH6A 2CF6A 2VUUA 3ASVA 3IP1A 4IIVA 3VVCA 3F47A 5J23A 4W7HA 3JYPA 2O2YA 3LT4A 1U4OA 4EJMA 1NPYA 1FDTA 4K28A 5KOIA 2D3TA 1P45A 5IN4A 4GAEA 3WYEA 4MVJA 4KDFA 1ZJYA 3PZRA 2WYVA 2OBNA 3FNHA 4MVJP 1RM0A 1XDWA 5DOZA 2PKQO 1EK6A 3F4BA 1MG0A 2W2KB 3LSYA 4DMLA 4B4UA 5H83A 1YO6A 3FR8A 2O3QA 4GGOA 2YQ4A 4BKOA 5DN9A 4WOKA 4CLXA 1LC3A 1X7DA 2CVQA 1YXMA 3GVIA 5GZ3A 1XLTA 5HWSA 1ZIDA 2XAAA 4IQ8A 4TMFA 3F1KA 1WWKA 3JD4A 2V6GA 4G2NA 1PZEA 1UXKA 5A05A 5A9RA 3ZNNA 2FWMX 3M1LA 4WNIA 2OL4A 1MG5A 4XJTA 5B4VA 1H6CA 2HQ1A 1Q1NA 4KQWA 3FBGA 1P77A 1N8KA 3DZJA 1V8BA 3I83A 3G0OA 2O3JA 3C7AA 2FR8A 1EVZA 3VDQA 4BNXA 1HYGA 4YJHA 1ML3A 4GX1A 3JQ7B 1DB3A 2GNAA 7MDHA 3AUTA 4DLAA 1ISFA 1ONNA 2ILTA 5KTKA 3RC7A 3TL2A 5C3MA 1XQ6A 4BNLA 4Q3CA 4J43A 2D59A 4AG3A 5JAZA 3RWBA 1LLCA 7ADHA 3E5MA 4J0EA 4F3YA 1FDVA 2C2YA 2I99A 4A2CA 3R1IA 5CFZA 2Y1FA 4CMJA 1K6IA 2O50A 2IEBA 2ZB7A 3TDKA 3SC6A 4Z9YA 4NK4A 1C1XB 3O9ZA 3MJ4A 4PLZA 2VHXA 2V7PA 5EESA 3IS3A 4RORA 1KYQA 2ZJ0A 3K5PA 4YAGA 1GADO 4BNNA 1Z7BA 3LC7O 2V6BA 4TRJA 3PFWO 4IDGA 3UHAA 3SJUA 3PJDA 2VNSA 1TT7A 5IXYA 4KUEA 3WTCA 4FD3A 3BHJA 2OMEA 4OYRA 4TWRA 4B8ZA 4PLHA 1RYEA 4D3SA 2B5WA 3DBRA 3ASUA 2HMVA 3FNGA 3QWIA 1RPNA 2O3SA 4OXKA 5L4LA 4RLHA 5KJ6A 1ADGA 3VPGA 3LT2A 3PVZA 4G81A 4FN4A 1LC0A 5CEFA 3KO8A 3RC2A 2VWQA 4DVJA 1OFGA 4J4HA 4RDIA 5G4KA 4AJNA 5JDIC 5JAMA 5BNTA 5TGDA 4RVHA 5BR7A 4ZD6A 1O94A 4W4TA 2YJZA 3WGYA 3D1LA 1H2HA 4JJFA 5L4SA 2WD7A 2Y1OA 4DIBA 2J3JA 3P7MA 3WB9A 3I4FA 4RV9A 4QO8A 1YKFA 2JCVA 2CFCA 3OJOA 4BB5A 5A03A 1ZNQO 4DPLA 4ALJA 2X22A 2NUAA 4E0BA 4XEHA 2BGKA 4ROSA 3W4JA 3WMWA 3C1AA 3GDOA 2X58A 3JV7A 3OM9A 4ITUA 4Z3DA 3ANMA 4R68A 1YB5A 4CMBA 4RLSA 1T4DA 4KWHA 2OP0A 4RVSA 4RJTA 1O9BA 1DIHA 4U6SA 2NTVA 1OC2A 4CMAA 3JQAA 2NACA 4LCJA 2DPHA 3ENKA 2E82A 4C4OA 3I1JA 2X23A 4J90A 2BRUA 2CSUA 1PQUA 2YV1A 1HSZA 3OA0A 4MDHA 2B37A 2HMTA 4E5YA 4Q39A 4QT0A 3SEFA 2FN7A 2DAPA 3DB2A 1EDOA 1IULA 4MP3A 2VN8A 1PR3A 3DONA 1V3VA 3E9QA 2DC1A 4J7UA 2EP7A 3ZWOA 1H6BA 2UVDA 4UVEA 1DAOA 4UAGA 2AEJA 1JU9A 3E82A 4L4XA 5A3JA 3GZNA 4PZCA 4J3FA 3WFIA 3AUSA 1B16A 3OETA 3NJ8A 2W98A 3ZWPA 1QORA 4U7WA 3QVOA 2VNAA 2G82A 5BSGA 4UULA 1GQYA 4YTEA 4XRGA 3UXYA 4FOSA 1GPJA 4EDFA 3FPLA 3AFNA 1YBMA 1PL8A 2VUTA 3L4BA 3N7UA 4L4SA 2BH9A 3WWYA 2X7HA 5EPOA 4BNIA 2P5UA 3OJFA 3LU1A 2FHSA 4PG7A 2VTDA 1KEVA 2BGMA 4LK3A 3H6KA 3WOHA 3MWDB 4L74A 1IZ9A 1H6AA 4ND3A 4B3IA 4YDRA 4BIIA 2PV7A 1ISJA 5G4LA 1DHTA 5JMWA 3WQSB 4OAQA 3WR5A 2JFHA 3T7EA 2IXAA 5K0ZA 5I7VA 4J0FA 5I7SA 3IKTA 4FFOA 2Y1CA 1VLLA 1P0CA 4NBVA 4XQCA 3WSWA 1VRWA 2OFPA 4I5DA 4EUHA 2ZATA 2WD7B 3I9LA 1KERA 4DRYA 3ANLA 3GY0A 1UXHA 4K26A 4W6ZA 3GFGA 4MIEA 3QVXA 2WSBA 1KEPA 1GQQA 1HL3A 3BHIA 4FPXA 4DL9A 4HY3A 1XEAA 2ZCVA 4DBZA 4CR6A 1X1TA 5HM8A 4UEJA 3AY3A 4HP8A 9LDBA 4KDEA 4DIOA 4XR4A 1RM5A 2Q1SA 1ZK4A 1D1TA 4Z9FA 3WLEA 3GGOA 3ZHXA 4JGBA 1IB6A 2A35A 4TKLA 5AOVA 3TQHA 4OOFA 4D41A 4I5FA 1MP0A 3A06A 2QIOA 1IZ0A 1DXYA 1MLDA 4E4YA 1T2DA 2GSDA 4DPKA 3EK2A 5DBIA 1GU7A 4FSHA 5G0TA 5JC8A 4IDDA 2DFDA 1HYEA 3WJ7A 1EQ2A 2DPGA 3RC9A 3GVXA 1XU9A 1LI4A 2FZWA 3JQAD 4BHTA 2QRKA 4AJEA 4XA8A 1XG5A 1Z82A 2WDZA 2X5KO 2P9EA 1R0KA 4EUEA 3L9XA 4XDYA 4Q3BA 5JPIA 4BNHA 5JY1A 1LSOA 5HS6A 1LDGA 1LRLA 4CV1A 1ZBQA 4XWYA 5BSEA 1TT5A 3CPSA 1KOLA 1TI7A 3VC7A 2Z1NA 3D5QA 4OHUA 5G0WA 4XZ3A 5COAA 3ROKA 4LMRA 2B4QA 1LUAA 4JJIA 4GSKA 4TRNA 1MFZA 1Q2XA 1QLJA 3ROQA 1C0LA 3EUWA 1Y8QA 3VPSA 4HUJA 3EYWA 5AXBA 4Q3DA 2FSVA 3WQQA 2FP4A 4WKGA 2W8ZA 1MV8A 2GASA 3D7LA 4LVCA 5AXDA 4HNHA 1GV0A 1F0YA 1MX3A 1U9JA 1XA0A 2IZ0A 4OH1A 4J7CA 5G4KB 3ZWNA 1DFGA 3T4XA 2X4GA 3AU9A 3VAZA 4E2XA 1R4NB 4Y67A 5CDTA 3ZN2A 2B36A 3GHYA 1YWGO 4BQRA 5TX7A 3D4NA 4BMVA 4E12A 3LZ6A 2X5OA 1RM3A 1B8PA 2VRCD 5CG2A 4RZHA 3HE3A 2OO5A 4RPHA 2WEKA 1SCUA 1M66A 2BELA 5JC1A 3NRCA 2HK9A 3DL2A 3H2ZA 2DVMA 2D1YA 3L4SO 2Y0DA 4CMCA 1NX6A 4I5GA 1A72A 1ISIA 2PK3A 1A71A 2Z1MA 4M89A 4NJOA 2PZMA 2X86A 3DHYA 1KVSA 2R00A 3SBOA 3V8BA 3AY6A 4TQGA 4MO2A 3PIIA 3JYOA 3ITKA 4WASA 5L40A 3CINA 3I9OA 5F21A 1L1FA 1RKXA 5EN4A 2RHRA 3KTDA 4FC6A 4MIOA 1XELA 1BXGA 2GRAA 3QVWA 1DBVO 1PZFA 3EGOA 8ADHA 3KYCA 3JQ9C 3EVNA 3MJEA 2CMDA 1M76A 1H0KA 3G49A 2C54A 3D3WA 4UUOA 1NNUA 5B37A 4Y8VA 2BFOA 2PA3A 3ITDA 1ENOA 5JCJD 4R16A 1Y1PA 3GFBA 4HX5A 1E3EA 4IGFA 3QA9A 4IJUA 1E6WA 4XYEA 1OC4A 3RUDA 1BSVA 3IJPA 4OOEA 2VZ8A 1BVUA 1DRWA 1A9ZA 3HUDA 2AXQA 3NTRA 2I6TA 4TVOA 3H5NA 1HDRA 2P9CA 1VPDA 1BW9B 1X14A 2VYVA 3ZV6A 4GMFA 3GRKA 3AWDA 1DO8A 1YBAA 3EVTA 3KYBA 3LQFA 3L6EA 4MIYA 1GYQA 1B3BA 1U3UA 1GEEA 3HDQA 2Q1WA 3A14A 1GYPA 1WDLA 1R0LA 1HE2A 3SVTA 3JQBC 1LRJA 3KBOA 3OECA 4R51A 4EYEA 2VOJA 5KJCA 4NFSA 2BF7A 1DIRA 3HNPA 3RBXA 3ZNOA 3WMXA 3PQFA 2DQ4A 4FFMA 1SC6A 3NYWA 3ZWVA 3ZWWA 2QX7A 3MOIA 3ZV5A 3PLRA 3DMYA 2Y0CA 1WW8A 3ADOA 4H16A 5C7LO 5F5LA 4M49A 1P1RA 1LDYA 1C14A 1M6WA 3AM4A 1G1AA 1LDNA 4BKUA 4FBGA 5GZ6A 2J8ZA 5I8WA 4UREA 5CEEA 2D5AA 4HV4A 3HADA 2AQIA 2Q46A 4CLEA 1LQTA 3GVPA 3MZ0A 2ZQZA 2V65A 2I66A 1R12A 2BFPA 2EV9A 1UP7A 3DFZA 1PJBA 4A0SA 1HLPA 1D7OA 1FXSA 2BGLA 4GX0A 1T25A 4LRTB 1OMOA 1ULSA 2X0JA 4RF2A 4ID9A 1Y8RB 4RF5A 4YJDA 3TNLA 4ZRNA 3VPFA 2YQ5A 4BOYA 3DAFA 4MVJF 5CDUA 2J5QA 1IL0A 3K2EA 5G0SA 3VPHA 4Q3EA 3IQDB 2EXXA 1LU9A 4YT8A 1GCOA 5B1YA 4YRAA 4DLBA 2O4UX 1ZMTA 3N58A 4YAJA 1B3RA 2EKPA 4PIVA 1VL0A 3ZWMA 1PS8A 1R37A 4NBWA 3IP3A 3GG2A 1P1KA 1RJWA 2Y66A 5ADHA 5CPFA 1ZKMA 3IC5A 4DWVA 1Y6JA 1IUKA 4CM8B 4J4BA 4WEOA 1GZ6A 3S55A 4NBTA 3BMOA 3VZRA 4WLOA 3BMNB 1JKJA 3GEDA 4IDFA 4L76A 4XJSA 5BSFA 1RYDA 3RJ9A 2YHIA 4ND4A 4DC0A 3ZU5A 1J5PA 4PLWA 1NPTO 4BNTA 2Y1DA 3SJ7A 4PVCA 5TF4A 1U8XX 4EI2A 1DIGA 1ZK2A 3SLKA 3DDNA 2X0NA 1T2FA 2ZKLA 5L9AA 2QZ9A 2GZ2A 3PWZA 1UAGA 1JWAB 3D3EA 2EIHA 4WOJA 1Q0HA 2AQ8A 3NTQA 4CV0A 4GWGA 1MA0A 2VYVD 1SNYA 1V0JA 4HADA 4XD2A 1HLDA 1YH3A 2B4TO 3ZU2A 2ZK7A 6ADHA 1NAIA 5THKA 1YGYA 2A4KA 4E3ZA 2JD2A 1NQAO 1KY5A 4CQMB 2WTBA 4Y6PA 5LDHA 3R0IA 1XKQA 1P31A 1Z74A 4QO7A 1CYDA 4OXYA 2PKQP 5EIOA 5H82A 5B12A 4YAEA 3K9QO 3V1YA 4OSOA 2DBQA 2VYND 1QRRA 5DDIP 1GD1O 1Z7EA 2LDXA 3DAGA 3O38A 1E7MA 3WYBA 1PJ2A 3RKUA 1HYHA 3TZQA 4PLCA 3PGXA 1B0AA 2CVZA 1EDZA 1GZ4A 2GN4A 4JN6B 4PRKA 4F6CA 4YAKA 4WLUA 4CMGA 3BZUA 5T8KA 4WJZA 1O0SA 3GDGA 3FN4A 4RVUA 3FSRA 4IQ0A 1SEPA 3G1TA 2DUWA 2PH5A 3PHHA 1TEHA 1SB9A 2G1UA 2FZEA 4HFNA 2I5PO 3Q1LA 1Q0LA 2QRLA 2VUSA 2GUGA 2WD8A 5FI5A 2PY6A 4DA9A 1JW9B 1QYWA 4BGIA 3WDSA 5ITWA 3AY7A 3EDMA 5TJ9A 1A7KA 1LBEA 2ZB3A 3D0OA 2YV2A 2G5CA 3I9JA 4WNCA 3OJLA 3OQBA 2O2SA 3OSUA 5G0VA 4C7KA 5A02A 1YE3A 4XIYA 4A27A 2P68A 2PZLA 4WEQA 3PZBA 1Q7BA 3ZDFA 3OIGA 3DO5A 2GZ3A 4PLGA 2JKVA 3ANNA 3PQEA 1TXGA 4LW8A 4Y6SA 3WGIA 4M86A 1F8GA 3S2FA 3FWNA 3E9MA 4BNJA 4BMSA 4BO7A 3VPXA 2VZ9A 2V6MA 4QEDA 2OHXA 2H9IA 3CMCO 6LDHA 3WIEA 2DFVA 2PFGA 1JA9A 3DBHB 2YYYA 4IPTA 5A4DA 1AHIA 2JD0A 2JAPA 3PDUA 3DOOA 3DHNA 1DHRA 1LDBA 2NWQA 2Q99A 1FDWA 1PJSA 4GLOA 2C20A 5T57A 3RU9A 5U1PA 1O95A 1E92A 1KY4A 4YJHB 5EQFA 1K2WA 3M2PA 1E7YA 1KVQA 3AI2A 1BMDA 4AJ2A 4NIMA 4CLOB 3RCBA 3I4CA 1IE3A 2R2GA 1U3WA 1VL8A 2E48A 2AEFA 1OI7A 1E1LA 2P5YA 1ZUD1 2JHGA 4M8SA 3RFTA 1KBZA 5KVSA 1E6UA 2NU6A 4D79A 4GH5A 5TJHA 2AG5A 3U49A 3WS7A 3OHSX 4R1UA 2EKQA 2P2SA 2W2KA 2YUTA 1P9LA 4IXWA 3GEGA 1LSSA 1BHSA 1NWHA 4IDEA 4RQUA 1M6HA 5ILGA 3ZCXA 5ER6A 3HZZA 3GQVA 4TROA 3VDRA 3JQFC 3G1UA 2CVOA 3ABIA 5KNLA 1XWFA 3INGA 3KM0A 4GVLA 1AGNA 3LF2A 3ZNQA 4BNFA 4CJXA 4BNGA 4HNGA 3PYMA 1VKOA 1NVGA 2NLOA 5A9SA 4WLVA 3GGGA 1NQTA 1ENPA 4E33A 1ENYA 3ZW9A 3FHLA 4CMKA 2GN9A 3B6ZA 3SC4A 4NMHA 2ZTUA 5DP1A 2Z5LA 2OBYA 4CQMD 5A5FA 1CJCA 4MPDA 3P2YA 2IRWA 3H5AA 3PTZA 3OEYA 2EEZA 3LT0A 4ONEA 4GBJA 5DZSA 2VRCA 1R66A 2IE0A 3PK0A 3CZMA 4ZRMA 3DOCA 4KTVE 3GHHA 4XYMA 3TFOA 5JBIA 2PGLA 1C0PA 4B4WA 1I01A 4IDAA 4OO3A 1CERA 1YDEA 4A73A 1J4AA 4PN3A 4DMMA 1Z45A 3VZQA 1V3UA 3OEWA 4ESOA 4K6CA 4RVFA 3WTBA 1UJMA 2HU2A 4YAIA 1UXIA 3A1NA 4QX6A 3FTPA 3W6UA 2GCGA 2F00A 1A5ZA 4HFRA 1MC4A 1F8FA 3DQPA 3PJFA 3SXPA 3WICA 3GGPA 3DOJA 4RVGA 3DZHA 3PHGA 4AJJA 4UVDA 1T2EA 1U2GA 3C8MA 3BYZA 3RVDA 4J1SA 5A5EA 3RIHA 1PEDA 3DBLB 4FJ2A 1E1KA 4J2HA 4J4TA 4JBIA 3D4PA 2YZ7A 2J5RA 3LT1A 1N92A 2OGUA 4EUFA 3GZNB 4L4RA 4UEKA 3AM3A 3MJSA 1WP4A 1HF3A 4B79A 4D0RA 4A7PA 5AYVA 2OORA 3R3JA 2DBZA 4YJGB 5MDHA 3D4OA 4DPMA 1EFLA 3N74A 1XGKA 5G0UA 4AJ1A 1A7AA 1ADFA 5KVVA 4NH4A 3K92A 4H3VA 3WX0A 3RBVA 1KETA 5BQFA 2GN8A 5JDCA 3QE3A 2UUOA 4IJWA 1PSDA 1K89A 1YQGA 3UCFA 1GUYA 3LF1A 4BNMA 3MJCA 4E2WA 3C85A 4B3JA 1WZIA 3IJRA 4MKZA 3COSA 4BV8A 5KVQA 5CDSA 2UYYA 2HSDA 1P74A 1H9BA 1U5CA 2VWGA 3RROA 4JCOA 4ZHSA
chains in the Genus database with same CATH superfamily
1W96A 1MVNA 3CNOA 5ALSA 1E5QA 1T4GA 2JFWA 1OXXK 2C07A 4DQLA 2IDJA 3FI9A 3I5XA 3UV6A 2QLLA 1IUPA 1NVAA 1UZNA 2ZSIA 3AL2A 3CLRC 3R5FA 4L72A 4OQNA 3J80A 3K0KA 3O91A 3K6SA 4GI2A 2D2VA 2ADOA 3WE7A 5ECYA 2I8LA 4RW0A 1TF5A 2M6SA 3RV4A 4KAFA 2GEKA 3OIYA 4E2YA 3O4IA 4FGSA 1WUKS 3WNBA 5DCYA 3L40A 4C0WA 1QYRA 1T9HA 2AN9A 3N2KB 1DDOA 5I7AA 3K2QA 4YJ3A 2QVXX 5EJEA 1H2ZA 2JGMA 4OLFA 4E1AA 3CN7A 3UAOA 2QG9A 5AW9A 4QODA 3VAYA 1I4EB 2C96A 3GMSA 1GDHA 1J23A 3KXIA 3KR2A 1EJ2A 1IOZA 1T36A 4L0CA 4OIMA 4RJ2A 2F43B 3NDBB 2OHOA 4ALLA 4G5HA 3FCEA 3KQVA 5E6RA 4NCBA 3EODA 3OIVA 3JQCA 5C53B 2CN1A 3NXSA 5JI2E 2VPWA 3IERA 3U3DA 3AHJA 2QRNA 1GVHA 2WKPA 1SD2A 5B57C 3E53A 1BYUA 1L4NA 3UGQA 4AI6A 4IFIA 2OCKA 4G84A 2GETA 1XRNA 2YXEA 3PD7A 4KX5A 4IHJA 3FCUB 4QELA 2MR6A 4YH1A 4YCCA 2D5CA 2HY7A 5AK5A 2JGJA 1JSZA 5I3CA 1E32A 1CVIA 1RI4A 3HV2A 4R71A 5L7WA 4OLAA 1Q22A 1RDFA 1ZGJA 2FN9A 3HNOA 3HWSA 3KSDO 3QBEA 4FYJA 3AZPA 4G0WA 2HXYA 1SCDA 3LBYA 1L4UA 1IPFA 3AB3A 1KSGA 1LXCA 3CVJA 4PG5A 5L95A 1G17A 3ME5A 1JTEA 4UTVA 5KYNA 2FSSA 3QNMA 1ZXBA 3CMMA 5K01A 4MUFA 1NR7A 4E4RA 1LTHR 2NM0A 4ISCA 3BIXA 4MVJG 3IQHX 3LP8A 1PV4A 1AK2A 5A3SA 2XNJA 1ABFA 2PKYX 4KBFA 5DLDA 1H8HA 2XWSA 2W37A 1KJQA 2CXSA 2E37A 1DV2A 4JDPA 3UMBA 2C2OA 2B69A 2X2PA 4AWAA 3NPAA 1JE1A 4TSFA 1CIVA 2N1BA 5EZ6B 5ALFA 2OT3B 1XALA 1I24A 1QF7A 3JWIA 4JP3A 1U8EA 4RZ2A 3W04A 2UVPA 1ETHA 1KI6A 3EAGA 1E8MA 4C78A 4C03A 1I3MA 1JJAA 5C81A 2IFTA 1V4NA 4KLZA 3GLRA 3N2NA 4XPZA 5IBRA 3FMOB 5C37A 3FTFA 1QS0B 3DMTC 3ZCTA 4Q7MB 2PUAA 5T4EA 1G8FA 2AWNA 3L4KA 4QHSA 1B14A 1H2WA 3WAGA 1C2YA 1S2GA 1U7WA 2CLHB 1ZI8A 4Y30A 1DKMA 2Q3EA 5A4FS 1G9SA 3AVVA 2CT8A 3BERA 1P73A 4N3GA 1C3VA 2WU3A 4DLRA 2AW3A 4HVLA 3TG8A 4P3NA 3VZCA 3OPNA 4CM7A 4XFKA 5K0GA 3RK4A 1DPGA 2FR1A 3I9MA 3RQSA 2AEMA 1K4KA 1LX6A 2H5JA 1O96A 2HCRA 2OV2A 2H92A 4MQFB 1EXWA 3NAGA 3KTAB 2G0TA 3OM1A 1KOJA 4ZANA 3RVOA 4OQZA 4KVFA 1K7EB 3KDSE 3LD9A 4CPDA 1RZ3A 3GV0A 2IP4A 3EWNA 1Y89A 5IT9A 1O0BA 1YRQA 2Q0HA 5H0IA 1ZG3A 4D0LB 1QQ7A 1Q12A 3OCZA 1LCIA 1E2HA 4Q7EA 1Q3HA 4OGWA 2D7DA 3GROA 2JFNA 2X1VA 2ZSAA 4K0KB 2Q45A 5K9ZA 1QGAA 1SHZA 1OLXA 3LCVB 3PHLA 5A0FA 5TNXA 2A5DA 1TX4B 1KC1A 5C7OO 3PPXA 3TRDA 5LQJA 4IY1A 3ETGA 3QYFA 3SSNA 4DLVA 3T94A 4B3BA 1C1DA 5ANRB 4TUYB 5CXUA 5LNK1 1JWLA 3BXGA 4BV3A 1R9JA 5KHLB 3LI2A 3DEKA 3FTEA 1R4MA 3OJ0A 2HD4A 3NDRA 2GPYA 5EXTA 3OWXA 1MIOA 2D2EA 4BNDA 4DUPA 1E9BA 1GUAA 1F8YA 2DTXA 3TCNA 3QXHA 3PHBE 2HHLA 3HVUA 2BUCA 1QK5A 3BKXA 4L5AA 4L75A 3W1VA 4CQMA 5JU6A 2B1GA 1L7NA 1DO2A 1NBOA 4QRIA 3HKEA 3BRWA 1IY9A 2JH9A 1WVMA 2JCXA 4TXHA 3MHTA 3JYHA 1A76A 2IHKA 4ZT6A 1NUSA 2OHVA 4A6PA 3FWHA 4A8JC 4R69A 4GZLA 4JJ8A 1CDOA 1MAUA 1O6GA 2IHVA 2F59A 4QARA 5EWJB 5EUCA 4IZHA 4RUKA 4FIDA 3N0TA 1GZHB 4BBJA 1HZZC 1RU3A 2AXPA 4HMOA 1M7GA 3SHVA 4F9GA 5FYDA 3WOVA 5FOQA 2JHFA 5JFOA 1MO2A 5BW8A 1JVBA 3SXUB 4HDKB 4MTCA 2FQWA 1DAIA 2HK8A 1WP9A 1MB3A 2QT0A 2QZZA 2DHQA 5AVQA 4UNIA 2IBTA 3OJXA 5E8JA 1QP7A 1UPXA 2ZYWX 4I55A 3C1TA 3DZBA 2QX8A 1M1ZA 4QA9A 4EEZA 1PCXA 4MUMA 4R3WA 3SBXA 1JX6A 4R4JA 4WOBA 4ZDKA 4ENWA 3QSYA 4RPLA 1X19A 1CSEE 1J1UA 1DFIA 4M7OA 3K1TA 2B1JA 3GU3A 4L7VA 4PLTA 4XTRA 2OFFA 3JQ8B 2O7QA 3GPDG 5CH3A 5G3ZA 3NM4A 4BVBA 1J5EB 1JFFA 1OWOA 4D8XA 1CR1A 4I9FA 3Q7SA 1PZMA 5LWQA 3VR6D 3AKZA 3CRNA 3O3NB 2JGEA 1X1EA 4A1FA 3KX2A 4N3BA 3JQ8A 1COWA 4LPKA 3DXXA 2NVUB 5JNRA 2GCNA 3C97A 5GZ1A 1I3LA 1XV5A 3B82A 3AEKB 1M2VB 1M7BA 3HUEA 3PFFA 3ZEAA 1QO7A 2O3UA 3PJGA 1GPH1 1HDIA 2C5HA 5JS6A 1Z0JA 2R6JA 3U4IA 1M6EX 3TTTA 2AIRA 3EX7C 4ACAA 1TCBA 5FUMA 4G24A 4L50A 4DRZA 2WJ3A 5LOVA 2GFIA 2GDZA 5AM0A 2H1SA 2B4YA 4RZSA 2QHXA 3L6DA 2WIJA 1M8PA 3BRCA 2E85A 1RCFA 2WMDA 3Q9UA 3WWZA 2V58A 3BMQA 3AB8A 3OQOA 2HQSA 3VR3A 4HZUA 1QR2A 5DXJA 3ON5A 3ZK7A 3DHWC 3SHTA 2XXJA 5ALTA 1NBIA 4KAAA 4DILA 2R1ZA 3LVFO 1YL6A 2P4EA 1YF3A 4ZO9A 5C32A 2NXNA 3TRHA 5DI3A 2AFIA 2I2XB 1D0VA 3EC7A 5EJAA 3T35A 4C7BA 5JYCA 4D43A 3U44A 5E0KB 3U0VA 2NVOA 1CVRA 3HMQA 1Z4LA 2A0KA 3DDUA 4P5PA 1N2CE 3TEJA 1NXSA 2Q8PA 3TLEA 2LIVA 3DJYA 1PVVA 4P7JA 1DKOA 1U98A 1N2ZA 3QFCA 4FDMA 4QGHA 3GPIA 2PBZA 4RDCA 1HXHA 4OKNA 1YUNA 3O8LA 3MTDA 2HRCA 2PKXA 3AJAA 4LKOA 1JG4A 1I10A 4GECA 3W5SA 1Q0TA 4E13A 2FJ0A 4MQMA 1FZQA 1YI1A 2BEWA 1FDUA 2FX2A 2FF7A 1JDPA 1DC8A 3HU1A 4IIUA 4B87A 4NICA 1L9XA 4FEEA 2YWCA 2JC3A 2CXOA 5EXPA 2WFMA 1I5RA 2IWHA 1VIDA 5DOVA 2XYGA 1FCJA 2R1VA 3EXHC 3PWTA 4WRRA 4X1OA 3OE1A 1T0IA 1ZCAA 1NMXA 3PGJA 4XWTA 3UJPA 3O1LA 1PR9A 4TL6A 2NV2B 1YAHA 1B6RA 4EWLA 2R1VB 3ZXIA 2R8XA 2YHAA 3FTNA 1O08A 1VCNA 2H52A 3OQ1A 4JLOA 4MINA 5FWXA 3WXBA 2FWIA 4G0XA 2P0EA 3KWJA 1D1QA 2PMWB 2BZGA 1BMQA 1FJ2A 3D02A 3DTYA 1E1RD 5FKJA 5AK6A 2K6GA 4Q93A 4CCWA 1WMAA 4CTOA 1HE8B 1J25A 2P6MA 2O8BB 1C9EA 1OW3B 3F5MA 3CM0A 1AUVA 1N2OA 2I7XA 2G06A 2RGBA 5EJ2A 3TK1A 4ZFNA 1BX3A 2C78A 2I3AA 1E9EA 4HYYA 3BAFA 1UOOA 3MBOA 4X8LA 1RABA 5KMGA 1H0RA 3G59A 2CLLB 4HLCA 1L7EA 2DHEA 4O4IF 3HLKA 3DGFC 3CRZA 5B1EA 1YCDA 4FW8A 2YDXA 3B3GA 2OEPA 2ZM5A 3JASB 2IS4A 5HBRA 2JIPA 2V9CA 3NHWA 1V1MA 2KJQA 4MV4A 3VHXB 1EZ4A 1NBEA 4DS3A 2BAGA 5C7IO 2IPNA 1ZK0A 5AJUA 5IULC 2EZ8A 4E1VA 1T15A 4CR7A 2J3KA 2JASA 2ON6A 3HP4A 4QGBA 4WT7A 3DCJA 2RAFA 5F5NA 5JALA 2XQKA 4HGOA 1GM5A 2YW2A 4K9RA 2ZT5A 4KXQA 1D2CA 2B8JA 5DIFA 3NO4A 1E3SA 3U7EB 3P1JA 1N6LA 4DREA 4MROA 1YRAA 3LGXA 4KLAA 5FV7A 5JYEA 1RAEA 3ZWYA 4DV0B 3U13A 1X42A 3DVAA 1POXA 1BS1A 1L4MA 1GLNA 1B26A 3PUJA 4JR0A 5KYUA 1OXBB 3EA0A 3COJA 4HN4B 1YUBA 3PFCA 1HE5A 3CC8A 2C4TA 1PQPA 4D9IA 1RXIA 1H2BA 4H15A 3A1WA 1K8YB 3CEJA 3LRXA 2YQZA 3VZDA 3HDHA 3OTWA 3FWYA 1D09A 1M7HA 1QYVA 4XJXA 2BFCA 3RTDA 4KWCA 3HM2A 1JMYA 1OLUB 4P5EA 1N6RA 2FSPA 1UBSB 2HCTA 3TLZA 1F6BA 3EZNA 2C2WA 2R8BA 3AKYA 3JQFA 4IHAA 4MV6A 5CLLA 2Y4NA 2FZKA 2NV0A 5EJIA 5K4GA 3I92A 3DVQX 5KWSA 1RPZA 1OXKB 2VA9A 3AR3A 1P44A 1AKWA 2WMYA 4DC1A 1HMYA 1YULA 3H5VA 4W99A 3PEVA 1G2IA 4FFNA 4HX9A 5C3UA 2PX5A 3PGA1 3DWFA 4NEHB 2W6PA 2DR2A 2NSYA 4FUQA 1NJ8A 4JV5B 1S3SA 3EEQA 4QICA 4O33A 1NNI1 3B1KA 4TZ0A 1Z0IA 1LNSA 1JEQA 3EGDA 3PV0A 4FLFA 3WLAA 2I1LA 3RC8A 4R9RA 1OAOA 4KG7A 4UXIA 3VR5D 3D0KA 1YBHA 1Q1QA 1I14A 1YKSA 4Q7KA 3ANTA 3ZHYA 1M0SA 3L1JA 3RV3A 3T5DA 2FNAA 4S35A 4R1NA 3L6OO 1BCSA 3U7JA 5KDLA 4Z4FA 2Z04A 4UVHA 1TVKA 4GM0A 2H4JA 4KPGA 1EUQA 5CVUA 4DF3A 1PN3A 2OV1A 5HR5A 2Z6VA 2VJYA 4ODIA 4ZYTA 2XEXA 1TVKB 5DBEX 2C7OA 2ZS7A 3QKRB 1E9FA 1I7DA 4TV9A 5KKCA 4UZSA 4GQAA 1ZSYA 3NHLA 5LQAA 4PGFA 1E60A 2X8BA 4AMVA 3CLVA 4YROA 3VU9A 1GPKA 2O2XA 1P2UA 1AKUA 1WPQA 5EKTA 4GOLD 4TV9B 4NYIR 1Q19A 2YRWA 3EHEA 1PJAA 2OUIA 1NLZA 4IZIA 3HK2A 4BECA 4LJ4A 3EH2A 2MYPA 2WU0A 4F9TA 4Y0NA 3VC3A 4OHWA 4B75A 1QYDA 3NAQA 3RC1A 4JI4B 2HXSA 3JARA 3D64A 2WIBA 3FH0A 2X0KA 1B00A 2AF4C 4IEFB 3E3NA 3A3KA 1ZMOA 2WWYA 2PKCA 4RANA 3WZ2A 2BHTA 1YZNA 4PZEA 4V0RA 4C4XA 1I4LD 4ZI7F 2VCYA 3M83A 4H7PA 3RGWS 4FGLA 2C4MA 3AYZB 1WVIA 3DCYA 2ZDHA 4B7XA 3C43A 3DZDA 4KNWA 1IJKA 4GHWA 3ADPA 1GGNA 4RIEA 1M2OB 1O5IA 1RRVA 2YXNA 3M6AA 2OCDA 4Q4CA 5JYDA 5FWNA 1O57A 1SOVA 3OSZA 4PXAA 5BV2P 3FFTA 1P4GA 5J63A 3U7IA 1J06A 5JRZA 5CNJA 3RHTA 2FLVA 3O9VA 3CCCA 3QV1A 3FW1A 5E9JA 2H51A 1J33A 2X0RA 4N7BA 4KQHA 4QXOA 5C2JB 3NYQA 4AZTA 4GI3A 3KOMA 2OHJA 5DNWA 1OXMA 4I1PA 4LY9A 4MRPA 1RBZA 3RKRA 1X7WB 1H5NA 4F7DA 2VHTA 3EZ6A 2FV8A 4QZVA 5HIKA 3VDXA 3KAPA 4E3WA 4UU1A 3OLZA 5F7OA 7YASA 2FX3A 3EOAI 5I01A 2YV5A 1E2PA 3JQGB 3TLBA 1G2QA 1AQLA 1WMBA 2VJQA 4N0EA 4JYAB 3U3ZA 2IVZA 2XDQB 4HN2A 1NXVA 2PPLA 3CISA 1TJPB 4WCFB 1KEUA 4BB0A 4FS3A 4UBLA 2HHHB 2QY6A 1VA4A 3HFJA 3VYRB 3RIEA 5H4HA 2UZIR 2WU4A 3AI1A 2JAQA 3W2GA 3T5PA 3ZV3A 3PQ3A 4PS1A 4M55A 4EX6A 1N6HA 4KE9A 2YOGA 4OBEA 2EAUA 3OAAA 4AF8A 2X14A 1WX1A 1RWMA 3AUFA 2YX1A 2EKZA 1SHJA 1UBFA 4XYBA 3UWMA 5C34B 1J2YA 4NONA 4DARA 1PF7E 1N1EA 4OYLA 5IDXA 3P2KA 5KWIA 1H8HD 2WD9A 1CY4A 1QH1A 2IPMA 2VVTA 5KU7A 1NR1A 1W46A 3AF3A 1NFRA 3KKOA 5JXIA 2Q50A 3LTEA 4HSGA 4I08A 2HRBA 1NUTA 2QUIA 5JAPA 4J16A 2I62A 3WIBA 4YIKA 4GS5A 2EFYA 2G4LA 3NBMA 4IHJF 1Y98A 3U16A 1QRDA 4J91A 3ZD7A 5DSTA 3EYAA 2ZI9A 3O8RA 3F8TA 3IEXA 3R0ZA 4MR9A 3DEJA 3LY9A 1Y3FE 2NSHA 4FWBA 4J16C 3EVFA 5FAXA 1IXYA 4UUQA 3Q3HA 1PJQA 4DIFA 1C30A 2DWCA 3NT4A 4DYHA 3DA8A 2GF0A 2B2XA 2PGOA 4I9UA 4JEIA 4L8VA 3S99A 3NC1C 3SC2B 3W2IA 1YQWA 2D2IA 1E2LA 4PZUA 4H1WA 4OHMA 2BI8A 3V8PA 2QMYA 5TVKA 1L5LA 2EZUA 1C8BA 1NDHA 5BWCA 2P4HX 4MS3B 4LHEA 1M10A 1PT5A 4OU5A 2H0AA 3IQEA 5KI6A 4ECEA 4YAWA 3R3SA 2O7SA 1KZ9A 4URFA 4ZAWA 5HKBA 1E4EB 5JDIA 4W9NC 1AKMA 2LXNA 3T0FA 4D57A 1PZNA 2FP4B 5JUWA 5AW0A 3GBPA 1QB7A 4F85A 1RYYA 2B83A 2GARA 4YALA 1RI1A 2R4QA 1NW7A 4FKBA 4Q4HB 2C1XA 4BGUA 1C30B 3RUIA 1X77A 2W0MA 1VJCA 3H5LA 3OAAD 2NT4A 3BXHA 2EW1A 5HGJA 5TARA 3THWA 1XYVA 2FW6A 1ZD4A 2NAPA 3VPCA 1G21A 4PAMA 5KTNA 4G0QA 2P62A 2P6NA 2XRYA 4UD6A 4D4KA 5C8VA 2Z6QA 2OQVA 4EL5A 4QD3A 2V7QD 2G88A 4CEJA 3ZJVA 4MWDA 1OAKA 2WTAA 4BFWA 1IFXA 1W0JD 3QKSB 4KXNA 4QJ4A 4EOGA 1JALA 2YIMA 3DFKA 1K88A 2D5LA 3R3XA 2B2CA 4X65B 1P4HA 1QRUA 4DRXA 4Z4IA 4LJLA 2AOXA 421PA 2WVAA 1XE3A 4P08A 5DW0A 4DV7B 1AS2A 4G26A 1N2HA 2BFMA 4CM3A 4I6GA 1PVDA 1Z0FA 3EARA 1HQDA 2C95A 2IY7A 3CF6R 2G9QA 1P8AA 4ARVA 4UBNA 3TGLA 4Q01A 3S2EA 1GZ3A 4NKRA 1J6UA 1BA2A 1U7DA 1EQAA 2F90A 4JUFA 4DCNA 4XM1A 2G9ZA 1MQ8B 3E9CA 4JI5B 2GCOA 2Q3FA 3HKCA 2VTKA 4OEHA 5EE3A 1EUZA 1YZFA 4IIXA 4BX2A 3SIRA 2DSNA 1R5OA 3OM0A 4OB8A 2ZRBA 5BMVA 3V1KA 1FTYA 1XHLA 4R2HA 1WXDA 4CMHA 2PYZA 5A7FA 3W5UA 3T54A 1TVMA 2JIMA 1W8DA 1TYCA 3U56A 2GWHA 1URPA 3MGAA 1JEEA 2AWOA 3F90A 1SXIA 4JNKA 1WDTA 3QEAZ 3ASZA 3B1FA 4ZQGA 5E2AA 4RTQA 3QYJA 3UJ6A 3BE5A 2P4SA 3DFIA 1FRQA 3S0JA 1VM6A 2CMHA 2Y93A 2BF4A 5KJFA 2FWNA 1JL3A 3RVJA 1R4AA 4B44A 1ONPA 5CT4A 3H4MA 4ZZ3A 3GH1A 1PLKA 3UATA 3EDCA 5DGCA 1DQPA 2W2MA 4KLRA 1KH3A 2H2IA 1EBFA 4BAZA 3QG5A 2IHZA 2FUG1 4KE7A 1XK6A 1UP6A 1XN1A 2QROA 3H7IA 1BU8A 4I50A 3SS9X 3HGTA 4HBGA 1COWD 3DYBA 4AQDA 2UYGA 3HR7A 1UBCA 3RRXA 4YBZA 3TRFA 1CY7A 3TPCA 4RM3A 2QRJA 4W5TA 2SKEA 3PWKA 1XZKA 3AHIA 1IOVA 3H0CA 5E6SB 1N4DA 1TPZA 4GZ6A 4WV3A 3ZVNA 1KO4A 4IS3A 4RF4A 4XDZA 4C01A 3T9FA 2ZT7A 5DEIA 3G2HA 1WDKA 1FFBA 4XIJA 4R3UC 2LCQA 3FM9A 3T3MB 1ZINA 1E77A 2H5IA 1WF3A 4ZCSA 1WB4A 4PAWA 2SNIE 2JJ1A 3EPRA 4J2TA 5HILA 4EVQA 4CFSA 2RI0A 1NL3A 2KW5A 1BD3A 2PNJA 1CR4A 1BRMA 2X8JB 5JNSA 4OQXA 4QXPA 1IM5A 5JAQA 3FYTA 3ZIDA 4OQQA 3N0XA 5JZSA 1B6GA 1QNLA 1DP4A 3IUEA 4FDAA 4LXXA 5E7MA 2YWBA 4WTOA 4EJ2A 1E7WA 3P9SA 1W5TA 4FSDA 2RHHA 4N9WA 3EIFA 5DNVA 4ZARA 2PT7A 4HRYA 3FRJA 4LNAA 1ZCJA 2IEIA 4WECA 1N2XA 5HIAA 2ZRKA 1SQFA 3OFSA 3PUXA 3PJEA 3LFUA 3DDWA 2AG8A 3BTUA 2NVWA 2NXWA 4P0TA 4CN9A 2AYYA 3CXRA 3E35A 1GOTA 3KXPA 4Y2GA 2BGJA 2FMUA 2EFCB 2C5BA 1E9RA 5EIFA 1CR6A 5TSDA 3U7RA 4TXLA 4ZN6A 4RO0A 3SZRA 3WSVA 5J4VA 1XTVA 1W5SA 3FYUB 3SKXA 1XN4A 4GP9A 4G5RA 3VTFA 5AW2A 1ZSNA 4AO7A 3VMFA 5KJ1A 2IODA 5BY2A 2CHUA 1I4OA 2WNSA 3QX9A 3UW1A 2VYFA 2EFGA 1I1NA 3CKKA 3F1LA 3G2IA 4NMWA 4A2QA 4DLPA 3PA8A 3F78A 3FAKA 4DBLE 3K9CA 1H3NA 5LP6B 2J9YB 4JUIA 4JCCA 4WACA 1E3LA 4URXR 1JIXA 3EF3A 2QLFA 1BDMA 2PMFA 2ZE5A 5COBA 1H93A 3TOCA 4QRDA 2ANBA 2IXDA 2D62A 4EARA 4EVRA 1KI2A 2ZWMA 4PHGA 3U4HA 2FP3A 3UXMA 4DCGA 3DT6A 3LDUA 3TWOA 3IMKA 1NASA 5BV1A 4AP5A 5T4FA 1EFDN 1BTOA 4V39A 1VLJA 3VSAA 3FPFA 1QIIA 1I2AA 2EP8A 3O21A 3TXXA 2IYOA 1GNQA 2G40A 1R5BA 4XASA 2B1QA 3LKDA 1V41E 1A2OA 2XNDA 4QVIA 1RHUA 4QJIA 3PDHA 1TQ4A 3OJWA 3LDHA 4XUGB 5KCMA 2X76A 3AR9A 1FYDA 2DX7A 2HNAA 2QYOA 4LBVA 2CHVA 3RRMA 2GF2A 5T64A 3ZV7A 5LPNA 4IKOA 3PIDA 2VCHA 4B40A 5JSQA 3N1UA 4DG8A 3OU7A 1HV8A 4JLWA 1G21E 4TTAA 4ZODA 2NW6A 3IVCA 5ES3A 2XQFA 4C04A 1PZGA 3OFND 4OMUA 2CV0A 3KFXA 1PGQA 2VPTA 4PNZA 3FCCA 4WLEA 1KOGA 3HBNA 4QPNA 2JLWA 3ROEA 3GJZA 1YJQA 2PUFA 1ORHA 1CUGA 1B8VA 2RK3A 4W1RA 1NMZA 2H2AA 4QGGA 3B1VA 2HWKA 4TRRA 4ZCIA 1XMOB 1JWBB 1RLOA 3VSBA 1W2HA 4Q3NA 1Y3DE 4K9PA 3PI6A 2O5VA 1S0UA 2BM0A 3ABZA 4EL0A 3FRHA 2PTGA 3A6DA 2VSNA 2PHZA 3O8DA 4Y9TA 5KPDA 4OB7A 1EE9A 2ADMA 3EAFA 4HDNA 5M3BA 5BYKA 1V6AA 3SC3A 1M1NA 2QUAA 3M4ZA 4QM6A 2JJ8A 1EEHA 3DP9A 1IQPA 3G0GA 5LQSA 1U7OA 4OSPA 5KPJA 1RQLA 4U7JA 1EIZA 1SXQA 1ZGZA 2XKBA 2IYSA 1W88B 3GZ4A 5EJ6A 1K4MA 1GTRA 1T2VA 4Q18A 4MKHA 2EJVA 3ZGXA 5BRJA 1RHRA 2CNLA 3QEKA 3PTAA 1UIRA 3ICCA 3CUVA 3RAFC 2IYQA 2SHKA 2A0YA 2QE6A 2HCFA 3PNYA 3R8FA 2XLBA 1U31A 3HYRA 4L0QA 1KDZA 4ZGGA 1G291 4BVFA 4JJZA 3E9NA 3RYIB 1XBTA 4Y9DA 3VZSA 2OZLA 1NV9A 4X6LA 2Z9CA 3RWOA 2C8VA 5K8UA 1ORRA 4MYTA 1VKHA 3PE3A 1LEHA 3PHIA 2JHPA 4BTLA 5D1HA 2CKMA 1A77A 1D1SA 1RI3A 1IEXA 3REFA 4PZPA 1Y9ZA 1TO1E 2EDCA 4DNOA 1LQUA 2HPZA 1K08A 2NN3C 4LOHA 4UZFA 3KKQA 5F2OA 4BEBA 2F1KA 2BY4A 3DKIA 1HYBA 2PIAA 3C5VA 4DA0A 3P27A 2C7VA 2E2WA 4UC0A 4AP6A 4RQTA 1BKSB 3FF1A 2IUTA 1FMLA 3IYLW 2R00C 2IJGX 1AQNA 5AJZA 4K6GA 4M9ZA 2AW5A 2XH8A 3CRVA 4Y1GA 1ZM2A 3FR7A 4I3GA 4G0UA 1IOLA 2J48A 3WLFA 4CRWB 1LF5A 1HE1C 1QOZA 2XWBF 3GJXC 4HPWA 3SF8B 3V9AA 1W75A 3E48A 3GXOA 1XRRA 4H6XA 3ETEA 2HUNA 1CNMA 5AOBA 5EGSA 4Q47A 3L8FA 2IDMA 4JI7B 2BM8A 1YK1A 7AT1A 3EZYA 4RXUA 2Z5VA 3NM6B 3CRQA 1H2RS 2NUTB 5K0EA 2B99A 3H04A 3AEUB 4G5OA 1ESNA 4ETWA 3N76A 4S1PA 1UP4A 1T26A 3HKEB 3SGLA 3S44A 5K3DA 2WAMA 3N53A 2OP1A 3L6BA 1XU7A 3MUOA 4BL5A 2JFXA 3CGGA 2JCYA 4CN8A 4LVUA 3L8YA 2VL7A 2XQGA 2IEAA 4OJTA 4TMZA 5IH3A 1MNQA 4F1JA 3BFVA 1GCIA 1T5HX 3DZFA 1P0PA 3T7TA 2O6HA 4B0OA 5JYBA 2HRZA 4FGUA 2WA2A 1KNXA 2Q2QA 3DE1X 5LLDA 1SC9A 2ZTSA 1SK8A 1X8KA 3QV2A 1KTIA 2LNDA 2C5EA 3TL6A 1GT91 3FNQA 4CLRB 2BT4A 1FUYB 1K6JA 4OYYA 3K32A 5CDFA 3QWAA 2I7DA 1QQTA 2VJLA 2SECE 1W8IA 2PD3A 3K0SA 1I8TA 2C5SA 3HB9A 4DJJA 4YDHB 1Y42X 3C3PA 1J99A 4A6DA 1VC2A 5CFRA 2YHUA 4XSGA 3O2SB 3ZYZA 4X63A 3SAJA 3W2TA 4G0ZA 1ZVVA 4N48A 1VIAA 4J1TC 3DZIA 4P38A 1N9GB 1XCOA 1E5DA 9LDTA 3PEEA 4F4DA 2RGWA 1N0WA 2EFDB 3PNVA 4GRDA 4Z9XA 2YHSA 3HI4A 3ZGOA 3GC6A 5KYWB 1WUTA 3Q88A 4RY9A 2CF5A 3L01A 3G7SA 5HQ3A 2C0PA 1AO3A 2GF9A 3TG2A 4WA8A 5JWHA 1QGZA 1ZUNB 2J3IA 5CCXA 3H5RA 5SZKB 4U0KA 4NG5A 4TMWA 5L7YA 3KCQA 5TF0A 2OB2A 4ZIRB 4E5MA 1K6MA 1K0UA 2VOEA 5IAGA 3VI3B 1HZZA 2IK8A 1ODLA 4EG3A 2DLDA 2YZMA 2NTNA 3C3XA 1KE1A 4D44A 3RYHA 1D4ZA 1YGPA 2GO1A 4KACA 2FSGA 4L85A 3KXLA 4LE0A 4HDAA 4BX3A 4MV9A 4FFSA 2A84A 1IVYA 1V35A 1V1RA 2V0GA 4KQXA 1MBZA 4JKOA 3RUEA 2YHBA 4EG5A 3PXAA 1ECPA 2B0JA 3N8NA 4MYCA 3KD3A 3F98A 4G25A 4HF7A 3Q2OA 4CUZA 1OYYA 1OZAA 1Y3IA 2F1IA 3MWJA 5ALMA 1PKXA 3TR5A 2V5UA 5BWNA 1RXVA 3VHQA 1H42A 1ZFNA 1FNSA 5EL0A 2P2YA 3HEAA 1UC4B 3PDJA 5GAJA 3AU8A 3WMEA 3GR6A 3E4DA 1ZNYA 2GFQA 3MS4A 1BHO1 4IMJB 3Q12A 1HE4A 2PIDA 3C7TA 4WL0A 3SX0A 3SVLA 2IYFA 3H9GA 4MUHA 2X0IA 2XMPA 1XEWX 4B4OA 3WO1A 3KOWA 3L06A 4IX9A 4RHUA 2FCAA 1JBEA 2AXNA 3SQNA 3ZKAA 3QX8A 3V7NA 2PN1A 1AK1A 1KYZA 2EGUA 2PR7A 3HZRA 5F98A 2WM8A 3SXJA 4OA8A 1P1JA 4AICA 3EZLA 3ZD6A 3WYAA 2NXCA 4S12A 1SD1A 4RYLA 1REQB 3QQPA 4YJ2F 1N1GA 1LLDA 2ZJFA 5ERGB 1Q7CA 1GR1A 4GXTA 5BN3A 1DLJA 3E03A 2L2QA 2MDTA 1T1EA 4RLFA 1OGJA 1U7TA 3LP6A 3UK1A 4A9AA 5KQMA 3KE9A 1L3BA 3M9XA 3G8YA 4X84A 5U4XA 4AY4A 5MFPA 1KEEA 1KS9A 5J2TA 3AYXB 2NADA 2FKNA 4RFSA 4KHPB 1E7QA 1JB9A 2IHJA 3GGDA 4HXFB 3BQNB 1KYIA 1O3YA 2IZ6A 2PX0A 1XHEA 1YZQA 2VHVA 1MDBA 2H11A 4FQ7A 4HWKA 4IJQA 1YONA 3S8MA 4DCSA 5TLSA 4MKRA 3A4MA 2A9JA 4XARA 4FGWA 1R0XA 3Q3IA 2EEPA 4EKNB 4ND1A 3IHWA 5LN1A 4CG2A 1ULUA 3O95A 3UG6A 3PXXA 3DT8A 4DCTA 2YJGA 3HEBA 1YIDA 2QRUA 5IKOA 2HJ9A 4YYEA 4X54A 3G2OA 1VHLA 2ZVQX 4G0NA 1Z7GA 3E8SA 4MEBA 2IA5A 1Z6ZA 4ER6A 1VCOA 1PDVA 4FIZA 2H1CA 1X9GA 2QN8A 2RHTA 4KK3A 4NQZA 4AF6A 1TK3A 3DC2A 3C6YA 1ZM4A 4FMBB 3ESZA 3R3WA 1B93A 4UAVA 3D5EA 4FOTA 1JFRA 1ARZA 4YR9A 3VR0A 2NQTA 2PD6A 5B6PA 3GGSA 4G8JA 5KTRA 1GL7A 2YJNA 5CA1A 2HHJA 4AMUA 1P2GA 1A7UA 3C5CA 1YI8A 2JAWA 2Q9UA 3FTQA 1IVNA 3G9TA 2NUAB 3RS9A 1G3UA 5BV8A 5C8YB 1RI5A 3AVWA 1RRFA 1MAWA 2OWDA 2HRQA 4BMDA 4IUBS 4WXPA 3QU4A 2OBXA 4IM7A 3OKPA 2IHUA 1JG2A 4US0R 2D5BA 3MWEA 1HEUA 1YZ3A 2P3SA 3JRWA 1XYGA 3PPWA 4WW0A 1T3TA 3GLGE 1NQ5A 2YCLA 4N5DA 5C80A 1GTMA 2GBFA 3NTOA 4N0DA 5D01A 5EMNA 1WL8A 2AE1A 2V7GA 1Q1GA 4PE5B 4S2EA 5JQGF 1BQEA 1XF9A 3VUEA 2C3UA 1H9CA 3F7TA 2E5FA 2Q1TA 4B6PA 5D84A 2IC5A 4IRXA 2I03A 1U0NA 2Y67A 3TBFA 4ZCQA 5F9HA 5KDOA 3CTMA 1YRBA 2LUOA 4Z4EA 5B1SA 1XMJA 2GJSA 3NATA 4OKSA 4CI9A 4BXOA 3AL0C 3D7NA 3KHTA 4L1KA 1V7CA 2CCGA 3A10A 1BXGB 1AUPA 3PT9A 1P6QA 1SXJD 2OPBA 3QF7A 5G40A 5AVVA 3HTXA 4JOCA 2JGDA 2XWJI 5AXAA 1QS0A 4CLDA 2F8TA 4Z86A 3WVNA 5K7SA 4N7JA 1UAYA 2MYTA 2QE7D 2Y3IA 1GUDA 1SN7A 2Z83A 3BWCA 3PSAA 2D1RA 4WGGA 2KBEA 2Y05A 1ZU4A 3AFMA 4MW9A 1FE8A 4X90A 5IUJC 5CX1B 1GNSA 1CJMA 1CS0B 4XH9B 3USES 1J22A 4QDOA 3LLUA 5B4UA 1NXXA 2XMCA 5JVDA 4JLPA 5JSYA 3AF0A 1XP8A 4TLEA 3HO6A 4G8BA 3OE5A 4OMCA 4B6EA 4ALNA 4QQNA 1WQ3A 1QB8A 4ZU1X 1T5OA 2C5AA 3WWCA 2DLCX 1RWVA 3A1TA 4MGHA 2J41A 4ZKEA 3GFFA 4RKFA 4QTYA 1EGQA 1Z7WA 1SB8A 4Q00A 3T1YB 2H1OA 4D82A 4D74A 4HN9A 3QWFA 3KZKA 1C7EA 3IESA 3L5KA 1U3VA 1QVAA 1JDSA 3OBBA 1SURA 5F5XA 5B7QA 2AVDA 4XWOA 1YL5A 3PUIA 4X5OA 1N6NA 1Z8HA 1W0JA 2V1XA 3I73A 3JQ9A 5F1OA 4CKCA 3QI2A 4DLSA 4B35A 2RHWA 3TINA 3UT5A 5BWOA 3SM3A 1NM5A 1XJCA 3R44A 2VDRB 1CEEA 1S01A 3KYDB 1GN9A 4ZEOA 1E6CA 3UOGA 4B6FA 3LS2A 5AM2A 4IQGA 3P9NA 2CWWA 4UTOA 4QAQA 4NMMA 1UDWA 3KL2A 1G6KA 1NM5C 3O3CA 2A33A 4DDKA 2PRSA 3QXCA 3V2UA 5IEJA 4Q9IA 1H4SA 1JPVA 3HGMA 2O8CB 1E2FA 1C1DB 3FETA 3IT3A 1Z2OX 3GCDA 3QXXA 4CQLA 1OXSC 5JFTA 1X7HA 3LH5A 5KBYA 1YA6A 1CEYA 1MC1A 1FK8A 2YASA 4AM8A 4NAHA 1RCTE 4UDNA 4JLMA 4C0JA 1QLHA 1ZITA 3UAGA 3MLBA 4P4TA 1DWUA 2EZTA 2JBAA 3THYA 4R9NA 1JBKA 5BT9A 1EM8A 1TM4E 1J2TA 1GSIA 2VTEA 1AKVA 3R3ZA 4DSNA 2R6AA 1UDAA 1KK0A 2P7HA 2W2NA 1R6DA 2PJZA 4N8DA 5B2EA 5BW5A 5IJ9B 5ALRA 1WA5A 1W59A 1J49A 3M1AA 3A05A 3TW8A 4YMGA 5JS1A 1YDHA 1OPXA 3KQQA 1T9AA 4BWVA 4D9BA 2W00A 1DBQA 1D2MA 2Q4EA 4TS3A 2ZYIA 2ZBFA 1DC3A 2ZBDA 1WXQA 2X2OA 1RSZA 4TGLA 2SBTA 1UM9B 1JAZA 1QAOA 2GEJA 3B1JA 1OAOC 1YJXA 5BN5A 3VJLA 4YFYA 1EZ1A 1H3FA 1D4AA 3QBDA 3O4FA 1V8FA 1ZO8A 3VYUB 2FPPA 4LNHA 4RDXA 5KYYB 5LU9A 4QTUB 1UM9A 3D2AA 4XJVA 4F0JA 3QVKA 5I4BA 4RL6A 5KSPA 1D6MA 3GRRA 3NX4A 5GONB 2JGIA 2G09A 3U5TA 3I04M 4R1SA 3ZEIA 1M74A 4LSWA 3TVYA 2GA8A 4TVSA 2PBLA 2HZBA 2BFBB 3TSAA 4GW3A 4UBOA 1VE5A 3TQIA 1KZ7B 2DR3A 4B71A 1VTKA 3RS5A 4EG7A 3IUMA 2Y6VA 1T29A 2X4DA 1C2TA 1NUAA 2O2IA 2ACWA 2YWJA 1ISHA 3I0MA 3QFFA 3PENA 1DBWA 4KMSA 4MRVA 4DQDA 3H87A 4KPYA 2ZIUB 1TJ4A 3ER6A 1TKRA 3RG2A 2H8KA 1VPTA 1LZKA 2HJGA 3NWBA 3Q2IA 1FJHA 4KO1S 4QLAA 1LVGA 1M2FA 3IP1A 1L5NA 1USKA 3CLSD 1FYWA 3BWYA 4IL5A 3I1FA 4Z1MD 4QM7A 3JYPA 2O2YA 3HJNA 3LT4A 5F9MA 4ZV9A 3DVLA 1U7UA 2IOFA 1Z2NX 3S81A 2AJ8A 9MHTA 5JTUA 5HTKA 5DHRA 2WYVA 1NI4A 3GLTA 4C0XA 1TE2A 4DWWA 1JXAA 1E9SA 3QEOA 4G4GA 5KTSA 1EK6A 4ABYA 1E69A 2BKVA 5EMMA 1QUEA 5FPHA 1MG0A 4DMLA 4P86A 4B4UA 1HTTA 5JHHB 4BLPA 4EAQA 4DUZB 1YO6A 4JU8A 4GLJA 2YQ4A 3BE8A 5ALQA 4YBRA 4X00A 5DN9A 4S0XA 4BKOA 2CB0A 4DB2A 4NYMR 2FVYA 4KQ2A 5HWSA 1ZIDA 2XAAA 3OUZA 3PNLA 1GG2A 3H2JA 4IQ8A 4L8LA 3QKIA 4TMFA 2ZS9A 5EE5B 4G2NA 3FRIA 1PZEA 1XTKA 5A05A 3REGA 2VQEB 4BGDA 2FR8C 2FWMX 4S05A 5FP0A 1H2XA 4X9XA 1Q1NA 1JG6A 4LRXA 3N6VA 4Q6BA 4Q6WA 3DZJA 4H7FA 2I4MA 3NBUA 3T7KA 3G0OA 1EINA 3MWYW 4V38A 1NT4A 4B85A 2GTIA 5JARA 5FTJA 5HW0A 2WWXA 5THXA 1IN4A 1EK2A 4GX1A 4YJHA 1Z5OA 2QL9A 1GARA 3L6UA 4BCDA 2W6OA 3WB2A 1ISFA 1VQ1A 3K6KA 1LI7A 1M72A 4CG3A 2A1IA 3RC7A 4BB9A 3LQ2A 4B0PA 3W3AA 3RJMA 3KSBC 2BL4A 1VKRA 4Q3CA 1M2GA 3LOPA 3T1VA 2PEYA 2PBFA 4AG3A 2ZRHA 1B23P 5JAZA