3PEHA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of a thienopyrimidine derivative
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
261
structure length
261
Chain Sequence
b'ESMESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin homolog
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of a thienopyrimidine derivative
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Chaperone
total genus 78
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pehA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pehA01
5BOCA 2YECA 4HZ0A 5CPHA 1UYLA 4EFTA 2H8MA 2UWDA 4L90A 3Q5KA 1H7UA 5CTXA 2C2AA 4O09A 3A0ZA 4LPBA 4HYMA 1EI1A 1H7SA 4KP4A 3HZ1A 1YC4A 1I5AA 2O1WA 3T1KA 5M4PA 2ESAA 5D6QA 3CWVA 2BT0A 4PU9A 1NHHA 4YKTA 1QZRA 1YESA 3U2DA 3Q5JA 2IOPA 1YT2A 3GIGA 2YEDA 4B7PA 4XE2A 1BKNA 1MU5A 2YKJA 4XD8A 4NH9A 3R4MA 1I59A 2CH4A 4MPCA 3FT8A 4DUHA 2YK2A 2CCUA 3HYZA 2GQPA 1UYFA 1KIJA 1ZW9A 1Z5CA 2XDUA 3ZM7A 1NHJA 3R4OA 4BXIA 3R91A 2YKCA 5IDMA 3R92A 3HEKA 4CE3A 3FT5A 3C11A 4ASAA 4AWPA 4XKKA 4URMA 4H81A 5L3JA 2BRCA 4U7NA 2CGFA 3OPDA 1BGQA 1I5DA 2YE2A 4YKXA 2YGAA 3H80A 2CCSA 1UYHA 4DZYA 1THNA 1B3QA 5FWKA 4V25A 3JZ3A 2FWYA 2WI5A 4O05A 4BQJA 4GGLA 3K99A 3QTFA 5M4EA 2E0AA 2QG2A 4XC0A 1AH6A 1TH8A 4X9LA 3K98A 4GFNA 4I3HA 3OW6A 4E00A 3O0IA 4XCJA 5M4MA 4WUDA 4CWSA 1S16A 1OSFA 4I5SA 2BU7A 2WI3A 2BTZA 2YI0A 3GIEA 4EEHA 4XKOA 4YKUA 1QY8A 4KFGA 1I5CA 4YKZA 3D2RA 3T0HA 1U0ZA 3B27A 2VWCA 3CGYA 1U2OA 3R4PA 4MPNA 3MNRP 1US7A 3R4NA 2YEBA 1I58A 2WEQA 2XJGA 1Y4SA 2FXSA 4GCZA 1UYMA 3CRLA 5FNFA 3A0XA 4JAVA 3CRKA 1UY6A 4FCPA 5J71A 2WI4A 2JJCA 5CTWA 4L93A 3NMQA 1Y8OA 1Y8NA 1YC3A 3D0BA 2FWZA 4FMTA 4K4OA 2IWXA 2Q2EB 3ZXOA 1KZNA 2EXLA 2IOQA 4KSGA 2VCJA 1BXDA 4MB9A 4YKWA 3DGEA 2YEGA 3VADA 2YE4A 4GT8A 4YKYA 2YE6A 1GKXA 2K5BA 3Q5LA 4WUCA 5D7CA 1MX0A 4XITA 4CE2A 3WQ9A 3KE6A 3QDDA 3LNUA 1S14A 3T2SA 1ZXNA 5F5RA 1EA6A 2YE8A 4CWFA 3GIFA 1Z5BA 4XDMA 1UY8A 4QPJA 3TTZA 1YERA 3B24A 2VW5A 4EGKA 1UYEA 3HHUA 4GEEA 2Q8GA 1GKZA 4PRXA 3INWA 4B6CA 3T10A 4KQVA 4MP7A 4ASBA 1TC0A 4AS9A 2ZKJA 2ZBKB 4XIRA 3K60A 4HXZA 2YJWA 3TZ0A 3BM9A 3EHJA 3CGZA 1AJ6A 4BQGA 2PNRA 2YGFA 2VCIA 4R1FA 4P8OA 1YSRA 2AKPA 2YKEA 5D6PA 4CE1A 4EFUA 3OMUA 2GFDA 3U2KA 2YE3A 3H4LA 3PEJA 1A4HA 2YI6A 1YS3A 3B26A 1UYGA 3ZXQA 4ZVIA 4H85A 3TZ5A 2WI2A 1YETA 2QF6A 3D36A 3RLPA 2XCMA 4CWNA 4YKRA 4YKQA 3VHDA 1TIDA 3EKOA 3RLRA 4URLA 2BU8A 2IORA 1UY9A 4QPKA 4WUBA 3U67A 3A0WA 3VHAA 3LPSA 3EHFA 1Y8PA 2XDSA 3HZ5A 1QYEA 1AMWA 4GQTA 2Q8FA 4CWQA 5CTUA 4URNA 4PL9A 2XD6A 3G7EA 2XJJA 4L8ZA 4NH7A 3G75A 4XKAA 5F3KA 4O0BA 4HYPA 3T0ZA 2XX2A 5C93A 3FV5A 1YT1A 4FCQA 3RKZA 2QG0A 3IEDA 1UYKA 4HZ5A 3TZ4A 4XIPA 2CG9A 1UY7A 4LP0A 2Q8HA 1YC1A 1NHIA 2IWSA 2XDLA 2YEHA 4KTNA 3EHHA 1GJVA 2YE9A 2YE5A 4P7AA 4EGHA 3A0YA 2XHRA 3INXA 2XABA 4HXWA 4LWFA 2HG1A 1ID0A 2YJXA 4NH8A 5CF0A 1ZWHA 4KSHA 2YEFA 2XX4A 2ZDYA 4JQLA 2WERA 2HKJA 1AH8A 5J6AA 3B28A 2Q8IA 1TC6A 2XDXA 3K97A 2XHXA 2BSMA 5M4HA 1Z5AA 5M4KA 4HY1A 4LWIA 3O6OA 3OWBA 3TZ2A 1B63A 3ZKDA 4CWRA 5D7DA 5M4NA 3ZKBA 2BYHA 2JKIA 2WEPA 3C0EA 2YEEA 2BU2A 2BU5A 2YI5A 3OWDA 1UYCA 4UROA 4E02A 3EKRA 2HCHA 2WI1A 1Y4UA 2ZDXA 5IN9A 4BIZA 1Z59A 2BZ5A 5BODA 2YE7A 5IDJA 2YEAA 4FCRA 4FPPA 2O1UA 3WHAA 4EM7A 4EMVA 1AM1A 4U93A 4XIQA 4MBCA 3A0RA 3BMYA 4XTJA 2BU6A 5FNCA 3VHCA 3A0TA 4CWTA 1TILA 4MPEA 4EGIA 4HY6A 4BIUA 1R62A 4R3AA 1UYDA 2YK9A 2WI6A 2XHTA 1PVGA 1BYQA 4AWQA 4BAEA 3SL2A 5CTYA 1L0OA 4O04A 4H7QA 4R3MA 2YKIA 4L94A 3RLQA 4O07A 4V26A 2XX5A 2YKBA 2BYIA 2IWUA 4W7TA 4JASA 5GGZA 2YEIA 3EHGA 1ZXMA 5FNDA 1TBWA 4MOTA 1YT0A 2WI7A 2YEJA 4CWPA 4PRVA 4E01A 3O2FA 4XCLA 1B62A 3GIGB 2CCTA 2XJXA 4ZKIA 4LWHA 2H55A 4Q20A 2YGEA 3TUHA 1YSZA 4U7OA 3G7BA 1I5BA 4ASGA 4CWOA 4JAUA 4ASFA 2YI7A 2FYPA 3PEHA 1UYIA 2QFOA 2XK2A 4AWOA 2XDKA 3HYYA 4L91A 4LWGA 2O1VA 4LWEA 2BREA 4MP2A 3B25A 5D7RA 1JM6A
chains in the Genus database with same CATH superfamily
2B4PA 5E3CA 4DU7A 3BQ0A 1R8PA 1U26A 2KN4A 4QIWD 1VQ6S 2ZEJA 3A0ZA 1KKHA 4HYMA 5GADU 3QO9A 2QIFA 2ASJA 3DLJA 2IMWP 2N3LA 3TX8A 1YJ9S 2B7BB 5L8RC 1VGYA 1BWEA 2IOPA 1R6YA 2O67A 2FDNA 1B3TA 1L3KA 5E0OA 4CLWA 1S1TB 5FLXY 3DRPA 4DV4F 3QRPA 3GG0A 1JK9B 1NO8A 3DU5A 2C22A 1NK6A 1ZM3A 3KK3B 4RNMA 5HQLA 3C11A 4CI0B 2YKPA 4N5SA 2XMMA 4URMA 4I6WA 4RW6B 2XQCA 5J2NB 4U7NA 2W2MP 4JI7F 5E7OB 2DXDA 3T1HF 2HPUA 1UVMA 2B5JA 1TUWA 1XNRF 1JJCB 3HCXA 3SDEA 2OEKA 3K99A 2LDYA 4X64F 5M2UA 2ZBCA 2MKYA 4RUHA 3M32A 3L3CA 3UWTA 1D8ZA 5IV4A 4M5DA 2R4FA 3GIEA 2UVUA 2BE7D 1A0OB 1EP4A 3PR5B 3KJVA 4DUZJ 4KFGA 2ACMA 4IOBA 1KQSR 2I6WA 1IKXA 1L3TA 5DQGA 3JYTA 4NLUA 2GX8A 3H4BA 1X5SA 2HNZB 4C11A 4DQRA 4HEA9 4ZHRB 3M8ZA 3EVMA 1RT3A 2RS8A 1Y8OA 1Y8NA 1CULA 2FJXA 1U1RA 2VCJA 4PXDA 2ZH3A 3BN4A 3U1MA 4E72A 4JI1F 3BBFA 3IBWA 4O3QA 1UWAA 1PJ5A 3M8WA 2KXHA 3N6NA 2AP6A 3I5BA 4N56A 3KTQA 3TA1A 4ATNA 1K8AT 4AXIA 3NNAA 2ABYA 5AXKA 3EVOA 2YE8A 4KPYA 3C6TB 4NYPA 3D0GE 3EZUA 2AV5A 4FF2A 1FRJA 3A13A 1UYEA 3HHUA 2HFZA 3NMAA 2RQCA 1RTHA 4UF4A 5DG9A 4IQXA 3V6DB 1MMNA 4AQYJ 1CEZA 1EQMA 1SBRA 3E3XA 8AT1B 3G2XA 5KT7A 1HNXJ 2JVOA 1X4DA 5IT4A 3HVTB 2BR0A 2QA2A 3VVUA 2LLZA 3TI0A 3EGNA 2GJIA 4R0JA 1P1LA 4WK3A 1UPMB 2ZH4A 2XHCA 2E5IA 3H2LA 5ETTA 2KKHA 4DG1B 2HHWA 2VKRA 3W61A 3EKOA 2HHHF 4U8VA 4O3OA 3DLEA 4GKJF 3EHFA 4GVBB 4GQTA 5FDLB 4MIWA 2L08A 5B0BA 4PL9A 3Q22A 4IQMA 1FFSB 5LMUJ 4NH7A 4P7TA 4FBUA 1I6JA 1XMQF 2ZOGA 3SBMA 3BBBA 1U02A 2O01C 4KRWA 1T3NA 2YQ1A 1ZM2A 5J2MB 1U09A 2XDLA 2I2YA 1LNQA 1FCAA 3LUYA 3SCKE 4KSHA 4KY3A 5GVQA 4ZVOB 4GC6A 1XMBA 4R0EA 4HY1A 3A8IA 2KVQE 4FKXA 4TXSA 5THWA 1RT7B 5M4NA 1ZA2B 1VQOS 1BLUA 1F9HA 5CD4A 3NY0A 2W4PA 2HBZB 3GWCA 3PFEA 1CS4A 2BZ5A 2ZKTA 4AXJA 2O1UA 2MYFA 1GXTA 3S7RA 1U6ZA 3G9CA 1FHTA 3OFHA 5BYQA 4HY6A 3W5ZA 3TP2A 4LUBA 4IRCA 3HXMA 1PVGA 4IH7A 5C7PA 2RDJA 1NNDA 4BAEA 3NMRA 1DAXA 5DQHA 5BJRA 2NUHA 3PXGa 3WQPA 4L94A 3CE8A 3AB2B 4ILLA 1KBRA 4P72A 1IBCB 2M8DB 1RLDA 1F5BA 1DHMA 4EO6A 1NB7A 1QSSA 5GADI 4DX8H 3BGLA 1RA6A 1W26A 3D1OA 1PILA 4C3MA 2XI2A 4CLFA 5KG4A 4WWSA 3CW2C 5KFGA 4PYDA 2PMWA 1RWNB 3HHNB 2AYGA 3BO3A 3NGDA 5HI7A 3CGIA 2DGVA 5K14B 3KLGB 4GVLA 1GTHA 3ZZPA 2V2VA 2LVWA 4LWEA 4MP2A 3B25A 3HDSA 2FB0A 2VB6A 4ZVUB 4ZJQA 3WC2A 4LF8F 3MM7A 1Q7LB 2YWKA 1MLAA 2XB2D 2C2AA 3W9IA 2R3VA 3T1KA 2BT0A 4ED5A 3K5PA 1FESA 2V4JA 2W24A 2BJ9A 4QR2A 2OD4A 1J27A 1LV5A 4A8OA 2YKJA 5D4LA 1WC3A 4L6V3 2VBYA 2XYHB 1PIEA 4DUHA 4PWDB 4A8QA 2M0GB 2WBRA 2IYGA 4UUWA 5HJYA 2EKNA 4KHMA 3QGGA 1ULRA 3VAIA 1MNEA 4BWJA 2LXUA 1L3UA 2BKNA 1ZPVA 2GQ2A 3GJSB 4TYBA 4K4UA 1X60A 5CZVA 3JZ3A 1YITS 1WNEA 4I6AA 3C16B 4P6QA 5M4EA 5IT9Y 5JVHQ 3QLHA 2FHMA 5K8MA 5T7LA 4B9LA 1TR0A 3S8SA 4IOCQ 1Y5LB 3KMSA 4DBQA 3CGYA 4DQSA 3Q8SB 2BJ1A 1RP5A 2XMVA 1WI8A 2R7OA 2MLXA 4A8SA 1C4CA 2XEXA 1PYSB 1RT5A 3M2RA 5KFKA 3NMQA 3TUJC 2XY5A 1YRTA 1Z2ZA 3W9JA 1KZNA 4OYPA 1XTZA 2PMHA 2KXFA 2XLIA 4LFBF 2V9KA 2CQBA 4F8RA 1PC4A 2LXIA 3CJ3A 2DCUB 4NLPA 2HWIA 1TL7B 1AFJA 3KE6A 2XI3A 2KT2A 1SB6A 4OYIA 1EHWA 2MPUA 2KYZA 3P49B 4C9DA 2FUG9 3KG1A 2VW5A 4GEEA 2ZD1B 4E2FB 4PRXA 4KQVA 3HVAA 3JAMU 4NZ0A 3HSGA 1S9GB 1RTDB 3BV8A 2MDAA 3VVTA 3ILIA 3CGZA 5L46A 1X4EA 2DTJA 3KLHB 4BBYA 1OY9A 1X0FA 2O1PA 2QSFA 5F41A 5K8NA 2XM3A 3J80Y 1GH8A 2IDLA 5MLCV 1M5VC 2P5VA 1SPBP 2B8QA 3I87A 2IC3A 3PJXA 2HMIA 4HDGA 4JUZA 2FD2A 5F8MA 3V6KA 3VHAA 1FRMA 3K17A 2EFGA 1H73A 3DI6B 1YZ6A 1FXLA 1U2FA 2VG5B 1N0UA 3L09A 3I9V9 2PC6A 3ZZUA 2DNLA 2HNDB 1UTAA 1R7IA 3MTJA 4HZ5A 1N33J 4XIPA 5A8RA 3MCNA 3U7JA 1LWCB 2L48A 3KHLA 3WX4A 3H0PA 4EGHA 5LSOA 9RUBA 3QAEA 1LW2B 3R2DJ 3V4MA 3GCXP 1T8EA 2MQ8A 2AJ4A 1Z5AA 3OBIA 1NJWA 4LWIA 4DS4A 4N77A 1O0PA 4USMA 4IG3B 3D1HA 4WE1B 4CWRA 1TL3A 4Q2MA 3D28A 4P52A 5KTQA 2H48B 1FWKA 4KGZB 3BH6B 3KMQA 2WI1A 4BIZA 5KG3A 3U1LA 1RHKB 4P71A 2YKNA 2NYHA 5BYRA 1JLQA 4R8UA 1U1PA 4MBCA 3RRKA 4ZMMA 3VHCA 1P1TA 4FKYA 2HRTA 2ZUGA 3K7RA 3KUEA 3P5TL 1PYOB 1X4GA 5HP1A 2MKSA 4OZLA 1C1BB 3HVWA 2XNQA 3GQCA 3NWRA 5CTYA 3NCPA 5EX3A 4Q8FA 3MEEA 3CC7S 4DMZA 1S1XB 1R0AB 2EFQA 4O07A 3C8YA 2J0WA 1U6BA 2IWUA 4RNHA 1LOUA 3CXCR 3EDQB 4WP9A 2P6SA 4J9RA 2DHAA 4QIVA 4F02A 2F4VF 2CQGA 3ICLA 1M1GA 1N6QA 3G7BA 3FDSA 3RBZA 5EWFA 4N76A 2HZVA 3LP0A 2XLKA 3CJKA 2PMZD 2HK3A 2UUCF 1D9FA 4KP4A 1BXNA 2XMAA 2BEFA 4QIFA 3ZTRA 3ISNC 3EZ5A 4Q2LA 4V1Ak 2MKIA 2ERRA 2AMCB 2HQIA 3H5YA 4DR7J 1S59A 5K8PA 1SKWA 4B17A 1UL3A 3FEXB 2IRXA 3LP2A 5L38A 4G1QA 3M8QB 2YH1A 2PT0A 3TA2A 2XSJB 1SQFA 2ROGA 3NGUA 3OR1A 1CC7A 2UXDF 1S0NA 4F4YA 2DGQA 4DL3A 2D3ZA 2W7PA 2OFGX 3SV4A 1X8DA 1HNZJ 3ET6B 3FMWA 2ZVSA 3HYZA 3GONA 3QSIA 3R27A 5FJ4A 1PAEX 1NM2A 4ED8A 3N79A 3RW7A 3M2VA 3MFHA 1RTZA 1OO0B 1R43A 3T9NA 4IO9Q 5C25A 2CGFA 5B08A 2IVYA 4G65A 2RT3A 4DR3J 2CCSA 1SIWB 2DY9A 1QLNA 4M5IA 4AQYF 1C4AA 1RAOA 3B4MA 1HNXF 1PGZA 2CQDA 2Q79A 2NXNA 5DQIA 3D68A 4NCGB 1OSFA 3OSNA 2CG8A 4H4KA 5IWAJ 3UQSA 3OUYA 4H4MB 4MYTA 3GE9A 4AFFA 2G2YA 5H9EJ 3R4NA 1NKCA 2AEJA 5A8WA 5F8JA 1YJ7A 2DK2A 4K5RA 2IVMA 4LFCF 1UYMA 1YTYA 3D54A 5HQ8A 2YWHA 2DGUA 1FKAF 1ZS6A 5CTWA 4Y2AA 2QX0A 2UVVA 1UVLA 5EX0A 5EWGA 2BE2A 2P6TA 4KE5A 1Q5YA 3BGOP 5LMUF 3PRDA 1LWEB 5A0YB 7AT1B 4YKYA 4DX7A 2PGCA 1HQUA 4OQJA 3W2WA 4ZVSB 2ALYB 2ZE2A 5F5RA 2CQIA 4CYUA 1LKZA 4TNOA 3RB4A 4EUVA 1YJUA 5HLFB 3HMJG 2COLA 3TTZA 5DM7Q 3PG9A 3BPDA 5D77A 3KG4A 2G1DA 2R7QA 3UN2A 1L3SA 4ASBA 2E66A 2CG4A 3BSCA 4I64A 4YEAA 3KLIB 4IFYA 2V68A 3EHJA 2OI2A 3FCHA 4HLBA 1TL1B 1U1LA 4BQGA 2Y9HA 2BDPA 2F8EX 3JQJA 2DNQA 2DR5A 4QWAA 2E9ZA 3MMJA 3PYGA 2UVWA 4B3OB 4USKA 4MH8A 3RLPA 1UW4A 2A2CA 1TV6B 1RT6B 2B9WA 3BREA 3RG6A 1C1CA 4FYVB 2AGPA 3PRVA 2OD6A 2D9PA 2XDSA 2KT3A 4CWQA 1Y7PA 3HX9A 3PIOQ 3DRSB 2B6AA 3J7Z5 4MKYA 2VG7A 1B64A 3G7EA 4F36A 4I68A 2J9CA 1KN6A 2DIVA 1EJ7L 5F8IA 4BC9A 4AD6A 2HYIB 1D09B 4ED4A 2F40A 1WDDA 1HBUA 2OPQA 4Z37A 4P7AA 3B8HA 5KFHA 4QR1A 2C28A 2RUGA 4OHXA 2YEFA 2DJWA 2DNHA 3GMGA 5ETKA 1IXMA 1TC6A 3T6BA 1NSKL 2Z4PA 3PW5A 3CMQA 2LA4A 4UUXA 1B63A 2MY7A 1ZM4A 4DCJB 1HIYA 2W8LA 2HS3A 2APOA 1FEEA 4KKOA 2CJBA 5ETMA 3BKFA 1D0EA 2YEEA 1WF0A 1ZPWX 5G4DA 3JB9k 4CNZA 1Y4UA 2ZDXA 5IN9A 2YE7A 5KFEA 1YBAA 3NL0A 4FNIA 1VQYA 2BQUA 3HJFA 3BB5A 1F9EB 2Y8YA 5G0RB 2DXFA 4CNYA 4H4OB 3MR5A 4BIUA 4USIA 4DXLA 2E9TA 1TUVA 1KNZA 2UUAJ 2JH3A 3SL2A 1WC5A 1DTQA 3VCDA 4J91A 4JV0A 1JXLA 4O04A 4ZPVR 1Q8KA 3H5SA 3KYLA 3O8WA 4UOFA 5FD1A 3EHGA 3DFEA 4CTAB 2HVIA 1N5VA 1PSDA 3PRBA 4AL6A 1R0CB 4YMEA 4ZN1A 3OSPA 3QFWA 4MFBA 3PJWA 1BUXA 3MMBA 2WOMA 1KQGB 5U47A 1OQ6A 2PD1A 3QAUA 4LF2A 4C8KA 1MW7A 2HBQB 4P9SA 3BO4A 4Y65A 4KTQA 1CJVA 1TFWA 2O1VA 3P3DA 3MCOA 2XCMA 2BW7A 4P73A 2JOQA 2ZZTA 1TVRB 5B7WA 1RB0A 1V3ZA 4EFTA 4DV6J 2UWDA 1S0MA 1H7UA 2FJDB 2MQQA 1TZ0A 3V2UC 4O09A 3FBBA 1Y3JA 1BQMB 3KNAA 3QWPA 5ETLA 2ESAA 3CWVA 1FWLA 3Q5JA 1UEVA 2IM3A 1WORA 2NSBA 1JLEA 2HBYB 1N4LA 3SV3A 3CMAS 5A6WA 4RW8A 4KR0B 1FE4A 3SMZA 4MPCA 1RJJA 3D4JA 2BA9A 1UYFA 3HHEA 1NHJA 2VFTA 1UVKA 5D8HB 1IKVA 2YNHB 1MWZA 5F0WA 4XKKA 2BMBA 4GC7A 2AW0A 2Z2LA 2FGOA 3GIIA 2YE2A 2GHVC 4DZYA 4HTJA 3JQMA 3IBFB 4MIBA 2PDAA 1U7LA 5KFTA 4WZQA 1S6PA 4DL2A 4PG4A 4DZ6A 2QG2A 3R7NB 1OS5A 3MPDA 1TH8A 4GFNA 4F0MA 1FFGB 2CVEA 2R2SA 3UPFA 4I5SA 2BU7A 3H2VE 3SIPB 4YS2A 1Q79A 4P74A 2XLJA 1I5CA 2BABA 1MROB 2C3MA 2VWCA 2LECA 1GAOA 3GJRB 2GV1A 4IYQA 1I58A 3KK1B 2HS4A 2LQBA 3BJYA 5FNFA 2RILA 2WI4A 3WHIA 1REGX 3HZGA 2XSFA 2R7UA 4IRDA 3IR5B 3X1LB 3NCRA 1VRUA 2IAJB 1M5KC 1VIXA 4MB9A 2YWWA 2CNOB 1JLAB 4N8OA 3HD2A 4H54A 2XMKA 1N33F 3W5XA 2YWFA 2PE8A 3M2UB 4HL9A 2CNNB 4FXWA 1LFPA 3WQ9A 3PY8A 5LSLA 2EBEA 4OI4A 4M5MA 1WHYA 1PYTA 4PXCA 2AT1B 1JNZB 1K9MT 2MQNA 2LEBA 5F8NA 4CWFA 2ZH6A 1EQ0A 3OVAA 2DEIA 2BYCA 4C97A 2GCFA 3B24A 3R7SB 2QMUB 1R89A 5AXLA 3DOKB 1F9FA 2XY6A 2CJYB 2I5JB 5D3GB 3K60A 2VKZG 4ES3A 2RDIA 2J9EA 3CD0A 3FVYA 2UUTA 1AJ6A 2C2KB 2V50A 4WBFA 2MLZA 2ZUAA 3DOLB 2VJUA 2CJAA 1SC3B 2H54B 4UQGA 4L74A 4RUCA 1TKTB 2YI6A 4WXOA 3BQ1A 4J37A 1NXIA 5AT1B 3BGRA 1SKSA 3RU0A 3VZHA 5HMWA 2KO1A 4J9UE 4B9TA 2I1RA 5AE3A 2G9OA 1YQHA 3GTYX 4CQ1A 3B82A 3I56S 3S01A 4IUFA 2VG6B 4RKUC 2OELA 2W2OP 3GR0A 5KFFA 2YEHA 4NLYA 1ZWHA 2LKZA 1AB8A 3OLAA 4LF1A 3MEDA 5KT2A 3CJ2A 2Q3PA 2J7KA 1K1SA 2PA3A 1F60B 3DM2B 3HHDA 4C8LA 3C0EA 2LQ5A 3N28A 3EGWB 4DR7F 3EKRA 2HNZA 2F63A 1N5TA 4JV5J 2DGXA 1FJEB 4P10A 4EMVA 1GX6A 2GO8A 1TK5A 2DR6A 4Y2CA 2BU6A 4KH1B 4D3GA 2A6OA 2HQGA 1KHWA 1QAYA 5DDQC 4EGIA 2A2DA 2GIRA 2C1GA 3EX7B 3PW0A 4DN0A 1XBWA 4OV6A 4H7QA 4V26A 4ANCA 4WXWA 1WJ9A 3VZIA 3QSYB 3H5UA 2YEJA 2OUGA 3FGVA 1RGVA 3PX6A 2CQ2A 4ED7A 4Z7YA 3HSJA 5C2CA 4DFMA 1FERA 1HNIA 4LWHA 4HH1A 3H40A 2PSZA 2LDIA 1DQ9A 1HI1A 2NPIA 3HVTA 3GFXA 3K59A 3MECA 1WG1A 4DSKA 4L91A 2P2CB 5DS7A 5IWAF 2ZFHA 3TAQA 4DQPA 1TQLA 3SQGB 5HQMA 5L1JA 1B0TA 2R8IA 2GVZA 3JAMY 5D15A 1AZSB 3CJSA 3BKTA 5JJBA 5KFCA 5D0RA 2VL1A 4TY8B 3T9ZA 4F0KA 3CIZA 1NK9A 3A1YG 1VQLS 4B7PA 3OFGA 4Y2MA 1F3FA 5D0EA 4NH9A 2MZJA 4C8OA 1IJEB 3QT8A 4PPZA 4B9UA 4J5OA 1HD0A 4G6VB 2JWNA 1WEZA 2QGFB 4RBTA 1RISA 3TRGA 4J9NA 4M5KA 5EHHA 3I31A 2VASA 4PQUB 5C42A 3DMJB 3H80A 1YWXA 2E1MC 4M8LA 4DPUA 3HULA 5E3RA 2E1CA 3RYLA 4LBIA 4XC0A 3JSYA 4RW7B 3MGJA 5DETA 3LOUA 2J76E 1OY8A 1UVJA 2M4MA 5ETVA 2RF2A 2BTZA 3IG1A 1U0HB 4XKOA 4YKZA 3T0HA 1Q1KA 5SZTA 2VQEF 3R97A 4ZPTR 3VAHA 1AFIA 3EYZA 3GPAA 2XJGA 3R2CJ 3CCVS 4C98A 3PCOB 4QU6A 5J71A 3IS9A 4FXVA 4FYXB 1FJCA 4LBHA 1OMSA 4WK1A 3CJQA 3MPYA 5KG6A 1CJUB 4QWCA 3H42A 2IRYA 2EK1A 3MR7A 2W7AA 5I3UA 3H25A 2Y8WA 1JLGA 2EFOA 3HHLA 4DOZA 4GT8A 1R6VA 3JTOA 2EFVA 3Q5LA 1N5YB 3DOMA 3KLFA 4EZ9A 2V69A 5L1KA 4XITA 1HBMB 2QMWA 4U95A 1JWWA 2DNYA 3I96A 1LWFB 1K0TA 2MSSA 4XDMA 2X1GA 2AJQA 4LQ3A 3IM9A 3HLUA 1ACMB 3NBPA 3T10A 5AE2A 1SI9A 3LP1A 4AS9A 1K44A 2ZBKB 3D0IE 2ZWOA 3BGFA 2DB1A 4YHHJ 1RDRA 3POTB 4FZVA 4I69A 4KO0A 3UCZP 1RWUA 2GJ2A 1WF2A 1N32J 3Q0AA 4TU9A 4B3RJ 2HQCA 3SFUA 4OHWA 4P8OA 2FGCA 2DNZA 3FQKA 2DPJA 2YE3A 3AFGA 4OI3A 4M5LA 1ZTTA 3MMAB 2C3UA 3AXKA 2HG4A 2W9AA 2X51A 4C7QA 4CLSA 1URRA 2L41A 2FLNA 3JSMB 1CJTA 3ELHA 1HWIA 4OHZA 2OHDA 2HHQA 1HI0P 1FKPB 1REVB 1AMWA 3MI7X 1SC4B 4OX6A 5ETQA 5T41A 4NLSA 2XD6A 2JVRA 2DHGA 2KZMA 2BKOA 3H59A 2OGUA 1IBMJ 2QG0A 1S1VB 2G0IA 2GZOA 4OI2A 2GJFA 2RQMA 2CRLA 4ILMA 4JI4J 4LP0A 3TZXA 5AXNA 5IFMA 1HPZB 1IBKJ 3CCQS 1C0UB 4R5PB 4QIGA 2XABA 4F4KA 2OH2A 2W2PP 4DL0C 2A6MA 2AGOA 3G71S 1XERA 2OMLA 1N54B 2GGPB 3M8PB 1AUSL 4J9QA 3O6OA 4CH0S 3ZKDA 2QYCA 1Q53A 1DBDA 1XQIA 4I4BA 4X65J 4WYLA 4DV6F 2HFUA 3LWMA 4DV1F 2HZCA 2IM2A 2W9CA 1C0TB 1XK8A 2LEAA 2VOOA 3FFIA 4QYZJ 3R5CA 1FVSA 4KV8A 2FLLA 3CJ0A 3SSRA 2CPEA 4I56A 4WFAQ 3A0TA 3CCZA 3UDEA 3GR1A 3V4IB 1IWAA 5F0UA 5DG8A 2W9BB 2R7RA 2XHTA 4AWQA 3ITHA 1TFYA 2I8EA 1TL7A 4LF4J 2H3EB 1AT1B 3R6LB 1GT8A 2AWZA 1QAJA 5H9FK 3NNHA 4C8MA 2NLWA 2MMYA 3CDAA 2AEMA 3K89A 4NCAA 2WI7A 1NLKL 2MJNA 5DDRC 4X4RA 3V81A 3QRQA 1HQEA 2BJ7A 4WFYA 2ZWPA 3CO9A 3ONQA 2YI7A 2XWYA 4QWDA 4XTTA 4DWIA 3R5DA 3AOBA 3ISND 3I6PA 2V9WA 4BDPA 2KB2A 2YECA 3OJUA 4O0NA 3J7AN 3MAAB 1SUQB 2LQJA 2MGZA 1QAXA 3ENVA 2A1BA 2IIHA 2HHUA 1WC0A 5HVFA 5ETRA 3F41A 3NP5A 2L9DA 1YESA 4ILRA 1YJWS 1J5EJ 2VG5A 1OIAA 2Z0GA 4V19J 3UVJB 3BYRA 2WSFC 4MT1A 2WB1D 2WTFA 4QPTA 4F2SA 2UVRA 3I0RB 3D6HB 4LF5J 4AYBD 3DYAB 1RAEB 1S10A 2D7SA 3R5GA 1FXDA 5DDOC 1RT1B 5L9NA 2OMOA 2J5AA 2AX1A 4CO2A 5C24B 2HVEA 2WONB 3OTDA 3BF4A 3US5A 4H81A 1EARA 1LW2A 3BM7A 4DPWA 1B7FA 2FIUA 4OZNA 1C2PA 1SC1B 2O5DA 2DPIA 1WSVA 1B3QA 4YP3A 1RYSA 4ELTA 3EGZA 3W3SA 4XAKA 1G4CA 3OTEA 3K98A 1R8BA 1M5PC 1RTIB 2DNOA 3UW1A 1YRUA 4KT0C 4A46A 5JUMA 4U96A 1CJKA 2XULA 2NXCA 5BR8J 3BSOA 4JV1A 2XO6A 2VQFJ 1C1BA 3JSBA 3JTPA 4LVOP 3D1QA 5B0FA 2VIHA 2VONA 3UR0A 4JAVA 4Y34A 1QY7A 1VRQC 4GRSA 1W25A 1YC3A 1S1XA 4ER8A 3GYXB 3PR4A 2QN6B 4PUOB 2Y0SD 3CD5A 2JC1A 1SC6A 4F4XA 3MR6A 2VHGA 4OL8A 1DY3A 1PC5A 5DRKA 4HVZA 3HHKA 5EN1A 1GMUA 2XMTA 1N48A 2KRBA 2XO7A 4WUCA 2DNPA 4X4TA 1HWJA 2B43A 2DBBA 1G6BA 3IGVA 3QDDA 4JI6J 4GKKF 2LP4A 3VGTA 3SCJE 1HNVA 2EG2A 1ROFA 1J5OB 3MEGB 4XO0A 3GV8B 2KYXA 3DLKB 1EAYC 3OQ2A 4FS1A 2OPSA 3T5LA 4EGKA 1VBYA 1VQMS 1XR7A 5A2QU 1S6QA 2D69A 4EEYA 2RRNA 3ZZZA 5MAOA 3T1AA 1M90T 1GEHA 3TQEA 4JV5F 4EYIB 3EXCX 3M1VA 2OEJA 3PX0A 5B0DA 4Q0BB 2C3PA 5GAEU 2EFNA 3M9NB 3ZNUA 2ZZMA 2XSJA 4LF7J 4JI8J 1HBOA 1NHKL 1OPIA 3K58A 1UYGA 4KQZA 1HHQA 4FVCA 4O3RA 4HACB 4TLQA 3FJ2A 2QF6A 4PG7A 5E3AA 3CUNA 2ROEA 5IV3A 3DLGB 1ZAVA 3MWBA 1HD1A 2OFHX 1IKYB 5CABA 1ZBTA 3T3FA 3G4SS 3DRRA 2GA7A 4ZN3A 2KTQA 3IC1A 4DZDA 4U7CA 1SV5B 3QFHA 1WC6A 2X3DA 3DKDA 4L8ZA 1TKDA 3ZZTA 4ZS6A 3FZBA 2P9GA 1SJQA 4X4UA 4WU2A 2A0FB 3H2UB 4DSFA 2G4BA 3L4BC 2LU1A 4KTNA 3RAQA 1BQNB 3GV7B 4RW4B 1SH0A 4M5JA 4ZP9A 2WHOA 3PKYA 4XIUA 2YNFB 3DGPB 1O6XA 2VPXB 3KLVA 3B28A 3SI8A 3UE2A 1FWPA 3TX0A 2FTRA 3I9ZA 2RKIA 1A7GE 5FIIA 3I0SA 3R5JB 2AYMA 4DSEA 1S4FA 4DUTA 3M30A 1VRTA 2LCWA 3TUIC 4OHYA 4C8NA 2DRBA 4Q43A 1SQGA 3PYFA 1IKWB 3MMCA 1HMVA 5A0YA 3EJMA 4WIIA 3PM9A 2WI6A 2V63A 1WEXA 2KDOA 3C6UA 1V9OA 5JMNA 3K5MA 2GQQA 2J8AA 1Y11A 2LU2A 2F9JA 3PW2A 5K5MA 5E3PA 2CYYA 3QO9B 5IOLA 4KAIA 4LSLA 2HHPA 2XBPA 2HNYA 1FK9A 3T41A 4A8FA 1UKUA 2ZH7A 3QT6A 3KHRA 2YGEA 1QM9A 1XNQF 3VR1A 5DLGA 1I3OB 2ZNZA 2MKHA 2FYPA 2MSTA 1UYIA 4AWOA 2XYPB 4RW9B 3VAJA 4GMKA 1NZ8A 3NNCA 4DSLA 1QVFR 3B6BA 2QTWA 2F4FA 2GS8A 3VWSA 2FJVA 2K3KA 4LPBA 2ZJQQ 2W2QP 1TV6A 2BANB 2V8HA 2CPIA 3K5LA 1RT4A 2ASLA 1JLFA 3SDEB 1RWKB 4YKTA 3MTKA 4ZLNA 2FTKA 5KAKA 3BDEA 4UY8T 1Z1ZA 2ZVIA 4KFBA 4EZ6A 3F73A 1TAQA 2Y1RI 4KHPJ 4XD8A 2I0XA 4M5DB 1L5UA 4ZP7A 3W8GA 3IMQJ 1T7PA 1EP4B 2CH4A 3KJVB 3THVA 3GB0A 4LSZB 2YVSA 3OJSA 2BM0A 2AJ1A 5DZ6A 2YKQA 1IKXB 1X4BA 3RRGA 2YKCA 1NH8A 2UV8G 3KJFB 3HEKA 1UJ6A 2QLWA 3JYTB 5D0GA 1UEKA 2WK4A 3EUNA 3D66A 4C11B 3C46A 5CZXA 1FNMA 5KFBA 2EXUA 3ILJA 4HTIA 3K2YA 3AQPA 2YGAA 5KFWA 1VBKA 1CULB 4DJBA 1FJGJ 5M2RA 3BEGB 4W98A 4YHHF 2D3OR 1DTTA 1N32F 4B3RF 4XCJA 4F3OA 3SZ2A 2DISA 2WAQD 3Q2TC 1WHWA 3ILLA 4ITSA 4OLPA 1TL4A 3MM9B 2NS1B 4MTPA 4DR6J 2AJFE 2BACA 1US7A 2MKKA 4X84A 1KHVA 2E9RX 1H98A 2MB0B 2FXSA 3NOGA 3TZWA 4CT9A 2F9DA 2L3MA 4ZVTB 4LRAA 1RTHB 4WFNQ 1V3SA 3F56A 4YFUA 1U25A 3D0BA 2HEKA 2JL9A 1OSCA 4DS5A 2RDDA 1HYSA 4WJBA 1WOOA 2VFSA 4YKWA 1SJRA 1IBMF 4NA1A 1F2GA 2FHOB 3GSIA 2DHHA 2DY1A 4UZBA 5HJXA 2GVDB 2EFPA 4JI4F 4NWBA 2V8PA 3T1YJ 5GAEI 1IBKF 2Z58B 5KOXA 3D67A 4ID8A 3GIFA 4C4WA 1UZHA 3HZEA 2GFFA 3D7SB 1UY8A 3TW0A 1S12A 1NZAA 3DLEB 4O23A 1T9TA 3N01A 3KLEB 3RZAA 4X65F 4IG0A 3Q8VA 3L7OA 1TVRA 1X4CA 2R42A 1R3NA 3TAPA 3A3OB 2W8KA 4D3HA 1BQMA 4CLZA 2VFUA 2YGFA 2W1BA 3WIUA 1SH2A 2J8SA 3Q86A 2UU9J 4TU7A 1KP6A 1NH7A 3VQTA 2EPIA 3QYYA 1D1UA 3G82A 5F9NA 1D3WA 5DGBA 2OTJS 4CCHA 3EZOA 2QL5B 1Q0NA 4QW8A 3IAS9 2BVZA 1X5TA 2V8VA 3U67A 3BDPA 1T02A 1IJFB 1FDBA 1FKOA 2I38A 4NMLA 2MKCA 2YNHA 2ATLA 4TKTA 2UXCJ 4F67A 2CPXA 2YNIB 2YX1A 1CS4B 2WSEC 2XNRA 4DPYA 4L73A 2MQLA 4E98A 1RA7A 4YDXA 1S79A 3M9OB 4NZ6A 2YX4A 4NLGA 3DGVA 5KT3A 1U6FA 4NH8A 1LWXA 4WP3A 2CZ9A 4KH0B 4Q45A 4JQLA 2DKOB 4IFVA 4TY9A 1S7HA 2HFSA 4C8ZA 3OTBA 2OEMA 3Q23A 3NS7B 3MZIA 1WKKA 5EDWA 3EGVA 2LA6A 4LFAJ 2CQ3A 3OWDA 4E02A 2SXLA 3CO0P 1T03A 1Q82T 1MMDA 2YEAA 4FPPA 3RAMA 4DCPB 4DR2J 2FHJD 3TZZA 4DV0J 3IBCB 4XTJA 4ZPDA 2YQ0A 3THPA 1QE1B 1U8SA 1X4FA 1TILA 1JLAA 4DV2F 1RTJA 3T5KA 3UDLA 3W60A 3D3BJ 4NOHA 3TO8A 3O2IA 3NAIA 4LF5F 4F4WA 4CLYA 1S99A 4PWUA 4A8MP 1H3DA 4E0DA 1TKZA 3FNNA 2B4OA 5KFDA 3CIMA 5D4NA 3LA0A 3SXLA 2CJ9A 1OQ3A 3MM7B 2E1PA 5IM0B 5IQQA 1U4BA 1T9WA 1N56A 4CH1A 2F3JA 3ZTPA 3W8PA 1T05A 4MOTA 5H1SV 1F5AA 2J0QD 2V4JB 4AT1B 2CKWA 4I2QA 4JI5J 4Q20A 2RSQA 2I5JA 5D3GA 3S5TA 1FTRA 4KIAA 4L3NA 5J2PA 2JLEA 4ICLA 2AIRB 2QLXA 4N8NA 3QGIA 3BN7A 4G3IA 3C2PA 4ZLPA 5LXYA 4ELVA 2V8GA 1TKTA 2VQFF 2POKA 2VBXA 2R2TA 4I7FA 4FP9A 5CTXA 4K4WA 1E6YA 2H4WB 5KT4A 4Q7AA 5D6QA 4LREA 1S97A 3HFKA 1NHHA 2MXYA 4O4RA 2N3OA 3CWJA 3QLHB 2CPFA 1RCOB 1WC1A 2BOAA 2YTCA 2LEPA 3HI9A 4PG6A 5T7LB 1S6OA 3PO4A 2R7XA 1QDUB 1FDAA 3Q2SC 2DRDA 2JLGA 4JI6F 1OPZA 3A8JA 1OYDA 3R92A 2HVZA 2PI4A 1O8BA 2HIYA 2Z8QA 1RT5B 3OPDA 3M2RB 3IAM9 3S1TA 4OYAA 4CLKA 1WEYA 1VS3A 1THNA 1JKHA 1M5HA 1WELA 3T6JA 3AT1B 4F4AA 4U7UK 2BV3A 4CH7A 3GV5B 3DM2A 3R1HA 3MAHA 2HURA 4LF9J 4OV1A 1HA1A 4ZP6A 2BXJA 4WUDA 1PO6A 2ATCB 1Q95G 4LF7F 4JI8F 4OZ2A 2VODA 2XZTB 4MK7A 1KEKA 1N5SA 4WYWA 2ZH5A 4UOGA 3TJAA 3QZ8A 3F0NA 3Q83A 1HHSA 3ILOA 4OZJA 5T14A 4K7QA 4EYHB 1N52B 2BOPA 3TOQA 1NBEB 4CZCA 4DR4J 2G0JA 3V6JA 1VBZA 4ZVHA 2FLOA 4RBVA 2FLPA 2ZKUA 4OMFG 3FQLA 3M8YA 2GMJA 2YE6A 3OD2A 2RIJA 2FZCB 4PYAA 3HF5A 2RAQA 3EPGA 3CJ8A 7FDRA 1RQ0A 5J1NA 1MX0A 1NKBA 3QWUA 3AB4B 2AF6A 2CPHA 3EICA 3T2SA 2R8KA 2IHR1 1KVIA 2Q66A 3MPWA 1QVGR 2QFJA 2IC3B 4C0OC 4DPXA 2HMIB 1HLWA 2HQFA 4FS2A 1FFWB 1F51A 4OX9J 3SQGA 4MP7A 3G8QA 4F04B 1F6TA 4X62J 2ZKJA 2Y1LB 4RNOA 4I2PB 2HHTA 3MR2A 3M8RA 1AZSA 1BHNA 5A8RB 2C2EA 1IUJA 2KFZA 1DLOB 4MKVA 4TY8A 2M3DA 4JB8B 3MUTP 2AKPA 3NGSA 4K4TA 3H5XA 5I42A 4IH6A 2DR8A 3PW4A 3UDVA 2UUWA 2KG0A 4B3MJ 1VLYA 2QMXA 1S57A 4NE9C 3OFFA 2B9XA 5CYMA 4YKQA 3W1YC 1Q5VA 1P27B 1E6VB 1TL3B 4X4SA 1QJHA 2MY8A 3PHTA 1WC4A 5LJ3Y 2B3TB 1Q78A 2NCKL 3OHBA 2XJJA 3WZ0A 1CLFA 4PQUA 3OTOJ 1FRIA 2KT5A 3CCUS 3DMJA 2YKNB 4YN3B 5SUHA 4NYZA 2BE9B 2MZRA 1YRXA 1JLQB 2DNMA 4KGVB 2XG8A 4R8UB 2FJAB 1M1KT 2V94A 3HT0A 3AA8A 1JX4A 4YB7A 2J6SA 4RNNA 4KGMA 3A0YA 3INXA 5HP1B 3GIRA 2FHJA 2H5IB 2ZDYA 4DV4J 3RGIA 4ZPCA 2WERA 1HR0J 4H4KC 1CC8A 2XDXA 1U0HA 2KZZA 1HI8A 3DLBA 4ZDNA 3OWBA 2VA3A 4HKQA 4KPCA 2F8MA 1VI7A 4I0WA 4YR0A 2CPZA 4JI7J 3DN9A 3T1HJ 2RNEA 4DSIA 3FK4A 4X66J 5J1PA 1P6TA 5J1EA 2R8HA 2UUBJ 2GMLA 1AM1A 5CQGA 5C5JA 1N6QB 4P2XA 5JENA 4NI2B 2XZDB 4KHPF 4DQIA 1EB0A 4S0MA 4CWTA 1XR6A 3LP0B 5IT0A 3Q24A 2IJFA 3CJKB 3LGHA 2KH9A 1HBNB 3FEZA 4U8YA 2ZOFA 2YKIA 3SCLE 2M5YA 2DR9A 1HWLA 4JASA 2ZH1A 1S0OA 1ZXMA 2QLBB 2RMLA 3UN3A 1FJGF 3OXFA 1VR6A 2GMHA 3I4HX 3CCJS 1A9NB 4U67Q 3DXBA 3OR1B 1R0BG 2QLJB 2V5HG 1DQ8A 2MJUA 2MTLA 3ISZA 4JI2F 1VLOA 2Z2ZA 3ZZYA 1PJ7A 4L76A 2WCXA 3IGNA 1H2TZ 1NKEA 4MKBA 2FJWA 3AJ2A 4DL6A 1VK3A 3M2VB 1UAWA 2DH7A 5K9FA 4UOHA 2K1RB 2KVIA 4HZ0A 3MM6B 2ZHBA 1D9DA 5HAOA 5A2QY 3J81j 1UYLA 3QATA 5C25B 1KLMA 4OYMA 2H8MA 1GMWD 5L39A 4EWTA 4Y3CA 2W7OA 1YC4A 1CVJA 4JOUA 1NCLA 1W2IA 1FKPA 1VQPS 3U2DA 3PX4A 4A8KA 7FD1A 2YNGA 4O4GB 3M7VA 4LRDA 1YSJA 1NSPA 3GIJA 3CD7A 3UFCX 4OIXA 4LF6J 3I4PA 2J0XA 4PG8A 2YK2A 4YB6A 2QL9B 3MURP 2CCUA 3T1YF 3OUYB 5F3ZA 3P96A 1Y10A 1ZW9A 4J9MA 5A8WB 4RU9A 3FT5A 3KK2A 1U8WA 3DCAA 4AWPA 3P4UB 2XHWA 1FD8A 1X5OA 2BRCA 2ZDOA 5F8GA 1BGQA 2XS7A 3SEOA 1J2VA 4DCOB 3IWLA 2WI5A 1AH6A 4IKAA 2E5LJ 2CPJA 4LRBA 4CWSA 5GMKa 2UU9F 2WI3A 3DHWC 1HQUB 3W2WB 1T0TV 1NDPA 1N34F 1QY8A 4ZVFA 3ZNJ1 3P6YC 1XMOJ 1T95A 1M5OC 2HWTA 2ZE2B 4MPNA 4CYUB 4NLOA 4QCLA 3J80U 1X9MA 2W9BA 4L72B 1R8AA 2DIUA 4URGA 1UP1A 1T9YA 2QA4G 1Z4UA 4NL5A 2QYGA 4ECXA 3ZXOA 1U2CA 5D4PA 2UXCF 1UJ5A 3FSXA 5AE1A 4IFYB 4ZK7M 5KFUA 1F5CA 5IZHA 2CDRB 1FA0A 4EO8A 2HQ3A 5HROA 2V2KA 1RK8A 1YVFA 1KS2A 3NS6A 2JLFA 3OHAA 4CE2A 3H7HB 1RWOB 3MM8A 1X4AA 1K1QA 2G2OA 1HQ2A 2QLFB 1S14A 4B9VA 1VJWA 2E5HA 4Y6IA 1DRZA 2YWGA 1C1CB 4CO3A 5GMEA 2QA1A 2HGNA 1ZM9A 1YDLA 1M1HA 5B09A 3DNCA 2RH3A 2B6AB 4EK2A 2VG7B 3PTWA 4LFAF 5K20B 3A12A 4WU3A 1JLBA 3H4DA 2VOPA 4NXMJ 4DR2F 2CUYA 3CDWA 1HBUB 2OPQB 4DV0F 1TMMA 3U2KA 3TJ9A 1Y5NB 1R27B 2P9CA 3OVBA 4J9SA 1JQGA 3LALA 4AL5A 3EWGA 2VD3A 1KOHA 3I0RA 3CF5Q 3RBDA 3DYAA 3HSZA 2M2BA 2BM1A 1RT1A 2C1EB 4KKOB 2JEIA 4W4MA 5CTUA 2BJEA 3L7PA 1Q86T 1YT1A 4F0HA 4TU8A 2OPPA 1CBKA 4DL7A 3RR7A 1UWBA 1YC1A 4DUZF 4JI5F 3OR2B 5HSPA 3G8SA 1YHQS 2XS5A 4LWFA 2HHIA 2HG1A 4DX5A 5HK4A 5J6AA 1RTIA 1AH8A 2Q8IA 1RCXB 1VISA 4BS2A 4JV2A 3BR9A 3D6TB 3DU6A 5I4MA 3QJLA 1UCNA 2HSEB 1SL2A 2HGLA 4L75A 3KUGA 6FDRA 5CYQA 2QT7A 2E44A 3LF0A 3JTNA 5IDJA 2AZ3A 2LQ8A 2OPRA 1YG0A 2XTJP 2WOMB 3FCVA 4PUOA 1GQEA 1P9YA 1VC6A 2DGSA 5D6GA 3W64A 1SL1A 4QWBA 2WBMA 4TQSA 4R3AA 1IR1A 3R1LA 4EBCA 1L0OA 2JRSA 1SKRA 1JLCA 1JXVA 2CJQA 5KFYA 3ETOA 3E51A 2XX5A 1HHTP 5ETSA 4W7TA 2AU0A 1LXNA 2ZBPA 1ZH5A 2AGQA 1VFJA 1GFWB 3EM1A 1VYAA 4Y2IA 1S5ZA 4QW9A 2VU5A 1JLEB 3NG8A 1MSWD 3O44A 3ENQA 1Y9OA 4LF9F 3TUHA 1YSZA 3TA0A 4LFBJ 3UNYA 4JAUA 4DDFA 2N4CA 5J2QB 4I6YA 1IKVB 1TL5A 1SIZA 2PFFB 1H38A 2QSWA 4NLXA 3LGMA 4IOAQ 4FF1A 3G6XA 4RUAA 3PKMA 4A48A 1WF1A 4NLRA 3NAHA 4OJ1A 3DLGA 1Y4ZB 1H7SA 3CC2S 1RU2A 3RTVA 3HZ1A 5HATA 1X5PA 2M52A 5M4PA 4DN9A 4CLUA 2WW4A 2RUSA 5KG7A 4BLGA 1S6PB 5HBMB 3VQSA 2VFVA 3AOCA 1SV5A 3GIGA 2YEDA 2DO4A 1BKNA 2CAJA 2LXFA 4PAAA 2VDHA 3ADAC 2GIFA 4YDDB 2K7JA 4KHRA 1VC5A 2CNLB 1NJIT 1ZZFA 2L9NA 4A8WA 5BYSA 4RW4A 2CPDA 2H5JB 1UPPA 4O0IA 8RUCA 3DGPA 3QT7A 1MU2A 3PZPA 1HW8A 5B0EA 3PYEA 2HKEA 1VRUB 1U1KA 2E1AA 3AJ1A 1LK5A 4OX9F 4J9VA 5CCLA 5KFZA 4X62F 2FWYA 1LW0A 1BGXT 4WKRA 2X1BA 2EEYA 3FCWA 3DDIA 4ECWA 2EG1A 1B99A 1WKJA 1S9FA 3JSRA 4HI1A 3RUBL 2NR0A 1RKIA 1YJTA 2ADBA 4QZVB 2AEFA 1RT2B 2CPYA 4B3MF 2WEQA 1IKWA 4USVA 1NJXA 1Y4SA 4A8XA 4KJIA 3A0XA 3H20A 2IMOA 4RR5A 4MK9A 1RAFB 2IOQA 4KSGA 2FC9A 3CDBA 5KG0A 3DGEA 4ZCKA 3OTOF 2BRLA 5CD4H 1NK5A 3CD6S 1TKXA 1F0XA 2HQDA 4N41A 2LQ9A 2R7TA 2YBVA 1SJFA 4ETZA 5JXSA 3T5JA 4O44B 1HR0F 1NSAA 3ULHA 4PQAA 3BGRB 3CCTA 1FRHA 1RSCA 1O5JA 4CO4A 4LIRA 2YKMA 1RADB 2QJ3A 3HM9A 4RW9A 2IA0A 4B6CA 2EBGA 4Q5VA 4OJGA 2Y1JA 1S9EA 4HDHA 4NRUA 1OJ4A 4ZCMA 3W2VA 1S49A 4WP8A 2VPWB 4M94A 1ELOA 4ED0A 3IN5A 4DFPA 4X66F 5ADZA 4J90A 5HN0A 2BANA 1VQ9S 3CNQP 3E01A 2UUBF 2F4VJ 2YKEA 4P75A 2NYIA 2K06A 3GYNA 2GFDA 4QWEA 2R2UA 3H4LA 1UW9A 3A3NB 1S1UA 4EU0A 4B3SJ 2ILZA 3ZXQA 4NZ7A 3LQVA 4O3NA 3PJ9A 4F2RA 3MEDB 4R25A 1NUEA 1KOOA 3ENAA 4QJVA 2E5JA 3W62A 2UUCJ 4N7TA 3CDEA 2RD5C 1K47A 4QPKA 4OJ3A 3A0WA 1S0VA 2F5GA 2XMJA 3BPSP 2PO4A 3C14A 4Z2XA 5L1LA 4YQWA 2KFYA 1NAQA 2OLWA 4PEOA 4NYOA 4CIOA 4ERDA 4ZCLA 4O0BA 2XX2A 3FV5A 1NK4A 4YY3J 2Q8HA 2J9DA 1RI7A 3I82A 3FSYA 3WC0A 4FXDA 3EHHA 2YE9A 2UXDJ 2Q6BA 2X1AA 4ECRA 3R7BB 2XX4A 1GNKA 1NHUA 1KTQA 5M4HA 6AT1B 2Z30B 1JMTA 2UXBJ 3MM9A 4CWBA 4LVNP 1VQSA 4LT6A 2JKIA 2JHEA 2WW8A 2BU5A 4ZJLA 1NHVA 2GIQA 4EMDA 4PG5A 4OI1A 4MKAA 4USTA 1HNIB 4URSA 3IRXB 4W90B 4XIQA 5HVHA 3A0RA 3BMYA 3HHLC 5D0HA 1PG5B 3NXZA 3MECB 4LF6F 1FRKA 1RACB 4NCBA 1EETA 2YK9A 2ZDPA 1XEZA 2GVDA 1AYEA 3U27A 2VICA 3GFHA 3ETMA 3UR3C 2M9KA 2GVZB 1Y00A 4AUKA 2BYIA 4UT4A 3TUPA 2BRKA 4LFCJ 5FNDA 1D8YA 3C15A 2NZCA 1TUGB 1QSYA 4IR1A 4KSEB 3KLEA 2QEXS 4XCLA 2HVHA 4EBEA 2HK2A 2XJXA 4RO0A 3KG0A 1NPRA 2E5LF 4ID5B 3B4DA 2FC8A 4C3KA 3TVKA 4UZCA 1XWLA 5CHCB 2M7SA 5HMZA 1SCJB 4AE5A 1XMOF 3SYZA 5D7RA 4YB5A 4Y28C 2D9OA 3W65A 1UFLA 2V0NA 2QE5A 5C42B 1VHFA 3Q5KA 5D4OA 3Q89A 1EI1A 3KKFA 4ZA1A 1WOPA 4DLGA 4DPOA 2KL8A 1GX5A 3BZQA 5C2GA 5DO2A 3LPEA 4XE2A 2XGQA 4ENOA 2YNIA 3GCWP 1FXRA 4M5HA 3D9BA 2RF2B 3IG1B 2FVRA 1S1WA 2QA4S 2JFDA 3TAMA 2KG1A 3RB0A 1PCAA 2CIMA 1Z5CA 4HHHA 3ZM7A 4CE3A 4ZVQB 5IS2A 1TP7A 2IM1A 3TR5A 2F7VA 1VQ5S 2HHVA 3IS9B 5L1IA 2DGTA 4OYZA 2ILYA 3IRWP 5I3UB 4O05A 3MCMA 1JLGB 3HHLB 4I3HA 3I32A 3CPWR 2XMUA 2XCPA 2BW2A 4NXMF 3DOMB 3KLFB 3ENWA 4QPXA 4CO0A 3MUMP 1S1TA 2DGWA 3R4PA 4B08A 3M6VA 3UDCA 3KK3A 4CLPA 2GO9A 3LWLA 2VDIA 2WB4A 1QE1A 1N88A 1PJ6A 3D0HE 3VAKA 1RYRA 4GCZA 3NBPB 2AJ0A 5E3QA 4RW6A 5J2NA 2D3O1 2GAGC 4L93A 3LP1B 2Y3YA 5IM0A 2IWXA 2Q2EB 2EXLA 1TK8A 4KO0B 2XC9A 4NASA 4HHJA 3MM5B 3GYGA 4DFJA 2FHKA 2YEGA 4OHVA 2EC2A 2KRRA 2GHPA 3FRZA 1I94J 4OX8A 3EDRB 2YKAA 4M5NA 3FSIA 1FX2A 1Y0HA 3KXDA 1G2EA 3LNUA 4UY85 2FY8A 2JZ5A 3AXMA 5CAAA 2IA6A 1EA6A 4OZ0A 1YJNS 1CJTB 1KD1T 3D5MA 3LAMA 3U02A 5DM6Q 3HK2A 4ZHRA 2HS0A 1RUSA 1EIYB 2BJDA 4HXZA 3D3CJ 3TEHB 3QIPB 4EI2A 2JDJA 1CSJA 4NMXA 2RVJA 6FD1A 1HNZF 4C0HA 2PNRA 1YSRA 4J9OA 4EFUA 2HHSA 4RL1A 2CQCA 4ZVIA 2IBKA 4FF4A 3C6TA 4TN2A 4QQBA 4DR3F 3AOAA 3LPSA 1JIHA 2Q8FA 3LANA 5DGAA 4OJHA 2W9CB 3V6DA 2C2OB 5LSRA 2E1RA 1S6UA 3FFIB 2VC1A 1NMEB 1UYKA 4KV8B 4L3KA 1SXLA 1WUUA 2CG9A 3GG1A 1YX2A 3RAXA 2IWSA 3GLJA 8ATCB 2YE5A 4UQTA 2XHRA 4DX6A 2ZNYA 3PFOA 2VV5A 2AZ1A 1U1MA 3ITHB 1JNRB 4DG1A 3TZYA 5M4KA 1WTBA 3M4XA 1HWUA 1NU4A 1UVIA 1N8RT 2P8IA 4USUA 2ALZA 1JXEA 5IC4B 2BYHA 3HKWA 4GVBA 5FDLA 2AYBA 3VGUA 1VQKS 1ZYQA 4UROA 1RAIB 1TELA 4RZRA 3V81B 5L9XA 1T9UA 1FNXH 3OL9A 2Y1IA 1HQEB 2DHXA 2XYGB 3A3PB 5J2MA 1GTEA 5H9FJ 3K5OA 3DC2A 3GIMA 3N0VA 3JS9A 2C2ZB 3CCWA 2Z57B 4ECYA 4RWWA 4TQRA 1ZOTA 1FT8A 4XK8C 2F8HA 2VA2A 2MGZB 2YKBA 1RT7A 3NGTA 2DCLA 2BJ8A 2JFKA 2FYXA 5KFQA 2CQ4A 2KXNB 4X2BA 4I2PA 2RHQB 4U7OA 1I5BA 3HPOA 5I3QA 5F3TA 3HYYA 1DLOA 3O3LA 3ZTOA 1VCTA 3UO0A 4ED3A 1HFEL 3AD8C 1PBAA 1QSLA 3DXSX 2J6TA 4RUBA 2K3IA 1AW0A 2V4RA 3EXYA 2RHSB 1E6VA 2QO3A 4PU9A 1X31C 2C2DA 2R8GA 4IR9A 1XIQA 1YT2A 4OZ1A 5KFOA 4NLTA 3AODA 3PIPQ 5GAHU 1X9SA 2ZJPQ 2N7CA 2ZM6J 4BCAA 1PBUA 4IH5A 3L9ZA 5K14A 3CVKA 3QGHA 1CJKB 1KIJA 3KLGA 3FEYB 4ZCIA 1IVZA 3FBCA 5IDMA 4FPRA 3IR6B 2B51A 1RAJA 2VF3A 1I51B 1HNWJ 4MIAA 5F8HA 4F4ZA 4FDFA 3NLCA 3TUZC 4NPOA 3UD4P 3Q8QB 4GGLA 5A8KB 2C2RA 4WKYA 3KOAA 2E0AA 1CG2A 1FVQA 2CQ0A 1NRKA 1Q4RA 2ADCA 3IWNC 2KHDA 2OP5A 2YI0A 3W5YA 1RWWB 2UUAF 3D2RA 1WI6A 1HNVB 2J9DE 4PWDA 3MNRP 3G96A 1G3OA 4NI2A 4B3SF 3QQCD 4X4NA 2ZHAA 2JEFA 4K4YA 2OPSB 2IDEA 4P2FA 5KG2A 1S6QB 4ANDA 1GMVA 1HBNA 2VC0A 3QZ7A 2A10A 3CJTA 4F25A 3WX8A 5ETPA 2HFVA 1UETA 1BXDA 1KWMA 1WDTA 3M1VB 3I5AA 3C16A 2H9ZA 2E7VA 1DJ0A 5DJBA 1KDNA 3MUVP 4FVMA 1UA0A 4YY3F 2G1HA 4QYRA 1HBOB 1V5IB 2FZGB 3LPYA 4ECUA 4UOCA 4B3TJ 1RAHB 4PRFA 1B0VA 4K4ZA 4K0KJ 2ZH8A 3DRRB 1YERA 3DDNA 4FF3A 3M8SA 2UXBF 4KGXB 5M2PA 2ASDA 2K1RA 3RBXA 3MM6A 4MAKA 2OIHA 4K4XA 2W01A 4NEYA 4U6PA 2YJWA 4BC7A 4IDKB 3M6XA 2AKWB 4RBUA 2LMIA 3IWXA 4R1FA 4CE1A 4ED1A 4KGKA 1V3RA 5JVGQ 4O4GA 3FKBA 3HT3A 2D41A 2R2RA 4JYAJ 2KU7A 2U2FA 4CWNA 4JI0J 1WKLA 5A76A 2MZ1A 2E7XA 2MZTA 3RJMB 1UY9A 4WUBA 1APSA 3BBCA 3W66A 4ZVGA 2EC0A 2RKIB 1EZZB 2ZD1A 4URNA 1YBTA 3I0SB 3HSDA 1S9GA 3M30B 1RTDA 4XKAA 1VRTB 4NLWA 3BYPA 4LSNB 4Y00A 3CJ5A 3GP9A 2Q43A 2UZAA 2WVFA 3KLHA 5D78A 3IP0A 1GJVA 2E29A 1HMVB 3MMCB 3CEDA 3TANA 2FY1A 5CF0A 1BD6A 1HL6A 3KHGA 1B70B 3LTOA 2G0CA 2PI5A 3C6UB 1ZTWA 2KFNA 4KC5A 1B7YB 2QC3A 2K7KA 4B9SA 2D1CA 4C0BA 3QGPA 4ANEA 3DI6A 2AYEA 3QNWB 2YI5A 4F26A 1V5VA 1UYCA 4LSLB 4HT5A 4F3QA 2VBWA 3BO2A 4WTYA 2HNYB 1FK9B 5BODA 2C42A 1OSDA 2HNDA 3VHQA 3AAWB 3LH2S 2HAIA 4DEZA 2GAHC 1LWCA 5FNCA 4ECZA 4X4PA 2HRYA 4U7UD 4B9NA 2RRAA 2J0SD 1BYQA 2V34A 2FVCA 3UD3P 2VQEJ 2HFOA 2LYVA 3NEKA 5KFRA 4IG3A 2CXEA 2DO0A 4WE1A 3GILA 3G6VA 1ZZNA 4NA3A 5GGZA 1RT4B 4CDIA 1JLFB 3JXOA 2V4QA 4PKDB 3F44A 4KFBB 4F7VA 4LJMA 5KFXA 2RRBA 2H55A 5KFPA 4C3LA 5CCMA 1WWHA 1F2HA 2HAFA 5GAHI 1FE0A 4ASGA 1IBLJ 1DARA 1TK0A 1U1QA 1X7VA 2ACYA 1NPKA 3LAKA 3ZTSA 1WHVA 2W2NP 2WZ1A 3KJQB 1K0VA 1EKSA 2DNRA 1WG5A 1R0AA 3D6MB 3BGUA 1SJ1A 3RRHA 5B0GA 2EW9A 2B4UA 3X3UA 4PZVA 1DTTB 3A8KA 1H7XA 3CCMS 1MU5A 2B4VA 3TWZA 4AL7A 1Q8BA 4E8UA 2JC0A 1I94F 2IRUA 4OYXA 4WFZA 2GQPA 2PN6A 3CJ4A 4QBUA 4TVAB 3VAFA 1IQTA 1WTFA 3OR2A 2PIIA 3I55S 3NS5A 3CMES 4XDCA 3DRYA 1FNOA 4PPDA 4M5GA 2D74B 1IQZA 1UYHA 2FVQA 3MDFA 1HYSB 2FZKB 1R31A 1YBUA 1QTMA 1FX4A 4KB7A 5LOQA 3IM8A 3M8QA 1VMBA 2DH9A 5LXRA 3GIKA 3CCLS 4DUYJ 1VC0A 3R6GB 1S16A 1YJRA 3H8YA 2PEHA 2ZBQA 4EEHA 3ET6A 1NDCA 1IN0A 2BKPA 3HD1A 2DNNA 1NB2A 1WHXA 2AJ2A 4ZVEA 3WBZA 2DGOA 1S72S 2V67A 3G86A 3AD7C 1UY6A 2B9YA 4IG0B 1RU1A 2NREA 2L9WA 1TU0B 2DXEA 4FYYB 5EGYA 2K8GA 5KT6A 5H9EK 2BQ3A 2HFNA 1NK7A 4EFAC 4DV1J 3TYTA 4JI3J 1VIOA 2W25A 1YJVA 1MWQA 2YE4A 3DRXA 4NCGA 5D7CA 3G82B 3DHXA 5F8LA 2HW3A 4HHUA 4H4MA 4NLDA 4WF9Q 3IA0A 1VQ4S 2BQRA 1SJ3P 4LIWA 1RHQB 4QPJA 1RHMB 4Q8EA 5J2QA 2M70A 1AXQA 5EWEA 2DNGA 3J81U 2Q8GA 1GKZA 1FKOB 3NCQA 2O66A 3INWA 1S4EA 1NDKA 1ZA1B 4OFZA 1A6LA 4GO7X 1VQNS 1LWEA 3IR7B 3ZC4A 3R9LA 5HBMA 2JEJA 2MQPA 2VFRA 1YZ7A 3J7A1 5KFSA 3OVSA 2A3JA 1A4HA 2OTLS 4H85A 4IFVB 1KRPA 2WI2A 2GC8A 3PNIA 3WDOA 3OW2R 2QL7B 4QIEA 3MPVA 5HLFA 1UA1A 2IORA 2Z56B 1QYEA 2XZWA 3QJPA 4YB1P 2G13A 1T94A 5ETNA 3G87A 1VQ7S 3MD1A 2JNJA 1FTCA 1T03B 2DH8A 3PYDA 5F3KA 3PACA 1RKJA 3A8EA 2FJBB 1P8GA 2BBEA 4DR1J 3DRPB 3KLIA 3OV7A 4BHQA 2OAUA 1TL1A 4DV7J 1VDHA 2YWEA 4K2XA 2H1YA 4DV5J 2CJXB 2ZJRQ 3OL6A 1RTJB 1KVKA 3K8WA 3G8TA 2B7CB 2VH7A 1BC6A 4B3OA 1H2VZ 4OZ3A 1FRLA 4FNHA 5A6PA 1TKZB 4M63A 3HO1A 2QZ8A 2R8JA 4V19X 4OYWA 2EKYA 2B5JB 2ZBRA 1RT6A 4DL5A 2BUNA 1NEEA 3ZKBA 3R5BA 4MK8A 3LMMA 1RT2A 1T05B 3DRSA 2KI2A 3D2WA 4J7CA 3M32B 3ZTQA 1Z59A 2HLUA 1N0VC 3SSSA 3HHLD 4I2QB 1KQFB 1RWMB 3I5CA 3TNVA 2ZH9A 4PR6A 2ZM6F 5J2PB 1G7CB 4O3SA 4ICLB 2M8HA 3MAQA 2EVZA 1WOSA 1CQNA 3KJNB 2YH0A 4MYUA 1WACA 5DG7A 2Y0BB 4ZP8A 4NEZA 1RT3B 1YGYA 2MLYA 3H90A 3QPIA 1Q7YT 1W2BR 2DITA 4I7FB 5HO4A 5AJ3J 4O44A 1H74A 1CQMA 1RABB 1HNWF 4WFBQ 1NSQA 1E6YB 2Z2YB 3K8VA 2HBRB 1HARA 3AH6A 4PRVA 4RLEA 4ZPAA 2RQ4A 4RNFA 1H72C 4ZKIA 4K2JA 2R7VA 1IXKA 2QFIA 3LW5C 5G0RA 4CWOA 1OWXA 1QUVA 4ZIVA 2E7WA 4H4OA 2QG9B 3O1LA 4KYZA 4GKKJ 5BOCA 1FF2A 4C8YA 3UI3A 2YPYA 3PHEA 5CPHA 1H2UX 4LRCA 3O6QA 1LEOA 1KLNA 3CB4A 1Q8LA 1ZAXA 5EUHA 4HR2A 4CTAA 1JKHB 1MG7A 4JBCA 1HKAA 2HHXA 5KOWA 3KDNA 4CT8A 1KONA 2AHOB 2JEGA 1UVNA 4USHA 3E2EA 1ICEB 3CCES 1D9AA 1RZMA 4ELUA 5IQ6A 4K8RA 4MJKA 5E2QA 1I5OB 3MPUB 1RBLA 3FT8A 1WG4A 3WIVA 4DR5J 3RB3A 3EE3A 2UP1A 2C2NA 2XDUA 3R4OA 4BXIA 3R91A 3HVRA 2JSXA 4B3TF 1UFWA 1FEHA 4K0KF 5L3JA 3N5BA 4CO1A 3KFWX 4ZPWR 2XS2A 3MOZA 2EK6A 2KM8C 1YI2S 3MD3A 2VZ9A 4BQJA 5KFIA 3PDNA 3QTFA 2VPYB 1BWVA 1TTHB 3OW6A 3C3LA 4B02A 3P45B 3GFZA 4YR3A 1TAUA 1RAAB 3Q8YA 3VGSA 3OL8A 3N9UC 1YKWA 1UEUA 1GXLA 4Y0FA 3AY0A 4YKUA 2WVCA 2NXUA 3B27A 2IM0A 3IRXA 4LF4F 1RE1B 3CDUA 3U1NA 2YEBA 1F1BB 3CJRA 4X4QA 4JYAF 4DF4A 4JI0F 4XPEA 2R9LA 2D3UA 1N36J 2DVIA 4QOTA 4LRFA 2X7IA 2FQQB 3CYGA 2NZ4A 1U1OA 2JJCA 3UCGA 3IFEA 4IO1A 1JJ4A 3ZZ0A 4ECVA 4FMTA 4PCQA 2CVIA 4DF8A 4EGLA 5B0CA 5GMDA 3VADA 2K5BA 1DZ5A 4LBPA 4EBDA 2DYAA 4ECSA 5I42B 4Z7CA 1MROA 4K5SA 4ID5A 1FJ7A 2BX6A 4A47A 3P5BP 4Q44A 5CYMB 3KK1A 3N4WA 1URNA 1U2RA 1NDLA 2CNKB 4U9RA 3NOCA 1TC0A 5LMNJ 1J5EF 3CCSS 9ATCB 2IAJA 3TZ0A 4P2SA 2KHCA 2C2MB 3MR3A 3SSQA 4LMZA 3DLHA 3FUYA 4CLLA 1Y3KA 2FVSA 4WPAA 3FZ2A 3ZFVA 3D6FB 4DFKA 3MHYA 4NXNJ 3M2UA 3PEJA 5BXIA 5FLXU 1XNQJ 3B26A 2W4DA 3K5NA 1S48A 2ZZNA 1L3VA 1WSRA 1XN9A 1VOMA 4O3PA 2IPOB 1TIDA 3DOKA 2KM8B 5HL7Q 5KFAA 3G75A 4OYBA 3HFZB 1IWGA 1OYEA 5J1EB 3TZ4A 3CTRA 4ZJOA 3FMBA 5AXMA 2PEBA 1LFWA 5CH7B 3DOLA 1IBLF 2VPZB 5BR8F 3UNGC 1S7IA 2A18A 3PVXA 4ECTA 2PFDA 2BSMA 4ZKAA 3J7YU 3TZ2A 2XMWA 3ZXWA 5KG1A 4C2MA 2GHWA 3EVWA 5DLFA 3DLLQ 4Y2KA 4X4OA 1RAGB 2BU2A 2HCHA 2RU3A 3FBEA 3EMTA 1FRXA 2B56A 1KFDA 3BR8A 3C19A 1GXUA 2ROPA 2VG6A 3OTCA 4U93A 3BS9A 5E5NA 1X4HA 3K57A 3Q8UA 3MM5A 3CC4S 2HIQA 3BH7B 3MXHP 1UYDA 3VAGA 3GZ7A 2KJWA 2CQHA 4YR2A 3BQ2A 1KLMB 1EKRA 3G6ES 4CP5A 1HWKA 2RE1A 3OXGA 3PO5A 1TBWA 4DSJA 3FBFA 4CWPA 1BE4A 3MCSA 2YPZA 2YNGB 2IVFB 2HLTA 2MZQA 2NXJA 2H65B 3DDKA 4DUYF 3QIPA 4J9PA 4HT7A 4HI2A 3VAMA 3R8YA 1U1NA 2B8PA 2YKOA 1T3OA 1DURA 2BREA 1VK8A 1JM6A 4ALZA 3KK2B 3VTIA 1KTVA 1Q81T 5LT5A 3QMQA 1S77D 3OPKA 3OT9A 4ED6A 4L90A 2RB7A 1NK8A 1I5AA 2O1WA 3AQOA 2VJVA 4DV3J 2MEWA 1QZRA 2IJRA 3B78A 3LGNA 3M6WA 2CJKA 4JI3F 4USWA 2IJNA 2XGPA 4YOEA 1QUPA 1BMQB 5F9LA 3R4MA 1TMJA 1I59A 4FPIA 3KNGA 1GK8A 5IXUA 3KDOA 3P8BB 2IBOA 3SQOP 3PV8A 2OO4A 4RX6A 2W4CA 1U45A 5K8OA 3QRRA 3M6UA 2MQOA 2DNKA 1X9WA 2NSCA 3TVYA 3BSAA 4QR0A 1AROP 1I5DA 3IXQA 2F1FA 2RJZA 4V25A 4LR8A 5RUBA 2LFVA 3ZZRA 5HROB 3MF5A 1AUDA 2AD9A 3EPIA 3NGRA 1KR4A 1NPPA 3V6HA 2WVDA 1FDNA 2VBZA 3MEKA 3MM8B 1XR5A 2UV8A 1JJHA 1U2OA 5B0AA 1SVDA 4CM0A 4K59A 2ZOMA 3J7ZT 5KFVA 3MFIA 4TLRA 3R5AA 3W9HA 3CRKA 1Q8IA 5CYJA 3TJ8A 1YIJS 3TVZA 4FYDA 5DDPC 2FWZA 3NWGA 5KFNA 2J6UA 1LXJA 1JLBB 2JX2A 3NGKA 4FYWB 3GJTB 4DR1F 1MWYA 1VHIA 3HJVA 4RW7A 4IRKA 4DV7F 4LQ9A 4LR9A 1LQ9A 2NXEA 5HMYA 2B9EA 5HMXA 1SKUB 4DV5F 4ECQA 1VJQA 3MEEB 1T9VA 1XJWB 2O3DA 3MOJB 1ZXNA 5CA5A 2N7YA 4DV2J 1U48A 4UTGA 3T19A 5I3PA 4JP8A 4RWXA 1BY9A 3VGVA 2Z2MA 5GAGU 1U0SA 5KT5A 2EI5A 2PA8D 2RS2A 1QAIA 1CJUA 1XNRJ 4X64J 5LL6d 3BM9A 3RB6A 4WIQA 4DI6A 2OPPB 1UWBB 2VCIA 2J7UA 3W7BA 2VUGA 1N5YA 3KWMA 2CZ4A 1KQKA 3THTA 2MQMA 2IFXA 1YS3A 3OFEA 1HBMA 2ZC4A 3D36A 1LWFA 1WD6A 1DQAA 1VBXA 2YX7A 4ES1A 5DZ7A 4ZITA 3BSNA 3VHDA 3RLRA 2BU8A 3J7YI 2MHEA 1Y8PA 3LP2B 4G1QB 5AJ3F 3Q8RB 1KC8T 5CYQB 2DT9A 5KFMA 3R3TA 5IC6B 2ZHOA 4JI1J 4HYPA 3T0ZA 2H4YB 2OPRB 2CFXA 3POTA 4FCQA 3RKZA 1SJ4P 2V8DA 1AA1B 1RBOB 4URQU 2XCAA 5IT9U 4ZLLA 2NQPA 1UY7A 3N5FA 5LJ5Y 4LR7A 1NHIA 2DHSA 5A8KA 4DR6F 4HXWA 3T5HA 1RWVB 1ID0A 2YJXA 2HZAA 4A8YA 2HKJA 1SL0A 1T11A 3VF0B 3MMAA 3AD9C 3UD5A 2IY5B 2XHXA 3K0JA 4TYAA 1JLCB 3JSMA 2ZITA 2MHNA 3IO1A 1MN7A 3HP6A 1R8HA 1REVA 2WEPA 3W63A 1V6HA 2NUUG 2V2ZA 2V2QA 3L7UA 3L95X 2K2PA 2OSRA 4G1PA 1OY6A 4WZMA 1EX8A 1ZETA 1UFKA 1S1VA 3UCUP 2C3OA 2CDQA 1HPZA 4MPEA 2C3YA 1C0UA 4R5PA 3FRYA 1CPZA 2Q1LA 2MKJA 2HWHA 4DR5F 3UN5A 4GO5X 4PABA 4QYZK 4NX9A 2AX0A 2GGPA 3M8PA 4G1IA 1NJYA 2HHHJ 1FD2A 4R3MA 4GKJJ 3RLQA 2BE2B 2XY7A 1IM6A 4P7VA 3AHPA 2YEIA 1IR0A 2FJEB 4OI6A 3QJJA 4CM2A 1YT0A 4E01A 1XMQJ 1H7WA 1C0TA 5KFLA 1B62A 3GIGB 2CCTA 3S6EA 2R7SA 3HKZD 1F3VA 1YK9A 3FC9A 2KJVA 2CWKA 3A4TA 2B0GA 1KVJA 2E5GA 1HW9A 4IDKA 3OLBA 1RHJB 4ASFA 2CADA 2QFOA 3V4IA 4LWGA 3CCRS 1SQEA 2BZ2A 3TARA 3J81Y 5HVGA 4K50A 4CO5A 1RHRB 1MU2B 3G6YA 3M9MB 1N36F 5HANA 1U49A 1MN9A 4M1KA 4FN5A 4NLVA 1LW0B 3ZZOA 1M5SA 4YUDA 4PWWA 1NK0A 1T9XA 4ZOSA 4I67A 2QV6A 4RPFA 4LSNA 1H0HB 3QBCA 3C66A 3KUHA 3Q8PB 3PW7A 1NJZA 1B4SA 1ITPA 2WRMA 3H98A 5KG5A 3SFGA 4NRTA 4ASAA 3MAAA 1SUQA 2WVEA 2QRRA 3AJDA 4C6AA 2ZBIA 4YKXA 4NLQA 1RHUB 5FWKA 5LMNF 1U47A 1PKUA 4X9LA 1TKXB 1MMLA 1X0PA 5ETOA 4E00A 3VALA 2IYIA 3O0IA 5M4MA 1W7WA 5E41A 3UVJA 4XPCA 1O51A 4A4JA 4DU8A 4NXNF 1U0ZA 2WSCC 4CRJA 3N6LA 2CQPA 2GW8A 2JJ4D 1VQ8S 3AA9A 4FBTA 3CSKA 4C48A 4LF8J 5C24A 2YKMB 2WONA 4DHVA 4ED2A 3CRLA 1ZAWA 1I1GA 3BKUA 2NPFA 4FCPA 2C1IA 1S9EB 3TEGA 5GAGI 3HFVA 4WFXA 4NA2A 4K4OA 3W2VB 5KFJA 2AQ4A 2DEJA 2N4DA 1RWXB 4B9MA 1QD1A 4X4VA 4ETXA 3N6MA 3E01B 2DRAA 3NKYA 1GKXA 3OXLA 3CT9A 4F50A 1DTQB 4DPTA 1S1UB 2RQKA 1B0PA 1IM4A 1Z5BA 1Q16B 4KBIA 3C14B 4DLEA 4UW2A 4K4SA 2YQ3A 4MFBB 2G2ZA 4RU2A 3M05A 3MMBB 1S76D 4N47A 2X3GA 4XIRA 4P2MA 3RW6A 1H6KX 4F3MA 1RWPB 2ZC3A 4WCEQ 2OKQA 1CJVB 1KSPA 1UJ4A 1JJ2R 2F65A 1DFDA 3KHHA 4OYOA 1K73T 5D6PA 3OMUA 4W92B 3GSDA 3GU0A 4OX7A 4JI2J 1RBAA 4ZLJA 3TZ5A 1P9QC 2XWXA 1YETA 1J5OA 3MEGA 1QTNB 4OI0A 3GFYA 4OLOA 4YKRA 4URLA 1Y5IB 4ZVRB 3DLKA 2CZVC 2BJ3A 3HZ5A 4RJVA 1SH3A 1GMWA 2YY3A 2HVDA 2YXLA 2CWXA 4OZ5A 2OJ3A 4RW8B 2U1AA 5C93A 1R8CA 2FPHX 5E33A 4WTOB 3IEDA 2ASYA 4PXBA 1UMJA 1FO1A 4J9LA 3QT5A 4HH0A 1KFSA 4Q0BA 4I1TA 3QIDA 4HYKA 1EETB 2HRUA 3SCIE 3RR8A 3E8OA 2CA9A 4HACA 3K97A 4MMOA 2I9SA 2R7WA 1N5QA 3OL7A 1PAUB 3V5RA 4ZVPB 1IKYA 2MZSA 3CULA 2RU9A 1G1XA 5D7DA 2N82B 4J9KA 1YLXA 4QU7A 4DR4F 2J7WA 2GQCA 4K4VA 3C15B 2P9EA 2FVPA 4DQQA 4DV3F 1RLCL 3NRBA 4FCRA 3ZO7A 3WHAA 5LM7E 4EM7A 3O5TB 3JQKA 1Z2LA 1JB0C 2GNKA 3RBEA 4DL4A 3B54A 5ITHA 2V6AA 1BQNA 4BWMA 5CXTA 1R62A 2Q6CA 2H5EA 2YNFA 1LK7A 1N34J 1IR2A 1FI4A 3VV2B 4USJC 1RXOB 2CQ1A 3TQ1A 1M0SA 1UZDA 2ZH2A 4ZIWA 2H51B 1U24A 2X1FA 2DD8S 4PXEA 1BQXA 4ES2A 4XDDA 4M95A 3LO3A 3O2FA 2DR7A 2OSQA 2EWHA 3GJQB 1S1WB 1XC9A 2M88A 3PEHA 2XK2A 2WVBA 4CLTA 2XDKA 3TAMB 2HGMA 4ZPBA 1FDDA
chains in the Genus database with same CATH topology
2ZFHA 3TAQA 4DQPA 2B4PA 1TQLA 1UAWA 3M2VB 5E3CA 1K0VA 3BQ0A 1R8PA 1U26A 2DH7A 5K9FA 3SQGB 2K1RB 2DNRA 2KVIA 4HZ0A 3MM6B 1WG5A 5L1JA 2ZHBA 1D9DA 2KN4A 5A2QY 4QIWD 1UYLA 5C25B 1R0AA 1KLMA 2H8MA 1B0TA 2R8IA 4WF9Q 3BGUA 3JAMY 1VQ6S 1SJ1A 3RRHA 3A0ZA 5L39A 2Q2EB 4HYMA 5GADU 3QO9A 2QIFA 4EWTA 4Y3CA 2W7OA 1YC4A 5B0GA 2EW9A 1CVJA 4JOUA 5JJBA 2ASJA 5KFCA 3DLJA 2IMWP 2N3LA 2VL1A 4TY8B 3T9ZA 3TX8A 1W2IA 1FKPA 2B4UA 1YJ9S 3X3UA 2B7BB 5L8RC 1VQPS 3CIZA 3U2DA 1VGYA 3PX4A 4A8KA 1NK9A 1BWEA 2IOPA 1R6YA 7FD1A 2O67A 2YNGA 1DTTB 4O4GB 3A1YG 2FDNA 1VQLS 4B7PA 1H7XA 3OFGA 4Y2MA 3CCMS 1MU5A 2B4VA 1L3KA 4NH9A 1YSJA 2MZJA 3GIJA 5E0OA 3CD7A 4C8OA 3UFCX 4AL7A 4OIXA 1Q8BA 1IJEB 3I4PA 4PPZA 1S1TB 4E8UA 5FLXY 3DRPA 4B9UA 2JC0A 4DV4F 2J0XA 4J5OA 1HD0A 4PG8A 2YK2A 4YB6A 3GG0A 1JK9B 1NO8A 3DU5A 3MURP 2IRUA 1I94F 2CCUA 3T1YF 3OUYB 2C22A 4G6VB 5F3ZA 4WFZA 2GQPA 3P96A 2PN6A 1NK6A 1ZM3A 3CJ4A 1ZW9A 3KK3B 4QBUA 4RNMA 3VAFA 1IQTA 1WTFA 2JWNA 4J9MA 3OR2A 2PIIA 5A8WB 3I55S 3NS5A 3CMES 4RU9A 3FT5A 3KK2A 3C11A 4CI0B 3DCAA 4XDCA 4AWPA 2YKPA 2XHWA 4N5SA 1WEZA 1FD8A 2XMMA 4URMA 4RBTA 1RISA 3TRGA 1X5OA 3DRYA 4J9NA 4I6WA 2BRCA 4RW6B 5J2NB 2ZDOA 5EHHA 3I31A 1FNOA 2VASA 4PPDA 5C42A 4PQUB 4U7NA 4JI7F 2D74B 5E7OB 5F8GA 1IQZA 3DMJB 3T1HF 1BGQA 2HPUA 3H80A 1UYHA 2XS7A 1YWXA 1UVMA 2B5JA 3SEOA 2FVQA 1J2VA 3MDFA 1HYSB 3IWLA 2E1MC 2WI5A 1R31A 4M8LA 1XNRF 1QTMA 4KB7A 5E3RA 3SDEA 2E1CA 3RYLA 3K99A 2LDYA 4X64F 3M8QA 5M2UA 1VMBA 2DH9A 4XC0A 1AH6A 2ZBCA 4IKAA 5LXRA 3JSYA 2CPJA 4RW7B 3GIKA 3MGJA 4RUHA 3CCLS 5DETA 3LOUA 2J76E 1VC0A 3M32A 3L3CA 1UVJA 4CWSA 2M4MA 1YJRA 3UWTA 5GMKa 1S16A 1D8ZA 2UU9F 4M5DA 2WI3A 2R4FA 2RF2A 2BTZA 3GIEA 3DHWC 1HQUB 3H8YA 2PEHA 3IG1A 2UVUA 4XKOA 4EEHA 3W2WB 1N34F 1EP4A 3PR5B 3KJVA 1QY8A 4ZVFA 4KFGA 4YKZA 3P6YC 3T0HA 1T95A 4IOBA 1M5OC 1IN0A 2HWTA 2ZE2B 1Q1KA 5SZTA 2VQEF 4MPNA 1KQSR 2DNNA 1WHXA 4NLOA 4QCLA 4ZPTR 3VAHA 1AFIA 1IKXA 4ZVEA 3EYZA 3WBZA 1X9MA 2XJGA 1L3TA 2DGOA 5DQGA 2W9BA 3JYTA 4NLUA 1S72S 4L72B 3CCVS 4C98A 2GX8A 3G86A 1R8AA 3H4BA 2DIUA