3PEFA

Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
287
structure length
286
Chain Sequence
b'SQKFGFIGLGIMGSAMAKNLVKAGCSVTIWNRSPEKAEELAALGAERAATPEVVESCPVTFAMLADPAAAEEVCFGKHGVLEGIGEGRGYVDMSTVDPATSQRIGVAVVAKGGRFLEAPVSGSKKPAEDGTLIILAAGDRNLYDEAMPGFEKMGKKIIHLGDVGKGAEMKLVVNMVMGGMMACFCEGLALGEKAGLATDAILDVIGAGAMANPMFALKGGLIRDRNFAPAFPLKHMQKDLRLAVALGDRVGQPLVASAAANELFKGARAAGFGDEDFSAIFKTYER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, NAD-binding
publication title Structural characterization of a beta-hydroxyacid dehydrogenase from Geobacter sulfurreducens and Geobacter metallireducens with succinic semialdehyde reductase activity.
pubmed doi rcsb
source organism Geobacter metallireducens
molecule tags Oxidoreductase
total genus 117
structure length 286
sequence length 287
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3pefA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pefA01
5FF9A 1U7TA 3MWEB 1TT5A 2C5EA 1PWXA 4J1QA 1ADBA 4BO5A 1Y81A 1UH5A 4W82A 4XQGA 1DLIA 3EDMA 5IN5A 1YB5A 3H3JA 5AXDA 4CL3A 3RQSA 3D7LA 4MKRA 1ENZA 4EUHA 2P5YA 3PIIA 3CZRA 3DL2A 3VH4A 1EBUA 4ALLA 4TKLA 2PY6A 1B3RA 3P7MA 3W1VA 3WJ7A 5CAEA 1HLDA 4IDFA 2BF7A 2Q46A 3DBRA 1PJBA 1U3UA 3GVXA 4HNGA 4J4HA 3FRJA 4J7UA 1DO8A 1JQBA 3W6UA 3ZU2A 4NBWA 4CLOA 1GR0A 2OO5A 5F21A 3RFVA 4FJ2A 4J7CA 3T7EA 3PP8A 1EUZA 4N7RA 1OBFO 3VAZA 3G1UA 3FBGA 4ROSA 1HRDA 4R01A 4GMFA 4UEJA 4YJDA 4BIIA 1XHLA 4QECA 4FFOA 4Z0PA 3KB6A 1PZHA 4RO0A 3NDJA 2V6FA 2I76A 4OM8A 3W8DA 3VDRA 6LDHA 4NIMA 4PCVA 5KJEA 1RJWA 4FIZA 3UW3A 4FS3A 1N2SA 2DVMA 3GNTA 4EITA 2YFQA 4DQVA 2D5AA 2DAPA 3W8EA 3KZVA 5CHEA 1HDOA 4J1SA 1PS8A 1X0VA 1LX6A 1BTOA 1QYDA 2VUTA 3EYWA 2CY0A 4ZU3A 1U5AA 5I9LA 4CLRA 1ZXLA 1GTMA 3KRTA 1LQTA 3OFSA 4R51A 1JWBB 3S8MA 4BGUA 2EKPA 1DIGA 3R6DA 5DNAA 4I9NA 4JBGA 4Q3EA 3O8QA 1FDWA 5EERA 1K3TA 2DM6A 5GY7A 3TZKA 5A4DA 1W8DA 1J6UA 1VE9A 2C07A 4AJ1A 1UP4A 2Q49A 4K6FA 1EE9A 1Z74A 1A7KA 2IZ0A 3DEYX 4IJVA 3RIHA 3H5NA 1NX6A 2VRBA 2Y1OA 2YDXA 3MJCA 4BNMA 3AI2A 5KVCA 3WOHA 4E13A 2QG4A 1AHIA 4OXKA 4PLGA 4BKUA 2VN8A 3FSRA 4II3A 2PV7A 1LU9A 3BMQB 2RH4A 4CMCA 1SNYA 3JYLA 2P68A 2WSBA 3H65A 1NNUA 3LT0A 4U6SA 3U4IA 4FC6A 1C1XA 4IBOA 3ANLA 1KEPA 4FDAA 5ENDA 5B4VA 1I2BA 1I5RA 4GBJA 1EEHA 1UUFA 1XLTA 3RI3A 4TQGA 3R3JA 5TIIA 1T4DA 3ZWBA 4MVJD 3WGIA 3FHLA 1O95A 4NJMA 2B4TO 4BNXA 1XG5A 4FBGA 3U49A 4TRJA 3K5PA 4MDHA 3ZN2A 3A28A 5A02A 2YHUA 1LRKA 3F3SA 4IS2A 3TZQA 4CLHA 3WQRA 2UV8A 5JNLA 2D0IA 2DTDA 1BG6A 1J49A 4Q39A 3PLRA 3ZWNA 2NNLD 3L9XA 4CMBA 4D0SA 1V0JA 1GAEO 2O3QA 1CQJA 3GPDG 1VKOA 4OOFA 1B2LA 3SVTA 1WZEA 4GI2A 5CDUA 1M6WA 2Y66A 4DQUA 5G0VA 1PL6A 4WCDA 2PGLA 3I23A 4XCVA 3ZHBA 3WGQA 3FR8A 4BGIA 5CEFA 3KSUA 4BKPA 3KOUA 2NU9A 2HRZA 5CFZA 5T64A 2OZPA 4DMMA 2R00C 3FBTA 2DUUA 2BKAA 4WLEA 1O9BA 2NTVA 1PGOA 4WEQA 1CJCA 3ITKA 4B4UA 3T4EA 4YJHA 3BA1A 3VKVA 1GPDG 1E77A 3LLSA 4XQ9A 1QYXA 1GV0A 4FCCA 5C5IA 4YVFA 3HDYA 1ZEMA 4BV8A 4E33A 3CZMA 1LNQA 3L07A 3CMMA 4B4WA 2BI8A 1GUFA 4IZHA 5KVVA 4NU6A 1ZSVA 3AU9A 4FFRA 2CDAA 1NQ5A 5JXWA 1ZSYA 2G0TA 3H9QA 1CYDA 2VRCD 4X54A 2X0RA 1DPGA 1NVMB 2Q45A 3O26A 4ONEA 5DT9A 4QQRA 5THQA 4CM6A 3HWRA 1UDBA 5JCXA 1CWUA 2DU8A 5TT1A 1U2GA 3QSGA 2YDYA 5HRUA 1VJTA 4BNZA 3OP4A 1P1KA 4MINA 1QG6A 4WCFB 4J2HA 5THKA 3WWZA 2D2IA 1Y5MA 4IJKA 5CG1A 1E1NA 3B1FA 2BGMA 3GVCA 4Y98A 3IKTA 5IJZA 2BELA 1XA0A 1Y9EA 4R16A 1NBOA 1P9LA 2VZ8A 3PGJA 1GQ2A 3CSDA 3DBVO 3KSZO 2B4QA 5J23A 4OIMA 5COQA 1AUPA 3WFJA 1T2CA 3HSKA 4W7HA 3ZW9A 4P38A 5IDWA 1V3UA 3GDGA 3GAFA 4OKNA 5A1TA 1N8KA 4NJOA 1ZMOA 3QVWA 1XR3A 3G0OA 1WMBA 1QYCA 1WWKA 1RYEA 2W4QA 4YRBA 2CD9A 3G49A 3DAGA 3OH8A 4F6CA 3H3FA 4WNIA 2IE0A 3AJRA 1ADFA 3OA2A 4XEHA 3C7AA 1G0OA 1JKJA 5BT9A 3D3WB 4RQUA 1YXMA 1ZEJA 3AOGA 3ZI0A 1NHWA 4LVCA 3MJVA 1WDMA 3VPGA 2J5KA 2ZQZA 3DZGA 4KZPA 4W9NA 4NK5A 5T6BA 1HEUA 3E48A 1GD1O 4NMHA 4WPGA 4GX0A 1T2FA 2VOJA 2YYYA 3NDIA 1CIVA 1V3VA 1EDOA 2EJVA 2NVBA 4RVGA 4EGFA 4NHEA 3UAGA 4DYVA 2VNAA 3BAZA 5F5LA 4PFJA 1NVTA 5FFFA 1IB6A 2NSDA 4IGEA 3KO8A 4E5PA 2C54A 2Z95A 4LRSB 2O4CA 2XAAA 4B4OA 1H6CA 1MG5A 4HFJA 5G4KB 4XDYA 1F06A 2G82A 3OEWA 4JCOA 5U4QA 2ILTA 1UXKA 3JQEA 2X4GA 3P5SA 4C7JA 4XA8A 2VYND 1A72A 2A4KA 5G0UA 5EESA 3FNFA 4JBIA 1Y1PA 2RH8A 3TJRA 3GNQA 4R68A 4ZQFA 4J9VA 2PZJA 3G3EA 4Z6KA 1BMDA 1HLPA 2P9GA 5FEUA 3MTJA 1T4BA 2PKQP 3DONA 1KC3A 3AU8A 3F4BA 4QT0A 5T8KC 2LDXA 3QWIA 1R4MB 4JJIA 3VOSA 3ROKA 4NNJA 2Q2QA 3QRWA 2ZYGA 3EC7A 3JQCA 2WD7B 2YW9A 1PJTA 1N9GB 5LC1A 3WGTA 4BS9A 5HWSA 3WX0A 3I9KA 2JFHA 4NPCA 4NG5A 4LK3A 4AJ4A 1WLYA 2ZYDA 1DC4A 1NP3A 2UVDA 1K6JA 4RPKA 2EWMA 1HE5A 1Y8QB 4YYZA 5A9SB 2Q4BA 4AFNA 4BO1A 4J1TA 3N58A 3QVXA 4R9RA 4R5MA 1PL8A 4EYEA 4OH1A 4FB5A 1R0SA 3V5NA 1B26A 3UVEA 4BMNA 4CL8A 3MWDB 4FR5A 1MC5A 4C4OA 5T5QA 2QYTA 1SEVA 3UKOA 5I7FA 3L4BA 3JTMA 1ZXBA 3GRPA 1B8VA 3GF4A 4L0QA 3GR6A 4DYDA 1U8XX 3L6EA 3PDJA 2X5OA 3Q1LA 2PNFA 5JPIA 5MDHA 1NPDA 1YS4A 2NQTA 3SX2A 3I9OA 3L6DA 3NGLA 2OBNA 1XSEA 2J3IA 3BMNB 3Q9NA 1ZK3A 2YZ7A 4U5QA 1D8AA 2YQ5A 1B8PA 1ZW1A 2QRJA 4I1IA 1Q1NA 2PH3A 1Y8RB 1BW9B 3F1KA 2PZLA 4R69A 5ITVA 1BXGA 4ID9A 1E7QA 3D4PA 1OFGA 4BB6A 1IHYA 2GR9A 3ENNA 3IP3A 1J4AA 4WASA 1TEHA 2ZJ1A 1N92A 2Y05A 1UJMA 3K8ZA 3S55A 1R66A 2UYYA 2WEKA 3HB5X 1AHHA 3JD3A 1MV8A 1RM3A 1D3AA 5AXBA 1R4NA 5IN4A 5JO9A 3UCEA 4BMVA 5K6AA 4ND5A 1GYQA 2ZCUA 3TRIA 1O5IA 3DZBA 3VZRA 1OOEA 1A7AA 2IXAA 5JW6A 3RKUA 1E3JA 3MJTA 1V6AA 4BO9A 1ZVMA 5ILGA 5JMPA 4B79A 2AEMA 4PGFA 3WYBA 4Z9FA 4BNJA 3DZHA 1F0YA 3TZCA 2LDBA 2VCYA 3BHIA 4Y8VA 1XKQA 2R00A 1LBEA 4YB8A 4K28A 5KKCA 1ENYA 3JQBC 5A03A 4BKOA 2HMVA 3PQFA 3CTVA 1LDBA 3QP9A 1HDXA 3RFTA 1HWYA 4DIBA 3K2BA 4CM4A 3UOGA 4L8VA 5EJ2A 4F6LA 4TROA 3ZU5A 3LT2A 5HBRA 3ZHYA 3JQDA 3TDKA 4E5YA 1SCUA 1VKNA 2YHIB 3UUWA 1H6DA 1HZZA 4GX1A 2Y0DA 3H9UA 3ORFA 4TVBA 1FXSA 1K89A 3EVNA 4NBTA 4PLZA 4DMLA 1IYZA 2DC1A 5L7WA 4BNIA 1HKUA 1O94A 3VZQA 2GNAA 2EP7A 3M1AA 3DZIA 4RF2A 5JDCC 4Z3KA 1F8FA 1E92A 3NGXA 2PA3A 1RKXA 3BTOA 1DRWA 3JQ8B 4XD2A 2HMUA 4NBVA 2O3UA 2P9EA 4LVUA 4A73A 4W6ZA 4PG8A 3LLVA 3CE6A 2DPHA 1PZFA 4JN6B 3D64A 4IDEA 2X6TA 4W99A 5C7LO 2X9GA 2EF1A 2ZB4A 4I08A 5JC1A 1LEHA 3NUGA 1XQ1A 3KYBA 3GLQA 4D44A 4AVYA 2ZTMA 4RVSA 3IKVA 1HSZA 4FGWA 3JQGA 4WLFA 5DCUA 3DTYA 4EJ0A 2ZYAA 3MJEA 1X1EA 1N7GA 3BTVA 4PLPA 5B12A 1SB9A 4AJPA 3OIDA 2XPCA 3AI1A 4FFPA 1MFZA 3F4LA 4CLXA 5FYDA 2J5RA 2G1UA 4TZKA 3I9MA 4XDZA 1KVSA 2B5VA 1HYHA 4BNYA 1Y6JA 5ADHA 5JYEA 2OP0A 3DZFA 3PLNA 4AJJA 2W8ZA 2JAPA 4QFDA 2IRWA 3GMDA 3B1KA 5AXCA 4MKXA 3PZRA 3E9MA 4RORA 4CQMB 1PSDA 1CQIA 4GX5A 2B36A 2UUOA 3PI7A 2X5KO 3GUCA 3GEGA 3Q3CA 4FQ8A 4LMPA 3W8FA 2HK7A 5F5NA 5C3MA 5MGBA 1P3DA 4D3DA 1U7HA 4O5OA 3NJ8A 3TZHA 2FWMX 1E1LA 1WMAA 1KERA 2FR0A 1LSUA 3LT4A 4XZ3A 4JBHA 1UAYA 1SAYA 1I8TA 3I6QA 1QMGA 1W6UA 1ZSNA 3NTOA 2PFGA 2B0JA 1DXYA 3ZWPA 3B20A 3Q2KA 2EIHA 1R0LA 3ZWVA 4HX5A 3QWFA 1C1DB 3T7CA 1PJQA 4FOOA 4HFMA 1ONPA 2RCYA 5F1KA 2I65A 1D1SA 4R1NA 4ZVVA 4FFLA 4JIGA 8ADHA 1HL3A 3GZNA 3G17A 1JAYA 2UAGA 5JAIA 1UAGA 4MVJM 1C0LA 2JD2A 3U09A 2YY7A 4MIYA 4FN4A 2JFFA 2J8ZA 3EK2A 5H81A 4CV1A 3JQ6A 2VT2A 1U5CA 4R54A 4YQZA 4S1VA 1EVYA 1MFPA 4WOKA 4GL4A 4QXMA 1KOLA 5CEJA 3E18A 3GOHA 1VC2A 1AXEA 4CODB 4I8XA 3ZNQA 3WGOA 5KOIA 5JY6A 3DOJA 3DOCA 2J3JA 5A5EA 1LSSA 3AUTA 3OEYA 4YWJA 4ZD6A 2YJZA 3PIDA 3GY0A 3QIVA 4J1NA 5T8KA 4R5HA 3CKYA 2NU6A 3DZKA 4Y9DA 3HFSA 4IGFA 2DBZA 2W2LD 4N18A 4HBGA 3E5RA 2CVZA 1H9AA 3GEDA 5BSGA 4HFNA 1F12A 5IXYA 3H2SA 4TKMA 1Q7GA 1N1EA 1YE3A 4GSLA 4L75A 3RC2A 1EUDA 1JKIA 2I3AA 2J5QA 1BVUA 2V65A 4D3SA 3WJAA 1I3LA 1QV7A 1LSJA 1I3KA 4DVJA 1JA9A 4A27A 1HE2A 4L4XA 4MKZA 1HYEA 4OGWA 5EPOA 2GASA 1E1MA 3ASVA 4UEOA 3PHJA 4I5DA 2VWQA 4R4JA 2FPGA 2ZJ0A 5DULA 4W9NC 3WB9A 3WGGA 1GPJA 3WNVA 4A5OA 3OF2A 2J6IA 4UUOA 3U4HA 4J49A 5IDXA 2HMSA 1F14A 1YB1A 5L4SA 4J0EA 3KYDA 2W2KB 4D43A 1LSOA 3C7DB 4FC7A 4RCVA 1V3TA 4DPLA 2PR2A 3O4RA 3SBOA 1P1HA 3KXDA 5TRTA 5IXSA 2CVOA 1EQUA 5ICMA 4GKVA 4YACA 3DXFA 2NTNA 2O7SA 4U7WA 5EQDA 4WECA 1UXHA 1PQPA 4IS3A 1DHTA 2PD6A 4DC1A 3BHMA 1VI2A 4ILKA 3WGYA 1YBMA 3PFFA 1U4OA 5HM8A 2IYOA 4MVJI 1S7CA 1GFSA 1IPFA 1NTOA 1OZAA 4ITUA 1DBVO 4L76A 4OSPA 2RHCA 4RQTA 3JQ7B 2E49A 1JDJA 3CIFA 4RVFA 4E12A 3AFNA 1PZGA 4WLOA 1ORRA 4BO7A 1EMDA 3FCOA 2G76A 2X9VA 1LRJA 3EAGA 1E3SA 3E1KA 1ZK4A 4KDEA 2Y99A 1I2CA 3WFIA 3BMCB 4RLHA 4XJSA 3KUXA 1HDZA 2Q4EA 5G0TA 3U0BA 1UZLA 1I10A 2P9CA 4HV4A 2CF5A 1EK5A 5JE8A 3V1UA 4RPLA 4MIOA 4NK4A 3VC7A 2GPTA 5KVSA 1NQOA 3PHIA 2AQHA 4R3NA 1H2HA 4W4TA 1D1TA 3EUWA 3LF2A 2NU8A 3DR3A 3RUDA 3GN2A 2FSSA 3GDFA 2FR1A 2VZ9A 4BO4A 4GWKA 2O3JA 3M2TA 4MIEA 2AW5A 2ET6A 5ES3A 1MXHA 3NTRA 4TRNA 1YO6A 3JQFA 4ZA2A 1Z7BA 3JQBA 3C3XA 3LDHA 4XYLA 3VH3A 5L53A 2W98A 4KDFA 1FDTA 3Q0EA 1BDBA 2VYVA 3JQAA 1DB3A 2YV1A 4EW6A 1GY8A 3CUKA 3PXXA 4WOJA 1HDCA 4BGEA 2JJYA 4BNLA 1DRUA 1PQWA 1UP7A 4AJHA 3OJEA 4G81A 2AA3A 3ZCXA 3F5QA 4NDNE 2AEJA 1KEVA 3RUFA 4Z9XA 3L4BC 1XGKA 1XU7A 1U3TA 1PIWA 3PJDA 3U4CA 5TJHA 3DBRB 1GV1A 2EERA 2IODA 4ND1A 2V7PA 3C1OA 3HDHA 1DC3A 3RUIA 1KY4A 5JDCA 4H7PA 5CDTA 5IG2A 4GMGA 2PD4A 2FPPA 1L1FA 3ZV5A 3KETA 2PZMA 4P4GA 4CQMD 2JFGA 3BMOB 3KV3O 4J90A 3GVIA 3C7CB 4OYRA 2DKNA 2QQ5A 4MP8A 5DOZA 4ALIA 4BV9A 4G5HA 5F1OA 2QHXA 3PRJA 3PTZA 4AG3A 3BTSA 4FSHA 1QR6A 4UVDA 4R1TA 1Q0QA 3A9WA 1X15A 5JO0A 2PH5A 1E6EA 1H2BA 5B4UA 2HUNA 2BFAA 3ZNOA 1G6KA 1H0KA 4IIUA 5TJ9A 4QO7A 5K6AC 2YV2A 5AVOA 1HF3A 2O48X 4IDCA 2B5WA 2WE8A 3EMKA 3N74A 4CLRB 1CRWG 4DQXA 3OM9A 3QVTA 3PYXA 4Y6PA 3RBVA 3F6YA 3VZPA 5DN9A 1G1AA 1PEDA 4YRAA 3AUAA 2I67A 1IPEA 4M87A 2OP1A 3TN7A 3DBLA 4B3HA 1TVEA 1X13A 2JHGA 4KUGA 3ICPA 3A1NA 3V2HA 2CDBA 2I9PA 2W90A 2XF8A 5TT0A 4ZGWA 3H9EO 3M6IA 4Q3BA 4M49A 1GQYA 4WCFA 4URFA 1Z82A 1H93A 4CR7A 4PN3A 1KVQA 2AHRA 4H3VA 4M54A 2XOXA 4JJFA 5L3ZA 2CMDA 1XELA 4WE3A 1EZ4A 2TMGA 1W0CA 3DAPA 1EK6A 3TOXA 1LC3A 3GN1A 3HUDA 3R1IA 1DLJA 3WBFA 4QTZA 1E7WA 2Q2VA 4E32A 3EW7A 3RCBA 4XX0A 1YKFA 4LMRA 4KQWA 3D4OA 3VVBA 5G2OA 2JCYA 4D79A 4E5MA 1YRLA 2D59A 1N7HA 4IJWA 2Y1DA 4CM5A 1EFLA 3GK3A 4G2NA 4BB5A 2VTDA 4Z9YA 1LDMA 3ZU4A 3D3WA 2WYUA 4ZRMA 2VUUA 1N1GA 1YBVA 2X9NA 2OFPA 3KEQA 4RV9A 3CXRA 3V2UA 3PJGA 3WLEA 2CZCA 3AK4A 1E7YA 2HQ1A 5U1PA 5DCYA 1DJNA 5CDGA 4BL5A 1PGQA 2JCXA 3GFBA 4PG4A 3RSHA 1NWHA 1YBAA 1PR9A 4NFSA 1P33A 3IIEA 4WUVA 1X0XA 2R2GA 1VL6A 5EN4A 1DOHA 4FGSA 3R3SA 1D4FA 3UGKA 2JD1A 1UZMA 4D3FA 3ZDFA 4EBFA 4YJHB 5DBIA 4UREA 3PHHA 4OJNA 4PLVA 5A5FA 3I52A 1VPDA 5A9TA 2AQKA 3AUSA 2X0JA 5TGDA 3WIEA 3RJ5A 4DUPA 1P1JA 3K92A 3JD2A 5I8ZA 1VSUA 2XXBA 3RVDA 3TL2A 2O3RA 3ONDA 1EVIA 2AXQA 2Q1UA 4LN1A 1FK8A 2RBEA 5GZ1A 1DC6A 5DBFA 1E3LA 3B70A 3DZJA 3KM0A 2AG5A 4JQCA 3QW2A 5JFOA 3ADOA 1GUZA 3HB4X 4KTVE 4DIFA 3ZNNA 1E1KA 4GLOA 3AY6A 9LDTA 3H5AA 4FJ0A 1R4MA 3AM4A 3TFQA 4PG6A 1SOVA 4CM7A 3STHA 1K0UA 1HE4A 3PEFA 3E9QA 3OHSX 1I01A 2ZTLA 2GUGA 4EI2A 1N9GA 4TRMA 1L7DA 4OXYA 4GX2A 3T4XA 1JLLA 1U3WA 1IZ9A 1FDUA 1UDCA 3WG9A 1P0CA 3U5TA 1NXQA 2E6UX 1XYGA 2NVUA 4MOWA 2HLPA 3ZWMA 4I5EA 2BFPA 3IP1A 1KYQA 1ZZEA 2VWGA 3JSAA 4GH5A 3WR5A 2VUSA 2WE7A 1DIBA 1ZK0A 2QRLA 1QXSA 3GQVA 3L4SO 3PFWO 3I9LA 1Y8QA 1P74A 3GPIA 3A14A 5A9SA 4ZQHA 4JK3A 4XRRA 2DBQA 5I9MA 4LSWA 4R1UA 5ENVA 4RPGA 1P45A 3WQSB 3U9LA 4XR9A 2BRUA 4I5FA 4EDFA 1DIAA 1H6BA 3AFMA 1I32A 3UXYA 3EHEA 1YL6A 3BZUA 3OQ1A 2BLLA 3HDJA 1VJ1A 3F9IA 3IMFA 4NBUA 4QO8A 1ISJA 1XCBA 2IXBA 5F1PA 4EEZA 5BQFA 1C0KA 4B4VA 1ISGA 4D7AA 4F3YA 1WNTA 5AXAA 1YDEA 5COAA 4ZRNA 2C82A 1LLQA 1I36A 4H16A 4R41A 5CPFA 4RF4A 2FMUA 1B15A 4EJMA 4YT8A 1M6HA 5TQVA 4E5KA 2X58A 1BXZA 1VJ0A 4HADA 4KWHA 3VPHA 4AL4A 4IZIA 5A3JA 4OQYA 1ZK2A 3BMNA 3V1YA 1U28A 1DJQA 1YJQA 1AXGA 4OXNA 1GZ4A 4GWGA 1Y7TA 2DPGA 1BSVA 1EUCA 1Y5RA 1YQGA 3VKUA 4AJEA 4BNKA 1Y8RA 4RJTA 1BW9A 3GHYA 4DRYA 3GA0A 5KKAA 5L40A 3ANMA 2QZZA 4J9UE 2E4AA 4IUYA 4JXKA 4Q3DA 4DPKA 3SJUA 2H5LA 5TLSA 5HA5A 1N5DA 1YWGO 2A94A 2IDZA 3JYQA 3HN2A 1WZIA 3H6KA 3MJSA 4O0LA 3NTQA 3WNQA 2PLAA 3KHUA 2ZTUA 5ER6A 4DTIA 3ASUA 1Z45A 3ST7A 1SC6A 5FWNA 1TI7A 1ZFNA 3OECA 3GDOA 2D5CA 1T2DA 5ITWA 2EGHA 4ALJA 4J43A 1FDSA 3E6AA 2Y0EA 3L6OO 2WD8A 1MG0A 3NKLA 4PLTA 1U4SA 4FPXA 2SCUA 3EY4A 4ZN6A 3JD1A 1ML3A 3ADPA 1KY5A 1HE3A 3INGA 4CUZA 2HAEA 3OICA 1MC4A 1VLLA 1Z7EA 4MJLA 1OAAA 1TLTA 1AE1A 1P1RA 1UP6A 1SPXA 1P44A 1VRWA 3E5MA 5JY1A 3K96A 2CSUA 4CMHA 4KP7A 3I9NA 4ZQGA 4AJNA 1SZJG 3JD4A 1R16A 4ZQEA 5DDIP 1QRRA 1KBZA 3LC1O 5DP2A 4CM3A 2UDPA 1M75A 3LU1A 4CM8B 1DAOA 1TT7A 4NR0A 4TSKA 3ON5A 4ZHSA 5IZCA 1A9ZA 4XIJA 1R37A 4CPDA 3SC4A 2A9FA 3MTGA 3ABIA 4BNVA 5GMOA 1UDAA 5I7SA 5KJFA 3S2EA 4DPMA 3ZWWA 1V8BA 1WW8A 5HTOA 2Y1FA 1XU9A 3ZWAA 4F46A 2B35A 4IM7A 3D3EA 4OOEA 3H8VA 4BNWA 1TXGA 4Z0HO 1OC4A 5KJ6A 2O2SA 3KYCA 3WQQA 4TZTA 3PPIA 2OORA 1DFHA 2AQIA 3PQDA 1LDGA 5G4LA 4YAKA 3VH2A 1A27A 4BO0A 3JQFC 3JD0A 1GYRA 4RVUA 2IEDA 3C1TA 1DFGA 3ZWXA 1XWFA 4M55A 2FP4A 4UUPA 3ICCA 1J0XO 3SLKA 4QX6A 1TB4A 2YUTA 3DDNA 2HRBA 3D5TA 3V2GA 2F00A 3HDQA 2PWZA 1PS9A 1X7GA 4CR8A 3DFUA 1BRMA 3H4VA 4MVJE 4XB2A 2OMEA 1A4UA 4WLVA 2PGJA 4WLNA 1B7GO 1QLJA 4CQLB 2HK9A 5A04A 1ULSA 3HFGA 1P1FA 4K6CA 4RPHA 4UUNA 1R0KA 4IDGA 1WP4A 5KIAA 5TX7A 1ADGA 1RM0A 1MB4A 2ZB7A 3PYLA 3QJ5A 3QQPA 4DBZA 1BXGB 1RM4A 1S6YA 3BIOA 3Q11A 4OSOA 3GHHA 4OO3A 4XGKA 2ZCVA 1PL7A 1C3VA 3DOOA 4NU5A 3KLPX 5GZ3A 1ZUD1 4XJTA 1R15A 1LA2A 1YONA 4YDRA 4XYMA 1E3WB 3SJ7A 4B3IA 1XEAA 1P77A 4TVOA 4YJFB 1X7HA 3FWZA 2CNBA 2VWPA 2Y1GA 2X8LA 3JCZA 3K73O 2B37A 1T24A 4JX8A 4PLHA 4E31A 2QW8A 2DQ4A 1ZKMA 1B0AA 4IY1A 1ARZA 2G17A 2IEBA 3QLJA 4KTTE 3UN1A 3PYMA 1QKIA 4XR4A 3IL2A 2B69A 1AGNA 4HUJA 3WIDA 2BFMA 5EL0A 5TF4A 5BSEA 4E2XA 1E3EA 3BXXA 4PZDA 4MVJA 1FF9A 2BH9A 1UZNA 3WYCA 3AM3A 1ISIA 3RU7A 5AQ1A 5JS6A 2PZKA 2EV9A 4XGNA 2JCVA 5L51A 2Q50A 1ID1A 2ZB8A 4B7XA 2E48A 1HTBA 2FZWA 1YOVB 1C1DA 1NR7A 2GRAA 1D7OA 2RHRA 5I7EA 1A9YA 1P1IA 1GCOA 2X86A 5BNTA 6ADHA 2TMDA 4PLWA 4RDIA 4CUJA 1PR3A 4J0FA 4UULA 4YTEA 3ZW8A 4D42A 4BO8A 4WEOA 3ETEA 3UCXA 2H63A 4ALKA 4WKGA 4BNUA 2Q3EA 3I1JA 4DLLA 1O0SA 3A4VA 2EGGA 3VPFA 1K2WA 1NAHA 3PVZA 4OMUA 4WCFC 5EMHA 3RBZA 1E0DA 3DHNA 2VHYA 5JAMA 3HJAA 1KVUA 2Z1MA 4FJ1A 4YT2A 2I99A 1JVSA 2JAHA 3C1AA 1EBFA 5BSFA 4B8ZA 3VPXA 1ISHA 3I9JA 3PWSA 3DC2A 3QVOA 3HN7A 3HG7A 4C7KA 3ZGYA 1ISMA 3DFZA 4J6FA 4YR9A 2WWRA 4HXYA 1XDWA 1LDNA 3AY3A 1H94A 5DCWA 1HT0A 2JKVA 8LDHA 1PGPA 2VQ3A 4LCEA 4BVAA 3LVFO 3V1TC 4IMRA 4BNGA 1EQ2A 2GO1A 1XQ6A 4D46A 3UF0A 3ULKA 3IQDB 2ZQYA 2V6BA 1KVTA 1PWZA 4FFNA 3RC7A 1PZEA 2C59A 1C0PA 2VRCA 3GMSA 4R1SA 1F8GA 4HP8A 5JCJD 3RKRA 1GDHA 1YDWA 4CMKA 3QY9A 2HJSA 4DXHA 2QZ9A 4MVJF 4CV3A 1LDEA 2V6MA 4OHUA 3LC2O 4B3JA 1YB4A 4JLWA 3WS7A 3GEMA 3TNLA 4PLYA 3GRKA 4U6QA 3NAQA 3QE3A 4MO2A 2HMWA 2C7GA 2R6JA 1T1RA 3JYOA 4GPD1 3ZHZA 2A92A 1AN9A 1T1SA 2Y67A 2W2KA 1PJ3A 2DLDA 4J4TA 1LLDA 4FFMA 3NEPX 2PGDA 3I4FA 2O2YA 2EHDA 5A9RA 1BVRA 3LYLA 5AOVA 1UR5A 2VTEA 4A10A 5EINA 3M1LA 1O8CA 4PZCA 1UXJA 1B14A 5JBIA 4JJGA 4RVHA 1NFFA 3UICA 1B3BA 5EQFA 1U8FO 1JN0A 3GG2A 1PJ2A 3PDUA 4B7CA 4YEDA 3JQ7A 4BOYA 1U3VA 4YA6A 4YPOA 1GYPA 5I8WA 3S2GA 3PZBA 3X2FA 2PD3A 2OXIA 3TPCA 3F47A 4INAA 3ITDA 4YT4A 4E21A 2OBYA 3EZYA 2GZ3A 3BMCA 3BYZA 1VSVA 4EUFA 3NT4A 3G1TA 4BO6A 3OIGA 4A2CA 5C7OO 1DAPA 3GZNB 3LSYA 2VHVA 4HWKA 1VM6A 4CMIB 1LUAA 3ENKA 1GUYA 3NT2A 2HU2A 4JP2A 3FPLA 3TF5A 3S2FA 2GN9A 4RZIA 2EKQA 4LISA 2Q1WA 1EDZA 2AE1A 2F1KA 4E5NA 2NV6A 2YFHA 3ZV6A 5L7TA 4CM9D 3EGOA 3RU9A 1NPTO 3C85A 4QEDA 1IZ0A 4ZJUA 2QRKA 5C37A 1Q0HA 4BNNA 3BHJA 3Q9UA 3FNGA 1Q7CA 4I9HA 4RF5A 1NFRA 4L4SA 3TSCA 2C2XA 1SO8A 3GFGA 2VYNA 4Y67A 4NQZA 1GCUA 1PJCA 1F17A 4BQPA 2VWHA 3UFXA 3DBHB 4RGBA 1HETA 5G0SA 3PWKA 1NAIA 4IDAA 3OIFA 3BMQA 3E8XA 4CLEA 2HCTA 5CPBA 3S2IA 5AYVA 3NX4A 4TRRA 1QYWA 1SBYA 3LT1A 4WLUA 4YJGB 4BNTA 3S1LA 3OSUA 1M66A 1E7SA 3FI9A 4E4YA 1E5QA 3QWAA 1SB8A 3O38A 1X1TA 3KSDO 5B4TA 2P2SA 1CDOA 2HKIA 4IDDA 4ESOA 3BMOA 1BXKA 2GCGA 5K9ZA 5TS3A 4GKBA 3ONFA 4K9DA 2VT3A 2I6TA 3NYWA 1E7RA 4PRKA 4JROA 5I7VA 1NPYA 1TT5B 2FHSA 4PLFA 2QIOA 2GZ1A 2UUPA 1I33A 1SEPA 1PJSA 3KYDB 2E37A 4GQAA 3FR7A 4D45A 4Z3DA 2WDZA 3ZHXA 5JSFA 3WGHA 3ZU3A 2DT5A 1T25A 1IUKA 2DTEA 3TZ6A 1DIHA 2WYVA 2Y1EA 4UVHA 5DOVA 3HE3A 2FPIA 5JDIC 3FTPA 5L7YA 1DEHA 3K30A 1U2DA 2VZ0A 2AMFA 5FI3A 5FI5A 1LLUA 2AG8A 3WYEA 1A4IA 2DBRA 3DHEA 4HNHA 4EEXA 4CLOB 4P4NA 4XGIA 3P2OA 4E6PA 4XRGA 3LC7O 4ZQBA 4O1MA 4RL6A 1RYDA 2BGKA 4II2A 3TWOA 1GADO 5CG2A 1I2ZA 2HJRA 3COSA 1HYGA 1CETA 1IOLA 5L4LA 1PGNA 2BGLA 1Q7BA 3GAZA 3MJ4A 3H7AA 4MP3A 5B37A 4CM1A 5TC4A 5LDHA 4AJ2A 3RASA 2X7HA 3E9NA 5IZCC 1FMCA 4KWIA 1P0FA 1SOWA 3RD5A 3GH3A 5K0ZA 1HXHA 2Y68A 4BNFA 3BTUA 2Q99A 1RPNA 5BSHA 1VL0A 2GDZA 2YQ4A 5KWEA 3M2PA 2WJPA 4L4RA 3VTFA 1E7MA 1J5PA 3K2EA 3U3XA 3O8QB 3RUCA 3OA0A 1DIRA 4HFRA 2ZKLA 3JQAB 2X1HA 1C0IA 4YBZA 3FNHA 5CEEA 3QWBA 5IF3A 1C14A 4BUCA 1DDOA 1Z75A 2X0NA 1K5HA 3DHYA 4WJZA 4JP3A 1Z6ZA 1JWAB 3GNSA 5CDYA 3VPSA 1LLCA 1NVGA 3ONEA 4B8WA 3WTBA 1Z73A 1R12A 3H5RA 4GAEA 1PQUA 5HS6A 4DL9A 4GLLA 2AQ8A 1PU2A 2NUAA 5KTKA 3Q6IA 3U62A 1BHSA 2JHFA 5H82A 3IUSA 2DUWA 2FRDA 4RVDA 4YAGA 4K26A 1X7DA 1C1XB 2EXXA 2PTGA 3AM5A 2GLXA 1JTVA 5CDSA 2CDCA 2WTBA 4U0KA 3KTDA 3CH6A 4TWRA 5IFLA 3JQ9A 2CF6A 4UAGA 5BNIA 2BI7A 4ALNA 4CJXA 1H6AA 4FW8A 2OGUA 3QVSA 3AOEC 3TL3A 4NJMB 3IDSA 5LCXA 4GVXA 2OHXA 1IL0A 4OAQA 2B83A 3B1JA 2G5CA 2OL4A 1OI7A 4U0JA 1HDRA 4IQ0A 2CVQA 3D1LA 3Q2IA 3PHLA 4M86A 4O59O 3X2EA 5JAQA 2CUKA 4XQCA 4DWVA 3ZWCA 5L4NA 3D4NA 2Q1TA 1CERA 1LJ8A 3C24A 3QHAA 4WK6A 4NFYA 1CF2O 2GN6A 1I3MA 4PVCA 9LDBA 1K6XA 1KEUA 3IOYA 1MGOA 4BGVA 1KIFA 1GU7A 4RDHA 5KVQA 3GVHA 2GSDA 1NQAO 3DBLB 1YQXA 4YAIA 3MCVA 3OJOA 5JAZA 3ROPA 5IDQA 4OL9A 1NM5A 2Z1NA 2OUIA 1YL7A 5HS4A 2O3TA 1PJLA 2J3KA 2NLOA 3LQFA 4JGBA 2BHLA 7ADHA 4GGOA 3AY7A 2GERA 2ZTVA 5G4KA 5A3VA 3WLFA 2O23A 3GUYA 3ROMA 2GD1O 1NR1A 1DRVA 2WYWA 2P5UA 3DAFA 4B7UA 4DREA 2H1SA 1NHGA 1YQDA 5COBA 4BQRA 5KNLA 4M1QA 3FN4A 4E3ZA 1R6DA 5GZ6A 2HSDA 2NACA 3L0DA 4IDBA 4DLAA 5KCZA 3VVCA 3DO5A 2DTXA 3RJ9A 1T26A 2HO5A 3HADA 2AEFA 4XYEA 4CR6A 4OQZA 1ENOA 2ZK7A 4Z0TA 3E03A 3K9QO 2IYPA 2WD7A 1NQTA 5IAAA 1Q2XA 2NADA 2NTJA 3F5SA 1WAMA 3AW9A 3ANNA 1V9LA 4HKTA 1I30A 3PQEA 4N54A 5TSDA 3VZSA 1V35A 1W73A 4MP6A 2P4HX 2HK8A 2I5PO 4N5NA 4J91A 4XYGA 3H9GA 5JCJA 4CMEC 2Y0CA 3VH1A 2ZATA 3SEFA 1PGJA 1U9JA 1IY8A 4IPTA 3EZLA 4KOAA 2X5JO 1EVZA 2EJWA 4CV0A 1HDYA 2RIRA 2C2YA 1ZCJA 3KEOA 3JYNA 3WICA 3F46A 4JNKA 3DTTA 5A05A 4O6VA 3EVTA 1WPQA 2C20A 4MVJH 5TNXA 4IXWA 3FNEA 1MUUA 1ZBQA 1ZO8A 2Q2WA 4XWYA 3OQBA 5KJCA 5B1YA 3QWHA 3AWDA 3W4IA 4ND2A 4NI5A 4FOSA 1LRLA 2EW8A 3HZZA 4I9UA 4KUEA 4J4BA 2W2LA 1JVBA 1ZJYA 5CP8A 2P91A 1PTJA 3SC6A 3MOIA 1ZMTA 1DSSG 2VHWA 2IZZA 5L9AA 5IDYA 2P4QA 4CLDA 1E5LA 4YAEA 4M8SA 5DF1A 3OETA 3DMTC 3WSWA 3K31A 5L95A 3NT5A 3PJEA 2FN7A 4CM8A 1ONNA 2PK3A 2NVWA 4J7XA 4XQEA 4GGPA 1P31A 4RPJA 3IJPA 4DLBA 1H9BA 2BD0A 3WSVA 1BDMA 3VTZA 3MOGA 1JKFA 4AICA 4CMGA 3GGPA 1H5QA 4YQYA 1DC5A 2NVUB 2VYVD 3JQAD 3L77A 5JDIA 3WTCA 3I6IA 4YT5A 2GGSA 4DA9A 1W4ZA 3AUUA 1HDGO 1B16A 3WWYA 3DWFA 4DBVO 2DFVA 2D4AA 1T2EA 4KQXA 1A71A 3CEAA 3CINA 3V8BA 1K6IA 4R9SA 1MP0A 2PKQO 4GVLA 4MVJP 1IE3A 1LXCA 1VL8A 3HNPA 4BMSA 2VNSA 4IXTA 3TQHA 2EEZA 1QV6A 4CMAA 4A03A 3FPCA 1T2AA 3E82A 2JL1A 4CM9A 4IQGA 1GEEA 4CMJA 5ICSA 4J2OA 2O3SA 1PX0A 2YHIA 1DFIA 3JYPA 4HY3A 4Y6SA 5JC8A 2FR8A 2DFDA 3L9WA 1GQQA 4L9RA 4CQLA 3PHGA 2HDHA 4CV2A 3ZNPA 2DBVO 4PZEA 1NASA 4F45A 2Z5LA 1JU9A 3FTNA 3D5QA 5DZSA 2Q1SA 3WMXA 5F3RA 3NDRA 3O9ZA 2OOSA 4OKIA 1XIVA 1PJ4A 4P22A 3WXBA 3GT0A 4ALMA 5T67A 3A06A 4KUHA 2QYSA 3JQ8A 3LZ6A 4PRLA 4YCAA 1L7EA 1YL5A 1I24A 2GYYA 1IULA 1E3WA 4IJUA 3RROA 4LGVA 3SLGA 4YJFA 1GZ3A 1KEWA 1RWBA 2HMTA 1WVGA 2BMAA 2FSVA 3I5MA 4QFCA 3RUAA 3W4JA 2VOEA 1LDYA 2H9IA 2I3GA 3OBBA 1UXGA 1MXFA 5ER9A 4FD3A 4XYBA 2FOIA 1QORA 2WMDA 3RC1A 1EFKA 4BKQA 1ISFA 1KETA 3UCFA 3MEQA 3RBXA 1YH3A 3W4KA 5U9CA 4D0RA 2I66A 4UVIA 5I9NA 2O50A 4R3WA 2C0CA 1YJ8A 4A0SA 3FD8A 1BGVA 4BO2A 4XKJA 1YOVA 4P8RA 4Q3AA 2GZ2A 3OQ6A 3RAJA 4E2ZA 1B8UA 1E6UA 2O7QA 3RUHA 4BO3A 5BNFA 3NRCA 5C7IO 3AOEA 3QV1A 3DQPA 4E2YA 5ILOA 4PG7A 1GL3A 3WGZA 4IMPA 3ZH2A 3PGXA 2AE2A 3UHAA 4WGGA 4CQMA 1R4NB 3ETDA 4Q3CA 1I3NA 3O03A 4A7PA 3TFOA 1ADCA 3GGOA 1GZ6A 4ND3A 3ROQA 2NWQA 4PLCA 1Q0LA 4TMFA 1LC0A 3SXPA 4O63O 4DIOA 3IJRA 4N5MA 4IIVA 3FWNA 4J16A 2EG9A 2YV3A 3KYCB 3GGGA 1ULUA 3N7UA 2C5AA 2VHXA 1KS9A 3PJFA 1LTHR 4NH4A 4KMSA 4LSMA 4D41A 1X14A 4H15A 3OJLA 3P2YA 4I5GA 1BWSA 2D3TA 1GEGA 3ETGA 2FZEA 1IHXA 1O89A 1NYTA 4CM4B 1LQUA 1A5ZA 2JD0A 4RF3A 4PVDA 3P19A 1HZJA 1WDKA 2C29D 4ND4A 4EZBA 2EP5A 1LI4A 3ZWOA 1RM5A 4BNHA 4IINA 4BHTA 4BKRA 4CUKA 1ZH8A 3MZ0A 1FJHA 3OJFA 4WNCA 1TA4A 5DBGA 1EVJA 3GVPA 3KVOA 3B6ZA 5IZ4A 1PS0A 2IZ1A 4Q9NA 2QX7A 1OC2A 1O6ZA 3D0OA 2D8AA 3OJ0A 3GG9A 1SMKA 1ZJZA 4Y6RA 1QSGA 2WM3A 2X23A 1CEQA 4MVJG 4A26A 5KJ1A 4NZ9A 1NWCA 2H6EA 2J3HA 3NV9A 3ZV3A 3DMYA 3WBBA 1ZNQO 3JQ9C 4UVGA 2A35A 4LW8A 3RWBA 2GN8A 3HHPA 4N5LA 4DGSA 4AJOA 3K6JA 4Q3NA 1G0NA 3IUPA 4YXFA 3VDQA 1YVEI 3INTA 3ZZNA 2C7VA 1JAXA 1YGYA 4G65A 2EW2A 5JMWA 5L45A 3WDSA 4W7IA 4E30A 2CFCA 1I0ZA 4K1LA 4CMEA 3JQGB 3RFXA 3KBOA 3RC9A 3W6ZA 2D1YA 2FY8A 3FF4A 4YRDA 4XIYA 1WDLA 4NFHA 1HSOA 3INRA 4LRTB 1MX3A 3VHRA 4AJIA 5JLAA 3H2ZA 4RLSA 2ZIZA 3CMCO 2X0IA 4E2WA 1ZK1A 2Y93A 3AI3A 4GSKA 3WMWA 1U1IA 4NBRA 7MDHA 4CMIA 1M67A 3GZ4A 4PG5A 4AJLA 1E6WA 5BR7A 4YAJA 3R0IA 1KC1A 5T57A 4AJKA 3IC5A 4S3MA 4LCJA 1MA0A 4ZICA 3OMLA 3CPSA 3I3OA 3LK7A 3PWZA 5LDGA 4EUEA 3G79A 1QYVA 4QUKA 3GC6A 3F1LA 3IAHA 4DC0A 3IS3A 4EJ6A 1M76A 3I4CA 4L73A 1NFQA 2POQX 4IQ8A 2B4RO 3I83A 3HQ4O 2NU7A 1QP8A 3DMTA 1QLHA 5JYDA 1FDVA 3PK0A 4J3FA 4MPDA 2V6GA 5DP1A 3JV7A 1UXIA 3CTMA 4P4LA 1JW9B 1ZIDA 3DB2A 4UUMA 1MLDA 2VHZA 1DHRA 1E3IA 3DBHA 3KLMX 3H9JA 4UVEA 4U8GA 3NJ4A 2EKLA 4PIVA 3TOZA 3ZWYA 5H83A 1WXDA 2NQ8A 3U4DA 2O4UX 4RZHA 2XXJA 4L74A 2ZB3A 2RAFA 4QSMA 5G0WA 1Y9AA 2Y1CA 4YJGA 2E82A 3LF1A 2GF2A 3C8MA 1ENPA 3RUEA 5A06A 2X22A 3UH1A 1M2WA 4UEKA 4XB1A 3ZV4A 1EE2A 1ONOA 2NM0A 4E0BA 2BFOA 1OMOA 2PKRA 5EIOA 4M89A 1KVRA 3QA9A 2GN4A
chains in the Genus database with same CATH superfamily
1X92A 1D5CA 2E4WA 3KKLA 4GOXA 4MYCA 4Q48A 5DTQA 3RQIA 3ZI7A 2ZDGA 5GAJA 1TT5A 3P52A 4MMZB 5JMTA 2P7IA 3AP3A 3DKVA 2GHIA 4A91A 1Y81A 4RXTA 5ESRA 4FR0A 5GV8A 1TU0A 1G8KA 1QH1B 1YB5A 4CZ2A 4WDQA 1UFOA 4CL3A 4C3OB 3RQSA 1Q84A 4QNRA 4MKRA 1ENZA 3TUJC 4EUHA 2P5YA 1J56A 1N2CE 3IAAA 1Z0IA 3CZRA 5FBHA 3VH4A 5D1HA 2J4DA 4LCBA 1EBUA 2OG2A 1V43A 4ALLA 4F71A 4KQ2A 3P7MA 1C4KA 4M0LA 2XB9A 3W1VA 5AM3A 2Q7OE 5SY9A 3ABRB 1FYWA 1Y1KE 1CW2B 5I8PA 2YN2A 3GVXA 3FPBA 4IW3B 4TMYA 5FUBA 1KNXA 3I5UA 3N2NA 4WBNA 2DR3A 3A37A 2H1IA 1JV2B 3ZU2A 1XTRA 1W36D 4U7GA 4FJ2A 5JZBA 5LN1A 4DA7A 3O8BA 1IIRA 3AIIA 4TUYB 2YWCA 4BYGA 3G1UA 1AKEA 5HE8A 1UBGA 4LQLA 2GS9A 1K08A 4ROSA 1HRDA 4MZXA 4TQAA 5JVDB 4ZI5A 1U7WA 1Z6TA 4BIIA 4FFOA 1UMDA 4XTCS 2A9QA 1JSXA 4X24A 1P19A 4YQEA 2PUAA 2Z6UA 1SOMA 1CZHA 3BD6A 2WJZB 3NDJA 2V6FA 3F6PA 3I2HA 2ZULA 5DEOA 1VZ3A 1IY0A 3EOBI 4RIFA 6LDHA 5F2NA 4PCVA 2C2HA 4Q02A 3KP1A 4B75A 3IPAA 1W6RA 2GBLA 1OV6A 2OYSA 2YFQA 4EITA 4DQVA 2AWNA 2BCJQ 3KZVA 1FSPA 2QGFA 1N2CA 4BRZA 1XRQA 2JS7A 5NULA 1BTOA 2VUTA 3EYWA 3UT0A 2DKFA 2VR1A 2CV0A 1QOZA 5DM70 1WMSA 3KWFA 3NMUF 2QRUA 1JWBB 1O4WA 1P9OA 1DIGA 1X7XA 3AR8A 4GEGA 4G5SA 5ALXA 3I5XA 1BHO1 2VTKA 2YMQA 3MLEA 4JDPA 2H9AA 2QM7A 1FFAA 1ODLA 1ZH0A 1K3TA 2GZAA 2VJLA 3JAWA 1E8DA 3B9BA 4FMDF 1OB5A 3TLYA 2BTOA 3VOAA 1UP4A 3Q6NA 1EE9A 2MR5A 5BYJA 1X1SA 1Z74A 1Z5GA 2OAGA 3DEYX 1UMBB 4IJVA 4RESA 5IJ0B 4CKWA 5BMVA 3RIHA 3H5NA 1DAIA 1QBKC 2QD3A 3H87A 1F2UB 1Y4UA 2Y1OA 5KVCA 4BNMA 2OLJA 2J48A 2BKLA 1Z88A 2QG4A 3DCNA 4PLGA 1QF9A 4B4DA 1QCCA 1I9CA 2ABWA 3FCAA 1T0IA 4YNBA 2ZI9A 3MVEA 1SUIA 4B80A 4H08A 1DXQA 1ZU5A 2C2KA 2F3PA 3EXIB 4WD3A 5CHYA 5D51S 1N1MA 5B53A 2RH4A 1II8A 1NBAA 3COWA 3QGMA 4FX2A 1LTKA 5F7JA 1FY2A 4RJJA 1E2QA 2AL7A 4MQ5A 2G71A 2IHYA 1HPLA 3ET5A 3U3JA 3BIXA 3WLKX 1Z4QA 4LYFA 4MV3A 3U4IA 4FC6A 1C1XA 4IBOA 1QPGA 3K0FA 3O4IA 2QPOA 3BN3A 4RHFA 5K1ZA 4Q7KA 1KEPA 1KO1A 2IT1A 2NTEA 3PC8C 1Z18A 2XMSA 4BEWA 4ERNA 5AVQA 1SHZA 3VU3A 3RYCB 4KRGA 3DNFA 4GBJA 1UUFA 2EBFX 9ATCA 2FOXA 3N2YA 1OFCX 2VJMB 4KX3A 4A8TA 3QEAZ 1F48A 3F5DA 3CF4G 3AQIA 3JASA 4BPBA 3FHLA 1O95A 2OFXA 4NJMA 5T6MA 2XNDD 3X43A 5GVSA 1U0LA 1XG5A 2OB2A 4NICA 5HG0A 4C4ZA 2AUMA 1YOBA 3KG2A 4FBGA 1WHTA 4TRJA 3U49A 4OKSA 3T1HB 2YHUA 1LRKA 1ES9A 3DDWA 4H6PA 4IS2A 4CLHA 4DCNA 1A1VA 3WQRA 2R62A 1AUVA 2IUUA 4Q7EA 4C2BA 1SA0B 3PLRA 4Q39A 3J81A 1TA0A 5HZGA 4D0SA 2RGYA 2FFAA 1ZMBA 2ZUUA 2GUWA 4B3BA 3H9BA 1Y0BA 4OOFA 3TW6A 2FG6C 2JFUA 4PYNA 3A9RA 1UJCA 3M5PA 3BK7A 2PGLA 2OGTA 3QLEA 5G0VA 3VRHA 3OZSA 3ZIAD 4DY4A 3R5JA 3ZHBA 3A04A 2PX8A 3AHCA 4BGIA 4NECA 5CEFA 1MNAA 4QXQA 4XQ0A 4IX9A 5T64A 5CFZA 4DMMA 5JRZA 2F1RA 1RJEA 1E6KA 3FBTA 1JZSA 3RUPA 3KBBA 5CFOA 1R9GA 4KQKA 2O8BA 1MAUA 4JI3B 5BUQA 1SCBA 5CA1B 3BA1A 4JC8A 1GPDG 1E77A 1NULA 4N3NA 3R40A 5HNKA 3BSFA 3NYRA 2G9NA 4FCCA 2KMLA 4Y9TA 1GUAA 1IATA 3HDYA 2WF9A 1MIOB 4M0FA 4BV8A 4E33A 5BXYA 3CZMA 1U0JA 2MHCA 5FV7A 4C07A 2CBZA 3FYUC 2OV1A 1AF4A 5EMKA 3CNQS 4L5AA 2R66A 2NPOA 5D7BA 4N18A 5EE1A 1ZSVA 1DV1A 1NQ5A 3VR5D 1XB2A 2YHAA 2I2CA 5DSZA 3JATA 1UM8A 2O19A 2E21A 3O8OA 3SHFA 4LRUA 4LTNA 4RK1A 4GZMA 3RIMA 4A82A 4BIMA 1U63A 1N6NA 1KZ4A 3GJYA 4EG1A 4ONEA 1G4AE 4F72A 3ND8A 3WB0A 2JVJA 5THQA 2VK2A 1MH1A 2O05A 4XFJA 5AW0A 2VT7A 4IR7A 2RGNA 2QJTA 3QMPA 3ABSB 1CWUA 2DU8A 5TT1A 4AWAA 4EX7A 4MEJA 4UEWA 4K9MA 1BWRA 2QG6A 1ID8A 2JA1A 4LDQA 5IM5A 1VPLA 4K88A 5JQGF 1NF3A 1P1KA 4M0EA 3T54A 4D96A 2OG1A 2RI6A 3MINA 4J2HA 1IZYA 5THKA 3SE0A 4IG4A 4EW2A 4IJKA 3VNSA 1VECA 2BGMA 4WESB 4R8RA 4H7FA 4ZCMA 3N75A 3IKTA 4GIBA 1ZD2P 4Z51A 1EJ0A 4TV8F 4XWOA 5DFAA 4OJKA 1G20B 2CDRA 2RONA 2VUHB 4UXJA 5BY2A 1G9SA 4AY3A 5FXMA 5J23A 3WNZA 3BJMA 4OIMA 1WXGA 2GCOB 4JJZA 4QEKA 3W78A 4E5SA 3CGGA 4P38A 4YCDA 1R9JA 1NGSA 3HACA 5EJ7A 1D2GA 5INTA 3CW9A 5F9HA 3GAFA 2AJLI 4OKNA 1XRLA 4MHOA 4I1PA 1RRGA 1KE2A 4DLUA 4PYQA 2WHXA 3VI3B 1IQ0A 1ZMOA 4AWBA 1HM5A 1WMBA 3LBHA 5B58C 1WWKA 2CLLB 5IUNC 1TK3A 3GCWA 3ZCPA 3DAGA 1MO3A 3BGWA 3GEHA 3H3FA 4U3JA 4F6CA 1Y5IA 3AJRA 4B3DA 5IKXA 1G0OA 1BQ4A 2X1LA 3GIWA 2H1CA 4MMXB 4ZQIA 3TTWA 2XTAA 3AOGA 4UUQA 3X2SA 1OHHA 4Y3UA 4JP8A 2BONA 1V3QE 1E5TA 3MJVA 3RWOA 3UPDA 2LD4A 2X9QA 1JXQA 1LW7A 4HYYA 3ZY3A 2XKBA 1KMHA 5T6BA 3UMMA 1J9ZA 2C9ZA 4NMHA 2HNAA 3ROZA 1YZLA 3EPPA 3T3HA 3VYWA 3FGPA 2YYYA 2R7AA 3NDIA 4NV0A 1CIVA 2BKXA 3TRIA 4NZMA 2EJVA 1JEOA 1NOIA 1R5OA 3TEJA 2QT9A 3RYFA 2V7WA 3NCTA 1IQRA 3UAGA 4MH0R 2YS7A 2VNAA 5F5LA 4JYPA 4L8FA 1J2JA 1NVTA 1CT9A 1YZFA 4HH4A 2EARA 4DV4B 3IEXA 3S6JA 2M6LA 2QF7A 4E5PA 4ZU1X 4IJ6A 3RG8A 4ER7A 3Q8XB 4NMWA 2O4CA 5G4KB 3C43A 1Y6QA 5U4QA 3TVDA 3OMXA 2FWIA 2WVHA 1T4GA 4JEUA 4HATA 1B41A 4ZVNA 5BRJA 3CJRA 1ZC4A 5SY6A 6REQA 3PPVA 4KOEC 4RK5A 2LVBA 1G291 5JAOA 4X85A 1S9HA 3DG9A 4J9VA 1FMJA 2PZJA 5LR6A 4DEVA 1ZMXA 1OLXB 4WACA 5JI2E 4HDNA 2YJGA 3MTJA 1T4BA 3QBTA 4UNQA 3UMVA 4D8WA 4FQ5A 3AU8A 5EKUA 4QT0A 5T8KC 2R4UA 2LDXA 1F5SA 1IIBA 2UZ1A 3GCXA 2QL5A 3KDAA 3QWIA 4MNTA 1R4MB 1SXJB 4ZCLA 3WO1A 3ZPXA 3ROKA 4YR7A 2JGDA 3QRWA 4LKOA 1IY1A 2GYWA 2O7VA 2V0CA 3FOAA 4EMBA 1S1CA 4GOMD 1N9GB 3DMDA 3RS9A 6GPBA 3DGEC 3ZJUA 1ZIYA 3OZEA 1JLLB 2ZPTX 2VJYA 4CCSA 5HWSA 2PX2A 2VLIA 5EE3A 4OFWA 3LH5A 1EB8A 1JI3A 4G0XA 2A0XA 4HDMB 5F5XA 2NUTB 1YULA 3REQA 3ZS8A 2J3MA 4CQNA 4KMRA 1UZAA 1WLYA 2ZYDA 1RLUA 2FUKA 3L7KA 4LZAA 2UVDA 3EW9A 4PQGA 2W11A 4GXRA 4RPKA 3I6MA 2IUFA 4P82A 5JD6A 1XZPA 3K6SB 5KSOA 1KARA 4DXDA 3U2QA 4EA7A 4EELA 1ZRSA 2AN5A 2VHUA 3WL4A 1E9BA 4AP6A 3N58A 3QVXA 3GYBA 3MCTA 4R9RA 3RHZA 1GL9B 1SWWA 1FDRA 1FPMA 3PKJA 5AW5A 4JGGA 4BVKA 2JKYA 3GLHB 3GFQA 3X2FA 4BNDA 3UWSA 3ZCRA 2EJBA 1YJXA 1FYEA 2XUZA 4U2BA 1NV9A 1PP4A 2AB0A 1UKVY 2H48A 4OFXA 2DFLA 3GRPA 4WXMA 4XD7D 3KVVA 4DGQA 4RA9A 3HKBA 4NAVA 5G41A 3U7GA 2Q1XA 2V97A 4UU7A 4ZO8A 2NSLA 4L9WA 1FQOA 2XMBA 2X5OA 2PNFA 1SQ5A 2QLJA 1BFDA 3ZVLA 2AKYA 3FMFA 1CQZA 5ECDA 4NNOA 2J3QA 4R9VA 3L6DA 4EF4A 3CLRD 3HJFA 5EP1A 5FNVB 1TFRA 2J3IA 2JB9A 3N8DA 4FE3A 4GNRA 1NJ2A 4M9RA 1VP9A 5F9MA 1XMXA 1D8AA 2YQ5A 3HEAA 5LUBA 4MJ7A 3WB2A 4JI4B 2FWJA 2ZUEA 1NQUA 3VDMA 4ZHQB 3E0QA 1ZW1A 5GM2A 3T5GA 4C03A 4EHAA 1Q1NA 5F3WB 1J99A 2PH3A 1BMFD 2PZLA 4X1OA 2XZLA 3MMZA 3AGQA 5EUMA 2Y1XA 4G63A 3D4PA 4DJJA 3H86A 3IP9A 2HSJA 4WASA 1GLGA 3S27A 2QTWB 1QR2A 3S55A 3S8EA 2UYYA 1XVLA 3T9DA 1I1HA 3DEZA 1TMYA 2DPLA 2K2QB 3SJBA 1D3AA 1Q22A 2BISA 1NSFA 3IUYA 5JO9A 3UCEA 4BMVA 4HNUA 2XCTB 2ZAOA 2ZCUA 5I7UA 2QAGC 3VZRA 1OOEA 5IWAB 4LXUA 1L4GA 1QUEA 2IXAA 3RKUA 1O5OA 5HF5A 2YWJA 1V6AA 3VM6A 2ZJBA 1FE8A 2GJ8A 4BO9A 3E35A 5JMPA 4M8KA 1Y3AA 1Y63A 4B79A 2ZIUB 3NHPA 4PGFA 1AQUA 1LWNA 3EQ9A 4ZPXA 3BA6A 3WYBA 4TZ6A 1W88A 3TZCA 3HR4A 4BNJA 2VCYA 5K6RA 3P9XA 2RE8A 2ZVPX 1OR8A 4ZVMA 5L6LB 3OTQA 2GVDC 1KAGA 4L50A 3PS9A 5A03A 2D0PB 3SHWA 2HMVA 3GRUA 4L72A 1TO1E 1LDBA 3QP9A 1GFWA 4YRPA 4G56A 4BMPB 1MQAA 4C04A 3MFYA 4HDKA 2RKOA 1Z36A 2Y9MB 4L8VA 4LQDA 4X41A 5LU9A 5TQJA 2C2MA 2F4VB 3IDOA 1CRPA 4MV0A 3ZHYA 4OF4A 2BR5A 3JQDA 5LYJF 2VVTA 1EQAA 2YHIB 3FPGA 4M88A 4D6YA 1DTSA 2H52A 1H6DA 3KEGA 4KSCA 5JIBA 1HZZA 4GX1A 5KUTA 3K9NA 2Y0DA 2ZVQX 5SY4A 3V32A 1KR2A 2NOGA 1UC5B 3BFJA 1QLWA 1NMQA 4DCMA 1JKXA 5HQTA 3U44B 2WIFA 3MWFA 3NWOA 3WNCA 4N5DA 4DMLA 2VHTA 1IYZA 1FFEA 5CVJA 1O94A 2WU8A 3AESA 3OC0A 3M1AA 3USCS 1L7MA 3WIVA 5KOJA 1G59A 3FAZA 4EG4A 4Z3KA 3IBYA 2UVPA 4RZQA 1E92A 3U17A 1DJPA 4KQHA 1BE0A 3IA2A 4Y2PA 1RKXA 3EZ9A 2GZHA 3PFHA 6NULA 5EJIA 1RSZA 1RT9A 4XD2A 5I7AA 2VJKA 5KPDA 2IEAA 2JJ1A 4LVUA 1A2QA 2H1FA 2JFPA 2WJGA 2XOEA 2ZS9A 4A73A 1FVFA 2NO6A 4GVPA 1A95A 3D81A 4XAQA 4X7MA 1LJUA 1XUOA 1Q11A 2X4LA 3FW1A 4RW0A 2O54A 3FCEA 4BJ6A 5C7LO 3HL4A 4KXXA 1VG8A 5E95A 5TS2A 4AO6A 4EMTA 5JC1A 1QP7A 1YACA 1KI4A 1UBMS 5DNEA 1JFTA 3ODPA 3FDIA 5BYAA 2JAUA 3L82B 4HEA6 3FJYA 1DX9A 3RS7A 2JVIA 1HSZA 4QELA 1H3NA 2PMWB 2WFLB 3DFKA 3DTYA 3SYLA 1S2DA 1W87A 3BM5A 3U48A 3O4HA 4EPVA 2ZYAA 2ZT6A 3MJEA 3CO0S 2CLOB 3GA7A 3FYDA 3SX4A 3M5WA 1FFDA 3NO4A 3OCCA 2CEKA 2R6HA 1SB9A 1U6KA 2BPOA 3Q7IA 4NMXB 4AJPA 5B12A 2ZUBA 2XPCA 3GBPA 5JJ5A 1QFMA 3AI1A 3DO6A 5FUXA 1KEKA 3DULA 2B8JA 2QP9X 1BQEA 5FYDA 4GC9A 3OOHA 4PCLA 1HR0B 2XTNA 4MGHA 2A9JA 1FW6A 4ARBA 1TVKB 4A16A 1B8OA 2WVJA 4IILA 1Y6JA 3ED5A 4TKVB 4AYWA 4BNYA 4KITB 1SUSA 2OP0A 1MD9A 1E1RA 4PSCA 3IXMA 3KFLA 4OUDB 1KQOA 4H1HA 4OCZA 2IRWA 2V6IA 2YNMA 4RABA 1H9CA 4IRMA 3ZQUA 1ZGCA 3B1KA 3T7SA 4MS3A 1TZCA 4MKXA 3PZRA 2YXDA 3CRNA 1LZLA 3F74A 3OM8A 4G4SP 5IEBA 4GX5A 1TTHA 1C30A 3PI7A 2X5KO 4LMPA 3GEGA 5DYNA 3AF3A 3V42A 2JJ2A 2MYPA 3QV2A 4B2LA 1ZGBA 4A4DA 3CUWA 5TE9A 4AY4A 1U7HA 4O5OA 3I0NA 2BGGA 3TZHA 5GGYA 2P75A 1KERA 3HXOA 1FFXA 1MC8A 2OXEA 4JEMA 3LT4A 3PUZA 4XZ3A 4JBHA 5CD1A 1TQ4A 1S3FA 1SAYA 1JPNA 4GXNA 1W6UA 1X77A 3QU9A 4FZJA 1XMOB 2V45A 1JSZA 2YQZA 5IDXA 4U2GA 4HGOA 2PSSA 1FA9A 3Q2KA 4Y2TA 4FDUA 4KKVA 1P2DA 1R0LA 2G0NA 5IAOA 4R8LA 1F0PA 3G82C 3BIWA 1C1DB 3T7CA 5K05A 5KEIA 1L8QA 4KU4A 5EEHA 5F1KA 4BVGA 4A92A 3OVMA 3FPAA 4UBIA 4R1NA 4AZ0B 5BT8A 4UCWA 1URPA 4ZVVA 4P0TA 1JRLA 3U40A 1BKDR 5AW1A 3RVKA 1GSOA 4C06A 1UBCA 5I3ZA 4CI0B 1L6RA 4TSRA 3PWTA 1QAQA 4C6SA 3MIIA 4FN4A 5ERGB 3VAYA 3BDIA 4RXMA 1L7PA 3GRCA 3JQ6A 1D0VA 3V3KA 2ZPAA 1T43A 1R7RA 5HQ3A 4NCBA 4YASA 1T1GA 4ND8B 1W29A 3T5CA 1EVYA 2RAVA 2SICE 3E7WA 4QXMA 4V0OA 4X1YA 3GOHA 4ZV4A 1XP5A 3MWEA 4I8XA 4UNNA 4PE5B 3ZNQA 3OOEA 1JQLB 5KOIA 3WWOA 1XNJA 2WQZA 2XQVA 3ZG6A 3TZBA 3OEYA 4Y2HA 2JAWA 4JJ6A 4ZD6A 4JI7B 4DCTA 3COPA 3RTGA 3CKYA 3KWLA 1W59A 4Q4JA 2JIZD 3HBNA 2GHQA 3GEDA 1H9AA 2C3UA 2W6PA 2WOOA 3SQOA 3CA8A 4MO9A 2O2XA 5IXYA 2CLIB 4QULA 2PT5A 1YTUA 2D6FA 4QBGB 1BDIA 1JKIA 2VL7A 3VR4H 3BRQA 4YWHA 2XDAA 3ICWA 1GCGA 4D3SA 2ANBA 2WSSD 2O7NA 5A3RA 2XZPA 1NONA 5I7HA 3TKLA 1QV7A 2BKEA 3L92A 3HCDA 1FLAA 2CFIA 4FT2A 3C3CA 5AVJA 4ZVOA 4DVJA 4PZYA 1TNDA 2Q8NA 3P2KA 4HLUC 2PE5A 5KWVA 2HMYB 3NVAA 3TAHA 2QZPA 1JI0A 3R3HA 2O8FB 3BXGA 2FAXA 2O20A 3C3DA 2H2WA 3EGDB 3F71A 1AO0A 3ASVA 4JVOA 4UEOA 5G1OA 2QD1A 3PHJA 4IVQA 3OBIA 3WA6A 4I5DA 4R4JA 1CEEA 1GZDA 1BMQA 2VAMA 4XVQA 2HPVA 521PA 3WNVA 1M6VA 4O4HA 4QHTA 1TYCA 2J6IA 3C4VA 3EIFA 4ZV7A 3VR2D 3IP6A 3K4HA 5LLSA 3RSCA 4MWZA 1F14A 1G6HA 2AD1A 1B73A 3KL4A 1UWCA 3KYDA 3OZDA 4MRSA 1RRMA 2JANA 4FC7A 3GLUA 1UMCB 3VPDA 1SZCA 4M37A 3SBOA 5FPKA 4X60A 5IXSA 3HM9A 5JD3A 4GKVA 4YACA 2GBIA 3O8LA 4AXXA 4U7WA 5EQDA 1OBVA 2BSAA 2C9DA 3QU5A 4QU5A 2FKAA 3AUJB 1HTTA 4WECA 3I12A 3DCIA 3KJGA 3H84A 4Q7JB 3BHMA 2X3YA 1T10A 1ZM4A 1VI2A 5DV9A 2P30A 1TZ2A 4F2PA 1U4OA 3PF8A 1CS0A 4QBTA 4FB4A 1T35A 1G21E 4AU1A 2WPNA 5BR1A 1NTOA 2HA0A 3ZGNA 2IHJA 1YJAA 1KDOA 2IBSA 4OSPA 2ZXFA 1DPFA 3CV3A 3OZIA 1AVTA 1JDJA 2E49A 2H31A 3QEKA 4X7RA 5DWDA 4YV2A 4E12A 4XWWA 1EUQA 4KNYA 4JBWA 1S2GA 2BRUC 3OFNA 2XNCA 1EMDA 2BGTA 2HY7A 4JAVC 4J94A 4B48A 2G76A 3LDFA 3QEJA 3S70A 5JAHA 4FYMA 2Q7DA 4R3UC 3L04A 5EQTA 2PXCA 3DEJA 3B3JA 4RJ2A 4ECEA 2Q3LA 5AJVB 4EJSB 1I2CA 3CH4B 4RQAA 4RLHA 4ENPA 4GKAA 3LPDA 5DTJA 4X94A 2NYAA 2W9XA 2WJYA 1QHIA 3BXFA 3MXOA 4WK0B 5A6SA 1MOQA 3NW9A 1I10A 2P78A 2GD6A 3QM1A 2CF5A 2QXTA 2HLHA 4U9HS 1NLZA 3ZGLA 5K3AA 3ADCA 4NK4A 4AG5A 2GPTA 1P2BA 3AVPA 3IDQA 4RZSA 1DEKA 1GNVA 3EUWA 4G97A 5KB3A 2C7BA 2VZ9A 2CEAA 2FR1A 4RHXA 2IPAB 3SZGA 4TXNA 4EG8A 1BX0A 2O3JA 3QVMA 4MIEA 1ULBA 2AW5A 1XQ9A 4AUEA 3RFFA 5ES3A 4DSUA 1MXHA 2BEVA 4R0VA 1B6TA 4Q1FA 1G21A 1ORIA 3G2NA 5E3HA 4OQLA 5KNCH 1XCGB 5FTLA 1RZRD 3LDHA 4IFIA 1S5PA 3C3XA 2W98A 2XUKA 3HKCB 1FDTA 2N75A 3LBNA 3Q0EA 1Z2DA 2VYVA 4GRDA 4KDFA 4R0NA 4YAUA 2XCRB 3CUKA 3PXXA 1E4EA 2C2GA 1FC0A 1HDCA 3KALA 1T8UA 2IU4A 2JJYA 3TOVA 3E4CA 1R50A 4NENB 3HP4A 2WA2A 2AA3A 4Q9DA 1GNPA 5DE3A 3VC1A 4M9SA 4ZVPA 4NDNE 5DWQA 3MSCA 3IOMA 3ERCA 1GG5A 2AUTA 1XALA 2IU3A 1P9NA 3DUFA 3HNOA 3L4BC 4FNAA 4OP3A 4Z9XA 1U3TA 2YZNA 3DEHA 1DT3A 1G7CA 4HQ6A 2BM9A 4ETIA 1DKRA 3CRW1 3UMBA 1CUIA 3MOSA 1PO7A 5D1NA 5AM0A 4CF3A 3PX2A 1NJ6A 3SYKA 5EKSA 2J0QA 2GAFA 1IWOA 5ED4A 4HCJA 5HKKA 3FTQA 4ENUA 2A9VA 3CZCA 4CQMD 3KV1A 1Q0RA 1LGYA 3ANXA 3H5VA 3KV3O 4J90A 3I30X 3GVIA 2R11A 4OYRA 4R9UC 2DKNA 2QQ5A 3H42B 4B3SB 4G5HA 3B3FA 3EWIA 5F1OA 3ZUGA 1AV7A 1ZJ5A 3PTZA 5AHWA 5CFQA 3IB6A 1A9RA 4MK4A 1AOXA 1QR6A 1Y4SA 3F6BX 2E1RA 4QYTA 4R1TA 2XTMA 1OROA 3GT4A 1Q0QA 5FI1B 1RI2A 2HU7A 2MJLA 1X15A 3AERB 3OLVA 3TO5A 1E6EA 4DDVA 1JLMA 5C8YF 1UQTA 5KCZA 2BFAA 5F76A 3FLMA 2CXXA 4RIHA 4WOCA 4NCAA 5K6AC 1VPEA 2YV2A 4PQYA 2O48X 3FLEA 4IDCA 3FUUA 3IVMA 3EMKA 2FETA 1JEDA 1QOPB 3GO4A 1CRWG 3AONB 3A7EA 3QPBA 4KLNA 3OM9A 4MV5A 4QHYA 1T9GR 2HH9A 3OHPA 2ZRJA 5E38A 4OQMA 4DA8A 2JIOA 4P6VF 3RSOA 3VZPA 2EYQA 2YVUA 3PR3A 1ODKA 2I67A 1ZOPA 1IPEA 4F85A 3OM0A 1F38A 2OP1A 3R3ZA 3NIBA 5IJXA 3PRKE 3DTNA 1CB0A 2ATVA 1Z26A 5EKXA 4ZT5A 4FKZA 2ORYA 3SFVA 2I9PA 4ZGWA 4K87A 2HWKA 1RPJA 3LHKA 2WQ7A 4Q3BA 3LUDA 1I1QB 4ESEA 1GQYA 2PEYA 2HXGA 3F6RA 4LWOA 8AT1A 4URFA 1H93A 3RUAA 5B30A 3VJRA 1I1NA 2QRGA 4PN3A 5KYYA 5LNK6 4H3VA 3LO8A 2Q0SA 4M54A 4TS4A 4MRMA 4UBOA 2FSFA 3ZW7A 2O6HA 2C3PA 1C7FA 1YGPA 4A8HA 4QAQA 1M7HA 4EI8A 1Z0UA 1V41E 3A9TA 4O2LA 1EK6A 3EDQA 4UARA 5ALQA 3RSQA 3EGCA 2PU7A 3ZHQA 6CHYA 3G5LA 1XKLA 3RK0A 2VYFA 3GPBA 4QTZA 2GD0A 4Y7CA 3OLWA 2EL7A 3I1YA 3RCBA 1J90A 4XX0A 2Z09A 1MT3A 1T91A 3AL2A 4OB6A 4KI0A 2V5VA 1R6BX 1SRRA 1ORVA 2H9YA 1OLSB 4WW0A 3OQNA 4NX2A 4JKYA 4E5MA 2D59A 4TMTA 1M1NA 4LGMA 4DW8A 3PQ4A 4ODIA 4BB5A 1RXVA 2VTDA 4Z9YA 2BMFA 3SC2B 2FMTA 5A0VA 1NJ5A 2VUUA 2J9FA 1YBVA 2IYEA 1VA4A 4WBXC 1FS6A 1XC7A 3WLEA 5FQNA 4ZVLA 5D7NA 3AK4A 2F1OA 4M7RA 4MQ4A 5U1PA 4LAFA 2B1JA 1U8ZA 4OJYA 4ZARA 1CRQA 2MIIA 4ACBA 4CKEB 1PG0A 2JCXA 5KKNB 2V0GA 4X8MA 4ASUD 1US8B 4XLZA 1P81A 4I55F 1BA3A 2COUA 4A0RA 1MABB 1PR9A 2AMJA 4NFSA 1P2SA 1X0XA 4DWJA 2V58A 3QFCA 5EN4A 2NU9B 3P9PA 2ZSKA 1DE0A 1IN6A 1TUBA 3R3SA 2PYIA 3OTIA 4FGSA 4KDCA 1EXVA 1L4UA 4NNPA 1Z34A 5AKHA 3RVQA 1MC1A 3AMVA 4OYHA 4YJHB 3M3HA 3AF1A 2ZBDA 3EAQA 5KTYA 1VPDA 4AUNA 4HNRA 2BBOA 3NEJA 3KLOA 1P7PA 2XWQA 5E3IA 2FZCA 4RV4A 1Y8AA 3WZLA 3HU5A 1CBUA 1OFVA 3LUFA 1T4CA 3TL2A 4TMKA 3DXYA 3LXXA 4O2BA 4X0EA 5CK4A 3FG9A 4HNAB 1QK5A 3PXEA 4ZT2A 1Q50A 2RBEA 4JQOA 1NF2A 1CNEA 1DC6A 3G2IA 4LV8B 5BPFA 1E3LA 1VP3A 3B70A 1B42A 4M1YA 1G5IA 3REGA 1M2HA 1QMPA 2ZI3A 1Y9ZA 3H3XA 1CE8A 3ECCA 3K0BA 4YCCA 4YUAA 1GUZA 2HA3A 1XPUA 1FIUA 3PQCA 4Z8XA 3MHTA 2IQIA 2ODBA 3H5AA 2VKQA 1XTVA 4M0KA 4M4SA 4QOIA 2G72A 2MSLA 3TFQA 1Q44A 4ZVSA 5LQUA 3STHA 1K0UA 4YMIA 4K6MA 2EATA 4YGXB 5BRAA 3PEFA 1E99A 2RAUA 3E9QA 1I01A 2Q8PA 3LW7A 3CN9A 4L9AA 4H4DA 4Y6OA 7YASA 1QK4A 3TLEA 4TWZA 5KNBH 1CDDA 4PGAA 3GJ7A 5TXGA 1UDCA 4N03A 4QOGA 3WG9A 3WRXC 1E1YA 1NXQA 4MCHA 2HLPA 5CTJA 2BFPA 2AYXA 2PHZA 3R6LA 3P0FA 3QYJA 1HEIA 1SCDA 2VWGA 2XUFA 2VUSA 4GH5A 3FUCA 3WR5A 2QRLA 3H6HA 3L4SO 1MO2A 4UEQA 2HFJA 4PX5A 4PONA 5CM8B 3TQCA 2XECA 3UHFA 3CNNA 3GPIA 2JFYA 2ZVJA 4A0GA 3V4ZA 5IHXA 2DBQA 1W49A 4WKCA 2ZWIA 4NBLA 3WQSB 1P45A 1IXKA 2VYQA 2L42A 3U9LA 3THYA 1Q7EA 5SZIA 3D8BA 2IHKA 2DPYA 5DLQC 2BN4A 1JLRA 4RJIA 3FZYA 4TMZA 3OQ1A 2BLLA 4HQLA 1N8SA 3HDJA 1VJ1A 4IO1A 4TVKA 2JGIA 5ALKA 4G0YA 2GETA 1Z63A 2IXBA 5FOTA 5DIZA 4RY0A 2HSGA 1C0KA 4F3YA 1Q6YA 2QRVB 3H8SA 4TLEA 5FO1A 3G6WA 3VSAA 4F3KA 5KQSA 5AXAA 3QXHA 5DASA 5HKLA 4BFYA 5K8TA 1LLQA 1A77A 3WDKA 4OJMX 2Z56A 3EBPA 3GDHA 3KKNA 4R41A 1DAMA 5CPFA 1XTJA 1B15A 4MI9A 4QDXA 4ZANA 3I8XA 1M6HA 4B73A 3K70C 4HADA 4KWHA 2H1WA 2PG3A 4ZU6X 1L8XA 1H2WA 4IZIA 4OQYA 3QTBA 3AEKB 1XJ5A 4HWPA 3T1YB 1LPBB 1SCNE 4UE6A 4OXNA 5HF9A 3T4UA 1GZ4A 3LP5A 1PDWA 5IBCA 1BSVA 4S1TA 1WUHS 4AJEA 2YH2A 3T1OA 1Y8RA 3QEMB 4RJTA 3THWA 5IVKA 2C95A 3WGKA 1Y3DE 4KAXA 2OV8A 4EHIA 1FL9A 4W1PA 1BJTA 3DDSA 3NRBA 4RMNA 3ZJYA 8ATCA 5KKAA 5M2QA 2V9CA 2IYWA 1QIEA 4EABA 2E4AA 5J2UB 4PGMA 1C3OA 4IIJA 5KS2A 3SJUA 2H5LA 5JXIA 3KZCA 1YWGO 3JYQA 2CLSA 1U0FA 3H6KA 3LDUA 3MIZA 5TF0A 1RWOA 2HT6A 3NTQA 3WNQA 3Q8MA 1H4SA 1QCZA 3O75A 5KSYA 4X1KB 1OBCA 3UQZA 1QKKA 3ST7A 1T8YA 3K8OE 1TI7A 3M3DA 3QKSA 4E15A 4WA8A 5FL7A 2ZBRA 5ITWA 4OY3A 1DBIA 5EY5B 1LKZA 2W0SA 3K32A 4LJRA 3HXTA 4MV7A 4BMCA 1RI5A 2A59A 1JHXA 3R7SA 4RUKA 2QTGA 3OCYA 1GAQA 2NT4A 1TTPB 1FNSA 4ZN6A 2OVBA 2AIRA 2JGMA 4L07A 4EX6A 2ECQA 4KHZA 1Y8CA 4LDPA 3OICA 1NU6A 1N0UA 2WJ3A 1MC4A 1VLLA 1GXSA 2V7UA 4M6WB 4GDMA 4M46A 5F4BA 1SKMA 3O90A 1P1RA 3UJBA 1KU6A 1J0DA 3F7NA 1J97A 1P44A 1A82A 3K96A 1OY1A 3I61A 3OOWA 1DOAA 2CSUA 4KP7A 3OT1B 4FE4A 4OBWA 5EHIA 5LYYA 2WU4A 4Y0AA 3W2GA 5BYKA 2PAAA 3ZQKA 5DDIP 1QRRA 1KBZA 5CX1B 4CM3A 1NMYA 4I19A 1N3YA 3R6GA 4NR0A 3IX7A 3UJ6A 3N2GB 1A9ZA 1YI0A 1KAEA 4YI5A 2A9FA 4JV5B 3MTGA 4ZYTA 3BCSA 4MW5A 2JK1A 1TJYA 2IKSA 4V0RA 2YJTD 1JEQA 3LVQE 5B3JC 4ENTA 2G7MC 2VH1A 4DPMA 3F6CA 1EAYA 1FP4B 2IHTA 3ZWWA 1V8BA 1O95D 5HTOA 2X14A 1R8QA 1LY1A 3CZQA 1R2QA 1CF4A 1YIDA 4NV3A 3G6KA 2B35A 4IM7A 4U2EA 3H8VA 3GRAA 1Z0DA 5KJ6A 1MRSA 5LMZA 1GHTA 1SUDA 3IUJA 4CKBB 1MPXA 3IT2A 3ZE8A 3A3PA 4MUIA 4P3PA 3PQDA 3ORRA 3IT1A 1EWKA 4Q4HA 3TKYA 1GKKA 2KLBA 4N01A 1IEVA 3T7TA 2EJUA 3GPCA 4RVUA 1ZN7A 4TTSA 2HZ7A 2W8BA 4QGHA 4QYWA 4IGKA 4ARZA 1DFGA 2NTYC 1MH9A 2Q29A 2SHKA 1DGQA 1TYBE 4W8OA 5E4YA 2YUTA 3DDNA 4KR0A 1DAHA 5EZ6B 3SLKA 4B74A 3K9BA 4DSTA 2FN4A 3V2GA 5LZ8A 5K03A 5C8ZA 3PEEA 3DC7A 2W48A 3DDCA 4M1EA 5J5VA 4CR8A 4IX1A 3ZE9A 5K3EA 4JUAA 1BRMA 1H4VB 2WIBA 3H4VA 4D80A 2QZSA 3U26A 2OMEA 4AW9A 4F12A 2O5RA 5IPFA 4B44A 4PFKA 4MDEA 1J06A 5CFNA 4CQLB 4BEJA 5A04A 5EXSA 2ZRMA 1YFKA 4RPCA 3UJ7A 4K6CA 3ESAA 1QOQB 3STUA 4NDZA 3QVUA 2J6BA 3FROA 3K6RA 3CWQA 2PX4A 1N5OX 1Q0UA 1XVVA 1O0BA 1P29A 1Z12A 2EQ5A 2X6QA 3K3PA 1U11A 3ZEAA 4KNVA 5KMGA 3FOEC 1G2PA 1RM0A 1MB4A 4HGQA 3OUUA 3PL1A 5J2TA 1BXGB 1S6YA 2WTNA 3BIOA 1KYXA 1WPGA 4NU5A 1ZCFA 4DZZA 1ZUD1 3A3KA 4FEAA 2OXCA 5DM4A 1HYQA 3DQQA 1YONA 3IVGA 4B3IA 2PLRA 4JWKA 3AZPA 1XEAA 1P77A 4DCOA 3CLRC 1X7HA 2ZIGA 4F4UA 1JEAA 3K73O 4E31A 4JX8A 3DMRA 2DLNA 2DQ4A 2ZE8A 2R7LA 2DUJA 1H0HA 1WQ4A 1M2VB 3TG2A 2G17A 3QLJA 3UN1A 2YJ6A 3CYFA 4XCXA 2FEKA 4F2GA 5AM4A 1TD9A 2WHYA 4W5HA 1ZD8A 1AGNA 3WIDA 4EKGA 1OXBB 2P6OA 2BFMA 3WIOA 2CLKB 3EUFA 4US2R 1W9HA 3PE4A 1E3EA 1LPMA 2V7EA 4RIIA 4XIIA 4MVXA 4XWAA 5GV7A 5A1JA 3K1ZA 3QBVA 1YS9A 2B99A 3EEQA 2VNJA 3RU7A 3NAMA 5JSZB 2MSDB 3D6NB 4MQFA 4KRFA 4C21A 2Q50A 2OCYC 2ZB8A 5IM4A 2IGTA 4PAGA 2VBIA 3MRVA 3V4OA 1Y4DE 3KT0A 1ESZA 4DYHA 1ST3A 3MMSA 1P1IA 2X86A 5BNTA 6ADHA 4PLWA 3KS9A 4HAOA 4CDMA 4OHPA 4D42A 4RZXA 1IM5A 2H18A 4BO8A 4CTKA 4TWJA 2MR6A 1B93A 3MSXA 4ALKA 2CLCX 4WKGA 1KU0A 5CLJA 3HUEA 1P7ZA 5EYPB 5JLJA 4DLLA 4NMLA 4CKZA 4V1CB 4IIGA 2NZVG 1YAHA 4H1TA 5DNUA 1U8AA 1K2WA 2G8NA 1OFUX 3NC1C 3PVZA 3K9LA 3H1PA 1E0DA 4WCFC 5FWXB 5HM6A 5KU7A 1SIUA 1C3XA 2E89A 4IJ5A 2QXYA 2R8YA 4DQKA 2FWNA 5C1OA 2I8CA 2Z1MA 4FJ1A 4HI0E 4QUJA 1Z6AA 4S1OA 4YT2A 3C1AA 3OEEA 3B6IA 3F78A 5BSFA 3F73A 5KO2A 4GMHA 4B8ZA 1SG0A 4XOIA 2H1RA 2VF2A 3ABOB 2IIBA 1JPJA 3RAEC 3PWSA 3G9XA 5AW6A 5AVTA 1FLVA 3EFHA 3HN7A 2ECKA 4C7KA 4GR9A 4HVTA 4J6FA 2WWRA 4HXYA 4LZOA 1YT5A 5DCWA 4DA4A 1HT0A 1L7XA 1AQYA 1PGPA 4LCEA 1OHHD 2H2HA 2NUBA 4X00A 4D56A 1E18A 2WSIA 5EUBA 3RRJA 4B34A 4BNGA 3BD7A 4DZRA 4M9CA 4ZI7F 1GITA 2EFDB 1FSZA 1MEEA 5F35A 4E5NA 2V6BA 1PWZA 4U7TB 3HEMA 2VRCA 1C0PA 1OV4A 3FPFA 3KE9A 4R1SA 3M9XA 4TLMB 3RKRA 1GDHA 4DR3B 1XMIA 3VC2A 2J6HA 1E32A 3QJYA 4D3YA 1A3CA 3QY9A 4LA4A 3EUAA 4YAOA 2WVGA 2QNRA 4G5OA 2R25B 1GDTA 1GTJ1 2X7XA 4K9QA 1QHYA 3VYVA 2UXDB 1YB4A 1OAOC 4YUXA 1EDDA 3GEMA 3WHIA 3TNLA 3IUEA 4MV4A 3NV7A 3GRKA 1FMLA 3NAQA 4U6QA 2XVAA 3SOPA 3H0CA 1UJBA 4JFRA 3QE3A 4MO2A 2HMWA 1CZNA 2A6PA