3PEHA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of a thienopyrimidine derivative
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
261
structure length
261
Chain Sequence
ESMESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of a thienopyrimidine derivative
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Chaperone
molecule keywords Endoplasmin homolog
total genus 78
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pehA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pehA01
2XABA 4MOTA 3T0ZA 4XE2A 4LWFA 4CE1A 5C93A 5M4EA 3R92A 2ESAA 3D36A 1UY7A 1Y8OA 2JKIA 4U93A 4DUHA 5IDJA 3INXA 4GFNA 3ZKBA 2H8MA 4KFGA 2FYPA 4AWPA 2WI3A 2IOQA 4EGHA 4XITA 2XHRA 3CRLA 4O07A 2YE7A 3MNRP 5FNCA 4JQLA 4LWGA 3TZ5A 1QY8A 5FNDA 1ID0A 1I5AA 1BYQA 2BU5A 2ZKJA 1EA6A 2YKEA 4XKOA 4NH9A 4XKAA 4HYMA 4MPCA 4LP0A 4EGIA 1ZXMA 2YECA 4QPJA 2XX2A 4JASA 4O09A 3ZM7A 3H80A 4KSGA 4O0BA 3KE6A 1UYGA 3VHCA 4URMA 2YEIA 3VADA 4URLA 3EHFA 3RKZA 3BMYA 4V26A 3T1KA 4CWOA 3PEHA 1UYLA 4BAEA 2AKPA 4ASAA 3HYZA 2YE4A 1US7A 2WI5A 2BRCA 2WEPA 4XD8A 1AH8A 2VW5A 3A0TA 3HHUA 2E0AA 3D0BA 4MPEA 2WI2A 4Q20A 4EGKA 5D7DA 3R4PA 2VCIA 2YEEA 2IOPA 2Q8GA 2XDLA 4KTNA 1Z5AA 4JAUA 2QG0A 4LWHA 4XTJA 2XHXA 4WUDA 1UYFA 3INWA 5FWKA 4X9LA 4YKWA 3O0IA 1NHIA 2BU6A 3T10A 1GKXA 5J6AA 2IWSA 1YESA 1H7SA 4HXWA 3GIGB 2UWDA 1UYDA 1U2OA 3CRKA 2IWXA 2EXLA 2CGFA 3JZ3A 3R4OA 4B7PA 1KZNA 4MB9A 4I3HA 2QG2A 3A0YA 1GKZA 2YGEA 1BGQA 2XX5A 4PL9A 4H81A 3ZXQA 1Z59A 4L91A 2FXSA 2YI7A 1Y4UA 2BZ5A 2C2AA 2Q8HA 4FPPA 4EM7A 4CWNA 4FMTA 1BKNA 3QDDA 2Q8FA 4YKQA 2YKBA 3VHAA 4JAVA 1I5BA 4R1FA 4ZKIA 4XCLA 4DZYA 1Z5BA 3B25A 3G7EA 2WEQA 4BQGA 4CWRA 4YKRA 2HG1A 5CTWA 4MP7A 2GQPA 3R91A 3EHJA 5CTUA 1H7UA 3OMUA 3R4NA 2YJXA 4LPBA 3Q5JA 2WI1A 3C11A 4E02A 4E01A 1ZWHA 4KQVA 3WHAA 2YE2A 2YE6A 4LWEA 2XJGA 2IWUA 4GT8A 3H4LA 1YC4A 2BYHA 4CE3A 1AM1A 2O1WA 3LPSA 1TC0A 4FCPA 2YEHA 4CWTA 4V25A 5M4MA 3HYYA 1S16A 2BU8A 2YK9A 5L3JA 5M4PA 2XDUA 3C0EA 1L0OA 2PNRA 4P7AA 3TUHA 4E00A 2YEFA 1ZW9A 2YGFA 4MBCA 1I5CA 3Q5KA 3U2DA 3FV5A 4AS9A 5M4KA 4W7TA 2VWCA 3LNUA 5GGZA 4CWPA 3WQ9A 2BSMA 2FWYA 4L8ZA 4NH8A 3EKOA 2BTZA 1TBWA 4L90A 4XKKA 4I5SA 3B27A 1BXDA 4PU9A 5FNFA 2YE8A 3G7BA 3K98A 3EKRA 4EEHA 2CCUA 3T0HA 3OWBA 2YE9A 2YKCA 1THNA 4R3AA 3EHGA 3SL2A 4YKXA 3O6OA 4YKUA 2YI5A 3U67A 1UY9A 3Q5LA 4MPNA 3A0ZA 2YEJA 1UY8A 1YC1A 1YT0A 2YKJA 3TZ2A 2O1VA 4HY1A 4KSHA 1YERA 3CGZA 1TC6A 2YEAA 3HZ1A 4HYPA 1QZRA 2XDKA 2YI6A 4PRXA 3GIFA 5BOCA 2BT0A 3FT8A 3D2RA 2FWZA 4EFUA 4U7NA 4GGLA 1S14A 5D7RA 1AJ6A 2XX4A 4XIRA 1TIDA 1A4HA 1MU5A 3K60A 2XDSA 1QYEA 1Z5CA 3A0XA 4O04A 4CWSA 1R62A 2XJXA 2YE3A 1UYIA 4NH7A 4XCJA 1I58A 2YJWA 4YKZA 4QPKA 4O05A 1JM6A 1UY6A 4L93A 2HKJA 2ZDYA 2XHTA 3GIGA 1B62A 2CCTA 4XIQA 2WI7A 1YSZA 2YK2A 4ZVIA 4K4OA 5M4NA 4MP2A 5CF0A 3GIEA 2HCHA 2JJCA 4ASFA 5CTYA 4ASGA 1ZXNA 3BM9A 2CG9A 4FCQA 4BIZA 3R4MA 4R3MA 3A0RA 2Q2EB 3IEDA 1Y8NA 3K99A 5CPHA 1AMWA 5F3KA 4AWOA 4H85A 1YC3A 4HZ0A 1KIJA 1U0ZA 3RLQA 3VHDA 2O1UA 2YEDA 1YT2A 1TILA 2GFDA 1UYMA 3DGEA 1Y4SA 2WERA 2BREA 3B26A 4CE2A 2YI0A 3TZ0A 1GJVA 2VCJA 2ZBKB 3HZ5A 2YKIA 1UYKA 1I59A 4HXZA 4GCZA 1NHJA 3TZ4A 4ASBA 5BODA 4YKTA 4URNA 2XDXA 2H55A 3B24A 2IORA 3A0WA 3FT5A 1TH8A 1UYCA 2Q8IA 3NMQA 3CWVA 1OSFA 4BXIA 4KP4A 3B28A 2QFOA 5IDMA 4YKYA 1B63A 2CCSA 2BU2A 3ZXOA 5F5RA 3HEKA 4HZ5A 4EFTA 4L94A 5J71A 2ZDXA 3OW6A 2YEGA 3T2SA 4B6CA 2XJJA 1YT1A 5D6PA 4XIPA 1NHHA 4LWIA 2YE5A 3G75A 5D6QA 3U2KA 1I5DA 4GQTA 4XDMA 1MX0A 3TTZA 1YSRA 4WUBA 4BQJA 2YGAA 1YETA 4GEEA 2WI4A 3RLRA 2YEBA 3ZKDA 4PRVA 1YS3A 1UYEA 4WUCA 2CH4A 4CWFA 3RLPA 1B3QA 4CWQA 3OWDA 4HY6A 5CTXA 2XK2A 2XD6A 4U7OA 5IN9A 5M4HA 1EI1A 4XC0A 4UROA 3PEJA 4H7QA 4FCRA 4P8OA 1UYHA 3O2FA 2BU7A 3K97A 3QTFA 1PVGA 3OPDA 1Y8PA 4EMVA 2WI6A 2K5BA 3EHHA 3CGYA 4AWQA 5D7CA 2XCMA 4BIUA 2BYIA 2QF6A 1AH6A
chains in the Genus database with same CATH superfamily
5B0CA 4LWFA 3MZIA 1VC0A 1D3WA 3GLJA 5CYQA 3ELHA 3B54A 1WELA 3LGMA 1APSA 2RQMA 2H51B 4LRAA 2YQ0A 4C8KA 3SQGB 2VV5A 1Q82T 3KLVA 5HQ8A 3D3CJ 2W9CA 4P72A 2ZOFA 3P4UB 4HYMA 3IGVA 5KT6A 3RZAA 2GZOA 1HNXJ 1J5OB 1SQGA 2B0GA 2HHIA 4EEYA 4DR7F 2ZVIA 3EHFA 1Q1KA 2Z56B 3CVKA 1NPRA 3R7NB 1RU1A 1HR0F 3PEHA 4LQ3A 5GADU 2HMIA 4BAEA 2F4FA 2XHCA 2AKPA 1HI1A 2IDEA 2ATCB 4U7UK 1ROFA 2M88A 1HFEL 2ZBPA 4MFBA 2QT7A 4OI3A 2IJRA 3EE3A 2E0AA 1LV5A 2WI2A 1I5OB 2V63A 3I5BA 1M5SA 2X1GA 2Y0BB 3UVJA 3BSCA 1IXKA 3QSYB 2C22A 4B3MJ 2IWSA 3GIGB 3OLBA 1MLAA 3I56S 2KU7A 5HQMA 5A2QU 1CC7A 2LXUA 5HANA 3A0YA 1IKVB 3THTA 3PCOB 4CLTA 1A0OB 4C7QA 5E41A 3EDRB 1P9YA 4M5GA 4JI2J 3PM9A 1GQEA 2CQGA 2WCXA 1JNZB 2R7VA 2HGNA 2Q43A 1UA0A 3TI0A 1S1TA 3QATA 2R8JA 1D09B 1NK7A 1E6VB 1KTVA 1ULRA 1RHMB 3ILJA 1FXRA 2H5JB 1TK8A 1IVZA 1MROB 1S1XA 2O1WA 4LF9J 4L73A 1VQ9S 4QU6A 4ZIVA 3A3NB 2YNHA 3C0EA 2PNRA 3HJVA 1EETB 4P73A 3TEHB 2XMMA 3DM2A 3G6XA 1EETA 3I82A 1WNEA 1JLQA 3GJQB 3OR1B 4J9KA 3K57A 4F4YA 1RWMB 2JHEA 2V8DA 1XQIA 3G6YA 4K4UA 4Y6IA 1FJCA 1RT7B 4RU2A 4ZPBA 3OVBA 3M7VA 1FESA 2GC8A 1WTBA 4DUYJ 4AFFA 3L9ZA 1IKYA 4C0BA 5F0UA 1GH8A 3GG0A 3C15B 4ZHRA 5C2CA 3E01A 2E1CA 1YJTA 2XDKA 3K5PA 5GMEA 2HURA 3M8SA 4DN9A 2FLPA 3D2RA 4QIVA 1AJ6A 4ED7A 3QMQA 5CYMB 3NWGA 2IVMA 3DLGB 3QT6A 1E6VA 1KN6A 2WW4A 2JSXA 4OZ5A 3N5FA 3ILOA 3NS7B 4DX6A 3J7ZT 4C8NA 3BO4A 2CWKA 3E51A 5HSPA 1YLXA 1X5OA 1LW2B 2EBEA 4JI5J 3MECB 4KKOA 2L41A 5KFDA 1QAXA 3SXLA 4DR7J 5C24B 2J6SA 1TV6A 4KH1B 5DETA 1ZETA 3P49B 2RRAA 1EAYC 5HMZA 4LFBF 1UEKA 4NI2B 3BH6B 2F65A 4DR3J 4X65J 5GVQA 2JC1A 1DQAA 5A8KB 3OFGA 3CIZA 1HNVB 5FJ4A 4J9LA 3Q24A 3EZOA 2P5VA 4Q0BB 2FLLA 1H3DA 5B09A 1XMBA 3DC2A 1AT1B 3FT5A 2WSFC 3THVA 2YWGA 4ZN3A 4HTJA 3ZXOA 5D0RA 3QWPA 1HA1A 5EUHA 2H54B 2HWTA 1LXNA 2ZKUA 4ZVRB 2CVEA 5H9FK 3GR0A 1UFWA 2HRTA 3BO2A 1N54B 3QJJA 1A9NB 2NREA 2PN6A 1U48A 5EWEA 3U1MA 4N41A 3N4WA 5GAHU 1SI9A 2KRBA 1RTIB 1VBXA 5CTXA 4IFYB 2F8EX 1CBKA 2LDIA 3KUEA 4DUZJ 1TL7B 3CJ5A 2QYCA 3M32B 1V3ZA 2VC1A 3V4IB 3DI6B 2J0QD 2OUGA 1RT3A 3GZ7A 3BEGB 1XNQF 3B78A 4DX8H 3HX9A 3IBWA 4N76A 1KQFB 3G71S 2K06A 4R25A 4U93A 2ZBRA 2A1BA 4DR2F 3IS9A 2J0XA 1FDDA 5KG5A 2JLEA 1H74A 5AXKA 4XITA 4O07A 3JSYA 1EKRA 3MNRP 1U45A 3IBFB 3GSDA 3CD5A 1FRIA 2GHVC 3ILIA 3KMSA 3I0RA 3P6YC 4FYDA 2YECA 4L74A 1Y5LB 5A0YB 2BDPA 3NXZA 4DI6A 3UCUP 2LQBA 2POKA 3CDEA 2ROEA 4E8UA 2Y1IA 1X4GA 1JKHA 5K14B 4HL9A 1UYLA 4NEYA 3W2WB 4USUA 1IQTA 2CG4A 4YB1P 2UUCJ 5F8MA 1S77D 3RUBL 3W2WA 5L9XA 2C3MA 3CCQS 4DL2A 2C3YA 3QT5A 3GYXB 3EGWB 1FJGF 2DGQA 2RIJA 3FJ2A 3EVMA 1OS5A 1JLAB 1S7HA 1JJ2R 4CO4A 1WC5A 4OIXA 1FFSB 3HPOA 5DDOC 2V94A 5I42A 4IG3A 2CQ3A 2M70A 4TLRA 3CJKA 2I9SA 2IWXA 2IVYA 6AT1B 1ZZFA 3TAPA 3GONA 5FDLB 4WZMA 5CQGA 2J8SA 4USIA 1U1PA 1R43A 5HQLA 4IYQA 3PYEA 3W65A 2YTCA 4IOAQ 3BN7A 4ANEA 3KLFB 1AZSA 2GAGC 3M8QB 1WG4A 2KRRA 3E8OA 1NKEA 2DR6A 1DJ0A 2NYHA 3MPYA 1KLMA 2WONA 5C42B 2RUSA 2MHEA 3HHLA 4LPBA 4USJC 4M95A 3T3FA 3L4BC 2OPQB 1HQEB 1FERA 2CDQA 2IWUA 2XSJA 4S0MA 3VTIA 3W66A 2GHPA 3CUNA 2FZGB 2GJFA 2DO4A 2FJDB 1XTZA 3DLBA 3UR3C 1RHJB 2AZ3A 3QJLA 3VF0B 2WVCA 5DQGA 2AQ4A 2BJ7A 3AJDA 5ETOA 1AYEA 3DLKB 4M5LA 4K8RA 2COLA 2GAHC 2KJVA 5GGZA 1CJUB 3B4MA 3GWCA 4F04B 3WIVA 4HYKA 2UVWA 1GMVA 4ECTA 4OFZA 3K59A 5HJYA 5F8HA 1FK9B 2DGWA 2HHSA 1LW2A 3MMBA 2RKIB 4O44B 1UY9A 5T7LB 4DLEA 5LMUJ 4ED3A 2IJFA 2FVSA 1WG1A 4OL8A 4OQJA 1F0XA 1Y9OA 3OSPA 4LF5F 2OJ3A 2LXFA 4PRXA 2APOA 1XMQF 2N4CA 1WD6A 2WRMA 1MWYA 3QO9A 3VVUA 3MI7X 1OPIA 5IT9U 2CADA 3I0RB 3ZXWA 1UY6A 2ZDYA 3QRPA 4MIAA 4ZVQB 4UOHA 3TOQA 1C1CA 3Q8QB 4CLPA 3RRKA 4X84A 2FTKA 1MWQA 1BQMB 2QLJB 3R4MA 3A0RA 3IEDA 4DUZF 2CAJA 5I3QA 4TQSA 2U1AA 2YPYA 4FF4A 1IBLF 4DPWA 1JLQB 1OYEA 3ZZTA 2OD6A 1DTQB 2W9AA 2O1UA 4CNYA 2QV6A 1C0TA 1EB0A 4TQRA 1KHVA 2P9EA 2ADBA 3HVRA 1FT8A 4DR5J 2VCJA 3HZ5A 4AL6A 2OEKA 1N5TA 4V1Ak 3H40A 4Y2CA 2MKYA 2BYCA 1K47A 2R7TA 4WP8A 1DY3A 2C2DA 2MLZA 4LF1A 2KXNB 1P27B 3DFEA 2HHHJ 1Q79A 1YT1A 1TKXB 3QT8A 1PIEA 1U02A 3KOAA 4O3OA 3ZTQA 1B7YB 2DTJA 1ZM9A 1NH8A 4X65F 4IR9A 4PXDA 1FD2A 1G3OA 4A8SA 2LQ9A 2CH4A 2W4DA 2MJNA 3D54A 2PMZD 1N5QA 3BGUA 2J9EA 3G9CA 3HHLB 1U6FA 3HF5A 4KGXB 1Z2ZA 2DEJA 2BU7A 4ZN1A 2IRUA 4QCLA 5KT2A 2FQQB 5G0RB 4HI2A 4YQWA 2XABA 1NM2A 2CNNB 4NXNF 1FXLA 2VZ9A 1X5PA 4ES1A 1K1QA 3BYPA 4UOFA 1T3NA 2B5JB 4KYZA 4AWPA 3CRLA 2ZOMA 4JI6J 1KSPA 2ZHOA 4ED2A 2BJ8A 4RUCA 2CQ2A 4MFBB 1BQXA 3SCLE 2OEMA 4O3PA 3CO0P 4KH0B 1RWKB 1X0FA 2BACA 1S6QA 3MAAB 3V6DB 3U1LA 1VQ7S 5BJRA 4IH6A 3W64A 3TUJC 1UYGA 1SKUB 2NR0A 5D78A 2YEIA 1JLCA 3DDKA 2HIQA 4DUYF 3S7RA 1GXUA 4CWOA 1PSDA 2W7PA 3C14B 2AEJA 1JKHB 5K14A 2DITA 2AJ1A 4P2FA 1R8BA 2G13A 1H2VZ 2QL9B 2X3DA 2QN6B 3OL8A 4K4YA 4DV0J 4XD8A 3R5DA 1Q81T 3CJ0A 4ZPTR 1HW8A 2VCIA 3M9NB 2V68A 4FF2A 4TVAB 4GO5X 3KLHB 3P5TL 1XERA 3NCRA 3INWA 3CIMA 4X9LA 2OPQA 2BU6A 1J5EJ 2WBMA 2MQNA 3R2DJ 4M5DB 1S10A 2DRAA 2FHJD 3GFXA 1JJCB 1U2OA 3MM9B 4NXMF 3TVZA 2BE2A 3BQ0A 1YVFA 2WSEC 2CNLB 2CQHA 2DBBA 3I9ZA 2KL8A 2E66A 1HYSA 1IXMA 1M1GA 2BM0A 2X1FA 4M5IA 1VHFA 2QZ8A 3TUZC 3EHJA 2WVDA 3R27A 2P6TA 4JI2F 3C11A 2MGZA 1N36J 3NGTA 1ZPVA 3SMZA 2MPUA 1TKDA 1U24A 2UVUA 2GNKA 2LXIA 4CWTA 3DRXA 1VQ6S 4EO8A 1N52B 1RT1B 5M2PA 2BU8A 2RH3A 2QFJA 2HFZA 5LMNF 1ZW9A 3T5KA 2IM0A 1NHVA 1R8CA 1N5YB 1RADB 1YJRA 4L8ZA 2UP1A 3M2VA 1YIJS 2F4VF 4NCAA 4DOZA 3M8PB 3S5TA 3RW6A 4KHPF 8RUCA 2GX8A 4XKKA 4B9LA 2GGPB 4AQYF 5D0HA 2JEJA 1X5SA 3EGVA 1FXDA 3EKRA 3FBEA 3EHGA 3O6OA 1KLNA 2W2OP 4JI8F 4KSHA 5LXYA 1VJWA 2YEAA 5KT5A 1T9WA 3D5MA 3VAIA 1RU2A 4B9NA 2CPJA 4GO7X 2R8HA 1N8RT 3HSDA 2DH7A 3GQCA 4YN3B 3QRQA 1F5BA 3DLEB 5G0RA 4A8YA 3MGJA 4KHRA 3T1YF 4XCJA 1FWPA 1SUQA 3DHXA 5L38A 4DR5F 1FHTA 5LXRA 1RT5A 4XIQA 1YSZA 3OV7A 2B4VA 4DR4F 3M30A 1J27A 4OYXA 3LANA 5L8RC 3NNHA 2DNYA 1LFPA 1BQNA 3QT7A 1Y8NA 2MZJA 2YPZA 3K99A 2HVEA 3DCAA 1XN9A 1MNEA 1MWZA 1UAWA 4UZBA 2QRRA 3JSMB 5IC4B 3CJ2A 4TLQA 1YDLA 5KT3A 3BSAA 2OP5A 1C1BB 1UYMA 2DNGA 1SB6A 3D6MB 2UUAF 1VQ5S 2YX7A 3F56A 4RBTA 3DHWC 1VMBA 2J7KA 3TZ0A 1W7WA 5HROA 5EHHA 2MKKA 4KTQA 1WKJA 4ILMA 1TZ0A 4Q45A 2GIFA 2K8GA 2G1HA 2RMLA 3UN3A 2Z58B 4ELTA 4RW8A 1RT2B 4NZ7A 3OVAA 2XGQA 4OMFG 3BS9A 3V6HA 1R6VA 3H2LA 4Q2MA 1SC4B 3KHHA 4NI2A 3MWBA 4JI0J 3CJRA 1NXIA 4LRDA 2C2OB 3DGPB 3KJFB 3OR2A 1FJEB 2LKZA 4FXWA 4DR1F 2AYEA 2FHMA 3PFOA 1VQPS 4ZPCA 4ZCKA 3QZ8A 3KLIB 2UXCF 2CPDA 4K4XA 3I5AA 2HWIA 5IN9A 4BC7A 5JXSA 3PYFA 4OZ0A 3Q83A 5HLFA 1BHNA 4PG6A 3HVWA 1UVLA 1IJFB 1IR1A 1UP1A 3U02A 3FBFA 4OYWA 1OMSA 3LP0B 2P9GA 2K5BA 3EHHA 4YR0A 3W63A 4RNMA 1R0BG 2HAIA 3AD7C 1HWIA 4CO1A 3BM7A 1IKVA 3INXA 1Z1ZA 3KMQA 2V67A 3OTEA 2Q6BA 2PE8A 4LWGA 1AUSL 2BU5A 3MCMA 4O44A 2SXLA 3Q8YA 4NA3A 1VDHA 4QWDA 3BB5A 4FN5A 2HS0A 3CC4S 4X64J 1FO1A 4HDHA 5HBMA 4NLVA 1HR0J 1UKUA 2XCAA 1KKHA 2N3LA 2LDYA 4DS4A 3TZZA 5HROB 4N5SA 1CJTA 3SV3A 2CDRB 3BO3A 2ASLA 2BKPA 3DRPB 5KFMA 2A2CA 3JSRA 3G8QA 1K8AT 1JLBA 3HHNB 1OYDA 5D6GA 4O3RA 1R0AA 1N56A 1US7A 1RWUA 2RDIA 3WDOA 2BRCA 1NK6A 1AH8A 3HHUA 1PJ7A 2V2QA 4CO3A 5B08A 3I4PA 2V8VA 1YJ9S 4O4GB 2JX2A 2PC6A 1Q5VA 2MLXA 4NRTA 2E44A 4YKWA 2D7SA 1U7LA 5D3GA 2XG8A 2AP6A 2B51A 2RHQB 1HARA 2BQ3A 2BJDA 4H81A 1Z59A 3CD6S 1Y4UA 3DLJA 4YUDA 2LU1A 3QDDA 1PYTA 3AQPA 2EFPA 2KYZA 4WWSA 1A7GE 1HHSA 2C2MB 4NLRA 1VK8A 3B25A 4Y2MA 4NLTA 4NEZA 4M94A 5ETQA 2HNZA 1TMJA 3UW1A 5LMNJ 5JENA 4B02A 2VODA 4PXCA 1IBKJ 4LWEA 1Y10A 1SH0A 3B82A 1JMTA 2DPIA 2V6AA 3FKBA 5KFGA 4EZ9A 4JP8A 3I87A 1RAIB 5KG6A 3ZTPA 3MURP 2LYVA 4KPCA 4FNHA 5J2MB 1T05A 4E00A 5IM0A 2A6OA 3X3UA 4J9NA 4DR2J 3R2CJ 4FF1A 1JLEA 3D9BA 4W7TA 3ZNJ1 2KM8C 2KXHA 4LJMA 2V0NA 2FWYA 1TK5A 4PAAA 3OR2B 4RBUA 4CP5A 3A8KA 3QAEA 4NCGB 1RLCL 1PAEX 2GVDB 1UVJA 1NB2A 2J8AA 2LA6A 2OLWA 3RB3A 2V9WA 5IS2A 3KDOA 2YWKA 4RW7B 4RW8B 4R3AA 2RE1A 5I3PA 5J1EB 3I55S 2R4FA 2PI4A 2W9CB 2FIUA 3OXGA 4I68A 4WP9A 1YT0A 2GHWA 4NLQA 4ES2A 4JV5J 1KR4A 2HNZB 3CCES 2QMXA 5GAGI 4FYWB 1FD8A 3OFFA 4KGZB 2DYAA 3ZZ0A 1RACB 2LLZA 4FNIA 4GGLA 2VD3A 2XX4A 2G9OA 3LF0A 4JI3F 2HQ3A 1JXLA 5MLCV 1IWGA 2ZHAA 1SJQA 4NZ0A 2E29A 2HKJA 3Q8UA 2A6MA 1ZM4A 1VS3A 2YK2A 4K4OA 4ETXA 3ZC4A 1B0TA 4AL5A 3MEGB 1V3SA 1ZS6A 3KJQB 1RSCA 1S6OA 3RGIA 2JJCA 4HH0A 1X4AA 4GC6A 3SBMA 2MZRA 1H0HB 5CPHA 1O8BA 3DU5A 3RYLA 3RTVA 1R0AB 1CJKB 1QM9A 1KEKA 3D66A 1PGZA 3MR7A 2EC2A 4XTTA 4CE2A 2J0WA 4QBUA 2DR7A 2PI5A 4OJ1A 2XGPA 1FKOB 2DHHA 2XYHB 4C8OA 1VQKS 4GCZA 4I2QB 2AF6A 2HZAA 4OYAA 2UXDF 1UYCA 3M4XA 3PRDA 4EBDA 4YFUA 3V2UC 5IDMA 5FLXU 3G96A 3HEKA 2QE5A 4R8UA 1NAQA 1U1KA 1R7IA 5J71A 2O5DA 3OW2R 3VCDA 2LCWA 2RNEA 4KQZA 5IC6B 4CLFA 2DXEA 2QA4G 3BBBA 2UXBF 2HK2A 2YEBA 4AXIA 2JEIA 4WUCA 3PKYA 2XHWA 3OTOF 2IJNA 2E5GA 3HFVA 1SC6A 2XMWA 1C0UB 3LPEA 3P3DA 4U7OA 2RB7A 1N88A 1CQNA 4KRWA 3MM6A 2IM1A 3BYRA 2ZBCA 1QSLA 1LNQA 2W9BB 4ZHRB 2FVCA 2B43A 3I4HX 4L3KA 4BIUA 5CYMA 3JS9A 2FY1A 2E5LJ 4Z37A 3R92A 2J5AA 2ESAA 1VQOS 3PJWA 1IWAA 2KDOA 2UUBF 2WI3A 4LF9F 1UWAA 1HBMB 1BWVA 2GQCA 5L1KA 4EYHB 4C8YA 3TEGA 3RU0A 2BJ3A 1SPBP 4DF4A 2E1PA 3DOKA 1EA6A 3M1VA 1HNIA 4NASA 2VU5A 4LP0A 2OTLS 3HHLD 1F5AA 3CD0A 1VQ4S 1VC5A 3ZM7A 4O0BA 4KFBB 3M32A 2BE2B 3QLHB 3NP5A 2OAUA 4Y2IA 4CWBA 3OD2A 4GKJJ 2MY8A 3L95X 5KG1A 3C16B 4ZMMA 1QUPA 4YY3F 4X2BA 4MIWA 1KD1T 4EFAC 5DQHA 3QGIA 3SFUA 3FBCA 2WI5A 3D1HA 1OPZA 4I6YA 3DN9A 3M6XA 5F8NA 1D8YA 1HQ2A 3D0BA 3NAIA 4WKRA 3CWJA 2YKPA 2YXLA 1UYFA 1F9EB 4XO0A 2H1YA 2M0GB 1XEZA 2W24A 3OTBA 1H6KX 1X4BA 2QO3A 1HNVA 1MMLA 5CAAA 5KFTA 4IG0B 4B7PA 2HIYA 4KV8B 2LVWA 4I2PA 5MAOA 4EI2A 5L1LA 5HMWA 1NKBA 1WKLA 1N34F 3FCHA 2D3OR 3UO0A 3K5LA 4RU9A 4C0OC 4AL7A 4WU2A 2DNNA 4ELUA 1NJZA 2XMKA 2Y3YA 2JLGA 2FLOA 4JI4J 4MP7A 3IG1B 4DR4J 2GQPA 2HWHA 2XZDB 1H7UA 2AV5A 4KGMA 5A8WB 2WI1A 4ECXA 2GA7A 1T03B 3KJNB 4E01A 1NDKA 2RKIA 3D3BJ 4R8UB 3MM7A 2W7AA 2M4MA 4MJKA 1H72C 4HACB 1RQ0A 1AM1A 3LPSA 1REVA 1KP6A 4IRDA 3UDEA 5A2QY 1I94F 1X8DA 3SQOP 4I2QA 1XC9A 4L75A 1RBAA 1N5SA 1SL0A 4FXVA 1LWCA 4WFXA 3PZPA 3LNUA 4CWPA 1FJGJ 4RW9B 2BSMA 1I51B 3HSGA 3I0SB 3EGNA 2VG5B 4WCEQ 2FVPA 3ZTSA 4I5SA 1IBLJ 3C46A 3QNWB 2C2KB 1L3SA 2MZ1A 4NLPA 2XWXA 4LSNB 2YVSA 4WPAA 1U49A 3C8YA 2G2OA 1TL3B 2Z4PA 3CCMS 1VK3A 1JB0C 1DRZA 1TFYA 2JFDA 3EGZA 1BE4A 1HNIB 2B6AA 2MTLA 4BCAA 3A0XA 1R8AA 5GAGU 1HNZJ 4JYAJ 1U0HA 5ETVA 3OFEA 2BEFA 4I7FA 1NJYA 4CO5A 3BSOA 3L7UA 4MP2A 3ILLA 5IZHA 3KLHA 1WSVA 1RT5B 2OKQA 4U67Q 2V8PA 2HBRB 5GMKa 3MEDB 3WX8A 4LIRA 1YC3A 1NUEA 4PXEA 5HP1A 5FLXY 3MUMP 2Y0SD 1RT6A 1V5IB 2M52A 2DVIA 3A8JA 3NL0A 4JI1F 3SCJE 3FMWA 2UV8G 3G82B 3O3LA 2EK1A 2MDAA 3C6UA 3IAM9 1KONA 4QWBA 2R42A 1CC8A 5BYRA 2E5LF 2H55A 4TYAA 3MUTP 5AJ3J 2WAQD 3UVJB 2ZC4A 4RO0A 3B28A 1T0TV 1YRTA 1UVNA 4ETZA 3V5RA 3TUIC 4J5OA 1IM6A 1YI2S 4TYBA 1RAOA 3G86A 5D6QA 2VB6A 1W26A 4HVZA 4QZVB 4GQTA 2GS8A 1ICEB 3OL7A 1MX0A 4BQJA 4IO1A 4PUOA 2O67A 1VFJA 4DDFA 2GFFA 4GVBB 1Q8KA 1GFWB 1FRKA 3NBPA 1VRUB 2VOPA 1GX5A 1VYAA 1TAQA 1TL1A 5H9EJ 4FCRA 2I2YA 2EVZA 5LSLA 2W1BA 5AT1B 4R5PB 1B7FA 1TELA 2AJ0A 2PGCA 2JNJA 2PEHA 4CWSA 3T0ZA 1D8ZA 4UY85 4YS2A 2DRBA 4DFJA 4BWMA 2RF2B 2KKHA 4TKTA 1S5ZA 3A8IA 1YITS 4CNZA 3CYGA 1RBLA 1I5AA 1UCNA 4PQAA 3FFIA 4USVA 1ZM2A 4UOGA 1F1BB 1X9WA 4RJVA 3EYZA 3PHTA 3JTNA 3WIUA 3BPSP 4FZVA 5I42B 2HHTA 2OTJS 2ZH5A 4ED6A 3CJ3A 1JLAA 1R8HA 3KK1A 1F3VA 5KG4A 2ZUAA 2J6UA 2QTWA 5B7WA 2BA9A 2E7VA 4FF3A 4EGKA 2R7SA 3C14A 3I31A 2XDLA 1Z5AA 2J9DE 4XTJA 4DQQA 4LF6J 1M5HA 5K8NA 2PT0A 2B9XA 3ITHA 4LUBA 1GKXA 3DU6A 1KNZA 2V50A 3AH6A 5KFQA 3ENVA 2DCUB 4MB9A 2F9DA 2Y1JA 2Q6CA 1BGQA 4DR6F 1C4AA 4H4OB 3ETOA 4MT1A 3HDSA 3Q8PB 5AXLA 1R8PA 1WC1A 3TAQA 3POTA 1Q7YT 1YWXA 1H73A 4CWRA 2HG1A 2DNLA 3VZHA 3CMQA 5J2PB 4ECRA 4DFMA 3T9ZA 4W90B 4KO0A 4F0HA 3KK1B 2XNQA 4P6QA 2N82B 2D3UA 2CA9A 1UVMA 2XB2D 4CE3A 2CG8A 4TY9A 4N7TA 5BR8J 5M4MA 2ACYA 1WF0A 4CTAB 4O23A 2XDUA 3P8BB 3AB2B 3TUHA 2ABYA 2RJZA 1TL3A 3CO9A 4LSNA 3FV5A 1NDLA 3ENWA 3DLKA 3H0PA 1Q86T 1VLYA 3D0HE 4ZLPA 1S79A 4NLSA 5AXMA 4DV4F 3HFZB 1FKPB 4I0WA 1P1LA 3BF4A 4P7VA 4CH7A 3TQEA 4IQMA 2CJKA 1OY8A 1V9OA 1KVJA 4BHQA 4USTA 4DSIA 3KYLA 4F3OA 2XMJA 2E9RX 5SZTA 1THNA 3PX4A 4KGVB 2NZCA 2HQCA 2DPJA 2AYGA 5AE1A 4KC5A 2BANB 1JLFB 3HZ1A 3D68A 4LF4J 2YI6A 3KG1A 3O1LA 2BT0A 3M8QA 5D4LA 4U7NA 3ZZOA 3Q22A 1AZSB 3P5BP 3K17A 4DPUA 7FDRA 1FNXH 3US5A 5AE3A 2R2UA 4HT7A 4X66F 3LWMA 2M9KA 5FDLA 1HQUB 1BQMA 2VIHA 2YJWA 4YKZA 2F9JA 4NL5A 1DTTB 2EK6A 4IG3B 2KFNA 2WSCC 2DGTA 3VV2B 3R9LA 2GO9A 4DEZA 4CDIA 2IAJB 4QR2A 4DMZA 4EZ6A 4RW4A 3F0NA 2HAFA 1U4BA 2CQ1A 4G3IA 3IC1A 3G6VA 2IA0A 4DV7F 3EDQB 4LSLB 3B4DA 3C6UB 4HI1A 4OZ1A 1Q4RA 2OIHA 2RILA 1F9FA 1TILA 1NHUA 3K0JA 2WERA 4L76A 3H4BA 4AE5A 1CLFA 3CT9A 4LRFA 5LL6d 3X1LB 3F41A 4XK8C 4BLGA 3PR5B 4N8NA 2F63A 2YX4A 2QIFA 4URNA 2IORA 4C6AA 1H7XA 3CNQP 4CIOA 5F0WA 2I1RA 2IC3B 2DNZA 3OL9A 4L94A 2V4QA 4ECQA 2YEGA 3OW6A 2ZE2B 3OBIA 4QYRA 3H98A 1UETA 1OJ4A 2YE5A 3FEYB 1XMQJ 4HTIA 1U2FA 2V2ZA 3J81Y 2NS1B 1P9QC 3EPIA 4RW6A 2ZZMA 1SIWB 3RLPA 3D67A 1B3QA 3RW7A 4F4XA 4DHVA 3H5SA 5D4OA 5CCLA 1UYHA 1HBOB 2KG0A 3UD3P 4DV3F 3T1HF 4NLWA 1T8EA 2VOOA 2ZH8A 1UMJA 1EHWA 3DLHA 1R89A 3OT9A 4DN0A 2DIVA 4IH7A 1LWEB 5M4EA 2K3IA 2XY7A 5IDJA 4H4MA 2A18A 2J9CA 4CO0A 2FVRA 4KFGA 4U6PA 5CH7B 1NSQA 3D4JA 2MJUA 3DRSB 1U2CA 1QY8A 3DLEA 4FPIA 4Q8EA 3M30B 4M5NA 3WX4A 1U26A 4V19X 1MMNA 2HKEA 2LEPA 4A8OA 1WOPA 1U1NA 2KM8B 1ZXMA 1JJHA 2XX2A 5LJ5Y 3TZYA 1SV5A 5HL7Q 3GTYX 2CXEA 1SH2A 3QZ7A 4DCPB 8AT1B 1M90T 3LO3A 1KFSA 2BM1A 4FYVB 1U25A 1UFKA 4K4ZA 5LJ3Y 2KI2A 4EU0A 3V6JA 5A8WA 1S1WA 3H7HB 4U7CA 4DS5A 2HBZB 1C2PA 1GK8A 2WW8A 3KHGA 2PFFB 1RUSA 1YGYA 5B0EA 1TUGB 2EFGA 2FHOB 3VVTA 1YBUA 2HVDA 1XR7A 2LEBA 1EP4B 3GG1A 4ELVA 1QY7A 1I94J 3LGNA 1SQEA 3DXSX 2GCFA 2AZ1A 4E2FB 4NE9C 2OHDA 3L7OA 1RWXB 4ILLA 3KK3A 3FBBA 2F5GA 2OFGX 1AW0A 4MKAA 4A8QA 4DSLA 2IMOA 4JB8B 2V2VA 4LF8F 4FMTA 1EIYB 3BBFA 1S6PA 4TN2A 1Z5BA 3DRSA 4J9SA 5GAEI 3HFKA 1HKAA 4AQYJ 2BW7A 5CTWA 4CH1A 2MLYA 3TANA 4H4MB 5JVGQ 4UZCA 2V69A 1NCLA 3KFWX 4KQVA 3EPGA 2BKNA 3UI3A 1NDPA 1TKTA 1QE1A 5A8RA 1B70B 1X31C 4JI3J 3QIPB 3PYGA 3MHYA 4ZVSB 4EUVA 2ZE2A 1NH7A 2U2FA 4K4WA 1AUDA 3TAMA 4QYZK 1UTAA 2JEFA 2DGUA 4AS9A 3R3TA 4BBYA 2Y1LB 5CD4A 1B64A 3ZZPA 3RRGA 4N8OA 3RG6A 3OPKA 2DHXA 2VFTA 3DOKB 1T9YA 3LAMA 2MSSA 4DG1A 4OYBA 1TBWA 4I1TA 1MW7A 3K2YA 4M5DA 1Q8IA 5FD1A 4PWDB 2ZH1A 4PU9A 3GILA 1Q78A 2EKYA 1C1CB 5IM0B 2OSQA 4LR7A 2VUGA 1J5EF 3BV8A 1TP7A 3HO1A 1IUJA 1WI8A 3QO9B 1UWBA 2R7QA 5IV4A 3CGIA 3MMJA 4I56A 4ZVTB 1S49A 1UW9A 3AHPA 1JLCB 2MKHA 1RWWB 4NPOA 1I58A 1S6QB 3MAAA 5L46A 3GIGA 2AYMA 3C3LA 2WOMA 5DZ7A 1NBEB 1YX2A 2IY5B 2Z2MA 2NQPA 1NK8A 1UJ6A 3IG1A 4ZVEA 3WC2A 3LP0A 3BM9A 3QGPA 3PTWA 2BXJA 2YX1A 2DD8S 2J9DA 1AMWA 7FD1A 4RUAA 5JJBA 4ZJLA 3JQJA 4X4SA 1KIJA 4NLYA 2YEDA 3PW7A 1N32F 3VHQA 2K7KA 4PWDA 2YI0A 4DFPA 5M2RA 1XJWB 2Z0GA 4OV6A 2DY9A 1FE4A 2VC0A 2ZOGA 3PIOQ 3OJSA 2ZWOA 5BODA 3HZGA 4D3GA 4C2MA 3H20A 4NXNJ 1Z4UA 1GMWA 2HHPA 4OYPA 5IT0A 1G1XA 3UDVA 4BXIA 1LW0A 2DXFA 3GFYA 1X9SA 3EWGA 4CLWA 4F26A 5KT7A 4QWAA 2B7BB 3DRPA 4HZ5A 2GJ2A 2C1IA 2XJJA 2N7CA 2JWNA 1NHHA 4EO6A 3M2UB 2RVJA 1NLKL 3NAHA 1YETA 1CULB 5KFRA 3ZKDA 2DHAA 5DGBA 1TMMA 5J2QB 1WEYA 1VC6A 1YJUA 4CWQA 3KJVA 2BQUA 4K5RA 2ASDA 4U7UD 3Q0AA 4UT4A 1WC4A 3FQKA 3T5LA 3QIPA 5DZ6A 3OLAA 2FDNA 3CJTA 3CDAA 3K97A 1Y8PA 2AEFA 2FJWA 3CGYA 2QA4S 5L39A 2M5YA 1YZ7A 3LP2B 2I38A 2G0IA 3NY0A 2HG4A 4A47A 3W8GA 3FZBA 3QGHA 1DTQA 3D0IE 3D36A 1UY7A 3NOGA 3DKDA 1SUQB 3CJ8A 4Y0FA 5DO2A 1RTZA 4ZP9A 4K50A 5HN0A 4WYWA 5FNDA 3M2RA 1EJ7L 1X4FA 1JX4A 2YKEA 4A8XA 2QA1A 1BY9A 2V34A 5LSOA 4KSGA 3KE6A 3HSJA 2YH0A 4PEOA 3TARA 1S1WB 2FY8A 4ZVHA 4GC7A 3GIKA 2XO7A 2G2ZA 4QIEA 3NGDA 2AX1A 2RRNA 2QL7B 3Q2SC 2AU0A 2W2MP 3WHIA 4B08A 2QLXA 1WHVA 1SCJB 4MYTA 1IKWA 4XPEA 2R7XA 3M2VB 3HD1A 2WEPA 2MZTA 4OHZA 1DAXA 5EWGA 3UD5A 2PMHA 2UUTA 2YKQA 1SKSA 3T10A 4LF6F 2LMIA 4ATNA 2MQ8A 2W2PP 4MH8A 2AHOB 2CGFA 4MKVA 1U47A 1DFDA 1DQ9A 5DS7A 3S8SA 5H9FJ 4I3HA 3IR7B 2E1AA 4PL9A 2LU2A 3C66A 1I6JA 4L91A 4WTYA 3J80Y 1F9HA 4C3KA 2BZ5A 4YDDB 1PJ5A 3J80U 2X51A 2XEXA 5L1IA 2HVZA 3FNNA 3BKFA 2ADCA 1H98A 2KVIA 3H42A 4ID8A 3CPWR 5T14A 1FI4A 2AGQA 5ETSA 5CTUA 2YJXA 2XWYA 5GMDA 4E02A 2GO8A 3TA0A 2CNKB 2KYXA 2YE6A 1VRUA 3NWRA 1YK9A 1EP4A 3H4LA 3TA1A 1QJHA 2CYYA 2JH3A 2IMWP 4IO9Q 3HK2A 4O0NA 2B3TB 4DPTA 2VQFJ 2YEHA 2NXEA 3K5NA 4O4RA 3OFHA 3K89A 4A8MP 5M4PA 3FK4A 4K59A 4OHWA 5KFWA 3RAQA 2YGFA 1VR6A 3S6EA 3OUYA 5J2NB 2MQLA 3RR8A 4WYLA 4AD6A 1KOOA 2XI3A 4JI8J 2WHOA 2CPZA 3I32A 1S48A 5HAOA 2B4PA 4XPCA 4L90A 2D1CA 3DMJA 3K5OA 3BH7B 2C3OA 3ONQA 2XCPA 4Y34A 1RWNB 5KFZA 1DLOA 4ZP6A 4EBEA 1RTJA 1SKRA 2CCUA 3T0HA 3HT3A 2YKCA 2N3OA 4B3RJ 1B4SA 3GCWP 5F3ZA 1VBYA 2YH1A 2PFDA 1IKXA 5LOQA 1OO0B 5HP1B 4NCGA 1RZMA 4X64F 3V6DA 3JYTA 4FKYA 2RQ4A 1GAOA 1FTCA 4RW4B 3MPWA 1ZAXA 1MG7A 4J37A 5CZVA 3PRVA 4PYAA 5IXUA 1RGVA 3D1QA 5AJ3F 2ZC3A 4XIRA 1TIDA 4ZP7A 1RAEB 1A4HA 2ZM6F 1MU5A 3RAMA 3G87A 1CJVB 1X0PA 3TZWA 2KG1A 4K4TA 4KPYA 4IRKA 4LFAF 2ZWPA 1W2IA 4ANCA 1FF2A 1RKIA 4B3OA 2BOPA 2ZITA 1T02A 1S59A 3D2WA 3DI6A 2BVZA 1CS4B 5HVFA 4BIZA 2AWZA 3P45B 1NU4A 3MR2A 1FEHA 4AWOA 3AOBA 1SJRA 3HD2A 2H5EA 4ZKAA 3IWXA 5C25A 1Y4SA 2DT9A 4OZ3A 4W98A 4RL1A 2R3VA 1CULA 2HHXA 4ZK7M 3G4SS 1NHJA 4ASBA 1GXLA 2DR8A 4LVNP 4G6VB 3TP2A 2JVRA 2W2NP 3I0SA 3SDEA 2KT3A 2CCSA 4J9OA 1LW0B 2OMLA 4QJVA 2ZM6J 2XC9A 2OPPA 4I6WA 1IBKF 5D6PA 3G75A 3W1YC 4DSJA 3PW5A 1GT8A 1I5DA 4XDMA 4WP3A 1YBTA 2YGAA 3DYAA 4HHUA 2WI4A 2UU9J 4OI1A 3KLEA 4PRVA 2F3JA 1K44A 3PX6A 1GEHA 4U9RA 2RS8A 3NS6A 4XC0A 4NYZA 5IQ6A 4OJ3A 3M05A 3OTOJ 4H7QA 1HBUA 2EEYA 1WKKA 3J81j 2BW2A 3W9IA 2NYIA 1NJWA 2F8HA 5RUBA 1AH6A 5K9FA 1U0SA 3DXBA 5HK4A 1T03A 3BGRB 1VRTB 3IN5A 3PVXA 2F8MA 4YB5A 3NS5A 2KFYA 4ECVA 1RT4B 2XM3A 4ZDNA 2R7OA 2YE7A 2VH7A 1ID0A 2DR5A 1KDNA 5K8MA 1N6QA 2NUUG 2UVVA 2FD2A 3CJ4A 2D3O1 4OJGA 2J76E 3DDIA 2MKSA 5F41A 1FRXA 4H4KA 4O09A 2L3MA 1SVDA 3GFHA 3DYAB 4URMA 3DLGA 3VADA 3OTCA 1SBRA 1NO8A 3ITHB 1LQ9A 4ZITA 3MCNA 3HZEA 2YNFA 1J5OA 4M8LA 1OWXA 2DGXA 4WE1B 4KHPJ 4B3SJ 3A1YG 2IM2A 5H1SV 4DFKA 2IPOB 3A0TA 1T94A 4CYUB 2XLJA 2VPWB 2EW9A 1MSWD 2CUYA 3MOJB 2QG0A 4ED0A 2DH8A 2DB1A 3O6QA 5AE2A 3AQOA 5CA5A 5IT4A 3NMRA 4NYOA 2DKOB 3RBEA 1U1MA 3DDNA 5BR8F 1M5VC 2UWDA 4O3NA 4XIUA 4UQTA 4QU7A 2HHQA 4DQIA 4DSFA 1VIXA 3JZ3A 3R4OA 4ZVFA 3ISZA 4RZRA 4IDKA 1ZBTA 2VF3A 3A8EA 3POTB 4CLLA 1IBMF 4TU9A 3IRXB 1WEXA 3VR1A 4QYZJ 3PW0A 4DZYA 4R5PA 3GU0A 1S9GB 2ATLA 4DR1J 3MM6B 4DUTA 4QQBA 4ZCLA 1KQKA 2YE2A 4GT8A 5D0EA 5DM7Q 4IH5A 4U8YA 3PO4A 3BKTA 3DGVA 1M5KC 2V9KA 3RBDA 1WG5A 4P2SA 1I5CA 2VBWA 1WC6A 1SL2A 2EC0A 1H7WA 5B0DA 3SI8A 4B9TA 1UVIA 2UUAJ 1R6YA 2R8GA 4F0MA 5A6WA 3SIPB 2XULA 4X4UA 3SL2A 4K4VA 3GCXP 2AGOA 3A0ZA 2V4JA 1UY8A 3VQTA 4ZPAA 3M8PA 4HY1A 2W8LA 5A0YA 3C19A 2KJWA 5F8JA 3KLGA 2G0CA 2Q79A 3JB9k 2Y8YA 4LF7F 1N5YA 2W4PA 1QZRA 1NRKA 3GIFA 3CCZA 4WIIA 2GQ2A 4IOCQ 3FDSA 2KT5A 4PABA 2RS2A 2KXFA 3GV5B 1LOUA 1Y11A 4RR5A 3MMAB 4OYZA 4ZA1A 3W61A 3MEKA 3IS9B 1KLMB 4JV2A 2JJ4D 5FIIA 4QOTA 4J9UE 3G8TA 2DGVA 5G4DA 5KTQA 3GIEA 3J7AN 5E3CA 4G1QB 3V4IA 1TVRA 4OX9F 3QQCD 1K1SA 2FYXA 1FRLA 3J7Z5 1IQZA 1ZTTA 2YQ3A 5F3KA 1HIYA 1WF2A 4WFAQ 2OMOA 5DLGA 3CCWA 4RWXA 1X4DA 1IKWB 3ZTRA 5F9LA 4OHVA 3JAMY 4FPRA 3WC0A 3AFGA 4DF8A 4RNOA 3TZ4A 4J90A 2GV1A 4YKTA 4NX9A 2E5HA 3LW5C 5ETTA 2QFOA 2E1RA 2YNFB 2HZVA 1XMOF 2QJ3A 1U6BA 2I0XA 1PO6A 1S0VA 1S9EA 1N6QB 1DURA 4A8FA 2UUWA 4LT6A 3VAMA 3GV8B 1S0NA 1F2GA 4JV5F 4LSLA 2RHSB 4WUBA 2HRUA 2ZBQA 3LQVA 4LMZA 3HVAA 1X7VA 2VASA 2PEBA 1YJWS 3UCGA 1JNRB 3PEJA 1TTHB 3MPUB 4CT9A 5HVGA 3PRBA 2D9PA 1FX4A 4OYOA 4AWQA 3HCXA 4PQUB 3G2XA 2OEJA 5BXIA 2VQEJ 2X7IA 2MY7A 2JKIA 3R5JB 3DOMA 1KC8T 4GFNA 2F40A 4ZLNA 3VAFA 4QW8A 2FTRA 1ACMB 4NMXA 4K0KJ 3L09A 1AB8A 4JQLA 3TZ5A 3D1OA 5D3GB 1XNQJ 1QUVA 2R7WA 2ZKJA 3U1NA 4F67A 3ET6A 1S99A 4XKOA 4DV3J 1QSSA 1DHMA 1GMUA 2HBQB 1N0UA 4JASA 2NLWA 1NMEB 4BS2A 4A8KA 4F3QA 2DHGA 4KE5A 3N6MA 3BMYA 1IBMJ 5KFLA 2MKCA 1VQ8S 5D15A 2JZ5A 2NZ4A 4RWWA 2Z30B 3JSBA 3J7YI 3HXMA 3HYZA 2YE4A 3FZ2A 3ET6B 5KFHA 3M8WA 4Q0BA 2B9YA 3MEEB 3CE8A 4C48A 1G6BA 4LR9A 4F7VA 5F3TA 1G7CB 2QSFA 5C5JA 2DXDA 1C0TB 1N48A 4WUDA 1RAAB 1T9UA 4A48A 1VCTA 1FDBA 5J6AA 3EUNA 4HXWA 2DGOA 3LUYA 2XMAA 3V81B 5IV3A 4J9PA 2M7SA 4PQUA 2VDIA 5HBMB 1KQGB 4B3RF 5HVHA 1CS4A 3O5TB 3GR1A 2YGEA 3W62A 4I6AA 4PR6A 3CJSA 2Q8HA 3GSIA 1FVSA 4EM7A 3PW2A 1FX2A 3GYGA 4QIWD 3IO1A 2O3DA 1CQMA 2YKBA 4H4OA 2YWHA 4QR1A 4OX9J 2OPRA 1QAYA 3JYTB 4O3QA 2BJ1A 4A4JA 3HKZD 5THWA 1Y7PA 3QWUA 3ADAC 4P52A 2IHR1 1U1QA 2JRSA 5DG8A 2HFUA 2XJGA 5E3AA 5U47A 1YC4A 1HLWA 4FDFA 4FCPA 1YTYA 1JK9B 1UJ5A 1L0OA 1UA1A 1S1UA 1RHQB 2YEFA 3PIPQ 4LRBA 3MR5A 3OHAA 1RYRA 3GFZA 3ICLA 5M4KA 4B9SA 1AFIA 3WQ9A 2WVEA 2JL9A 2VL1A 1V3RA 2YKNB 1TUVA 4U96A 3H25A 3J81U 4LSZB 5KFVA 3LALA 2R2RA 3EZUA 1S72S 1Q16B 4AXJA 1VBZA 2ZDOA 3FSIA 3UWTA 2HRYA 3G7BA 3K98A 1FK9A 4C3MA 2CRLA 2R2SA 1TKTB 1HNWF 1WJ9A 4LREA 3A3PB 1O5JA 4G65A 5K8PA 4KGKA 2YEJA 3IA0A 1XR6A 5IWAJ 4V19J 3PW4A 1YERA 1SV5B 5KG7A 3CEDA 5HATA 1SXLA 3RB6A 2RF2A 1U1OA 1LWXA 1AA1B 5E3QA 4JI0F 2XY6A 2VPZB 3DOLA 4B17A 3SQGA 3V4MA 4IFYA 2AW0A 2ZH2A 2XDSA 3RRHA 3LP1A 1QYEA 1Z5CA 1G4CA 4ZP8A 1NJIT 1JWWA 3FRZA 3AT1B 4QPKA 2B9WA 4LF5J 4YY3J 3Q23A 2GIRA 4ZVIA 2WVFA 2RRBA 4M5JA 5J1NA 3UPFA 3ZZZA 2WONB 4L3NA 4GVBA 1ZXNA 3EMTA 1IM4A 1FDNA 2Q1LA 4RLEA 4PG7A 1KQSR 1TL1B 3THPA 2JOQA 4I67A 3BZQA 1YT2A 3ISND 2XMVA 4LF2A 5D0GA 3ZNUA 5EGYA 3UN2A 1WWHA 2GQQA 4ANDA 3DRRA 4Q43A 2HFNA 2QC3A 1IR0A 3Q89A 2CJ9A 3SEOA 5HI7A 5KFSA 3VGVA 3A0WA 4TXSA 2IC3A 5CZXA 1VOMA 2ZJQQ 3MXHP 1OSFA 4K2JA 4OI4A 2RDDA 4IR1A 2BU2A 1OIAA 2R9LA 3LH2S 4DSKA 5ETMA 2D74B 4LBPA 2BKOA 4LWIA 2HSEB 2HPUA 1TKZA 3AB4B 1SJ1A 4YB6A 4F2SA 3RLRA 1JLGB 1S9GA 1JLEB 4URGA 1CSJA 2B56A 1Y5IB 2RQCA 4UW2A 4P7TA 1YHQS 2A3JA 2RD5C 1RI7A 1LWEA 4O3SA 2J7WA 3N01A 4QPTA 1EKSA 2DNRA 3M6UA 1U0HB 3EX7B 4PRFA 4P8OA 4XDCA 4WF9Q 2EFNA 2LQ8A 3OPDA 1IJEB 3WQPA 3M9MB 4JI5F 2W2QP 1X60A 3CDUA 3JTPA 3GYNA 4M5KA 3IR6B 2BYIA 4OYIA 2XZTB 2UVRA 2QF6A 9ATCB 4KR0B 2MGZB 2K7JA 1PCAA 1HI0P 3EVWA 1U8WA 3PR4A 2PD1A 2H8MA 3H5UA 1RHRB 2A0FB 4E98A 3R6LB 4WFBQ 4RPFA 1Y4ZB 2BRKA 4OI6A 3CCSS 4IQXA 2YKOA 4ID5A 2Q3PA 3ZTOA 4XKAA 2HFSA 2JEGA 1QLNA 1N4LA 5ETLA 1DARA 3TX0A 2JFKA 2XBPA 4I4BA 3T5HA 1RTDA 1MN9A 4QWCA 1RTIA 3VGSA 3K7RA 4DWIA 1OQ6A 2HEKA 3HVTA 2HQIA 1FKPA 4W4MA 1EARA 2CPIA 2NSCA 2L9WA 1M0SA 2FGCA 1DBDA 2VW5A 2KZZA 1P1TA 3NGKA 2XTJP 4KB7A 4HACA 3KUGA 1S9FA 5KFEA 1B0PA 1S0OA 1F60B 2AMCB 4A8WA 1H7SA 4HT5A 1SJFA 4NCBA 4LQ9A 2H5IB 5A8KA 1GKZA 1HWJA 5C24A 3ZO7A 3DOMB 3NOCA 4NLDA 3AJ1A 3J7A1 2ZH7A 1I3OB 1HNWJ 5J2PA 4JAVA 3OQ2A 1UWBB 4ZIWA 3BR9A 4DV5F 5K5MA 5SUHA 1HQUA 1Q95G 4PG4A 2FLNA 3MUVP 4YR2A 1RJJA 4CQ1A 2VG7A 1FRJA 4JYAF 6FDRA 3PKMA 1YJVA 1SH3A 1K73T 2FPHX 4OLPA 4NA2A 1IN0A 2IYIA 4PZVA 3KLEB 1GTEA 1AXQA 1RTDB 2BANA 1S16A 4DCJB 5L9NA 3IRXA 1WDTA 2IVFB 3A12A 4QWEA 3R5BA 2K3KA 4CM2A 3UDLA 1RT2A 2LQ5A 1HD1A 3HVTB 1S76D 2YQ1A 1RWOB 3RBZA 2E5JA 4P2XA 3BBCA 4N56A 2EPIA 3PV8A 2AJ2A 2FB0A 2OPSA 1UW4A 1RDRA 4NLUA 1IBCB 3WZ0A 2GMHA 3OWBA 3M1VB 3KHLA 4C8ZA 3R7SB 4YKUA 3Q5LA 1SQFA 2VHGA 1YC1A 3QLHA 2XS7A 3TZ2A 4C8MA 1RE1B 3CGZA 8ATCB 4X4PA 2D41A 3QPIA 4ECYA 2GIQA 1KS2A 3UN5A 1LXJA 4HEA9 5F8GA 3JTOA 5DGAA 5D7RA 4F0KA 4HHHA 2ZD1A 1YSJA 3IBCB 1S7IA 3A3OB 4BWJA 3CMES 5CXTA 4QIGA 4O05A 2HS3A 4L93A 1B62A 4FBUA 4DL7A 3UQSA 2ERRA 5A76A 1Z2LA 1SC3B 3MM5A 2W25A 2GW8A 2FC9A 4DQSA 4IFVA 2CJBA 5E3RA 4DZ6A 4HDGA 4X4VA 3R1LA 1N34J 2HLTA 3I5CA 1Q8BA 2QX0A 4X4RA 4PPZA 4N47A 1U0ZA 3NGSA 3RLQA 2UXCJ 2HHVA 3VHDA 2BOAA 2GFDA 3KKFA 5C7PA 3R5AA 2EFOA 4X62F 4ED1A 2CZVC 2D9OA 5J1PA 1GJVA 2FZKB 2E1MC 2WB1D 1PG5B 1YQHA 2BV3A 2DISA 3NGRA 3KG4A 1NDCA 4ZS6A 1ZAVA 2NXCA 3DRRB 3CD7A 3TYTA 1NSAA 3MAHA 4K0KF 4PPDA 2KO1A 3AXMA 3L3CA 1VQYA 3MMBB 2BQRA 2BMBA 5KG2A 5F5RA 2L08A 1KFDA 2FC8A 1PC4A 1B3TA 3AJ2A 4GRSA 3AODA 1BGXT 4WXOA 4B3TJ 2HS4A 4WBFA 1GNKA 2L48A 4H4KC 3R8YA 4ZPVR 2OFHX 3UNGC 4NLGA 1YS3A 1BWEA 4AYBD 2HMIB 4GKJF 4ED8A 2UZAA 1HQEA 3AOAA 3FFIB 5E0OA 4DV6J 3LMMA 2YBVA 1TAUA 1X4CA 2HVIA 6FD1A 1HYSB 1NJXA 2CVIA 4EMVA 2XSJB 5KFUA 4LFAJ 4XE2A 5C93A 2BRLA 5K8OA 2E7WA 3NCQA 3BGLA 1R27B 4RW6B 2ZNYA 2CQBA 2VDHA 4ZVPB 1MMDA 2B4OA 1LWFA 1S4FA 3V6KA 2CQPA 4WFYA 2XYGB 2IBKA 2B4UA 5GADI 1ZA2B 5HJXA 4P71A 5BYQA 4EMDA 5D77A 2KFZA 4QPJA 1RAJA 1H2TZ 2PIIA 3MM9A 4M5MA 1CJVA 2ALZA 2QGFB 4URLA 1NK9A 4JI4F 2CNOB 3E3XA 2CZ4A 4HLBA 1K0VA 3LAKA 3AD8C 3N6NA 2VA3A 1S1VB 2HBYB 2ACMA 3CF5Q 4OV1A 2KVQE 4YOEA 3D0GE 2YKMA 1B0VA 4OJHA 2CIMA 3W5XA 1YG0A 3HHDA 4TU8A 3OXLA 3MTKA 2VA2A 4CT8A 1WC0A 2OPRB 4X66J 1TU0B 2YEEA 5I3UA 3VQSA 5T41A 4LWHA 3SFGA 3QJPA 4OHXA 4KY3A 4USKA 2ZFHA 1YESA 1D9AA 1F6TA 3W9HA 3CRKA 3LA0A 3MDFA 4Y3CA 2EXUA 3TVKA 5CCMA 1M5PC 2HNDA 2BJEA 1ZTWA 5EX0A 3DRYA 4ZCIA 1NB7A 2V8HA 4CWNA 2WBRA 2Q8FA 3BSNA 1FCAA 2ZH3A 1DTTA 1I5BA 1UVKA 1BUXA 2DHSA 1W2BR 2MSTA 4RUBA 2DCLA 4BQGA 2K1RB 4K5SA 4YKRA 2G1DA 5KAKA 4FS1A 3MEEA 5EWFA 2ZKTA 1FNOA 3W2VA 3K5MA 2RQKA 2PA8D 3IGNA 3CDWA 2O1PA 3QGGA 2LP4A 2IIHA 3KWMA 5DDRC 4Q2LA 2QA2A 2H65B 2DJWA 5CHCB 4O0IA 1FRHA 2RUGA 1D9DA 2EBGA 2VONA 1NK5A 5M2UA 2YK9A 2IRYA 2XQCA 4MMOA 4MBCA 2DGSA 3Q5KA 5BYSA 1V6HA 2E7XA 1ZPWX 1ZM3A 2CPXA 2BE9B 4DV5J 2EG1A 3CB4A 3U27A 4G1PA 5ADZA 2OO4A 4PYDA 3SV4A 2EFQA 2EG2A 2MZQA 1JLBB 2MKJA 1CG2A 1BXDA 2GMLA 4EEHA 2HHUA 1ZOTA 1N0VC 1RB0A 4CO2A 1URRA 2YKJA 2E9TA 3FUYA 1TC6A 1KTQA 3BQ2A 4JV1A 1TL4A 1SJ4P 3NGUA 3AXKA 3FT8A 4EFUA 2IRXA 1Y3KA 1X4EA 2MZSA 2CQ0A 4KO0B 5LT5A 1NPKA 4MAKA 5JUMA 2MEWA 1B99A 3D7SB 3P96A 3BGRA 2HNDB 5ITHA 4PG5A 4KT0C 2YE3A 3JQKA 3BGFA 4X4OA 4K7QA 1F51A 2ROPA 5HMXA 2CCTA 1A6LA 3MM5B 4DXLA 4CLSA 1YJ7A 1VQLS 2H9ZA 3ISNC 3R6GB 3M2RB 4DLGA 2QMWA 2J7UA 2A2DA 4ASGA 3GJSB 3B8HA 3GIJA 4R3MA 1T9XA 3C15A 4IG0A 1Y3JA 2VJVA 2VICA 3NKYA 5T7LA 4M5HA 1TKXA 1IKYB 4C4WA 1HNXF 1O6XA 4ECUA 3LP2A 2OH2A 4ECZA 3FGVA 3C16A 2YKIA 3R5GA 1LEOA 2UXDJ 3W3SA 4U95A 5GAHI 5KFYA 1RLDA 1Q53A 1OY9A 3KJVB 4UTGA 2Q8IA 5ETKA 1WC3A 4WIQA 2VQFF 2XS5A 1WF1A 5LM7E 1HMVA 2OPSB 3HKWA 4NMLA 5KFNA 1N32J 1NK0A 1MU2B 2V8GA 3HULA 1HPZA 4ICLA 3U2KA 3FVYA 2AJQA 1F5CA 3WBZA 1FKOA 4GEEA 2AJ4A 3ZFVA 2ZDPA 1BQNB 4X4TA 3JAMU 3VAGA 3PO5A 4TU7A 2KHCA 4ED4A 2XK2A 1C1BA 3H90A 1DZ5A 2IA6A 4HH1A 4JBCA 1M5OC 1E6YB 4RX6A 5LSRA 2BR0A 3RAXA 5ETRA 1PYSB 3QTFA 4K4SA 4Y00A 3MEGA 1RCOB 3MMAA 3KHRA 2X1BA 2HFOA 4KHMA 4JI7F 2ZVSA 4EBCA 4CE1A 3NBPB 1O0PA 3W2VB 3QSIA 1GMWD 4DUHA 2QEXS 1PC5A 2HK3A 4CRJA 1WI6A 3PACA 3ZKBA 1D1UA 2ZH4A 2IOQA 2R7RA 4ZVUB 4ERDA 5B0AA 3GE9A 3KLGB 3CJKB 1S1TB 3W5ZA 3D6TB 5IFMA 1TKZB 3AD9C 1PJ6A 2DO0A 1S97A 2ZHBA 1G2EA 2KTQA 2VFRA 3Q86A 4RNHA 2DNKA 2YKAA 4NH9A 2DY1A 1IKXB 2PO4A 5DG7A 3LTOA 4U8VA 1RAGB 4MKYA 1L3KA 4DL0C 4RBVA 3H80A 4R0EA 1AFJA 1XNRJ 2XS2A 3I96A 3CSKA 1S6UA 4FXDA 4V26A 2BX6A 4P10A 4ASAA 1UPMB 3FQLA 2EKNA 4KSEB 1W25A 3U7JA 2CPFA 2AX0A 3BR8A 4YP3A 5KFXA 1HHQA 1PKUA 3MEDA 1S9EB 3PX0A 4UUXA 5D7DA 1NSPA 3HJFA 3H2VE 3R4PA 3ZZYA 2Q8GA 5ETPA 3D6FB 2WK4A 4WTOB 5F8LA 1WHXA 2XHXA 1R3NA 4DSEA 3T41A 4OHYA 4ECWA 5IT9Y 2CQCA 4XDDA 3UDCA 3BDPA 1RBOB 2XX5A 2F1FA 3BQ1A 1VLOA 3Q8RB 5DM6Q 2C2AA 4NYPA 1E6YA 3LP1B 4FPPA 2NUHA 4I7FB 4LBHA 4WU3A 1I1GA 4DV7J 2O66A 2J6TA 2ASJA 4PKDB 3DOLB 1Q8LA 4NOHA 3CDBA 1QTMA 3G8SA 1S57A 2WEQA 1PBUA 3HSZA 2H48B 1TVRB 3M6WA 4NLOA 1Y00A 1SJ3P 3KNGA 3CCLS 4NRUA 2B6AB 3KXDA 5DQIA 4WE1A 4KAIA 2Z2ZA 1RISA 2B8PA 4FBTA 1NHKL 1HWKA 1PYOB 2BYHA 2KT2A 3NRBA 2LQJA 3VAKA 1Q0NA 3M2UA 1TL7A 2BABA 3HYYA 4Z7CA 4MIBA 2XNRA 1KHWA 4O4GA 2RSQA 4DCOB 2P2CB 2HQFA 4OI0A 3FMBA 2HGLA 3KK3B 4X4NA 2ZEJA 4WKYA 1QVFR 1Y0HA 2ZJRQ 3EKOA 4HKQA 2BTZA 4EGLA 1ELOA 4P75A 4WK1A 4XAKA 1RK8A 4OX8A 3W7BA 1X4HA 1VQMS 3Q2TC 3PHEA 2YNIA 3BKUA 1T05B 3NG8A 2FJEB 3CXCR 4MYUA 2CPHA 4HYPA 2CQ4A 5BOCA 1HBUB 3MM7B 5B0GA 2NXJA 3N6LA 2VPYB 3VAJA 2CPEA 3F44A 1HW9A 1JIHA 3ZZUA 1VI7A 1FDAA 2V5HG 3K60A 1UYIA 1WDDA 4I2PB 4DQRA 4KJIA 1TQLA 1H2UX 4C0HA 3LOUA 3CULA 4KKOB 4FP9A 3Q8SB 3MTJA 4F4AA 1Q5YA 2ASYA 5KFKA 4UQGA 1HWUA 3O8WA 5CF0A 5GAEU 5JVHQ 3GIMA 4I69A 4C9DA 2QLBB 3S1TA 2VKRA 3SDEB 4C8LA 1SIZA 1JLFA 1Q7LB 1FKAF 4G1IA 4ITSA 2OPPB 3Q8VA 4B3TF 5KFFA 3KLIA 3B26A 3OHBA 4AUKA 4NXMJ 1HNZF 4UOCA 2H4WB 1TFWA 1RCXB 2DNPA 4JUZA 3OR1A 4DU7A 4DV1J 2JLFA 1HD0A 3B24A 2C1GA 2VQEF 2M8DB 3VWSA 1HMVB 3EM1A 3CTRA 2AT1B 3NMQA 3KG0A 2XI2A 4DL4A 4DL3A 2N4DA 4LFCJ 4ID5B 2HVHA 4EYIB 4P2MA 2H4YB 2ZDXA 3N9UC 4Y65A 1QTNB 3UD4P 1KWMA 1HBMA 2YKNA 1OQ3A 1RTHB 3TTZA 2Z2YB 3LGHA 3AA8A 2QYGA 4F8RA 3TO8A 3HHKA 2C3PA 2VFSA 3OWDA 5M4HA 4DPXA 3FSYA 3AAWB 2QG9B 3JSMA 4LF8J 4ZJQA 1NNDA 1NSKL 2OGUA 2C2ZB 2VFVA 3QIDA 1QD1A 4J7CA 3CC2S 2WI6A 2FHKA 1C4CA 3FC9A 4URQU 3EZ5A 3IR5B 4MOTA 1LK7A 3HP6A 5E2QA 3IWNC 3VZIA 1MN7A 1BXNA 3B6BA 1EQ0A 4EGHA 2LEAA 3TVYA 3OJUA 2Y8WA 5HO4A 4NWBA 5C2GA 2XO6A 5K20B 2GJIA 3NNAA 3ENAA 2DNOA 1RHKB 4EWTA 1UPPA 4PWUA 3R5CA 2C2NA 3PG9A 2DIUA 2FVQA 4TY8A 4J91A 1FE0A 2GVZA 2IYGA 2DRDA 2DNMA 3H5XA 2F7VA 2AEMA 3MM8A 1ITPA 2ZZTA 3CJQA 2CFXA 3M8YA 3SZ2A 1VJQA 1P6TA 3MAQA 4F3MA 1WTFA 1TUWA 2DR9A 4DZDA 4Q20A 3O44A 5H9EK 2XLKA 1YRXA 3BJYA 2KHDA 1YJNS 3IWLA 1SL1A 1N33F 2P6SA 4Q44A 4DV1F 3TA2A 4DU8A 2ZJPQ 1R0CB 2EXLA 3FEZA 2CJXB 1JQGA 2QG2A 4OZ2A 3IAS9 1VHIA 2AIRB 1K9MT 4ZPWR 1KBRA 1Y5NB 4A46A 5C25B 2AJFE 2JDJA 3C2PA 1BKNA 4WFNQ 4CTAA 4BDPA 4R1FA 3R7BB 1WOOA 2I6WA 2C2RA 2VBYA 1RA7A 1QSYA 1FFWB 3TWZA 3Q5JA 3BGOP 2AYBA 2WB4A 4MTPA 3WHAA 2QSWA 4RW7A 4C98A 4DR6J 2BZ2A 2EFVA 2K1RA 2EWHA 1BC6A 1UEVA 2KZMA 4B3MF 5E3PA 4PXBA 4YHHJ 3PYDA 4CI0B 2KH9A 4YDXA 3FSXA 3LWLA 2PMWA 3U2DA 5I3UB 2XY5A 1NK4A 5DJBA 2GVDA 5LMUF 1UJ4A 4DR3F 2GGPA 4RUHA 5DDPC 5KOWA 1RT1A 3K8WA 1TR0A 2DEIA 1VIOA 1XIQA 1FEEA 5FNFA 2HNYB 1UZHA 3PJXA 3U67A 5DLFA 1JXEA 4Q7AA 2D3ZA 3G6ES 2O1VA 4F25A 2W8KA 5IQQA 1D0EA 3TJAA 1LKZA 5J2NA 3BDEA 2IAJA 2AD9A 1YKWA 1S1VA 4F4ZA 2ZD1B 3TR5A 2NCKL 3HMJG 1CPZA 4OI2A 3MCSA 1RT3B 2VFUA 2PA3A 4B3SF 2UV8A 2GMJA 2B5JA 2IBOA 4Z2XA 1JM6A 2FUG9 1SKWA 4LF7J 4G1QA 1FRMA 2QLWA 1WORA 2YWEA 4L6V3 5D4NA 4WZQA 1ZYQA 1HBNA 5B0BA 2HCHA 4ASFA 5CTYA 3RB0A 4FCQA 4F50A 3RB4A 4CYUA 2VG6A 2OSRA 5DDQC 3MR3A 1CVJA 4DPYA 1F3FA 4HZ0A 4WK3A 4OYMA 4C11A 3RBXA 4IRCA 2M2BA 2BUNA 1HPZB 4ICLB 3TUPA 1LFWA 2RT3A 2B8QA 4OX6A 3N5BA 1L3UA 2CJAA 1TH8A 2AKWB 2DH9A 3UFCX 4KP4A 4IKAA 3HI9A 2ZZNA 3MM8B 3W60A 4ILRA 1WACA 1VRQC 4X4QA 2FZCB 4XIPA 4ZCMA 3GJTB 2H3EB 4B9UA 1NZ8A 1REVB 2YY3A 2Z57B 4CLZA 2MMYA 3MR6A 1RT4A 1UYEA 4ED5A 3MFHA 4DV6F 2MXYA 2XSFA 2XD6A 2I5JB 2M8HA 4ZLLA 4GKKJ 1VRTA 1FVQA 2YNGB 1RABB 1XNRF 3EICA 2W7OA 3T6BA 2Z2LA 4GMKA 4ZVOB 3RR7A 1WUUA 3LPYA 1PVGA 1RAHB 2VJUA 1U1LA 1RA6A 3EXYA 2ZNZA 3UCZP 3MECA 5E33A 2YNIB 2QL5B 3BN4A 1FFGB 3CCRS 1Y8OA 1OSDA 3OSNA 3OTDA 3W9JA 2K2PA 4KV8A 2XHRA 3DGPA 5FNCA 3BPDA 2P9CA 1DQ8A 1BYQA 1HWLA 1WHWA 3MPDA 4MPCA 2FGOA 4OZJA 3TAMB 1RT7A 3E01B 3I9V9 1RTHA 3CCTA 2XYPB 3VHCA 1N5VA 4DG1B 3W8PA 5D4PA 7AT1B 5B0FA 1QE1B 2KB2A 2P8IA 3ETMA 3OXFA 3SCKE 3T6JA 2V4RA 4YEAA 3CW2C 1ZAWA 3T1YJ 4HHJA 2X1AA 1HHTP 5D8HB 3QFWA 4W92B 1U8SA 2ROGA 1UFLA 1O51A 1S1XB 1QAIA 1MROA 4USHA 4LR8A 1M1KT 3GB0A 1NHIA 3GIIA 4B3OB 2FJVA 1NEEA 2VG5A 3CMAS 1EQMA 4WFZA 4MK8A 3NNCA 4RW9A 1T9TA 3MOZA 1RHUB 2LA4A 2MB0B 2IM3A 2YI7A 3CCVS 3IRWP 2CJYB 2NPFA 3JQMA 2JC0A 2YWFA 2J0SD 1ZA1B 5C42A 3VHAA 4JOUA 4ZKIA 4XCLA 2UUCF 2FJAB 2C42A 2W4CA 3R91A 2UU9F 4K2XA 5HMYA 3K8VA 5EX3A 1X9MA 1KVIA 2WOMB 5JMNA 1RXOB 2ZUGA 4NA1A 4UF4A 1ZWHA 1C0UA 5I4MA 2DNHA 4LVOP 4F4WA 3VGUA 4J9RA 2NXUA 3FRYA 4PUOB 1DLOB 1U09A 4RNNA 3UR0A 1S0MA 1X5TA 2IDLA 4YMEA 3GMGA 5L3JA 3IM9A 2MQOA 5KFCA 4P7AA 3TX8A 3OL6A 3A4TA 3MFIA 3MF5A 3KK2B 2YWWA 1WOSA 4H54A 1HL6A 1KOHA 1L5UA 4E0DA 3EJMA 4R0JA 1ZZNA 4ES3A 2O01C 4I64A 4ZJOA 1XK8A 5CYJA 1D9FA 3NCPA 4ZLJA 4USMA 2YE8A 3MD1A 4Q5VA 3H8YA 1K0TA 4UY8T 4M63A 2L9NA 2MQQA 4DV2F 3D28A 4YKXA 1VISA 2YI5A 3SSSA 3D6HB 1KVKA 1H38A 1QDUB 4CLUA 5F8IA 1NPPA 5KFBA 1GTHA 4RNFA 3OVSA 1REGX 4NZ6A 3L7PA 4J9VA 4ZVGA 2I8EA 4F36A 2PDAA 2UUBJ 2FWZA 3HT0A 1HBNB 2ALYB 1QAJA 5AXNA 3VGTA 5EDWA 4O04A 1URNA 4Y28C 4F2RA 3VALA 2Q66A 2RDJA 4NH7A 2LECA 1RYSA 5DG9A 3MMCB 4QR0A 3QFHA 1XR5A 4PWWA 2WI7A 2R7UA 1MU2A 4JI7J 3PJ9A 1LK5A 1WEZA 2R2TA 4MKBA 5KT4A 4CH0S 2Y9HA 3C6TA 2CG9A 9RUBA 2MQPA 2AGPA 4ALZA 2QMUB 2OELA 3SCIE 1U1RA 1NKCA 2ILYA 1CEZA 1UL3A 3M8RA 3R97A 2CQIA 4FKXA 3PXGa 4ZPDA 4EK2A 2BREA 2UXBJ 3PNIA 4KIAA 1T11A 1FTRA 3BREA 2ILZA 1I59A 2M3DA 2CKWA 1RWVB 5IOLA 4B9MA 3IFEA 1AROP 1RWPB 1FWLA 4F4KA 4DBQA 3M8ZA 2YKMB 4CLKA 3KK2A 1B63A 1LWCB 5KFIA 4YR3A 4LF4F 4EFTA 1UZDA 1L3TA 3T2SA 5J2MA 1R31A 4LFBJ 4LRCA 4L72B 1IR2A 3M9OB 1S12A 1T95A 4DQPA 4YB7A 3S01A 3ULHA 3H5YA 1PBAA 2CWXA 4C97A 2DK2A 5A6PA 3HM9A 2HGMA 4OZLA 4OZNA 5D7CA 5DRKA 4DV4J 2BE7D 3HHEA 1XBWA 3GJRB 2EI5A 2HHHF 1RAFB 4WJBA 3N0VA 3PFEA 2XLIA 1OY6A 5KG0A 1VGYA 3DLLQ 5J2QA 4J9MA 2FYPA 4MK7A 3R1HA 2VPXB 2Z8QA 4LBIA 3H59A 2E5IA 3JXOA 4YHHF 2JVOA 1N36F 3T1AA 4JI1J 1HI8A 2BBEA 2VBXA 1P8GA 2OD4A 4EGIA 4AT1B 2RU3A 1M1HA 1CJTB 4OX7A 4F02A 3RKZA 1J2VA 4USWA 2XZWA 3SYZA 3GPAA 4P74A 1PILA 1YBAA 1NZAA 3T1KA 4JV0A 4PCQA 1V5VA 3QYYA 1VBKA 3MCOA 4KBIA 2ZH9A 1KRPA 2RU9A 3NMAA 3TRGA 4ENOA 3GP9A 2NPIA 3IXQA 3ZZRA 3H2UB 1BD6A 3EVOA 3FEXB 4RKUC 2CZ9A 3TZXA 1TV6B 1JJ4A 4MPEA 1N33J 5J1EA 1SC1B 2HYIB 2C3UA 2IOPA 1XWLA 3E2EA 4KTNA 4JAUA 3TW0A 5FWKA 2YNHB 3O0IA 3TNVA 3NEKA 2GVZB 4DV0F 1UYDA 3UNYA 4QPXA 4TY8B 5KG3A 2D69A 1KZNA 4NLXA 3QRRA 2FJXA 3ZXQA 3H4DA 4CZCA 5EN1A 2FXSA 5KOXA 5IWAF 2VG7B 2G2YA 4J9QA 1S1UB 4DJBA 1EX8A 4YKQA 5KFOA 5KFPA 5CABA 3T19A 1EZZB 4FS2A 3AY0A 2WZ1A 3G7EA 2W9BA 2PSZA 2QFIA 3W5YA 2HHWA 3MPVA 1WSRA 4CLYA 3OMUA 3R4NA 2B9EA 1TL5A 2N7YA 2IFXA 3N28A 1T9VA 4GVLA 2L9DA 4JI6F 4P9SA 1TK0A 1TC0A 1WHYA 3AA9A 2R8KA 1RP5A 2V2KA 4DL5A 4V25A 3V81A 4DL6A 4BC9A 4CM0A 4IUFA 2I5JA 3TJ9A 2FJBB 1CJUA 2WVBA 1T7PA 2VWCA 3VAHA 2HZCA 2OI2A 3GV7B 3HLUA 4NH8A 3FCVA 4URSA 4LIWA 2HQDA 4FVMA 3M6VA 3T9NA 4ECSA 1FA0A 2FHJA 3B27A 3NLCA 3QBCA 3KDNA 4KFBA 1QVGR 3RJMB 5A8RB 4DX5A 3DM2B 4PG8A 2YE9A 1CJKA 1GX6A 4MPNA 3CCUS 3FCWA 2F4VJ 4UUWA 2VKZG 2HW3A 3QAUA 2CJQA 3TQ1A 3PY8A 2CPYA 3F73A 1ZH5A 3IM8A 4ER8A 1FNMA 4LFCF 2HQGA 4QIFA 1VQSA 4WXWA 1UEUA 2KN4A 3A13A 2X3GA 4C11B 2XMUA 4C3LA 2LFVA 1S14A 1S6PB 2A10A 2CQDA 3J7YU 3UE2A 5KFJA 4B9VA 4Q8FA 2ZBIA 1BMQB 2NXNA 3AOCA 2C1EB 3I6PA 1VQNS 2E9ZA 1R62A 2XJXA 3DNCA 4D3HA 4M1KA 2MYFA 4CCHA 1RKJA 4OLOA 5CYQB 5CD4H 2G4BA 1L3VA 1YZ6A 3O2IA 3ENQA 2XHTA 3TJ8A 3MD3A 3GIRA 2V4JB 5M4NA 3KLFA 2YNGA 5E7OB 3N79A 4HR2A 1U2RA 4TNOA 4DV2J 1PAUB 2Q2EB 3SSRA 1F2HA 2ZH6A 4H85A 1U6ZA 2MKIA 3KUHA 3PDNA 2HLUA 3T5JA 3DGEA 2BJ9A 2HNYA 1JLGA 4MK9A 3IP0A 2ZBKB 5E5NA 1UYKA 5ETNA 2XMTA 4HXZA 4DX7A 4Z7YA 4FYYB 3EXCX 4IOBA 2MHNA 5HLFB 4FVCA 3G82A 5L1JA 2XDXA 1FWKA 1RTJB 4IFVB 3CWVA 1FJ7A 4YKYA 4Y2KA 3K58A 1RT6B 2QLFB 3T1HJ 3HHLC 3DMJB 4X62J 3CCJS 1JXVA 2G0JA 2WTFA 4B6CA 1YRUA 2B7CB 5KFAA 3IMQJ 3KNAA 1YSRA 4GKKF 4FYXB 3OUYB 2VG6B 4QW9A 4Y2AA 4DPOA 3SSQA 4CWFA 2R8IA 2VBZA 4HY6A 3KTQA 5F9NA 1EI1A 2DNQA 1GXTA 4E72A 2HFVA 1OSCA 3CC7S 4UROA 2RAQA 2MQMA 4ZOSA 3MMCA 4IDKB 3O2FA 2NSBA 1LWFB 1XMOJ 1BLUA 2Y1RI 3C6TB 4N77A 1T3OA 2XCMA 2W01A 1HBOA 2C2EA 2C28A 1S4EA
chains in the Genus database with same CATH topology
2HFOA 4KHMA 4JI7F 5B0CA 3DXBA 2ZVSA 2FY1A 4EBCA 1T03A 4Z37A 3BGRB 4LWFA 4CE1A 3NBPB 1O0PA 1VRTB 3IN5A 3R92A 3W2VB 2J5AA 3MZIA 3PVXA 1VC0A 1D3WA 2ESAA 1VQOS 2F8MA 4YB5A 1PC5A 2QEXS 5CYQA 4DUHA 3NS5A 1WI6A 3PJWA 2KFYA 3PACA 3ZKBA 4ECVA 2KDOA 2UUBF 1RT4B 2YH1A 1D1UA 2WI3A 4ZDNA 2ZH4A 2IOQA 4LF9F 2R7RA 1WELA 2R7OA 4ERDA 1HBMB 5B0AA 3LGMA 3GE9A 3KLGB 3CJKB 1APSA 2RQMA 2GQCA 2YE7A 1S1TB 5L1KA 4EYHB 4C8YA 5IFMA 3RU0A 1TKZB 2VH7A 1ID0A 2DO0A 2DR5A 1S97A 4C8KA 2ZHBA 3SQGB 2VV5A 1G2EA 2KTQA 2VFRA 1Q82T 5K8MA 1N6QA 4DF4A 2NUUG 4RNHA 2UVVA 3DOKA 2DNKA 2FD2A 3CJ4A 1EA6A 2YKAA 3KLVA 4NH9A 5HQ8A 3M1VA 1HNIA 1IKXB 2W9CA 2PO4A 2ZOFA 5DG7A 4OJGA 4HYMA 3IGVA 5KT6A 3RZAA 4LP0A 2J76E 1J5OB 2B0GA 2MKSA 5F41A 2OTLS 4MKYA 3HHLD 1FRXA 1F5AA 1L3KA 4H4KA 3CD0A 4O09A 2L3MA 4DL0C 4RBVA 1VQ4S 1VC5A 3H80A 4EEYA 4DR7F 4O0BA 4KFBB 4R0EA 1AFJA 3ZM7A 3GFHA 3M32A 3DYAB 4URMA 3DLGA 2XS2A 2BE2B 3I96A 3VADA 3OTCA 3EHFA 1Q1KA 1SBRA 1NO8A 3CSKA 1S6UA 3QLHB 4FXDA 3ITHB 3NP5A 2OAUA 4Y2IA 3CVKA 1LQ9A 4V26A 2MY8A 3L95X 5KG1A 1HR0F 3HZEA 3PEHA 4LQ3A 4ZMMA 2YNFA 1QUPA 4YY3F 5GADU 1J5OA 2HMIA 4X2BA 4BAEA 4MIWA 1HI1A 2AKPA 1KD1T 4ASAA 4M8LA 1OWXA 4EFAC 5DQHA 3QGIA 3SFUA 3FQLA 2DGXA 4WE1B 4U7UK 4KSEB 2WI5A 1ROFA 3A1YG 1W25A 2M88A 1HFEL 2IM2A 3D1HA 2CPFA 3U7JA 5H1SV 2AX0A 1OPZA 4MFBA 3BR8A 4DFKA 4YP3A 5KFXA 4I6YA 3DN9A 2QT7A 3A0TA 3M6XA 4OI3A 5F8NA 3MEDA 1D8YA 2E0AA 3D0BA 3NAIA 1S9EB 1LV5A 1T94A 2XLJA 2WI2A 2VPWB 2EW9A 3PX0A 1MSWD 4WKRA 4UUXA 3I5BA 3CWJA 5D7DA 3HJFA 3H2VE 1M5SA 3ZZYA 3R4PA 2YKPA 2Q8GA 2X1GA 3MOJB 2QG0A 2WK4A 4ED0A 2DH8A 5F8LA 2DB1A 3BSCA 1WHXA 3O6QA 1R3NA 3AQOA 5AE2A 5CA5A 5IT4A 1IXKA 4XO0A 4DSEA 1UYFA 2C22A 3NMRA 2M0GB 4NYOA 1XEZA 3RBEA 4OHYA 1U1MA 2W24A 3DDNA 4ECWA 5BR8F 3OTBA 2IWSA 1H6KX 1X4BA 1M5VC 3GIGB 2UWDA 4O3NA 3OLBA 3I56S 5IT9Y 2KU7A 4XIUA 2QO3A 2CQCA 4UQTA 4XDDA 3UDCA 4QU7A 1HNVA 1MMLA 2HHQA 4DQIA 5KFTA 4DSFA 1VIXA 4IG0B 1CC7A 3JZ3A 3R4OA 4B7PA 2LXUA 4ZVFA 3BDPA 4KV8B 2LVWA 4I2PA 3A0YA 3ISZA 5MAOA 1IKVB 4RZRA 3THTA 2F1FA 2XX5A 5L1LA