3PEFA

Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
287
structure length
286
Chain Sequence
SQKFGFIGLGIMGSAMAKNLVKAGCSVTIWNRSPEKAEELAALGAERAATPEVVESCPVTFAMLADPAAAEEVCFGKHGVLEGIGEGRGYVDMSTVDPATSQRIGVAVVAKGGRFLEAPVSGSKKPAEDGTLIILAAGDRNLYDEAMPGFEKMGKKIIHLGDVGKGAEMKLVVNMVMGGMMACFCEGLALGEKAGLATDAILDVIGAGAMANPMFALKGGLIRDRNFAPAFPLKHMQKDLRLAVALGDRVGQPLVASAAANELFKGARAAGFGDEDFSAIFKTYER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, NAD-binding
publication title Structural characterization of a beta-hydroxyacid dehydrogenase from Geobacter sulfurreducens and Geobacter metallireducens with succinic semialdehyde reductase activity.
pubmed doi rcsb
source organism Geobacter metallireducens
molecule tags Oxidoreductase
total genus 117
structure length 286
sequence length 287
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3pefA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pefA01
5TQVA 3NDJA 2RAFA 2ZK7A 4BB6A 4CM9D 4J7UA 4R54A 3QIVA 1LDMA 4PLCA 1R4NB 3DFZA 4FFPA 4TSKA 3HNPA 1F12A 3MEQA 2VYVD 3RJ5A 2D5AA 1MV8A 1DAOA 3TN7A 4ND3A 2W2KB 4YTEA 5I7SA 2OGUA 2VT2A 1GR0A 5T8KA 5BNIA 2PLAA 4IDDA 4A26A 2I3GA 1OC4A 3NAQA 1P1HA 4XYBA 4PLZA 1EK6A 4M86A 1ID1A 2VTDA 3GNSA 5A02A 4EUHA 3VDQA 4GGOA 2W2LA 5JDCC 3ITDA 1U3TA 2IE0A 4CODB 4YB8A 3TQHA 3QLJA 5JDIC 1PJTA 1GU7A 1CJCA 1WDMA 1MC5A 3KYBA 2AXQA 3S2GA 4QTZA 3LYLA 4PLGA 1OBFO 1CF2O 1KVTA 3TF5A 4NBRA 2EHDA 1A4UA 3DZGA 1SAYA 1F17A 3UCFA 4C7KA 2C5AA 3JD4A 3EW7A 4DBVO 4CMHA 1E5QA 3PDUA 3VPXA 4UVGA 4B7UA 3ONEA 3A4VA 1E1KA 3ULKA 1EVIA 1XIVA 2BH9A 4O5OA 1GFSA 5ENVA 4CM1A 1MG5A 2NADA 3LZ6A 4ZQEA 3FBTA 3KEQA 3SLKA 5L7YA 4ILKA 3AUUA 4J1SA 4ZJUA 4XYMA 3Q3CA 2I6TA 1F0YA 3GDFA 1N7GA 5IZCA 1HYHA 1V35A 2HO5A 1J4AA 3RAJA 5AYVA 1XYGA 4ZD6A 3GY0A 1NR1A 3ZNPA 1C1DA 5KJ1A 1SOVA 3DAGA 3OHSX 5IXSA 2GR9A 4PLHA 1BHSA 5JYDA 2PD3A 2DU8A 3OA0A 2BLLA 4UVIA 3NX4A 4BGUA 3NYWA 4FR5A 4PG7A 1IZ0A 1M76A 1QYWA 3PTZA 1R0KA 3K30A 3L6DA 3LT2A 3RIHA 4O63O 4J91A 4Z6KA 3I4CA 1O9BA 1U1IA 3FN4A 5JLAA 3DHNA 3STHA 3GVCA 2F00A 1SEPA 1VL6A 1ZO8A 1LC0A 1L7DA 2PZKA 5TSDA 3IL2A 4PLFA 1PGQA 1W6UA 3E1KA 2LDBA 4LVUA 4P4GA 2JAPA 4IQ0A 3JTMA 3OIFA 1J5PA 1RM3A 2HRBA 1X1EA 4IXWA 2AA3A 2VNAA 3FHLA 3H9GA 3ONDA 4BV8A 3DEYX 4RLSA 3KB6A 4G2NA 3BMOB 4GH5A 2Y1GA 4CPDA 4DQXA 3PWSA 1ZCJA 1VSVA 2DBVO 3DO5A 4W4TA 3I52A 4L74A 4WLVA 3GEDA 2NTJA 3E9NA 3GFBA 4JP2A 1JDJA 2XF8A 2HUNA 1X7DA 1P1FA 4WLNA 5JXWA 3L4BC 4BIIA 2JCYA 1NHGA 4E5KA 1T4DA 1PQWA 5AOVA 4A2CA 4OL9A 1G1AA 2CY0A 2Y1DA 3GF4A 5I7EA 4Z0PA 1WDLA 1FK8A 3AM4A 1WP4A 3LSYA 1LSUA 1WMAA 3PK0A 4M1QA 4JBIA 4GL4A 1HLDA 5DP2A 3AOEC 4NBUA 1IYZA 5JAQA 3SX2A 4BB5A 1G0OA 3M2TA 3HFGA 3PZRA 1JWBB 1ZEMA 4CV2A 4BNIA 4KUHA 3MWEB 2VWPA 4ND5A 2P9GA 3ZGYA 2VQ3A 2YY7A 5DBFA 2VTEA 3WQRA 4E2YA 5JY6A 1LEHA 4YT5A 4Q3DA 1XHLA 1O95A 1WMBA 1O5IA 4OXKA 3GHHA 1ENOA 3IUSA 1E1NA 2ZYGA 4IIUA 3RBZA 1ULUA 4M8SA 1TVEA 4D46A 5CDYA 3PWZA 4IMPA 4Z0TA 2YHIB 1LDGA 2CUKA 4KP7A 4ZA2A 2NU6A 3VKVA 3H5AA 1YXMA 2X9GA 3OJFA 2G1UA 1TLTA 3U49A 5L4NA 1KETA 1DC4A 4E21A 4YQYA 2TMDA 1ADCA 4MJLA 5DCUA 4I5DA 3DOJA 4AICA 1UP7A 4E5NA 2P4QA 1YB1A 3VH2A 1YDEA 4R68A 4CM4A 2XPCA 3CXRA 4BQRA 2IXAA 1I0ZA 1Y8RB 1A72A 4RORA 1KEVA 1NQAO 4D7AA 1EFLA 2HMUA 1A27A 3Q0EA 3DFUA 2Q2VA 3ZN2A 1X7GA 2IZZA 1QYVA 5EERA 3TOZA 4NFSA 2Y05A 1GQ2A 3BXXA 3OJOA 2C59A 4IUYA 4QFDA 4TRMA 4B7XA 3Q9UA 4U6SA 3JQCA 1N1EA 2X8LA 4GGPA 3ZWXA 1EFKA 4J1NA 5MGBA 3ETDA 1GUYA 3DL2A 1HKUA 4XQGA 3WWYA 2O4CA 1YH3A 2EP7A 4CUJA 3H3JA 1CERA 5DOVA 5U1PA 1RKXA 4B8ZA 4PCVA 3NJ8A 2YV3A 3IOYA 5COQA 4E31A 4JK3A 4J49A 4PLTA 1B7GO 4A73A 4XGKA 1LSJA 1D8AA 2X9VA 3GMSA 3DXFA 4IGEA 4FJ2A 1PJ2A 4CV1A 3JQBC 1I2ZA 3OEYA 4BKOA 1L7EA 1NVGA 1BSVA 4I5FA 3ST7A 5EJ2A 4R3WA 4KUEA 3VPHA 3WQQA 1E7YA 2D5CA 1PWZA 5B12A 1BW9B 3TL2A 5IDXA 4Q39A 2NSDA 4ALIA 1MLDA 3JD2A 4BNKA 2GGSA 3H9QA 2Q4EA 1A4IA 3KLPX 9LDBA 4MKRA 1XKQA 4NPCA 3ZU4A 1LSSA 2VZ9A 1I24A 4J90A 4CM8B 2EW2A 4OAQA 4ZQGA 1LQUA 2CMDA 3TSCA 3C1AA 1Z74A 2EERA 3DBLA 2OORA 1HDGO 4Y98A 4TRNA 4DGSA 4I9UA 1I36A 1NVTA 4XR4A 1EDZA 4ALJA 2A9FA 2VYNA 5TRTA 1OZAA 4GKVA 4N5LA 3FPCA 4N18A 3E8XA 4WECA 5KVCA 3ITKA 3WGQA 3WR5A 2PKQP 4BNTA 4GX2A 1Y81A 5JPIA 4MIEA 4LGVA 4BL5A 4CR6A 3PIIA 3LK7A 2UUPA 1BDMA 1EQUA 2JFHA 3FNEA 1LBEA 1Q7CA 3I9LA 2AHRA 4YAGA 5EIOA 4WLOA 1EMDA 1H6BA 3L77A 4BO9A 5CP8A 1FF9A 4NBVA 3RC7A 1TEHA 4FJ1A 3W4JA 3WOHA 2JJYA 3I4FA 2GRAA 1Q7GA 4M54A 1E6UA 5K6AA 1NX6A 3TWOA 4EJMA 4Q3AA 1PEDA 3G49A 1YOVB 4EZBA 2FOIA 3PRJA 1ISIA 1SBYA 3B70A 2V6MA 4K9DA 3WJ7A 3N7UA 1BRMA 1ZSYA 5AXDA 1IZ9A 1EVJA 4WLEA 4Q3EA 3DHEA 3UKOA 4MOWA 2HK7A 4QXMA 1C1XA 3DONA 4YCAA 4CLOB 4Q3NA 3FSRA 3GRKA 3VH1A 2VUUA 4LRTB 2DPHA 4E33A 4EGFA 1NPDA 2PKRA 3A14A 3S2IA 3E18A 2D0IA 3U09A 1DFHA 4KUGA 4Z3KA 1R4NA 2GN8A 3LT1A 1T2CA 4H16A 2W2KA 3DMTA 1PU2A 4G81A 4OGWA 1CQIA 4UVHA 3ETEA 3VOSA 4DRYA 1RM0A 2GASA 3PFFA 5IG2A 1AXGA 3IP1A 1F8GA 1VC2A 2OFPA 2B37A 2Y1EA 4I9NA 4LCJA 3WBFA 2JHFA 5U9CA 3PGXA 5EQDA 4DMLA 4AJJA 3D4OA 3A06A 1CIVA 3HFSA 3ZV3A 1H6AA 1HF3A 3S8MA 2DAPA 4JX8A 5ER9A 1PJQA 1AHHA 5LCXA 3GGGA 5JW6A 2FRDA 2ZTLA 2PA3A 4IQ8A 4OSPA 5HS4A 3GPDG 1YBVA 4LCEA 4U7WA 5ITVA 3RD5A 2YQ5A 3S2FA 5JDCA 1JN0A 3IKVA 3LU1A 1LLDA 1DJQA 1H2HA 3GR6A 2DTXA 4XGNA 5KIAA 1E3IA 2VWHA 3BMNA 4NK5A 1BXKA 4ZRMA 1VL0A 1PJBA 3F5QA 3Q2KA 4BNUA 1UZLA 3AOGA 5JDIA 4YRDA 3ADPA 5TX7A 5TJ9A 3WGHA 1KY5A 2VWGA 3O03A 3ASVA 3BAZA 4J1TA 5I7VA 1ADGA 1Q2XA 3ZWNA 1YL5A 2PKQO 3OETA 1WZEA 5DF1A 1CEQA 4PLWA 1X0VA 4A7PA 4UEKA 4JIGA 4BNVA 4FS3A 5JY1A 1MG0A 1KOLA 1HEUA 3QWBA 4NU5A 1XELA 3AU9A 1DBVO 1E5LA 1F06A 3O38A 5JMWA 5A1TA 4KWIA 2D2IA 3CKYA 1WW8A 2HK8A 2NVUB 3P19A 3W4IA 3FTNA 4XKJA 1E7MA 6ADHA 1ZJYA 4B7CA 3E5MA 1PL8A 4WNIA 4KQWA 3K8ZA 1R6DA 4EITA 4CL8A 2P5YA 4O1MA 1PIWA 5KVQA 3QW2A 2CDCA 1GZ3A 4XYLA 3GHYA 4IS2A 2ZCUA 1DIHA 1R66A 5HS6A 2VHXA 2E82A 3K2BA 5F5LA 1Z82A 2WJPA 4DA9A 3UOGA 2W90A 3I9KA 3SJUA 5A3JA 1DIRA 3IJPA 1M67A 4UEOA 4RDIA 5G4LA 4MVJD 3U0BA 2P4HX 3BMOA 2HKIA 4KMSA 4BS9A 5FEUA 1GYRA 1C3VA 1HZJA 2O3UA 1N92A 4MVJH 4YAIA 3F1LA 4B4OA 5DN9A 1T2DA 4RF5A 4GSLA 1QYCA 3O26A 1V3TA 2GNAA 1GTMA 2OP0A 5CEEA 1ZIDA 5TIIA 2X23A 3KSUA 2C54A 2QZZA 4RF2A 2NQTA 3U5TA 1N5DA 4CV0A 4DIFA 5JC1A 4HBGA 3ZDFA 3L9WA 3VKUA 1DIAA 4CLRB 2RBEA 3IS3A 5DP1A 1JU9A 2YDXA 3FNGA 3NTQA 3P2OA 4GBJA 2Y99A 4I5GA 2J5RA 1GAEO 2HAEA 1E3WA 1HYEA 3OP4A 4BO6A 3DB2A 2GZ3A 5A06A 4GMGA 5EMHA 2DKNA 3ZWPA 3MJEA 4BNGA 4DREA 2I3AA 4W82A 3X2EA 1NYTA 4IY1A 3TZKA 5KOIA 1AHIA 3L4BA 4E2WA 1WDKA 3NUGA 5EQFA 2BFOA 5ILOA 5A05A 1VRWA 2C2YA 4X54A 2PGJA 2BI7A 1I3KA 3D5TA 2I67A 1IB6A 5BR7A 4YBZA 2YHUA 3BTVA 1B3BA 3ONFA 3WGOA 3ZU3A 1UR5A 3QSGA 4HWKA 2RHRA 2V6BA 3DZHA 3AUAA 3GUCA 4BKUA 3HDJA 3WFIA 2GO1A 3D7LA 4EEXA 1FJHA 2I9PA 2YDYA 2C82A 5JCXA 1N2SA 3HG7A 3INRA 4XJTA 4J1QA 3WIEA 4D3DA 3CSDA 4RV9A 1GY8A 1NASA 2PWZA 5AVOA 5DDIP 3K96A 4IDCA 5IJZA 4R5MA 4BKQA 5KJEA 4FOSA 1KIFA 3U62A 3MJSA 1PGNA 2JAHA 3E03A 1MXFA 1C14A 1Y8RA 2DQ4A 3C8MA 3FWZA 3TNLA 1ZSNA 2GUGA 3NKLA 5HBRA 1HE5A 3PLNA 1LNQA 4MKXA 4CQMD 3F1KA 2IYOA 4GI2A 5HM8A 1V6AA 2OP1A 3OIGA 2X5OA 4RVDA 3CINA 3WGIA 1YL7A 1EE9A 1R16A 2W2LD 4RPLA 1YRLA 3DBLB 1PGOA 4RQTA 3GG9A 4IDFA 4QT0A 4BMVA 3V8BA 5H83A 5KJ6A 3UF0A 1XDWA 4Z9YA 3WMWA 1TT5A 2G17A 4BMNA 2HDHA 3FR8A 5G4KB 3PGJA 2ZYAA 1Z73A 2CNBA 5TT1A 4AJLA 2JFGA 4YAKA 4XYEA 2W8ZA 5K6AC 5DBIA 1DIBA 1PR9A 2OMEA 1BXZA 5JSFA 4GVXA 1UUFA 4RL6A 3Q6IA 4XDZA 4YJDA 3G17A 1BW9A 2VZ0A 4DIOA 3HSKA 1SB8A 3B1FA 1P1RA 4BO3A 1NFRA 3JQBA 4ZU3A 4EEZA 4MVJF 4OQYA 5CAEA 4WEOA 3NTRA 3PXXA 4Y6PA 4CM8A 3GLQA 2NTNA 4B8WA 1T24A 4DBZA 2FMUA 1E6WA 1N1GA 4BO7A 1A7AA 3GVIA 4NJMB 3GZNB 3JYNA 3WG9A 2BKAA 1KEWA 3KYCA 1C0KA 2C07A 2DTEA 3ENNA 3ZWVA 4XR9A 1Z45A 5BSGA 4KOAA 2AW5A 2Q50A 3RBXA 3D64A 1ZMTA 3PQDA 2FWMX 3KETA 3JQ9C 1OAAA 3GVPA 4F6CA 3HDQA 2F1KA 1DRUA 3GUYA 1EUCA 4CM6A 5KJCA 1YQDA 3DMTC 4CUZA 4IMRA 1YL6A 4BNNA 1GEEA 2DLDA 3C24A 5JCJD 3K92A 3PEFA 3OJLA 4GKBA 4WLUA 3DAPA 3I5MA 1IUKA 4FD3A 3WYCA 4RO0A 1HXHA 1JVSA 4BNFA 4CM3A 2AEMA 1KVSA 3DOCA 1O8CA 4BVAA 1LUAA 1E7RA 4ALKA 3L9XA 1M75A 4GLLA 2FPIA 3S55A 4ID9A 4J7XA 3K9QO 2HCTA 1YOVA 3GC6A 3PJFA 3D3EA 2IEBA 3KRTA 1FXSA 2ZB8A 1ZMOA 3KO8A 4JJIA 2UAGA 4OOEA 4Q3CA 3Q1LA 1H9BA 1ISMA 4MDHA 3PQFA 4AJHA 4W99A 5F1OA 1YB4A 1ZK2A 4CLOA 2D4AA 3MTGA 1HTBA 2WSBA 5L7WA 2AQIA 3JQAB 4IJUA 3ZHYA 2PZJA 3JD1A 2B5WA 4FFRA 4WPGA 5ENDA 5K9ZA 3ZU2A 2C7GA 2ZCVA 2O7SA 5DNAA 2HJRA 3RVDA 1LX6A 4URFA 1VKOA 2BGMA 3C1TA 3BMNB 3RQSA 1WVGA 3L07A 4NZ9A 3VH4A 3KEOA 2IRWA 1MUUA 4ZVVA 1RWBA 4XCVA 4E6PA 4D44A 3TZCA 3E5RA 1HYGA 1XU7A 4N5MA 4IM7A 2X5KO 5IAAA 2V7PA 2OHXA 2VWQA 2GYYA 1ENPA 1ARZA 1ISHA 3DZKA 1TB4A 1XQ1A 2IZ1A 1U4OA 3PWKA 4BNLA 1M2WA 2Q1SA 2DPGA 2O3QA 2NQ8A 5DT9A 3JD3A 1LC3A 1WZIA 4DPMA 3RCBA 5AXAA 3I3OA 4BGIA 5KKAA 3EK2A 2QX7A 5I9MA 4RF4A 3BMCB 1CYDA 3CMMA 3KZVA 3EZYA 4PG8A 1HDOA 3PVZA 4D0SA 1S7CA 1GUZA 2Q1WA 3AY7A 1KEUA 4EW6A 1JVBA 2RHCA 2IEDA 2EJWA 4LRSB 4WKGA 4MVJE 1OI7A 4E30A 5CFZA 1HSOA 3LLVA 2J3HA 1C0PA 2X0NA 2C0CA 4NK4A 2XOXA 4RVFA 1EUDA 4YACA 1YS4A 2AE2A 2GN9A 4WGGA 4GMFA 4A27A 1PGPA 3FPLA 4HNGA 4IBOA 5BNFA 5HA5A 2X7HA 3I9OA 3RC2A 4A10A 2PFGA 4GPD1 1ONNA 3TL3A 1GADO 4KZPA 3QHAA 2PD6A 3HE3A 4RVGA 3BA1A 2NVUA 3HHPA 3MCVA 2CVOA 1HSZA 3AUTA 3DBHA 1LSOA 2E49A 4L9RA 2X86A 3PHIA 1LRKA 5EINA 3U3XA 3OQ6A 3DTTA 3U4CA 4A5OA 4RVUA 3R3JA 3ASUA 4E13A 1Y1PA 1NPTO 4GQAA 3CUKA 1VL8A 1QR6A 3WJAA 3PJGA 3ADOA 2QYTA 1E3WB 5A04A 4J0FA 2WD7B 1T2AA 4BGVA 3JQ7A 4CLHA 1P77A 4PG6A 3RJ9A 5IN4A 3DAFA 4KQXA 2YW9A 3JQ8B 2P5UA 4WEQA 4JQCA 5K0ZA 3OFSA 3E82A 2ZB4A 5L95A 4EJ0A 2O3RA 1K89A 2D3TA 2PH3A 5JFOA 1SEVA 1KY4A 2E37A 4IGFA 4J2OA 4XZ3A 1BMDA 3CZRA 5HRUA 3JQGA 3V1TC 3K31A 2OO5A 3WGTA 4QUKA 3LC7O 3OBBA 5FF9A 2WWRA 1U2GA 1UXGA 3O9ZA 3TRIA 3FWNA 1KEPA 5BSEA 1XSEA 2VYND 3F4BA 3WXBA 4NBTA 3RFVA 4D45A 2GD1O 4J4BA 4YT4A 4F3YA 3AY6A 4CLRA 5TNXA 1YONA 3VAZA 2DC1A 4QEDA 1PJ3A 3T4XA 3MJTA 4CMGA 4NU6A 1PJ4A 4B79A 4BNZA 2ZYDA 2O2SA 3QVTA 5LDHA 1V9LA 1XGKA 2G82A 4R69A 4DLLA 2X1HA 5T64A 1N7HA 3AI2A 1U7TA 1ZBQA 3S2EA 3B20A 3ZNNA 5A5FA 3EVNA 2IYPA 2BGLA 3OMLA 2FPPA 2WYWA 4IINA 5T5QA 5IDWA 2ZKLA 1LJ8A 1B16A 3AK4A 4XYGA 2P68A 1PZGA 4WNCA 1R12A 3AM3A 4E2XA 4TRJA 2BGKA 2D1YA 1PS8A 4L76A 4IDEA 4XDYA 4B4UA 1RPNA 3ON5A 4J9VA 4GWKA 2O7QA 3WYBA 4W9NC 1TT5B 3QP9A 2Q2WA 3C7DB 3IDSA 4FFOA 2HSDA 2YYYA 3QVXA 3WSVA 3IQDB 5KCZA 3VC7A 1UDCA 3EGOA 1LRLA 4E2ZA 2BD0A 1G0NA 3M1AA 3ROQA 4R9SA 4CR7A 2Y0EA 1HDZA 1UXIA 3QWFA 3LF2A 3L4SO 4RPGA 4JLWA 3TJRA 1ML3A 1UZNA 2PGDA 1DDOA 1QMGA 3D0OA 2DBRA 4AJOA 1JKIA 1IL0A 4L0QA 1X15A 2ET6A 4WOKA 1JKFA 3IC5A 1U3WA 4ZQFA 1DAPA 2C7VA 4AJ2A 2NNLD 1HE3A 3BZUA 1LQTA 2EKLA 2FR0A 1P74A 2JCXA 1VLLA 2A4KA 3GVXA 2HLPA 3KYCB 5BSFA 1ZXBA 1VSUA 1IY8A 1E7QA 3SC6A 5F1KA 3F4LA 2W4QA 5G4KA 4Y8VA 1E3JA 8LDHA 3NT5A 4OKIA 1E92A 5ITWA 3GT0A 4FW8A 1UDBA 3MWDB 1YBAA 4EBFA 3WWZA 3ROKA 1B3RA 1Q1NA 5IN5A 5C7LO 5CEJA 1MA0A 4LMPA 5KKCA 2DBZA 1JQBA 4J16A 1B8VA 4BGEA 4HP8A 3N74A 3WBBA 1U3VA 4FBGA 1PZHA 2WYUA 4Y6SA 2A35A 1PQUA 4AJNA 1ZFNA 1NP3A 5AXCA 2FR1A 3H65A 4P4NA 3H5NA 1LA2A 2SCUA 3AUSA 3RUDA 2GN4A 5CG2A 3AW9A 1LI4A 4U6QA 4NJMA 3GZNA 1CWUA 2FR8A 2GPTA 4DLBA 3PI7A 3U9LA 4FC6A 2B4TO 2R00C 2HK9A 2VNSA 4I1IA 4BNHA 3HDHA 5C37A 2EWMA 3SEFA 4GSKA 1E77A 4K6FA 3MJCA 2EGHA 5BSHA 5CDGA 1TXGA 4WUVA 3B1JA 4FB5A 4P22A 5FI3A 3ZHBA 2E4AA 1YJ8A 1JWAB 4NR0A 4KTVE 5G0WA 2DVMA 3WB9A 2B4QA 4XA8A 1QLJA 2V65A 3JQ9A 3W8DA 5C7IO 2I66A 4D3FA 5C3MA 3W6UA 3DC2A 2B0JA 4M49A 3QWIA 3AI1A 1B26A 3QJ5A 4BNWA 3UVEA 1DEHA 1ISJA 2JKVA 1A71A 1UXKA 4XRGA 4JN6B 1KC3A 4OSOA 1F8FA 5B4TA 4QQRA 1YJQA 3I23A 1UXJA 3GN2A 3JYLA 3PHGA 4WASA 5T57A 3U4HA 2Y93A 4P38A 3Q9NA 3BIOA 4FQ8A 3VPFA 2CFCA 3QRWA 4EYEA 1FMCA 4YJHB 3H9UA 3ROPA 3JQAA 1R0SA 2GZ1A 4BHTA 2ZJ1A 3HDYA 1FDWA 3CPSA 4ALNA 1Z6ZA 4RPHA 2EGGA 1D1SA 1GEGA 4LSWA 4D42A 1RM5A 3WX0A 4KDEA 3NDRA 4MVJI 2P9CA 1GV1A 4FFMA 1EBFA 4XB1A 5DULA 2OUIA 5I7FA 3DBRB 3RU7A 4BNMA 2DBQA 1OFGA 3DWFA 1U8XX 4XIJA 1IPFA 1DRVA 4XX0A 3RC9A 4TWRA 4D79A 2R2GA 5LC1A 1JA9A 4INAA 2BFPA 1AXEA 3EZLA 3OJ0A 2QIOA 4ZQHA 4NH4A 8ADHA 2DUWA 3ORFA 1HDYA 3ICPA 2VHWA 2B69A 4PVCA 1P9LA 4IDAA 4IJKA 5I9NA 3F6YA 2X9NA 3KVOA 2ZTMA 4MVJP 4PRLA 3ZWOA 3EAGA 4EDFA 4DIBA 4XIYA 3X2FA 2CDBA 4MIYA 4R51A 1GL3A 4H7PA 4OXNA 2ZQYA 3A1NA 5EN4A 2Z1MA 1OC2A 4I8XA 4AFNA 3INTA 4K6CA 4M89A 4YXFA 5EPOA 2OBNA 4YWJA 1DC3A 4CLDA 3GDOA 3IUPA 1KVRA 4DC1A 4FJ0A 5A03A 1D1TA 3BMCA 2J3KA 3QVWA 3W1VA 2GSDA 1KC1A 3DBHB 1S6YA 3GEMA 4OXYA 3ZHZA 4P8RA 1FDTA 2EEZA 4MO2A 4N7RA 2OXIA 2Q2QA 1SOWA 5L4LA 4IZIA 5L40A 4OKNA 4IS3A 1E1MA 4GX5A 4TROA 1DB3A 1EE2A 1ZNQO 5KVVA 1X14A 2QRKA 1Y9AA 4R1NA 3JQ7B 3G79A 5JAIA 4NBWA 1Y9EA 4IJWA 2VCYA 5CPFA 2AMFA 4AJ4A 5B1YA 2HJSA 2Z5LA 3ICCA 4D3SA 3F3SA 1BVUA 2X5JO 3ZV6A 2VHZA 2NTVA 1UH5A 1W4ZA 4UUPA 3SC4A 3HB4X 2J5QA 4MP6A 3JQGB 3OSUA 1EK5A 4IDGA 5GY7A 4PZDA 1V3UA 4R4JA 2ZTUA 2WDZA 1CRWG 3UN1A 4JCOA 4R01A 1H2BA 1PWXA 4NHEA 1LU9A 5HTOA 4I5EA 1LLUA 2Y1FA 4YPOA 2H5LA 1MGOA 3HB5X 4WCFA 1SPXA 4WK6A 4E0BA 1N8KA 1Z75A 3V5NA 1XU9A 2YUTA 4LW8A 4AJEA 3ENKA 5CG1A 4JROA 2W98A 4UREA 4Z9FA 1E0DA 2Q49A 1DLJA 2WD7A 4R1TA 4PLVA 2JFFA 3DMYA 4ND1A 2YFQA 5B37A 4DLAA 1JTVA 3P5SA 2CSUA 3JQ8A 5H82A 4U0KA 4UVEA 3QVSA 1NWHA 2B35A 2AQKA 5DCYA 2GDZA 4ITUA 1TI7A 4XWYA 3OICA 1SO8A 4OYRA 4CR8A 3ANNA 3U4IA 4S1VA 1IE3A 4YVFA 3N58A 4S3MA 3VDRA 2YZ7A 3TFQA 3C7CB 2AQHA 1PJCA 1UXHA 4GWGA 1HETA 1R37A 2FPGA 4AG3A 1ULSA 9LDTA 4OHUA 3JQ6A 1PL7A 2PY6A 4R16A 1R0LA 2VRCA 3R6DA 1ZK3A 4NFYA 4XB2A 5DBGA 3RUCA 1JAYA 3MJVA 3VHRA 2TMGA 3RUFA 1F14A 2P91A 1OMOA 2I5PO 1LDYA 4YRAA 5T67A 2BELA 3RASA 2Q99A 2AEJA 4YYZA 1SCUA 1HE2A 2AE1A 3CZMA 1T1RA 4HFJA 5T6BA 3WTCA 1T1SA 2BFMA 3AFMA 1H6DA 1P0FA 4E5PA 1HDCA 4GAEA 4TZTA 1R15A 1SB9A 3PIDA 1WAMA 1YQGA 3GH3A 5B4UA 3UFXA 5CDSA 1V0JA 3QVOA 4RQUA 4RVSA 3EVTA 1GCOA 1Z7BA 1DPGA 3JQEA 1DC6A 2QG4A 5MDHA 5TF4A 1HE4A 5A9TA 2PZMA 3EUWA 4Q9NA 3HZZA 2I65A 4XJSA 2PR2A 1E7WA 4YT2A 3F46A 2X58A 3KM0A 3SJ7A 2Y66A 3FNFA 1PX0A 3CH6A 1I30A 3KSDO 3A9WA 3H8VA 1Y5RA 1CQJA 1ENZA 5JE8A 3KOUA 4EUFA 5JYEA 5L45A 4RPKA 2IXBA 2CVQA 2HMVA 3H9JA 3B1KA 4J43A 3LVFO 1O89A 2NLOA 3GN1A 4W7HA 3WMXA 4DVJA 3WSWA 4MIOA 5JMPA 3JV7A 1EVZA 3M2PA 3QA9A 4E5YA 1IHYA 4UULA 1ZK0A 3SBOA 1T4BA 3W8EA 1I10A 3WLEA 1KBZA 1EBUA 1U9JA 2EW8A 3WTBA 1MC4A 1LTHR 3H4VA 2HMTA 4JNKA 5A9SB 1D3AA 4W9NA 1EDOA 1WLYA 3LC2O 3BHMA 3GEGA 3OECA 1EEHA 2NU9A 1O0SA 2A94A 2O3TA 4OO3A 3O4RA 4B4WA 4FIZA 4NNJA 1BVRA 5KVSA 4R1SA 2QQ5A 1HRDA 4H15A 1E3EA 3NT2A 4GX1A 1GZ6A 4DMMA 5AXBA 3SVTA 2UDPA 4J3FA 3OF2A 2NUAA 4LISA 3FBGA 4N54A 1TT7A 2BF7A 5L53A 2O50A 5DOZA 5TC4A 3BHIA 5EL0A 2VT3A 3EYWA 3GDGA 3DTYA 1WNTA 2EKQA 4BKRA 1UDAA 3JQDA 2Q45A 4JJFA 3TZQA 5JAZA 1N9GB 3ANLA 1P1JA 4DWVA 2OL4A 4UAGA 5COBA 4BO2A 5IDQA 2Y67A 2D8AA 3SLGA 1B8UA 4NI5A 1XQ6A 3H5RA 2GLXA 2P2SA 1ZK1A 4U8GA 2D59A 1DXYA 2FN7A 3C3XA 4MVJG 4CMIA 1PGJA 1RYDA 5I8ZA 3RUEA 4F45A 2FHSA 1EZ4A 4U5QA 5F3RA 1R4MB 3I9JA 2POQX 1ISGA 2J3IA 3H2ZA 3K6JA 3NRCA 2CDAA 4F6LA 1FDUA 3DQPA 2P9EA 1YKFA 4DQVA 1NPYA 4ZN6A 1K6XA 1ZXLA 1QLHA 1SNYA 2PTGA 2YQ4A 3NT4A 1W0CA 5L51A 1UAYA 3QY9A 3ZWAA 4QO8A 2O23A 1T2FA 4OM8A 2Q1TA 2YFHA 2AQ8A 2C5EA 2HU2A 4QECA 4DYDA 1E1LA 1H93A 1LXCA 3OH8A 4CQMA 3F5SA 1X7HA 1XLTA 2R00A 3CIFA 4J4HA 5A3VA 3V2UA 4DTIA 5ER6A 1K3TA 1DRWA 5CPBA 3WIDA 3V2HA 1JW9B 2YV2A 1YB5A 3E48A 3GGOA 5U4QA 3WICA 2OBYA 1XG5A 2ZQZA 1KS9A 2X4GA 1DC5A 3NV9A 4HV4A 5CDTA 4HY3A 1XA0A 5JO0A 4FFNA 3UCEA 3BMQA 5FFFA 4ESOA 3D3WA 3AI3A 1IULA 1XCBA 3VZRA 1I2BA 4MVJM 3PLRA 4B3JA 2NACA 3DR3A 4PZCA 3FI9A 3RFXA 4ALMA 5IFLA 1ZJZA 4AJPA 1WPQA 4TVBA 4WE3A 4BOYA 2QRJA 4YJHA 3L6EA 2C2XA 2NV6A 4CJXA 2GN6A 2H1SA 3RKUA 1C0IA 4FGWA 2PK3A 3HJAA 4Y6RA 1DJNA 3JQFA 4CMAA 1EQ2A 3ZW8A 1ADFA 5JAMA 5DZSA 3UICA 2VUTA 3PPIA 1U4SA 4QX6A 2QW8A 1MFZA 1DO8A 1Q7BA 3UHAA 1UZMA 3DBRA 3E9MA 3FRJA 4Z0HO 3O8QB 1BXGA 1Y8QB 4MKZA 2OOSA 4NQZA 1DFIA 2EXXA 4YJFB 1QXSA 1D4FA 3WYEA 1BG6A 4ONEA 5LDGA 1LDEA 1M6WA 1KERA 1SMKA 2Y1OA 4FC7A 2Q46A 1NWCA 3LDHA 3GFGA 1A7KA 3HWRA 2O3SA 3OM9A 2BFAA 2JL1A 5TLSA 2GCGA 4D0RA 5JCJA 4B3IA 1QKIA 1L1FA 2QHXA 2DUUA 2EF1A 3BYZA 3W6ZA 4CM9A 4ALLA 1IHXA 1ORRA 3DZJA 5FYDA 3FD8A 4WCFC 2FP4A 4J6FA 1MB4A 3VTZA 2VYVA 1X0XA 3WNVA 1MFPA 3RUHA 1SC6A 3IAHA 3VPSA 1U2DA 1VE9A 4CLXA 1GV0A 4YRBA 4NMHA 1NM5A 3FR7A 4Z3DA 3VZQA 1AUPA 3DOOA 3C1OA 1UP4A 4OJNA 3QQPA 4OH1A 1T26A 2AG5A 5IXYA 4NDNE 5L9AA 3D1LA 4WCFB 3JYPA 3ROMA 1H9AA 4J7CA 1T25A 4DXHA 3WDSA 3EHEA 4Z9XA 4YAJA 2EIHA 2Y1CA 5CEFA 4C4OA 1PJSA 4HNHA 1QP8A 2NVBA 4WJZA 3CE6A 3DZIA 4QFCA 5I8WA 3LC1O 2NU8A 4Y67A 2B5VA 1FDSA 4WOJA 4CUKA 5CDUA 3C85A 5IZ4A 4J2HA 3RROA 4UEJA 4ZGWA 3D5QA 1H6CA 4B4VA 4R9RA 1B14A 4GVLA 1YWGO 3EY4A 4HX5A 3A28A 4EJ6A 1ZEJA 4NG5A 4IQGA 1V8BA 3UUWA 4L4XA 1JLLA 2IDZA 4BKPA 4BV9A 1YGYA 3IIEA 3VH3A 2EV9A 4W7IA 1W73A 4RJTA 3LLSA 1NQOA 1NFFA 1GPJA 4E32A 3M1LA 2FSSA 2DT5A 2BRUA 3COSA 1Y5MA 4AL4A 1I3MA 3GG2A 3NEPX 4IDBA 3NGLA 5H81A 5HWSA 3PHJA 4D41A 4MINA 1PJLA 1GCUA 4BNXA 4AJIA 1YQXA 1NNUA 4E12A 3EMKA 4J0EA 2NVWA 3IMFA 2Q3EA 4BO0A 2QYSA 1ZK4A 3KYDB 4CQLA 3H9EO 4E5MA 4KWHA 3ZNQA 2JD0A 3DBVO 3KHUA 2O48X 3KV3O 4CLEA 2DM6A 4MP3A 4XD2A 5ES3A 4YEDA 4GX0A 3D4PA 2CF5A 3C7AA 3D4NA 3KUXA 3ZWBA 1AE1A 2X0IA 1KVQA 3TFOA 2VOEA 5FI5A 1YBMA 3RUIA 4O0LA 4E4YA 1U28A 2FZEA 2FY8A 1H0KA 5AQ1A 4PZEA 1YO6A 2ZIZA 2O2YA 3KXDA 4KDFA 1QG6A 4QO7A 3RBVA 1NXQA 4K28A 1Q0LA 1QYDA 2Q1UA 4YA6A 4R41A 1I01A 4L8VA 3LT0A 2ZATA 4FOOA 4PIVA 3AU8A 1X1TA 3GZ4A 4UUMA 1U5CA 3GA0A 3JD0A 3KSZO 1NFQA 4BNJA 3QE3A 4BQPA 2HRZA 4CV3A 4EI2A 3PDJA 1GUFA 3TOXA 1CETA 4TMFA 3DZFA 1P45A 1X13A 1A9YA 5GZ3A 2PH5A 2VHVA 1ZVMA 1O94A 3MJ4A 5I9LA 4DPLA 3AWDA 3R0IA 4CMCA 4D43A 1I5RA 3GQVA 4JBGA 3VPGA 6LDHA 4DUPA 1QSGA 4FN4A 4CMEC 1HDXA 4CMBA 1O6ZA 3PYXA 3LT4A 2ZTVA 4PLYA 5CHEA 3INGA 3VZSA 4TKMA 4JP3A 3GK3A 3JQAD 4CMJA 3PJDA 1HT0A 3SXPA 1NBOA 4TQGA 1I3LA 1P31A 4BO8A 2XXBA 3Q2IA 4ND2A 3H3FA 5DCWA 1P44A 2GZ2A 2Y0DA 1HL3A 1BGVA 1I33A 3G0OA 5A9SA 1AN9A 1Q0HA 5TS3A 5IF3A 3TPCA 4JXKA 2RH8A 3UH1A 5TT0A 3F47A 4YJGB 4DL9A 1U7HA 4OMUA 2CF6A 1E7SA 5KNLA 4XQ9A 3T4EA 1GQQA 3GOHA 3I9MA 4G65A 2HMSA 5F1PA 4CMIB 1QV6A 1UP6A 5ILGA 3OIDA 4BNYA 2XAAA 1LDBA 4ZQBA 2JHGA 1QYXA 3FCOA 1QV7A 4RLHA 2JD2A 1QORA 1SZJG 2RIRA 1KYQA 3H2SA 2ZB3A 5T8KC 2WYVA 1XR3A 3OEWA 3JYQA 3L6OO 4M87A 5G0TA 5G0VA 4FPXA 4PN3A 5BT9A 3GNQA 3W4KA 2PV7A 4L73A 4DC0A 3UAGA 3ZW9A 1ZZEA 3PZBA 3I6QA 4AVYA 3WGGA 2FZWA 1N9GA 3HUDA 3ANMA 1EVYA 3KLMX 3PYMA 3ZNOA 4HFNA 4RGBA 1Y7TA 3ZV4A 3WGZA 4CQMB 1DIGA 1YDWA 4HUJA 2RH4A 3ZV5A 4WCDA 1PL6A 3GAZA 3T7EA 1B15A 1VJTA 3EC7A 4BO5A 3WNQA 3R3SA 4BO4A 4NFHA 2I76A 4LN1A 1IPEA 2VZ8A 4F46A 3PYLA 1DFGA 1NAHA 3DDNA 2G0TA 1ISFA 1R4MA 3G1UA 3W8FA 1K2WA 1HWYA 1GDHA 2QRLA 2X0JA 2PZLA 2H63A 1I8TA 4RZIA 3VZPA 1V3VA 3WS7A 1WWKA 3BMQB 3V1YA 4CM5A 4BUCA 4TRRA 4L4SA 1BTOA 1XEAA 1P3DA 2WM3A 3D3WB 5B4VA 2UVDA 3I9NA 1VI2A 3JQFC 5BQFA 2A92A 4M55A 2GERA 3F9IA 3QWAA 2Z95A 1PS0A 2V6FA 4DQUA 3JCZA 5IZCC 3B6ZA 4UUNA 1DHTA 3GAFA 3PHHA 2H9IA 4I9HA 4FCCA 3BTUA 4ROSA 1B8PA 1ONOA 3BTSA 3IJRA 3PJEA 4YAEA 3U4DA 4QSMA 3RU9A 1FDVA 4CL3A 3ABIA 5ADHA 2EP5A 1LRJA 3ZH2A 4CMKA 5ICMA 1B2LA 5C7OO 5KTKA 5THQA 1BXGB 2CVZA 4XEHA 3PQEA 4KTTE 4TVOA 1PQPA 1C1DB 3HN2A 1B0AA 4L4RA 4PG5A 5JS6A 2PD4A 4YQZA 1DSSG 1PSDA 2E48A 4HFRA 3K73O 4L75A 3WLFA 4JGBA 4MPDA 4ND4A 1D7OA 2NU7A 1YVEI 3LQFA 2PNFA 3L0DA 5F5NA 1ZW1A 1A5ZA 4I08A 1M66A 3ZCXA 1DHRA 1Q0QA 3OA2A 4C7JA 4LVCA 5L3ZA 2Z1NA 2J5KA 4IZHA 3NGXA 3QWHA 3OQBA 3KTDA 4E3ZA 2VRCD 4PVDA 2RCYA 2HQ1A 2BMAA 3AFNA 3PFWO 2J3JA 1NQTA 4LK3A 5JC8A 1VJ1A 1C0LA 1MP0A 3O8QA 1XWFA 1Y8QA 3I6IA 3HQ4O 4YT8A 1RJWA 3E6AA 4RPJA 2G5CA 4YJFA 1HLPA 4R5HA 2WEKA 1K6JA 3ZU5A 2BI8A 2NWQA 2DFVA 5A4DA 4IPTA 2Y0CA 3ZZNA 1IOLA 1DOHA 4FDAA 4K26A 3AJRA 1GPDG 1MX3A 1LLCA 3CMCO 1DLIA 3CEAA 4J9UE 3V1UA 3PP8A 4Y9DA 1GD1O 1CDOA 1I3NA 4AJ1A 3M6IA 2EJVA 4W6ZA 3ZWMA 2E6UX 2VRBA 4CM7A 3ETGA 3TZ6A 4B3HA 3S1LA 2PGLA 2V6GA 4YR9A 1J49A 5COAA 1RYEA 1K0UA 3GMDA 2IZ0A 3EDMA 1I32A 2HMWA 1UJMA 2QZ9A 4R3NA 5GMOA 2X22A 3NTOA 2R6JA 3VVBA 4J4TA 4BMSA 1U8FO 1W8DA 3UGKA 3OJEA 1VM6A 3P7MA 4HXYA 4MP8A 3FTPA 4LSMA 4XRRA 2UUOA 2ZJ0A 4P4LA 4ZHSA 1MXHA 2DTDA 5TGDA 4FGSA 4YDRA 1P1IA 5FWNA 4CQLB 3RWBA 5KJFA 1P1KA 3VVCA 4NIMA 2IODA 4TKLA 5G2OA 7MDHA 2O3JA 3GPIA 1I2CA 3H7AA 2I99A 4RDHA 3MTJA 3TZHA 3ZHXA 4PG4A 3RSHA 4DYVA 2C20A 2CD9A 3G1TA 3UXYA 4RZHA 4HFMA 5ICSA 2X6TA 2WE8A 1ZUD1 1J6UA 3HADA 4G5HA 2GF2A 4XQEA 3NJ4A 3IKTA 1GYQA 4RVHA 4PRKA 5G0UA 5KWEA 4NJOA 5F21A 2B4RO 1NQ5A 4A0SA 1NHWA 4UVDA 1PTJA 4FFLA 1GQYA 1HZZA 4CM4B 3RFTA 4FSHA 3ZWWA 4K1LA 1Y6JA 3BTOA 3HN7A 4ZICA 1M6HA 4OQZA 5BNTA 4PGFA 2X0RA 3GGPA 2BHLA 4OIMA 3T7CA 3H6KA 3K2EA 4PLPA 1ZH8A 1H94A 1UAGA 1PR3A 3KYDA 3FNHA 2XXJA 2AEFA 2CZCA 2WD8A 1PZEA 1TA4A 1AGNA 1JKJA 3AOEA 3Q11A 3AM5A 1K5HA 5GZ1A 1P33A 4H3VA 2WTBA 3QV1A 3CTMA 2O4UX 1KVUA 2B36A 1VJ0A 2WE7A 4RF3A 1J0XO 1LDNA 2ZB7A 3OQ1A 2YHIA 4TZKA 2UV8A 2EG9A 3DHYA 1ZKMA 1U5AA 2YV1A 4WLFA 3R1IA 1E3LA 2VHYA 1WXDA 5EESA 1QRRA 2G76A 4UUOA 5JO9A 2Q4BA 1JAXA 4JBHA 4II3A 1YE3A 3AY3A 2VOJA 3WGYA 1PZFA 3MOGA 2B83A 1ENYA 3RC1A 1PS9A 3UCXA 4Q3BA 4IJVA 3WQSB 4HADA 3VTFA 4JJGA 4MVJA 1NTOA 3I83A 2VN8A 1H5QA 2JD1A 3ZI0A 4XQCA 1E3SA 3P2YA 3DZBA 3KBOA 5A5EA 2Y68A 4O6VA 3LF1A 3UW3A 1NAIA 4N5NA 2UYYA 1K6IA 3JSAA 3ZWYA 2NM0A 4ZRNA 5JNLA 7ADHA 4DPKA 2H6EA 2J6IA 1T2EA 2EKPA 3RI3A 1Z7EA 1OOEA 1ZSVA 1BDBA 4U0JA 3RKRA 4O59O 3ZWCA 5A9RA 1ONPA 3GRPA 3BHJA 3GNTA 4IIVA 1HDRA 1ADBA 1NR7A 3V2GA 3MZ0A 2FSVA 2YJZA 4EUEA 5IDYA 3K5PA 3PHLA 2ILTA 5L4SA 3RUAA 5G0SA 4AJKA 1GZ4A 2WMDA 3FF4A 4HKTA 5J23A 4RCVA 1RM4A 3E9QA 4R1UA 1BWSA 4CMEA 4PFJA 4IXTA 3G3EA 1GYPA 3I1JA 5GZ6A 1VKNA 4BO1A 3WFJA 4II2A 4YJGA 5JBIA 2OZPA 4LMRA 1A9ZA 2J8ZA 2VUSA 1U3UA 4A03A 4GLOA 5C5IA 3CTVA 1LLQA 1NVMB 4OOFA 1P0CA 3NDIA 3IP3A 1EUZA 4XGIA 3TDKA 1C1XB 3GVHA 1E6EA 5TJHA 2DFDA 3JYOA 2LDXA 2AG8A 2JCVA 5L7TA 2C29D 3MOIA 1G6KA 1VPDA 5THKA
chains in the Genus database with same CATH superfamily
2RAFA 1R6AA 1RLJA 1JEDA 3M82A 5AW0A 2WWGA 3D3NA 3RJ5A 2OXCA 3HNPA 3MEQA 4XLTA 1R00A 1A95A 3L93A 4WIAA 4CKZA 1R1DA 2BEWA 3MLAA 3I05A 3QLUC 1NVKA 5SZHB 3TD6A 2VT2A 4ZANA 2QENA 2XWJI 2ZDGA 2WJGA 4YUZA 1MH1A 1YZUA 2GD6A 1G4HA 4JEIA 3IELA 2B3DA 4JJEA 4L16A 2C00A 1Q3HA 4MULA 4S24A 2PWYA 4IDDA 5A2QA 4JT2A 1TVCA 4TV8B 1COWA 1TKRA 1KIMA 1UPBA 1SUAA 4XYBA 1GNSA 3O3NB 4RD0A 3GNSA 3H42B 1NSFA 2RCNA 4EX7A 3H2JA 2Y6UA 5DGXA 3PENA 1ZOOA 3IBTA 3KJIA 3AJAA 1PNTA 1U3TA 1XAGA 2WJVA 2IE0A 1GTL1 5EOVA 3KQOA 4CODB 1ZI8A 4RK7A 4PF1A 5JDIC 1P2FA 1MAAA 1FOEB 4O08A 4HSEA 3DL0A 2F6RA 2R7MA 3LYLA 1SJ9A 3S1AB 4Y0NA 3AZQA 5DHPA 2VDLB 4UQLA 1U2RA 3B7PA 4WESA 4AMGA 2WU0A 5LNK6 3U3DA 5LXTA 3TF5A 4D9GA 3DZGA 5TPWA 3CLRD 1MC1A 3A3OA 3CCFA 2XCTB 4A9AA 3MGCA 4DY6A 3CF6R 1X1QA 5EXSA 1QUEA 3MTIA 4IICA 4UVGA 3BULA 3MMZA 3PWTA 2BH9A 2IIPA 2Z4TA 1AQNA 3PGMA 4DSAA 2C4NA 2JGFA 3K1YA 4RDCA 1G9SA 3FBTA 3KEQA 4RLQA 5L7YA 4TWAA 3QUSA 1PNRA 1NYLA 2VDJA 5EHQA 4J1SA 2VJMA 4XYMA 3Q3CA 4PE5B 2QQFA 3E8SA 2I6TA 1F0YA 4MICA 4AT1A 5IPFA 1EIZA 3GJTA 2HO5A 1KARA 3H0KA 1WQ1R 1VYHA 3I9V6 1XYGA 3O1JC 3HCNA 3UHPA 5AVUA 1UWVA 1OH8A 3GY0A 4GD3Q 1QO0A 5KJ1A 1JF8A 4MCJA 1BRTA 3KX2A 3QK7A 4Q1VA 5FR2A 2O8DB 4AKGA 2WV7A 3W5CA 1EHCA 1V1RB 2ZRMA 5IXSA 1GG2A 1T91A 5JYDA 1QG4A 2J7PD 2PD3A 4L3VA 4Y9UA 3CZCA 5EFOA 2GXAA 2QLNA 4C07A 3M1YA 4BGUA 2JK1A 2W2OA 3AKYA 1JBQA 3JPWA 3U0VA 5LQKA 4PG7A 1IZ0A 1TJYA 5CH3A 3K5IA 3C3JA 3PUKA 3VMFA 1R0KA 1ZCAA 4GI1A 3K30A 3KJQA 4LOIA 4YUXA 5EZYA 4CZ2A 4WJLA 3PEYA 1SUFA 1TM3E 2YN0A 3LT2A 3OESA 3MXTA 2W0MA 2XAUA 1EVLA 3NC0C 3K2QA 3RIHA 2RC6A 3R77A 4YUVA 4DCCA 4PSCA 4X1OA 1C9JA 2UVPB 4GI5A 3ZJYA 1VHLA 3UATA 3MD9A 1Q7TA 1SEPA 1C7JA 3HR7A 2XVYA 3D6MA 1LC0A 3OLCX 4UMFA 3TVTA 1WB5A 2GDJA 3QVGB 4G5QA 4K8OA 3FXAA 4HI0E 1C7QA 4PLFA 2WQ6A 2FSGA 3E1KA 1LJUA 4QIHA 5HRAA 2ZDHA 4Z4HA 1KZYC 1YV9A 1U4NA 3Q5GA 1X1EA 4IXWA 4LZOA 3RSSA 4Z4EA 1Z2CA 1T8WA 1JV2B 4V38A 4RLSA 3KB6A 4JODA 4D8YA 2Y1GA 5EGSA 4K9MA 3KTAA 4RPCA 5FL7D 3PWSA 3O0TA 2Q07A 1UINA 1KNXA 1BXRA 2A5DA 5SY6A 3DEHA 5FCDA 5EJEA 2ZM5A 3LCRA 4MV9A 4W4TA 2BFFB 5JZBA 3PD0A 5LQNA 2PUAA 2VCEA 4WLVA 1VYVA 3OPMA 2NTJA 4AKIA 2ZBDA 3MGGA 3RS2A 1PTJC 1DEAA 1CUXA 1OX5A 2FFHA 1QU3A 2HUNA 3EG9A 1R88A 3CR8A 3AWIA 1S3IA 2JIMA 4WLNA 2P40A 1F2TA 3CYFA 3L4BC 4BIIA 3HO1A 4MHOA 1MO6A 1NHGA 4E5KA 2H0RA 1T4DA 1PQWA 3EPKA 1K86A 2CFSA 3MWYW 3N53A 1AUOA 4E03A 1C3OA 1M1UA 1G8GA 1TIPA 1R8SA 3ERCA 4Z0PA 2OYRA 1FK8A 3PK0A 3NWOA 1LSUA 4M1QA 2WWIA 3H8JA 4QHYA 2V7EA 4XPIB 5AHRA 1Q0SA 1SZCA 2DQSA 4DDHA 2JJ2A 1U9YA 4I4IA 4BB5A 4RVOA 2FZVA 3D54D 2V8BA 3M2TA 821PA 4O4LB 1KSJA 3EPRA 2JFWA 1E59A 1JWBB 3A2LA 3INYA 4I1SA 3B3AA 4KUHA 4RQAA 5C9ZA 4FX5A 1M5TA 1OZHA 2C5LA 2O1EA 2VWPA 2WIKA 2VQ3A 2QQ0A 2GHTA 3IKMB 3K8QA 1V5GA 2E3JA 2VTEA 4HDCA 4IKOA 1AO0A 4C7OB 1LEHA 1EFHA 1J2JA 4YRGA 4P81A 3DYIA 3OTWA 3GJ6A 4YQEA 1Q84A 2QU7A 4Q3DA 4Z1OA 4Z7JA 3Q7RA 1BCSB 2I62A 3LXRA 3GHHA 3K53A 3QVJA 3QYFA 4QQNA 3VR0A 2C3PA 3IUSA 4P7BA 1S7GA 3EPLA 2R8OA 1PUJA 1OFHA 2L2QA 3HCOA 3PWZA 3QYJA 4GUDA 4XGQA 5ALVA 3KKKA 1LDGA 4FD2A 4LXQA 3MAAC 4KP7A 1Z83A 4WMLA 5SV2A 1RACA 4IR7A 3T8YA 5BW4A 5MFPA 1EB9A 3IX7A 2OZLA 1TLTA 4DRXB 1A76A 1SVOA 3GWGA 4XH9B 4YQYA 5CH5A 4MJLA 2OCYC 4YR7A 1Z18A 1ISRA 3DOJA 4E5NA 4RIIA 1RYNA 2D74A 2FF5A 1I6WA 4R68A 4CM4A 3U3RA 3CXRA 4BQRA 3N8DA 2IXAA 1I0ZA 3OEHD 5A05A 1ACMA 1SIWA 3KJZA 4M1YA 4RD6A 5JFTA 4RTKA 2BMEA 1MJGA 2HMUA 3Q0EA 2Q2VA 1JEAA 1E1CB 4Q82A 3TOZA 3O47A 3UOAB 1A5SB 2YUIA 2HV8A 1O4WA 3B3QA 4K86A 4NFSA 5CH8A 2QT9A 1QHEA 1UBHS 4JI4B 2C59A 2DPLA 4IUYA 3AHCA 1AF4A 3CG4A 4D9MA 2F8MA 3ROFA 3SZRA 5HOQA 4CF5A 1AF7A 1UMBA 3F9CA 4RJLA 1WF6A 3ZWXA 1HOTA 1U02A 3RV4A 1CDDA 1EFKA 1QZXA 5HSGA 4MYDA 3TIVA 1TNDA 2BIFA 2FE4A 1YK1A 2AN9A 2WAOA 2GEUA 3FB4A 4B45A 4XQGA 1G7TA 2BP7A 2H7XA 3EIWA 8ATCA 2EP7A 3OZVA 5DOVA 5U1PA 1VL1A 4B8ZA 4PCVA 5GP1A 3NJ8A 3LM8A 5LZ5A 2QIPA 4MB0A 5M29A 4GBGA 4PLTA 1B7GO 3WRYC 1T5OA 4ZOLB 3Q5DA 1D8AA 3GMSA 2VDMB 3DXFA 4LYYA 4FJ2A 4N8DA 4PC1A 4YUWA 4A8JC 3CNQS 3JQBC 4AG6A 4CV1A 4DT1B 4DHEA 1I14A 1SBTA 3NHRA 1GNLA 4UU7A 4YRKA 5IF9A 3WZMA 1NVGA 3TTXA 3R74A 2ZJ6A 3D6NB 3HVKA 4BRZA 3T7AA 3ZVNA 4UPVA 4BX0A 2H4ZA 3EWAA 3HKCA 1ZU4A 5AKHA 2B9EA 4B35A 3TL2A 2WRZA 3K9WA 3SWWA 2X5NA 4X1YA 4Q39A 4FUQA 4ALIA 1O9GA 1SUCA 1U1FA 4K87A 4TTRA 1KMCA 2GGSA 2K2WA 4YCBA 1PNOA 3TIIA 3BFJA 4BNKA 1GJRA 1QC5B 3IE2A 3WYGA 4X95A 4YMTA 1LVUA 1KDOA 4ND6A 5CAEB 1Y1KE 3VU8A 5EMKA 2OO3A 1YTLA 1WBDA 1HI9A 3QLTA 4BLVA 2EW2A 4BE9A 2PRYA 2W7TA 4ZQGA 4CM8B 2CMDA 1EM6A 4HQRA 3BWCA 1VIDA 1ZNWA 1J2YA 3C1AA 2QTCA 4FE4A 1CUHA 3TCKA 3DBLA 5I8PA 4Y98A 1HDGO 4DGSA 2BGNA 4JCCA 4HMPA 4TRNA 2CE2X 4UNPA 5EPUA 5I48A 4E5UA 2OA0A 1NOKA 2Z1DA 4DCJA 1EDZA 2A9FA 2BGJA 1OZAA 2FKNA 4KXWA 2FXVA 1X1BA 5KVCA 2XCOA 3ITKA 1G1MA 2IUEA 4I1VA 3DDCA 4LY6A 2QY6A 2DETA 3TB4A 4EVIA 2ZYUX 1KBQA 3NDPA 1ATZA 5ALIA 3DO8A 1W48A 4Y1RA 1EGMB 3DDHA 2EGUA 1Z38A 1JQLB 1BDMA 3WVNA 2F90A 3FNEA 1LBEA 1Q7CA 3LWDA 3BDIA 5EIOA 4QVGA 1EMDA 2CLIB 2JRLA 2R79A 3PI6A 3AMVA 4L15A 4NCIA 3DXXA 2HRRA 4XVHA 5CP8A 4PQYA 4QYXA 3W4JA 4C43A 3I4FA 4KEAA 2H1HA 3RIMA 4Z7OB 1Q7GA 5E9JA 4EG3A 2QVCA 1U9IA 5K6AA 3BUSA 1XNGA 1WV1A 1NX6A 1HQCA 1PEDA 4LJ5A 2N1BA 3DEKA 4MQMA 5CT9A 5AKIA 5DX1A 721PA 2WA1A 1TFUA 1RAAA 1V4BA 1STOA 1YRHA 3B70A 2J7KA 3JRNA 4ZC8A 4LHWA 4Q02A 3WJ7A 4DIKA 2Z6UA 5JVDA 1IZ9A 3D31A 2PS1A 5JCZA 5LP6A 2XNSA 1LF5A 4Q3EA 1CNEA 4D4LA 1DMSA 2XZPA 4DSUA 4MWZA 4BMYA 3HY6A 2YXNA 4RYLA 1C1XA 4JLUA 1W4RA 5AVRA 1NN3A 5JCOC 4CLOB 1MRNA 2DCMA 1DTSA 4Q3NA 3FSRA 3VH1A 1C8KA 4EF5A 2R4UA 4EBBA 3I28A 2FSIA 3N2KB 2DPHA 1TQHA 4LRTB 4EGFA 4ZXPA 1GSOA 4ZYZA 3ER9A 5I9TA 5AVXA 3EGEA 1F6BA 3A14A 3GFFA 1QUFA 4OXIA 1ODJA 4X6LA 2D0IA 2RFLA 3U09A 1NI4B 4KUGA 1GFIA 2ZRNA 5LA6B 3EGXB 2ZBVA 5DE3A 4QUEA 5KYWA 2GN8A 4QC2A 4C4ZA 1KJ9A 2ZI3A 3EF0A 4Z1MD 5LZ7A 1T2CA 3MWKA 2FB9A 4H16A 4TLAA 1DOZA 3T5AA 2ZRDA 3ETEA 1V71A 1BE8A 1Z07A 2GBCA 2A9JA 2E89A 1TE2A 2BFCB 2GPNA 3B9PA 3IP1A 3PFFA 2OFPA 2B37A 1M6EX 2XYRA 2XIQA 3MERA 3NB0A 2P2CA 2GKGA 2JHFA 5ENZA 1JHRA 2F7SA 3LY5A 4DXDA 3I1FA 3PNPA 3ROTA 5EQDA 4Q01A 3D4OA 4AJJA 3HFSA 4L0DA 1S4QA 1GRVA 1DWPA 1H6AA 4PXAA 2W4MA 5BQPA 2FQYA 4OXQA 1VG8A 1LZKA 3K9LA 3KPWA 3Q15C 1CUAA 5BUQA 4PX9A 3L82B 1PJQA 1AHHA 4J75A 4FYIA 5JW6A 1KI2A 2ERXA 4EG5A 4OSPA 2WR8A 1KK1A 4KLNA 5IAJA 3TLMA 5JEDA 4GZ3A 2EZ4A 1KMHB 1DTEA 4R9NA 4YPFA 5BY2A 3WAGA 5ITVA 3RD5A 1Y3AA 2YQ5A 4AKTA 2BAGA 3LU1A 3VBEA 2AZXA 1AH2A 3TSOA 3R5FA 4XGNA 2EX0A 4ZRMA 3VJRA 3A3PA 1P7CA 1VL0A 3F5QA 3IEUA 5JDIA 1BOFA 4YRDA 3UK1A 5CYPA 5TX7A 4U7TB 1WY7A 4DR5B 3QKUA 5HUHA 3O9VA 3O03A 2XWSA 1YS7A 5DM70 5FI1B 2QGFA 2QGZA 1Q2XA 4N5IX 1NJ8A 3C3YA 1YL5A 2PKQO 3OETA 5I47A 5D2CA 1ZOSA 1JDBB 1NUPA 1SOAA 2AHOA 1G5PA 5JHHB 2Q4DA 4TQAA 3Q9LA 4JYPA 3DO6A 1VHDA 5BSMA 5C2JB 1D0SA 3M6WA 5HJ7A 4DWWA 1EUDB 4ZPXA 1DO2A 4QD3A 4JIGA 1U1CA 3A25A 4FS3A 3ZXIA 4XFKA 2C94A 1OHHD 3CWCA 4JMPA 5AOCA 4NU5A 4K9LA 1FTGA 1XELA 4KDCA 4CIBA 1J33A 1A8HA 1VB3A 3MQFA 4GLJA 2GESA 5HMLA 1MQAA 2WT4A 3TQCA 3IQWA 1N5MA 3NANA 1XN4A 3H13A 5JPDA 1XMIA 2IHZA 4LWZA 3TO5A 1QONA 4F9GA 4F6RB 5A1TA 4MS3A 1DOAA 3RTDA 5KQGA 3WK5A 1J90A 1QDUA 2BONA 4J0QA 2Q4RA 4ND8B 2HK8A 1FY2A 1IQRA 3E3AA 4ZGGA 4RAOA 1ZUIA 4QNRA 2X14A 1K7SN 4WNIA 4J0IA 2FMXA 4S04A 1KZ9A 2H2FA 1PIWA 4QTTB 3VNUA 3KLBA 2FJ0A 4I2NA 4BFLA 2QR3A 3ND7A 4RS3A 4XYLA 3K94A 3WZLA 2PX8A 2EX4A 3QUTA 4ENVA 4U7FA 2E82A 2HL6A 3K2BA 1Z82A 5F5LA 4BDTA 4TMWA 4C3ZA 3OWHA 3UOGA 2QSYA 3I9KA 3ETCA 3SJUA 5A3JA 3R0XA 2GFQA 3BE5A 3IGFA 4GR5A 4UEOA 1JFLA 2M32A 5LBIA 3VYRB 3I2GA 3ZEAA 2OE2A 4AKEA 1G5IA 2DFKB 3Q6NA 2HKIA 4HAUA 2OTCA 5FEUA 1DAGA 2CXHA 2WHXA 3GBVA 1HZJA 1L7XA 2Q6TA 3PRYA 4MVJH 1P2GA 2XB8A 2VSQA 4YAIA 3FFXA 3F1LA 2JHPA 3ZJ4A 4B4OA 3UT5A 2WABA 3EBPA 4ENPA 2XB4A 3GLIA 3B6MA 1OBVA 1V3TA 1GTMA 4P7GA 4DABA 5TIIA 1PHRA 3KSUA 1M7GA 4RF2A 3RVNA 2NQTA 2XUOA 3WWEA 3P4UA 3V7WA 1PYDA 4QYTA 1CY2A 3PNKA 2PJDA 3L9WA 5DXAA 3DD1A 2RBEA 3LY8A 1K3UB 2R25B 3P26A 1KH1A 4ZODA 1YUMA 4I5GA 1UBRS 1R3DA 2J5RA 2VDWA 3GH1A 3QVLA 3AHJA 2X1LA 3GLTA 4LZJA 2ZYRA 1PK7A 1UJNA 2HBQA 2WSYB 1UANA 2P7HA 1GQSA 3KJEA 4GMGA 5EMHA 4DREA 2J4CA 3WLRA 2F1OA 4PXSA 2REXB 2WKRA 2DWPA 2Q5JA 1HDIA 3L4BA 3M5DA 3IRVA 4LRUA 3AVTA 1WDKA 5TGTA 2N46A 1YFJA 3G5UA 4JYMA 5FOQA 4LXXA 2BTQB 3Q0TA 2BI7A 2OCKA 1WV0A 1VMAA 1G6OA 3PCRB 4GE3A 4WZZA 5DYIA 2I67A 4PZUA 4BV3A 1V4NA 3E9RA 1SC4A 3QUCA 2ZIGA 2BHRA 5KEIA 2QG6A 1L5WA 4KIWA 1T29A 4PZAA 3RS8A 1GDTA 1Y6FA 1Z6XA 1KSGA 4A0FA 3E81A 3DZHA 4ZFNA 1QVRA 4CHTA 1TM7E 2OV1A 3IV7A 3E5HA 1SUIA 2H16A 5IJ9B 1FJHA 4MPTA 1N8SA 3SS7X 3ZJ5A 1N2SA 3ZKAA 4BFUA 1I4EB 4XJTA 1X7WA 4W1PA 1Q1EA 2QT0A 3BFXA 1GQRA 3AF3A 3AESA 1GXSA 2JLXA 3U1BA 1Z56C 1KAHA 1MAUA 2FUKA 3K96A 2NYAA 4P9NA 5DDIP 2XUPA 5AVOA 4ZKEA 5CB4B 1ZW6A 3TMKA 1SKUA 5J2UB 4ZTZB 5IW8A 4MWSA 2G88A 1KIFA 1V43A 2GD2A 4RW0A 1MVOA 3U62A 3E03A 1MXFA 1C14A 2AI2A 2DQ4A 2R8PA 2PL9A 3FWZA 3T4UA 3JS5A 1WJGA 3NKLA 4OXXA 3K9BA 4PAQA 4OIFA 2XMCA 3I12A 2IX3A 5JYBA 1AK2A 1G7CA 1HRKA 1S2GA 2KBEA 2RONA 1UJ4A 5DGTA 4G89A 1XYVA 3N5CA 4DWOA 4IWNA 4CTNA 5ARCA 4PY2A 5AW4A 1TGVA 3T7JA 1NURA 4QUAA 4CTOA 5T3YA 1TM4E 4L9AA 1DWUA 1IZ7A 1OE0A 2XTNA 4YREA 3SG0A 1E1RA 3BJEA 4RQTA 4EW1A 4ZU1X 3PHBE 4LJKA 2VF4X 4OBXA 3EYAA 5B3AA 2CV1A 2JDIA 2AH5A 4MHSA 5IKPA 1WABA 2SICE 5DYNA 1DZIA 3ORHA 3JZIA 2Y9PB 2G17A 5IH7A 3T94A 1O77A 1WDTA 2PU7A 1L9KA 2LV8A 3DPIA 3H9CA 1BU5A 3QNMA 4LQDA 4PICA 1EXVA 4X92A 4V2IA 5TT1A 5JADA 3USCS 1WTCA 5AK3A 1JIQA 2PIDA 4C2TA 4KRXA 2XB6A 2PUVA 4XOUA 5HW0A 3H0CA 1J8QA 2W8ZA 4H7EA 1GA1A 1DIBA 1PR9A 1YE5A 2YH2A 3BEOA 3IRUA 4YP5A 1VPEA 4XDGA 3T1NA 4DFDA 5DW0A 5DCLA 3TD9A 3Q6IA 5JWRA 4YJDA 1G59A 3G17A 3EUEA 1BW9A 2QMOA 2VZ0A 4QARA 4DIOA 3DHWC 5DTJA 3HSKA 1FFXA 3WRYA 3GJSA 1SB8A 3B53X 4BO3A 4FFSA 3GEHA 4KIGA 5JQGB 4MAFA 2VTVA 1XF1A 1A7JA 1UODA 2M6RA 3JQBA 3Q3IA 4LI3X 4NENA 4OTZA 3TAUA 3NTRA 4JSYA 4Y6PA 3IVAA 3DCNA 3GLQA 1ZIPA 3LLCA 3DAYA 1T24A 1TJ5A 2R1TB 3WRXC 2GZHA 3B51X 3O4FA 1N1GA 3H2HA 1A7AA 1IRIA 1ULZA 3H18A 4J3NA 4JI7B 5EMLA 2CVHA 4M0MA 3LRTA 4BZZA 4L22A 2XXAB 2R8ZA 1QO0D 3MAJA 4NAVA 1Z25A 1Z45A 4KOAA 3ZWVA 3ANYB 5HDQA 1P4SA 3PQDA 4OLBA 5K20A 4MNTA 1PV1A 1NXXA 1JDSA 3JQ9C 4MEBA 4MYCA 3JW8A 1Z8HA 1ZN8A 4F6CA 3ED1A 3HDQA 1YQDA 4MPRA 4ZKDA 2W48A 2A1TS 1QJ4A 4W5NA 1FFAA 7REQB 3C6BA 3BSFA 3I5UA 2OB1A 1P0MA 3C5CA 3K92A 3TLGA 3VPCA 4GKBA 3I5MA 5KMGA 2XNDD 4FD3A 3BGWA 5BT8A 4DV1B 1NN5A 3L7BA 3TW0A 2UXCB 5E3JA 5AD1A 3MYRA 3TMAA 2NO7A 2AEMA 5AVSA 4YALA 4BVAA 5BV1A 1IY9A 1BS1A 3P9CA 4ALKA 1SUWA 3S55A 2RHJA 2OCLA 1VRVA 3NKVA 5EE0A 5JH7A 1BHQ1 1HURA 1OBCA 3B1XA 5BSTA 3VC2A 4UQOA 3DLHA 1KDYA 3PJFA 1YOVA 1LBHA 5BN4B 5JXIA 3D3EA 3RADC 1VP3A 1N3YA 2ZYTX 3L1KA 1Z2NX 2EKBA 1MX9A 1NBMA 2D5BA 3T52A 4WA7A 1K8XB 2QM0A 2UAGA 3D1VA 4IIJF 3GLGA 4KREA 1L6RA 3A1CA 4Q3CA 2COUA 1KWGA 2XGSA 1H9BA 4L5CA 2Q8NA 3EVFA 1ISMA 1CUWA 4NE2A 1T8PA 4BWVA 1YR6A 1XMQB 2C61A 1ZM7A 4W99A 1ZH6A 5F1OA 1HUQA 1NV9A 3IAXA 4QYSA 1HTBA 4KMOA 1FNBA 1MW9X 5I5GA 5AP9A 1XJCA 2PZJA 3W9BA 3ZHOA 5MN5A 1USVA 1ABFA 3PQ7A 4QLOA 3ZDYB 4H6VA 2I7TA 3LXMA 3KT3A 1O03A 16PKA 4FFRA 5ENDA 2GJ4A 5DM60 5K9ZA 4OHWA 1R9NA 1VBMA 3HMQA 4L6AA 4ETNA 4W9RA 2FMKA 2BGMA 4FHFA 4LHSA 3ZVKA 1LK5A 3BMNB 5KNCA 3AQ4A 3HCRA 4DF3A 2VP6A 4O29A 2Q0HA 2C7OA 1WVGA 2JPDA 3L07A 1BCRA 1N0WA 1NJ5A 2AJDA 2PMWB 4NZ9A 4HYYA 2HJ9A 5BV2P 1W0KA 2IRWA 1MUUA 1W93A 4PFSA 4XX0B 1RXWA 1Q83A 5DLQC 1QCYA 3AT1A 4UFPA 2GCOB 4E6PA 4JLKA 1E3QA 3E5RA 1HYGA 1MQ9A 1XU7A 4N5MA 4IM7A 2HW8A 5LQDA 3AEYA 5JS1A 2Z04A 1ISHA 1PDWA 1ZH2A 2P4SA 3BE8A 1YC2A 3DLIA 3TLCA 3VI3B 1LS1A 3W5IA 5KSWB 2IZ1A 4MAAA 3BJRA 4GM0A 4TXMA 5AW7A 2YXBA 4LY0A 3UKJA 4CT5A 4Y2VA 4RGYA 4TSRA 2NQ8A 3LBFA 2XCQA 3PFNA 1GKIA 3BX1A 4ARSA 5DWQA 2FOLA 2NUBA 3O8DA 3QFRA 1R27A 2OV4A 3WHLA 5EYPB 1TRKA 2DLCX 1JFFA 3BDAA 4EZEA 1XCOA 3FYUC 4DHWA 1MOQA 3LKBA 2J32A 5C5CA 4TWIA 3KZVA 5TVKA 3F6RA 1BYIA 4NATA 4R6WA 2GZSA 2WMNB 3A1EA 3ESCA 4D0SA 4UU1A 1GUZA 3D7KA 2C95A 4R7TA 3AY7A 2JEOA 1JVBA 4AN1A 3L8ZA 4F4JA 5JNUA 3MILA 4NEGA 1AQLA 1N4AA 1UKVY 2VDKB 1MB2A 3TR0A 2IYEA 4F8EA 5CFZA 1HSOA 1SCNE 1UT5A 4HL6A 4Z2AA 4AWBA 1TLLA 1FDRA 1ZJ6A 4LYAA 2XOXA 1SVWA 2CBGA 4YACA 3QTBA 1X9IA 2Q7DA 5BMVB 2BTEA 5I9BA 1Q20A 1R64A 2AE2A 1NZDA 1MO4A 1XA4A 3D4IA 3F0TA 1MC8A 3K09C 2RGWA 4QUIA 3VUEA 2XNJA 4A27A 3UBMA 4AU1A 1SKMA 4JC5A 1WUJS 2PJRA 4HNGA 2AMYA 3F96A 3ODPA 4IBOA 2W2XA 4JKOA 5HA5A 5LB4A 3IXQA 1YULA 1GL6A 1OH6A 5BQOA 3V32A 1OZFA 2EDAA 2O0KA 1WD5A 2PFGA 3TL3A 3ZLTA 3MT8A 1YVPA 4V0LA 3QHAA 2QW0X 2PD6A 3HWSA 3QEBZ 1Z5UA 4R2JA 5BWNA 1PP4A 2WWYA 4LFBB 4X1IA 5CK4A 1WXXA 5CDTA 2CVOA 5DRYA 5HGJA 2HR1A 3UC9A 4ZYUA 3AUTA 4ZYVA 3A2NA 2JARA 4L9RA 5EINA 3QXJA 4JEHA 4IJ5A 4UNQA 2RJNA 2TSYB 3HBJA 3LPLA 1GTRA 2P6PA 121PA 3ASUA 2FN9A 1A04A 3R3JA 4E13A 1NPTO 4EUKA 4FYMA 5GADl 2BEVA 1VBKA 1GZHB 5EZSA 2WD7B 1CJTC 3TLKA 4A2QA 1TCBA 1YAHA 1D4ZA 3EXEA 1V8ZA 5JNRA 2PM8A 5EUQB 3DAFA 3UB2A 2YW9A 3HCDA 3JQ8B 5SYAA 2FW9A 4ABTA 3IVRA 3GGCA 3L0IB 3W1EA 2X4LA 4DIEA 2Q4OA 4KBGA 3RYCA 4LF8B 4KR6A 1IJKA 2O3RA 2ZPUA 2D3TA 4GOMD 4F2PA 1P80A 2R8EA 5JMTA 3OJCA 3GT3A 4UHCA 2EQ5A 1BMDA 4N0QA 1T43A 3AV0B 1A2BA 5HRUA 3W3AD 2GYUA 3DC7A 3K31A 2EJBA 3CLKA 4PGAA 5FF9A 2EBWA 5DHSA 1U2GA 2BL4A 2CYAA 3L0OA 1KEPA 2VPQA 1CR1A 1LGYA 4GPIB 1FFEA 1TUGA 3IJEB 4EW3A 1FIUA 4WBXC 5KHOC 1YONA 1WX1A 3CNNA 4D5GA 2QXYA 5J5VA 4RTMA 1PJ3A 1YKSA 3AR8A 1ZD4A 4Y2JA 2DHQA 3DE7X 3QG1A 1DTWA 4PCAA 1RFGE 1OV4A 4OHXA 1K0FA 4X93A 3OF5A 4NU6A 4O8CA 4CFZA 1OFIA 4RNCA 4FCVA 3DV0B 4UCWA 5DHRA 2FG6C 1SA0A 4OGFA 4YCJA 4AMUA 1XGKA 1G2OA 3VPAA 4ZV9A 1SOUA 1ZNZA 1CUGA 3L7IA 5BRJA 4CDRA 4P2BA 1ZA1A 3PFHA 4D6XA 1Y37A 1JTFA 2GK4A 1I2DA 3ZNNA 2I4NA 3R9KA 1OLUB 1AU9A 3U37A 2FPPA 2IU3A 3PXUA 1D09A 4IV8A 2P2NA 3JPYA 2QT1A 1B16A 1L5YA 3OVMA 4Q03A 1X80B 3AK4A 4WNAA 3URMA 3S5JA 5BVGB 4ZDIA 1GDDA 4O2AF 2XW6A 1NNLA 1CBUA 2ZIXA 3HJBA 1XX6A 3VJKA 2FEOA 4N76A 3UAXA 5C46F 2BGKA 1REQA 1WXWA 3ELDA 1Q0UA 1GARA 1DWOA 2H2GA 3QEMB 4LQCA 3GFTA 2LKDA 1XMSA 4M88A 5FBWB 4B4UA 2YXLA 4F2WA 5LYJB 4IDQA 4J9VA 3WYBA 4EPYA 1TT5B 1M0WA 2Q2WA 3IDSA 2DPMA 3NBQA 3TE6A 5JNSA 4FFOA 1FW6A 2J0SA 2YYYA 1GTG1 2CNKA 1NDUA 3R44A 3WSVA 3L0PA 1ZMRA 5KCZA 5MGNA 4F9FA 4ISCA 1DBIA 1Z06A 4GP9A 3TLYA 5AT1A 4URWR 1JPJA 2MSEB 2WIJA 3IALA 1IQ0A 2ACEA 3MJDA 4KWEA 4LHYA 2BT4A 5K0JA 2XODA 4R9SA 2CK3D 3QWFA 5ERYA 3AUFA 4B6SA 2UYOA 3LF2A 4RPGA 3VTAA 5DTRA 3R2JA 1CE8B 5H5JA 3RF7A 4NCBA 4K3UA 3TJRA 5M5BA 1TD9A 1UZNA 3NRJA 1U8UA 1GTSA 4KAXA 1XTPA 1A8IA 4L5AA 1MORA 3Q3HA 1CT9A 1ECPA 4EOGA 1MW8X 4P80A 3UMSA 1F3LA 1JKFA 4JJZA 2FN8A 1YI8A 1VI6A 4AJ2A 1KOJA 2DPYA 1EI9A 1NVUQ 5D51S 2H1RA 3E7DA 3GCDA 3K2IA 4N6NA 5LYYA 4RSMA 2A4KA 1GR1A 4EHBA 2HCJB 2B7LA 1GRNA 4ZVQA 5BSFA 4BBPA 4X94A 1OB2A 1MQSA 3D6VA 3ESXA 1NU8A 4AWAA 4D9KA 5G4KA 2VNJA 3IP7A 2BBOA 3FLAA 4PR3A 1RZUA 1E3JA 3QG5A 2JG3A 3NT5A 2RGNC 3NOVA 4KYVA 4AXXA 2P3SA 3WMEA 7ABPA 1E92A 5HILA 5ITWA 1IDN1 2BEUB 1X2BA 2GM3A 2ZJZA 2YMMA 5IN5A 1EVQA 3AUXA 3AVUA 1MA0A 5KKCA 1JQBA 4J16A 2AZDA 1W49A 3WBBA 4FBGA 4KX3A 5KAPA 4Q4HA 1PQUA 3RTAA 5AK4A 2H0QA 1IHPA 1NP3A 3M4XA 2Y2VA 1QGYA 4P4NA 1LA2A 1O87A 3AUSA 1PJAA 3RUDA 3LUCA 3QF4B 1S96A 1GT6A 4FW9A 1RXUA 1J2RA 2UYQA 2C8KA 2VSYA 3D6FA 1CWUA 3R8CA 3Q7QA 3WKBA 4D9BA 1LV7A 3PI7A 3U9LA 2E55A 2BKEA 3GUHA 4EB6B 1IN8A 3GIDA 3HDHA 5C37A 2EWMA 3SEFA 5IBQA 4K6FA 1V16A 1FRVA 3LY7A 1ZRHA 4G09A 2OQVA 1BEUB 2COKA 3WRXA 1KI9A 4UNRA 1VQ1A 4KAJA 3G8AA 5FI3A 2QE6A 4FYPA 4R2XA 1D6SA 1DAMA 2E4AA 1XPRA 1P7ZA 3NG1A 3VV3A 4EKEA 4NR0A 3UUEA 2WB2A 3JALB 5G0WA 3SLRA 1YFLA 2FX5A 4LJRA 4XA8A 1GLNA 3JQ9A 4LFAB 3A2KA 3CUWA 3E3LA 4M1WA 3STUA 5C7IO 3S2UA 4L50A 1WB6A 4FKBA 4EFNA 4EMBA 2I66A 1AX9A 2ZSHA 4RCYA 2VPZA 3DC2A 1XAJA 5HFNA 2B0JA 2HOQA 1FMFA 1PLKA 1Z63A 4LDPA 3QJ5A 1OYYA 4HDMA 2DWUA 5HCNA 5PGMA 5FA5A 2HWWA 5K4HA 2HLDA 1DINA 2X15A 1A71A 4PS0A 4XRGA 3PL1A 1OLOA 2XVZA 1KYYA 1KC3A 3GLKA 4HEA6 3UAVA 4ESEA 1IQPA 2ZWAA 1RAHA 1FFYA 2FUEA 2H07A 4QQRA 2V74B 3JYLA 3T1TA 1PUIA 4NTZA 4FQ8A 1BNCA 2QRMA 4Q6BA 1AQYA 2CFCA 2GEBA 3QRWA 1NRXA 4Q21A 3PB3A 3ZLJA 4I1PA 3ROPA 1UOOA 2PGAA 2ZBFA 1NJFA 1PLJA 3A9UA 2SKEA 2I2CA 4P83A 3DMHA 2GZ1A 1D2RA 3DDZX 1H05A 1K5PA 2EGGA 4I3HA 2A57A 5ITSA 3WSTA 4D42A 5TXGA 1KXJA 1GLVA 1H22A 4HDRA 4GMHA 4TL7A 2BGWA 1JAIA 4Q7MB 1U9CA 4DLRA 2ANBA 1IQUA 1ZD2P 4BNMA 3RU7A 3AEQB 3HVIA 4F8JA 4A3SA 1F4LA 1IRXA 1U8XX 4XIJA 2HN9A 1NMYA 2E1PA 2NP6A 4TWRA 1JBEA 2BE9A 5LC1A 3AR3A 4N7BA 3FPSA 1JA9A 2J30A 3AHGA 4G1BA 1JQJC 1DV1A 1IUOA 2Z2IA 2QIOA 4NH4A 5CFLA 3IA2A 1SXJB 1U2DC 1Q7RA 2B69A 4PVCA 3V2IA 3DEJA 3NORA 3PC4A 3H83A 3L6CA 3ZCPA 4UBJA 5I9NA 2ZTMA 4G1UC 4HLCA 2J0UB 4PRLA 4N5DA 1BROA 1FS5A 1SRQA 2MSNA 2XECA 1WZNA 2QJFA 3D8RA 3MIZA 4HVTA 2CDBA 4XIYA 5SICE 4ETIA 1A2QA 1NLZA 4WXEA 3TUJC 3CZPA 5LZ9A 3UGJA 1N2EA 5EN4A 1OC2A 1KQFA 3RRNA 1JIKA 4AFNA 4YIHA 4UXIA 4K6CA 2XIJA 3UXEA 3NI2A 5EPOA 5DX8A 1F1JA 3L4KA 5K0TA 5A03A 3BMCA 3WB0A 4KK3A 4UCFA 1QANA 2J6HA 1QTQA 1E5DA 4WY2A 3T6KA 3MG9A 5D01A 1FDTA 3OTQA 4G5XA 4MO2A 5FPTA 2P79A 2PX6A 3S29A 4M6WA 1VG0B 3GQBB 2Q9BA 1NMEA 4GX5A 4HQ0A 2B61A 1P5HA 3PQ8A 4TROA 1Z7GA 3FVVA 2O1WA 1EE2A 2AX4A 1X14A 1Y9AA 1VECA 3G79A 4CIVA 3AF0A 4NBWA 5AK0A 1Y9EA 2QQEA 5ALUA 1MBZA 2G25A 1VCHA 4KQGA 1WXQA 4ZCLA 1MJ5A 1SQGA 2AMFA 3O0DA 1VKZA 2YZGA 4P2GA 5B1YA 3BXGA 4EI7A 3F3SA 521PA 3WGJA 2X5JO 2FV8A 3ZV6A 3NYRA 6GPBA 1E62A 2R6DA 3SC4A 4YDQA 2GFIA 1TIKA 2RSLA 2JKZA 3HB4X 4FBLA 4KLZA 4EYSA 3SXUB 5E6SB 1JLLB 2PXCA 4PZDA 3QV2A 4FOTA 4CN9A 4ER7A 2KLHA 2JDID 4Q4AA 1FVFA 4FKMA 1N2XA 1P5FA 4XWGA 1UPFA 3H6GA 3AIOA 1M73E 4NHEA 4FBMA 4OHMA 5CLHA 4K40A 5HTOA 1K66A 3B2EA 4I5EA 4D4KA 3CW8X 4C6HA 4BRWA 3DFIA 4Y6LA 1BQ4A 1Y63A 1Z5GA 2M2IA 2H2AA 2YUTA 1VA5A 5EXEA 3RG8A 5LWQA 4UREA 3JAWA 2A33A 1TUBA 1N7IA 2QTVA 1D7AA 3CGGA 4UOQA 3TNYA 3DV2A 1Z4LA 2JFFA 5LZ4A 2BGRA 1K7FB 4GZ6A 2VHTA 5BW5A 3NTXA 1P2VA 1JTVA 2IZ5A 5A7HA 3EQZA 1E2DA 1M2VA 1NWHA 1RT9A 3KQSA 3WHKA 1UWLA 2LR0A 1OD6A 4F93B 1LF0A 3ZX5A 1CR2A 1TI7A 3UNXA 4EQZA 1RR6A 4TM8A 5SY9A 1Y3FE 4D81A 3EFBA 3U4IA 4S1VA 4BJHB 4YCLA 5HJEA 3R41A 1XMOB 3VDRA 4FYHA 4GOJA 3BWEA 5F4ZA 5KX5A 5ILOA 1UXHA 1E6MA 1HETA 1R37A 2PX0A 4J8PA 1OPRA 4FGJA 2PY6A 1R0LA 4NFYA 4XB2A 3K6KA 3MHPA 1VHJA 1JAYA 1E9SA 5CXUA 2WIDA 5D1NA 1P7VA 1X92A 1F14A 1OMOA 3PNLA 2I5PO 5SZJA 4AD8A 5JI3E 3IE1A 4OA5A 5EP1A 5T67A 5KAMA 3RASA 5TS2A 1MJFA 2K6GA 2W2NA 1G291 2Y1LA 1O94C 1MB9A 1TYZA 1T1RA 2BBTA 1KEZA 2R6FA 3HCCA 3KYIB 5K3AA 2OKGA 4B48A 3TRFA 2BFMA 4LQ4A 4E5PA 2ECFA 4TZTA 5DJ5A 4I46A 2IPAB 4D98A 3PIDA 4V1CI 3FM9A 3JASA 1H2EA 5B4UA 4MSUA 3UFXA 5EUCA 1QK4A 1V0JA 1KI7A 3GFSA 3KXIA 3PNBA 4O4LF 1EFVA 3UQYS 5L3SA 1HEIA 2XGMA 3PQ4A 2ZJOA 1Z7BA 1DPGA 3JQEA 1DC6A 4JYBA 4TV9B 3T3DA 4KFRA 2CEKA 3C3PA 4S1TA 2Q2NA 5TF4A 1RI1A 3HZZA 1NBMD 2BBWA 2PR2A 4GFDA 4GYJA 3STVA 2UYGA 4W7SA 4ZT3A 3UAYA 3FOEC 3EZNA 2X58A 3KM0A 3SJ7A 4QOGA 3TPFA 3CH6A 3BB3A 3A9WA 3H8VA 3JX9A 1Q21A 3N39C 4IVRA 3ECSA 4PQRA 3EQ9A 3IOBA 5FUVA 3HB1A 5K6RA 4JOQA 4W7HA 1TW3A 1PDOA 1XNRB 3GN1A 4A2WA 4BNDA 2VQSA 4S05A 4MIOA 1SUDA 2QP3A 4MYSA 2P9BA 3AINA 1WE2A 3JV7A 4MXDA 4OQQA 5JMPA 1EVZA 3M2PA 4MUMA 4DCNA 1IHYA 1G21E 2A5FA 4M3NA 1ZK0A 3W8EA 1WR8A 2DBYA 2ACVA 1YZLA 2AXNA 1II8B 1KBZA 1U9JA 2MINB 2P9TA 3LFHA 1H3FA 4ZPJA 2IXEA 3UV7A 4US0R 4Q16A 4IO0A 5AUNB 1UJ6A 4PZYA 3HKDB 2HMTA 4LK2A 5A9SB 3G5MA