3PEHA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of a thienopyrimidine derivative
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
261
structure length
261
Chain Sequence
ESMESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of a thienopyrimidine derivative
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Chaperone
molecule keywords Endoplasmin homolog
total genus 78
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pehA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pehA01
4MPCA 2CH4A 1ID0A 4R3MA 5M4EA 4HY6A 5M4HA 4U93A 1QY8A 4CWFA 4HYMA 4YKRA 2FYPA 3RKZA 4AWPA 3GIEA 4XDMA 3FT5A 5CPHA 4FMTA 1UY6A 3R4NA 4FCRA 1TC0A 2YE9A 2YEAA 4FCPA 3HZ1A 1H7SA 4URNA 2YJXA 2WI2A 2WEPA 2WI7A 2YEIA 4WUDA 3O2FA 4HZ0A 2Q8GA 1B63A 4KSHA 5F5RA 4O07A 2CG9A 4JAVA 3K99A 1I5AA 3U2DA 2XDSA 4DUHA 2BU6A 1AJ6A 3GIGB 3RLPA 2CCSA 3HEKA 5M4MA 1A4HA 5CTWA 4EGKA 1B62A 2XD6A 2VWCA 4NH7A 2BTZA 1I5BA 1UYDA 3WQ9A 4CE3A 1Z5CA 2YI0A 3OPDA 5CTUA 1NHIA 4XIPA 2HG1A 4YKXA 1ZXNA 2YGEA 1Y8OA 3OMUA 2C2AA 4H85A 3A0WA 3T10A 2WI3A 1R62A 2CCTA 3EKOA 3OW6A 4MPEA 3D36A 2CGFA 4L91A 4CWRA 3VHAA 4GCZA 4GGLA 2XABA 3T0ZA 2O1WA 2QFOA 3B27A 1Z5BA 5FNDA 3G75A 3Q5KA 2XX5A 4EFUA 4AS9A 1YT2A 2IWSA 4BAEA 1UY7A 2BU8A 1EI1A 4YKWA 2YI7A 3IEDA 1BKNA 1OSFA 3U2KA 4XD8A 1MX0A 2XDKA 2YKCA 3H4LA 3G7BA 3K98A 1UYKA 4H81A 4EGHA 1QYEA 4V25A 2BYIA 4XIQA 1TH8A 2XCMA 5CTYA 1GJVA 2XJXA 2YEHA 3B28A 5C93A 5L3JA 1NHHA 5M4NA 2ZDYA 3D0BA 1AM1A 3QDDA 4CWPA 3R4MA 2O1VA 3B26A 3TTZA 4JASA 4YKZA 4XKKA 4EFTA 1MU5A 2VW5A 4E01A 4B6CA 2BREA 5CTXA 3ZXQA 2H55A 4URLA 4W7TA 1Y8NA 2GQPA 3TUHA 2Q8FA 3JZ3A 2WI4A 2YEBA 3A0ZA 4B7PA 3R91A 4E02A 4DZYA 2IWXA 2BSMA 2YKIA 4FCQA 4L8ZA 2YEGA 4LWGA 1UYFA 3CRLA 2O1UA 4CE2A 2E0AA 2YE5A 4L93A 2PNRA 5CF0A 3INWA 4U7NA 4L94A 3KE6A 5IDMA 2BRCA 2YK2A 2XJGA 1TILA 4E00A 1EA6A 1TBWA 2VCJA 3CGYA 1Z5AA 2Q8HA 4V26A 4I3HA 4ASFA 1Y4UA 1KIJA 1QZRA 3BMYA 2IOPA 2AKPA 5GGZA 3QTFA 4ASBA 4LWIA 3NMQA 1UYMA 3HZ5A 4EMVA 4O09A 2YEDA 1Z59A 2HCHA 2Q8IA 3ZKDA 4BQGA 4WUBA 2UWDA 3LNUA 2YE7A 3BM9A 4FPPA 4LPBA 3TZ5A 2BU7A 1ZWHA 3RLRA 4ZKIA 1UYEA 3ZKBA 2YECA 5IDJA 2IORA 5BODA 5BOCA 3OWBA 2YEEA 1AH8A 4CWNA 4XITA 3T1KA 3R4PA 1BXDA 2YE6A 4GQTA 5D6QA 2GFDA 2HKJA 1U2OA 4AWQA 4KQVA 1AMWA 3EHJA 3T0HA 3FV5A 1YS3A 1ZW9A 2XX4A 3WHAA 4MP2A 3U67A 1S14A 2K5BA 4XKAA 3OWDA 1Y8PA 4UROA 2YK9A 3TZ2A 4ASGA 3PEHA 4PL9A 4R1FA 2YGFA 3CRKA 3R92A 2YJWA 5D7CA 1PVGA 3CWVA 3B25A 2QG0A 3H80A 4BIUA 2XK2A 4MP7A 3HYYA 2ZBKB 4QPJA 1YETA 2QG2A 5FWKA 2WI5A 2YKJA 2IWUA 1BGQA 2YE8A 4NH8A 2FXSA 4O0BA 3HHUA 3O0IA 2YE3A 3ZM7A 1YC4A 4JAUA 4U7OA 1TC6A 2WI1A 4GEEA 2YEFA 4L90A 1US7A 2H8MA 4HY1A 3HYZA 1YC3A 3CGZA 2ZKJA 4XE2A 5D7DA 2FWYA 4MOTA 5F3KA 3PEJA 3K60A 1GKXA 1UYGA 4XTJA 4P8OA 4HYPA 3MNRP 2JJCA 4MPNA 4AWOA 2XHXA 1YERA 3B24A 4BXIA 4YKYA 1NHJA 4ZVIA 2YGAA 4LWEA 1U0ZA 4LWHA 4BIZA 4LP0A 3TZ4A 3EHFA 2BU2A 2XX2A 2YE4A 3K97A 2WEQA 2EXLA 2ZDXA 2Q2EB 4LWFA 2YKEA 3SL2A 4GFNA 3G7EA 1YSZA 4O05A 3ZXOA 1B3QA 3EHGA 3Q5LA 4HZ5A 4NH9A 4Q20A 2ESAA 4XCLA 3INXA 2VCIA 1ZXMA 4XIRA 1AH6A 5J6AA 1YT1A 3DGEA 4X9LA 3A0TA 4CE1A 4EEHA 3A0RA 2JKIA 2YEJA 3O6OA 4XKOA 4PU9A 5D7RA 4URMA 4KTNA 3EHHA 2BYHA 4XCJA 2YKBA 4MBCA 1YC1A 2XDXA 3FT8A 4PRVA 1I58A 1KZNA 4KSGA 2YI5A 1H7UA 3TZ0A 4HXWA 4I5SA 4GT8A 1S16A 4CWTA 1TIDA 4KFGA 1Y4SA 2BZ5A 4YKTA 4CWQA 1GKZA 2BT0A 1UYIA 1UY8A 1UYLA 2WI6A 4H7QA 4JQLA 4CWOA 3A0XA 3VHCA 4PRXA 2IOQA 4O04A 2YI6A 5FNFA 4BQJA 4KP4A 4WUCA 4MB9A 4XC0A 3R4OA 4HXZA 1YSRA 3VHDA 4CWSA 1I5DA 4YKUA 3Q5JA 4K4OA 2XDLA 2YE2A 5J71A 3D2RA 5IN9A 3RLQA 2WERA 3LPSA 4P7AA 1THNA 5D6PA 3VADA 1JM6A 1I5CA 1UYHA 3C0EA 2XDUA 4R3AA 1YT0A 2FWZA 3C11A 2CCUA 5FNCA 1BYQA 3A0YA 1I59A 4EM7A 1L0OA 2BU5A 2XJJA 4ASAA 3GIGA 4QPKA 1YESA 3GIFA 3T2SA 5M4PA 4EGIA 2XHTA 4YKQA 2QF6A 1UY9A 2XHRA 5M4KA 1UYCA 3EKRA
chains in the Genus database with same CATH superfamily
1ID0A 4YOEA 5KG6A 2DPIA 1DBDA 3RKZA 4A46A 5A8RB 4JI6F 3WC0A 1HARA 2OFGX 2W7OA 3R4NA 3MECA 2I38A 1U1OA 4TU8A 7FD1A 1JXVA 2W9BA 2R8JA 4IH7A 2Q1LA 3CT9A 3VVUA 4CLTA 5DZ7A 5F0UA 4WUDA 3O2FA 2AP6A 4KT0C 4DZ6A 3SV4A 5K8MA 4JAVA 2R42A 3PR4A 5A8WB 4IUFA 3CCJS 2VG5A 4NE9C 3VALA 3HVRA 5KFCA 1U1MA 5KFHA 5KFLA 4RX6A 4X4VA 1RLCL 4EMDA 1VCTA 5HMWA 1U2CA 1LOUA 2VFSA 1NJWA 4C4WA 2CGFA 1Y00A 4DL0C 4G3IA 2RHQB 4RU9A 3Q5KA 4ECWA 2ZE2B 4HL9A 2LKZA 4A8YA 1NHUA 4EGLA 2BM1A 3C6UA 1S1WB 4QR1A 4XD8A 3N5FA 4OV6A 4DS5A 4L73A 3H4LA 1UYKA 3MM9A 2ZE2A 1RTDA 4NLTA 3VR1A 4RO0A 3CDEA 1VIOA 2HFNA 2RF2A 2CVIA 2G2ZA 3HCXA 2AIRB 3MOZA 2WTFA 4A8SA 4YKZA 4DSFA 3EM1A 3UD3P 2MZTA 2HFOA 4RL1A 3NGDA 2CIMA 4W7TA 1N48A 5JVHQ 3P4UB 4AQYJ 3M05A 3ITHB 4E02A 4ZLLA 2HQDA 3R9LA 3VQSA 3GSIA 1T03A 2GNKA 1WHXA 2M70A 3E8OA 1Q8KA 1L3KA 3L4BC 2H5IB 2MKIA 1U47A 3THPA 5KFVA 4CLLA 3IWXA 3G82A 5IV3A 3TYTA 3LPYA 5AXKA 3T19A 5L9NA 1SC1B 1Z5AA 1MROB 4P2SA 5E7OB 2O1PA 1F1BB 3TJAA 1KIJA 1LXJA 2OGUA 3MCNA 1S0MA 4NLXA 2VUGA 3NRBA 2YE7A 1S59A 2W2PP 4JI3F 3D28A 3ZKBA 5MAOA 4MK7A 4LFCF 4J7CA 4CWNA 1BXDA 1YJ9S 5GADI 2XX4A 2XLIA 4XKAA 3OD2A 2ZJRQ 1RAEB 1FRLA 2PA3A 2DNQA 4URSA 1KSPA 1UAWA 3PX4A 3T41A 1PVGA 3DRSA 1M0SA 2Q66A 1JKHA 1F0XA 3IM9A 2OPPB 3FC9A 1LW2B 4LBHA 5KT7A 3W8PA 4IOAQ 2BA9A 3ZM7A 1CJVA 2MQQA 3OFGA 5E3RA 2OKQA 1KWMA 5IV4A 4DV6J 1QDUB 1SB6A 3GYNA 3KK1A 1FEEA 2PFFB 3A13A 2IBKA 3CMES 5BYQA 2HHVA 2GZOA 1J27A 4Y28C 2LMIA 4WU2A 2XHXA 2Z2LA 5A0YB 2KRBA 4LWEA 2ASLA 4BIZA 2BU2A 5CD4H 1JX4A 3NNHA 4ANEA 4ID5A 5LMUF 4B3SF 4P72A 1UVIA 5KFYA 3NG8A 2W4CA 3I96A 4E8UA 1AXQA 1RA6A 3DLGB 2EI5A 4B9VA 2DNKA 1Y11A 4ZIWA 1Z1ZA 2N4DA 4IO1A 3PW4A 3CCRS 2R8IA 2RUGA 4IFYA 5IT9Y 1P6TA 3MMBA 2BYHA 2YKBA 1K1QA 1NMEB 3GV8B 4ETZA 5A8KB 2VBZA 1KZNA 2DYAA 4HKQA 3HX9A 5BR8J 1K9MT 1EQMA 1Y4SA 2HLUA 3GJTB 1FJEB 3VHCA 2AHOB 4LRBA 3VHDA 1AT1B 5IN9A 1GMWD 3HI9A 3D6TB 1R0AA 2F4VF 2H4YB 2NZCA 3FRZA 2CQ4A 5LMNJ 2BQRA 1RTDB 1HWKA 4LBIA 2FLLA 2GQ2A 1L3TA 3CDAA 3GIFA 1IUJA 1RHMB 3IR6B 1HMVB 4MK8A 1TL3B 3CCMS 4N7TA 3C66A 4DV3J 3BYRA 1XK8A 1RA7A 2V8VA 2HEKA 4XK8C 4CP5A 4X66F 3F73A 1NLKL 3UDLA 5KG5A 4IR9A 4LSLA 2FVSA 4FXVA 3ENAA 5H1SV 1NK4A 4I0WA 2GC8A 1TKTB 2YQ0A 3D9BA 3RRKA 4EEYA 2BZ2A 2HBQB 2YKPA 3UVJB 1HNVA 3VGVA 5A6WA 3KUHA 2P8IA 4WFBQ 1RTIA 4A8OA 4KYZA 1U02A 2QSFA 3GIGB 3H59A 3D5MA 3I4PA 3KJVB 4O3PA 1FO1A 3CXCR 1SI9A 1Y8OA 5BR8F 2G2OA 2DNOA 5CA5A 1N5VA 4PEOA 1T9YA 4HH0A 3TAPA 1TFWA 2NS1B 4LJMA 3HT3A 3M6XA 3PXGa 1Z5BA 1WF2A 4PXDA 4O3QA 2IFXA 4OZ1A 5HBMA 3D6FB 1NO8A 2HHWA 4DFMA 1DTTA 2LEBA 4YKWA 2K7KA 3R1LA 2G1DA 3IEDA 1DFDA 3DRRB 2Y8WA 1U7LA 4LF6J 1PGZA 3N0VA 4X2BA 5DGAA 1Z2ZA 3OSNA 2HVZA 1FK9B 2PE8A 1VQ7S 5KFDA 4FYYB 1TKDA 5EX0A 1AFIA 1XN9A 2OO4A 3GG1A 5LXRA 3AQOA 3UR3C 1R7IA 2DEJA 4OYIA 1S4EA 3EXCX 4FDFA 1RT5A 1IR0A 5D0HA 4NLRA 5IOLA 3FFIB 5E3PA 3BDEA 3TZYA 3QMQA 1R0AB 2YEGA 2VFTA 1WWHA 3GQCA 4C7QA 2XEXA 2YE5A 1UW9A 1LWCB 2F4FA 3V2UC 2HK2A 2RKIB 4M5MA 2DNPA 1EAYC 1WOPA 4F26A 1I5OB 3IS9B 1ZA2B 1N32J 3IG1A 2XY6A 4I3HA 3CDUA 3B8HA 3EVMA 2AKPA 3KLIA 5GMKa 4CH7A 1JLBA 4BC9A 5C2CA 2B7BB 3O5TB 1ZWHA 1N34J 1WEZA 2KYXA 4WFNQ 3AODA 3NGSA 4IG3B 4NXNJ 1GXTA 1QTMA 5A2QY 5ETLA 3EHJA 1VFJA 3BKUA 1VS3A 2GMJA 1S1XA 3R92A 2CDQA 2ZKUA 1IJFB 2VOPA 5DM6Q 2KXFA 3PYEA 4DPWA 2J0XA 4W92B 2WVDA 4BCAA 1ITPA 3QPIA 1YJTA 4W4MA 3M30B 4I6WA 5HAOA 2W9BB 1BGQA 4A48A 2YE8A 5SZTA 4O0BA 2NCKL 3GFXA 1PCAA 4C6AA 2YEFA 2XY7A 4ZDNA 4WFAQ 2FJXA 2NXEA 1HHSA 2C2OB 3J7A1 3T1HJ 3GE9A 1S79A 1S1TA 1YITS 1D3WA 2W2MP 5HMYA 3MNRP 1DTTB 1V9OA 2VASA 3LMMA 4J9UE 3MM6A 4X4UA 3WIUA 1R27B 1HI1A 2MKHA 3EPGA 1S6QB 1FF2A 4USTA 2E5IA 2QGFB 2UXBF 1H7XA 4NXMJ 1RI7A 4QR0A 2DY1A 3EXYA 4RBVA 4RW4B 1Y5LB 5A6PA 2IRUA 5J6AA 1OSDA 3A0TA 3KLVA 4CE1A 2M2BA 2BJ1A 3BGRA 3H20A 4X65F 1FJCA 1OPIA 2BANB 2ZH3A 4XCJA 2WSEC 1SCJB 4JUZA 4H4OA 4JV0A 2CUYA 3T9NA 1FD2A 3UN3A 2EWHA 3BR9A 2QEXS 1IJEB 1UL3A 1HL6A 2BANA 1GKZA 1F60B 1UYLA 1YSJA 4U9RA 1NCLA 5HMXA 3TAQA 2W7PA 1KC8T 5T7LA 1RT3B 4ZP7A 1OQ3A 4YS2A 1Q8LA 2VQEF 3NL0A 3TZZA 5KFXA 3C11A 2D69A 4ERDA 4B3OA 2LCWA 4DR7J 1K47A 1YESA 1X4GA 3BEGB 1JLGB 2XHTA 4YKQA 4DV2F 2D9PA 7FDRA 4QWBA 5F9LA 4I2PB 4OX7A 3TWZA 1X5TA 3Q23A 5KFEA 2C22A 4HYKA 3MPYA 4UOCA 3MAAA 4JI4J 1IBKJ 3BB5A 3DNCA 3J7Z5 4ZCKA 1B99A 4C8ZA 2J7UA 4DX6A 1NH8A 2OSRA 5CHCB 2NYIA 4O07A 3HVAA 3JXOA 1SH3A 4DV0J 4ZPWR 3GSDA 4MMOA 3L09A 1AJ6A 3LP2B 2GIQA 4CLSA 4CO1A 4IH6A 1IKVB 4U8YA 4P7VA 1BY9A 2B3TB 3OMUA 3ULHA 4QWAA 5FDLB 3MM5A 3QJPA 4LF4F 3VVTA 3MUTP 4LF9J 3EKOA 3D36A 3LGNA 3MUMP 1LNQA 1RYSA 1QAJA 2UXDF 2XX5A 2N7YA 4EFUA 4AS9A 4DL6A 2AF6A 1NNDA 3FGVA 1WHYA 1B70B 1EI1A 2MB0B 3G8QA 1C0TB 1HYSA 3CPWR 1KS2A 2YX7A 4MIWA 4V25A 3KHHA 3DGPB 5L46A 4RW9B 1S4FA 2HQFA 4CWPA 2CPHA 3R4MA 4R25A 1DQ8A 4QOTA 2X3DA 1NHVA 2KT3A 3K0JA 4E01A 2Y0BB 1BUXA 1EP4A 4ZCIA 2OIHA 4IO9Q 2WOMA 1VHIA 1SKWA 1FJGF 4IG3A 1RT2A 5D8HB 3JZ3A 3MMBB 1DARA 3MM8B 3R91A 2IWXA 4OZ5A 5F3TA 3CF5Q 1GXLA 4FF4A 1OO0B 3AT1B 4DR5F 4OLOA 3K7RA 1P1TA 1YLXA 3EMTA 1QUVA 2MPUA 1FX2A 4RZRA 3UI3A 3MR3A 2BQUA 1EQ0A 4U7NA 5IDMA 1EA6A 2YQ1A 2VIHA 2LLZA 3FEZA 2WSFC 3W65A 2XYGB 1AYEA 3PKYA 1NAQA 1LWCA 5D4OA 1FTRA 1S6PB 3M1VB 4RR5A 3A8JA 2IOPA 4ASBA 4QU7A 5EWGA 3NMQA 3R8YA 3CJSA 5D4LA 3GIJA 2UWDA 2N4CA 2UUWA 5D0EA 3IG1B 4WFZA 1U8WA 1HKAA 5BODA 1FXDA 3EUNA 3FCHA 2EFPA 2RAQA 4B9TA 1N33J 1JLQB 4HVZA 1XTZA 3H25A 3QSIA 4A8WA 5B7WA 2DR9A 5CQGA 4LF8F 3T1YJ 3LALA 2OMLA 4P2XA 3WHIA 3CWVA 2MLYA 4QYZK 4MT1A 2NYHA 3QWPA 2H5EA 4CO2A 1Y3KA 2YKJA 4NZ7A 1WACA 2IJNA 2LDYA 2KVQE 4O3SA 4EYIB 4NCBA 3G8SA 2GVDA 5F3ZA 2R7XA 1UVLA 2MSTA 1WD6A 2HFVA 1TQLA 2Y3YA 2YKMA 3SXLA 2BRKA 3PACA 2FGOA 1HNZJ 2Q6CA 1KLMB 2D3ZA 1N56A 4DF4A 2G2YA 3DLKB 3PO4A 3TEGA 5T7LB 4U7UK 1BLUA 2HFSA 4ZVGA 5KFWA 3K59A 1S0NA 3G7EA 4JV2A 2MZQA 1C4AA 1UCNA 3QFWA 3OW2R 4EZ6A 3G6VA 2CXEA 8ATCB 3W2WB 4XO0A 4V1Ak 2W9AA 2EC2A 1SC3B 4B9LA 2KG1A 2EG1A 4ANDA 3V4IA 4EEHA 1LW0A 4PWDB 4XDDA 1R89A 1REVB 2MJUA 2HSEB 2NSBA 3OPKA 3QNWB 4XKOA 3ENQA 4FVMA 1S48A 2E29A 1S1WA 4KTNA 3B4DA 3L7PA 3EICA 4G65A 2M0GB 2AT1B 3LW5C 3FT8A 1RT7A 3V4IB 3JSMA 2CZ9A 3I82A 4DFJA 1A0OB 1RXOB 4CWTA 3LH2S 1JK9B 2HNZA 1TUGB 3KXDA 3OVAA 2CPEA 1IBMJ 3MTJA 4RKUC 4NLWA 1RAAB 2PI4A 2DR7A 1QLNA 4P7AA 1KBRA 4KB7A 2RQMA 4H4KC 1VJWA 2XMTA 1B64A 4OI1A 2HFUA 3R27A 4AXIA 2HURA 3NGUA 3MD3A 2BE2B 1YRUA 4G1QA 2PI5A 1YX2A 1PBUA 2CH4A 4C9DA 5B0BA 1SUQB 2DPJA 3NGRA 1QY8A 4AWPA 2G0IA 3N6MA 2AU0A 2XSJB 3GIEA 4JBCA 4FVCA 2E9RX 3CD6S 4FXDA 7AT1B 2AV5A 4QWDA 3RAXA 4DV1J 2PA8D 3I0SB 2A0FB 2YEAA 4CZCA 4FCPA 2AJ0A 3GJRB 3OL9A 3HM9A 4F3OA 2F5GA 2N3OA 4KV8B 1N36F 2C2EA 3NMAA 3MECB 1VRQC 3P3DA 3KLFB 2GVZA 1Q8BA 4IOBA 1AZSB 3POTA 3GIRA 3ZTOA 4DUHA 3KJQB 3W5YA 2D74B 2GQQA 4DCPB 2L48A 4A8MP 1NKEA 4LF7J 2LQ5A 1Q0NA 1AZSA 4I7FA 2OEMA 5CZVA 3PJWA 3HVWA 4EZ9A 4MYTA 4DR5J 5F9NA 4GGLA 3R7BB 3I55S 2MY7A 2NR0A 3THTA 2DK2A 4DX5A 2W4PA 3KHLA 2YI7A 2HK3A 5I42B 2IM2A 2J6SA 3U2KA 2YKCA 2R7VA 4R5PA 4J9VA 4K4SA 3Q86A 1NKCA 4TYAA 4TXSA 2FJVA 1U1PA 5D3GB 1EIYB 3FRYA 3QIPA 1CQMA 1UJ5A 2YKMB 3NMRA 2ZOGA 1RT6B 3N5BA 3V6KA 2F7VA 2VG7A 3UN2A 2BSMA 4PQUB 4Z7YA 3OV7A 5DO2A 3U02A 4OZJA 1S9EA 4JV5F 1UA1A 2YPYA 3KK3A 2H9ZA 5I3UB 3DRXA 3ETOA 4L93A 4PZVA 1H74A 1L3UA 4F0KA 1PG5B 4ED0A 4OHXA 2V8PA 2BRCA 4E00A 1T3NA 2O5DA 4UQTA 3A3NB 3BH6B 4ED6A 3OR1B 1G7CB 1CULB 5C42B 3HLUA 2MQOA 3QTFA 5BJRA 2H1YA 1UVJA 1S9GA 5K5MA 2HHSA 2CQ0A 1ZA1B 1RABB 4ZPVR 3TZ5A 3E51A 3RLRA 4CLKA 3KHGA 2YEEA 1AH8A 5D6QA 1RP5A 2VBYA 2KM8B 1B4SA 5D4NA 3QRQA 4I68A 2FLPA 5D7CA 1M1GA 1TFYA 1BQMA 1SVDA 1IXMA 2PN6A 2V94A 3DOLA 4BIUA 4QPJA 3NGTA 1VBKA 2ZBKB 1JXLA 1YETA 2UXCF 2WK4A 2VKRA 5LL6d 2ASYA 5LOQA 1VLYA 3GV5B 4U7OA 1R8HA 3DRSB 2OEJA 2H8MA 3JSBA 4YR2A 4Y6IA 1BC6A 2R2UA 5DS7A 3M2UB 1NK0A 2UZAA 1T05B 1SL2A 3MURP 1VC0A 3MXHP 1FRMA 3LUYA 1U2RA 2YGAA 1U0ZA 4LWHA 2W4DA 1FKAF 3K58A 2JJ4D 2P9CA 4DOZA 4J9QA 1M5KC 4Y65A 3J80Y 3A12A 1HD1A 1RAFB 4K4VA 3U1NA 1T02A 2QMXA 2FHKA 1EHWA 4Q20A 3VAJA 1TVRB 4K59A 1Y9OA 5F8NA 4X9LA 1UWAA 4ED5A 2MDAA 1TTHB 5J1PA 2I0XA 2KJVA 3GV7B 4ZPAA 2YNHB 3MMCB 4PQUA 3AXKA 2HS3A 1DY3A 4PRVA 3HP6A 3TZ0A 3EZUA 3C2PA 4I5SA 2BQ3A 2HRYA 3ZZZA 5KFNA 3U1LA 4BBYA 2Y1IA 3R6LB 2B6AB 4FS2A 4CWQA 4H7QA 4Q2MA 3UR0A 2XSFA 1RBAA 3FQLA 1I6JA 4ZVSB 2CADA 3H8YA 1U49A 1N88A 2VG6B 2DNHA 2V8HA 3UCZP 1J2VA 2UU9F 1S6QA 2QFIA 2ZFHA 3P45B 5IFMA 1RE1B 3LPEA 1NDPA 4NI2A 2E5LF 3D2RA 3LAKA 3KNAA 4ID8A 4X4RA 4D3HA 3FBCA 4DDFA 4CH1A 1YI2S 1C2PA 1XJWB 5G4DA 4DV2J 3PW7A 3T2SA 1GXUA 2CWKA 3IGNA 4QIGA 2P5VA 2YWFA 5DDOC 4YP3A 4NZ0A 5I3QA 1NU4A 4I4BA 4R3MA 1IWGA 2MKYA 2V9KA 2FC9A 1YJUA 4BWJA 4HYMA 2QG9B 4DPYA 2BOAA 3GTYX 2B9YA 1VQ5S 5A76A 4GO5X 2LQJA 2C2ZB 2VPWB 3HSZA 2J7KA 1RYRA 3C6UB 5L8RC 1IQTA 1NB2A 1H7SA 4YY3F 1FRIA 5DQGA 2GJIA 5FD1A 4OX8A 2AEMA 3R5DA 2XCPA 1S12A 5F5RA 1TMJA 2B4UA 5BYSA 2XDSA 3LGHA 1HBNB 5JMNA 2CCSA 4ER8A 1A4HA 5J2NA 4J9PA 4X66J 1P9QC 1X4AA 2GHWA 1I5BA 2RH3A 1HMVA 3J80U 2YI0A 1SV5B 3BQ0A 4HR2A 1Y4ZB 3BQ2A 3PRBA 2C2AA 1SC6A 4H85A 2KN4A 4DWIA 4L74A 1YK9A 4EO6A 8AT1B 2XI2A 1FKOA 4L91A 2XABA 2V2QA 4KR0B 4NRTA 1U09A 2QFOA 1TL7A 4AUKA 3G6YA 3R5JB 1KVJA 2Y8YA 4PCQA 4CRJA 1U48A 3H2UB 1FRXA 3H2LA 1S10A 4RWWA 2W25A 2JX2A 3LP1A 2HVIA 1H2VZ 1D8ZA 2M88A 4WCEQ 2YWKA 3EVWA 3ZTRA 2XCMA 3F0NA 3OXLA 1ZM9A 1JLEB 5CD4A 2YWGA 2QLWA 2KFZA 2R7WA 1E6YA 3TTZA 4QW8A 4XKKA 2ZWOA 4EFTA 3N4WA 3AA8A 3HD1A 1EB0A 1X0FA 4URLA 1CS4B 1EZZB 4RW7A 2B4OA 2VODA 2C2NA 3LA0A 4F7VA 2QSWA 4L8ZA 3QGHA 2PO4A 2R7SA 4A8FA 4OLPA 3UQSA 3WDOA 2E0AA 1FX4A 2RVJA 2YTCA 1YQHA 3KUGA 2RE1A 2ZVSA 1IKWA 4V26A 3UD5A 4ASFA 4YHHJ 8RUCA 1CJVB 5HANA 3TUPA 3G6ES 4DSLA 2HVEA 3GIMA 5E0OA 3UNYA 2HQIA 4EYHB 3TEHB 2D9OA 1KHWA 4K5SA 2RNEA 2JDJA 1RDRA 4K8RA 1JWWA 4M5DA 3R2CJ 1ACMB 4A8XA 3T5HA 4B3SJ 3BGFA 3T5LA 2YE6A 1TK8A 2CJXB 4RNOA 5AE1A 2PMHA 1ZAVA 5FIIA 1KONA 4JI0F 2YK9A 3PZPA 2DNGA 1FKPA 1RHKB 4O4GB 2YNIB 1BQNA 1X5SA 2E1CA 3CD5A 1SL1A 1NDCA 3BGLA 3TA1A 1YIJS 1DRZA 4NA1A 2MQNA 5AE2A 5J2NB 5DDQC 4ILLA 4ZPCA 1R6YA 4OX9F 5LM7E 3H40A 2CZ4A 1DLOB 1KFDA 1RT4B 3HHUA 4X4SA 3OVSA 4IFVA 5HROA 4JAUA 1YZ7A 2JVRA 3AB2B 1US7A 2K2PA 4XE2A 2OMOA 3WIVA 4FYVB 2FLNA 3H7HB 1SIZA 4ZS6A 1KHVA 4F25A 3IC1A 2PGCA 2KU7A 3B54A 4ZVIA 2KJWA 1HNIB 5A8RA 3G4SS 3KLEA 2D1CA 1UA0A 4A47A 3SFUA 4BC7A 3KUEA 4GFNA 4HDHA 4F4AA 5IM0A 3I87A 4DR3F 2K7JA 2ZH6A 2LVWA 5KG2A 4OZ0A 3T5KA 3KWMA 4ES2A 5A2QU 2JH3A 1CJKB 3R5BA 2IIHA 4ELTA 1KQSR 3K5MA 5KFZA 3K5LA 3N28A 1GEHA 3M6VA 3W9IA 5JVGQ 2IHR1 1YC1A 1LV5A 1HBOA 3PW2A 3R6GB 4FPIA 4ZJLA 4X4PA 2POKA 4KGVB 4P74A 1DZ5A 5IWAF 3IFEA 5G0RA 2GS8A 2RB7A 4IFYB 3MM7B 2IYIA 2Y9HA 2QYCA 4YKTA 1QAYA 2GW8A 4HH1A 4CWOA 4O04A 9RUBA 1KQGB 3G9CA 4M94A 2AZ1A 2U2FA 4ICLA 3CJQA 3E01B 1KVKA 1OYEA 3TUJC 1Q81T 1VK8A 4YR0A 2CPFA 1SKRA 2GA7A 3HVTB 2BU5A 1MWZA 1WHVA 3CCZA 2I9SA 3Q8SB 4EGIA 3Q8UA 1NEEA 1IBCB 5K14A 4JI6J 1X9MA 4P2MA 3ET6B 3SCIE 1X4HA 2K06A 5GAEI 2XZTB 2XLKA 3MCOA 4K2JA 2JFDA 3V6HA 4PR6A 1I3OB 2HQ3A 4L3NA 4USJC 4DN0A 4KHPJ 3FZBA 1JLFA 3TP2A 5HQ8A 3MHYA 2DJWA 3D1QA 4ZLJA 4FCRA 3EE3A 2ILYA 2AGPA 2E9ZA 2MGZA 4G1PA 1N36J 4DR3J 2AGOA 4CNZA 3NEKA 3M8QA 2LA4A 4J90A 2Q8GA 4WFXA 3ENVA 1ZOTA 3DN9A 3F44A 3AQPA 4OL8A 2P6SA 1VQ6S 2XZWA 3ISND 2VB6A 5F41A 3R5AA 1MMLA 2RMLA 3AJ2A 3I5AA 3HPOA 5F8GA 4CE3A 3EGWB 5M2PA 4CM2A 2XWYA 3HJVA 1RHJB 4YKXA 2Y1JA 1FD8A 1SKSA 3DOMB 4NLQA 2CCTA 1PKUA 4DQPA 4UW2A 2GVDB 2HHPA 3M6UA 4LF8J 4KBIA 2EK6A 4ZP6A 3OHBA 3JSRA 5KFGA 4AQYF 1T05A 3IM8A 5KFRA 2IWSA 1T7PA 2FJEB 2YKNA 1O0PA 4CWBA 2OSQA 2V2VA 5A0YA 4LF9F 1ZZNA 3PFEA 1LWFB 1P27B 1QUPA 2X51A 2HNYA 3K98A 4EGHA 1CJTB 3IXQA 4NLPA 1TUWA 3EZ5A 2YKNB 2FTRA 5C93A 2UVWA 3W63A 4Q8FA 2ZDYA 1AM1A 4D3GA 1XMBA 5GADU 1RBLA 4ZVUB 4OJ1A 2IY5B 3MPWA 3IN5A 1FNMA 4BDPA 4USKA 4URQU 2KXNB 1WG1A 2FVQA 2BREA 2ZHBA 4LF5J 4FBUA 2H55A 4IG0B 1XMQJ 2DHSA 4JYAF 1GK8A 3MPDA 2YEBA 3GCXP 4ZVEA 1QY7A 5M2UA 3Q24A 2YKIA 2V8DA 2CQIA 3HULA 4U96A 5D78A 1UYFA 2VBXA 4IQXA 5L1IA 1U0HB 3G71S 1T9WA 2X1GA 2QL7B 3NWGA 4YB6A 4ZVFA 4HTIA 5GAGI 4PPZA 1UTAA 1IBLF 2H4WB 2ZOFA 3H5SA 3UO0A 2CQ3A 2VG5B 1XEZA 3HZ5A 5J2QB 4QYZJ 2MEWA 3N79A 2B4VA 1RHQB 3R97A 4G6VB 4LR7A 1IQZA 4FPPA 3ZZOA 2HWTA 1I94F 2UVRA 2A6OA 2GMHA 4I6AA 2GAGC 4PUOA 4DV7J 4UF4A 2AJQA 1MSWD 5B08A 3T0HA 4NXMF 1YBUA 2FLOA 2EEYA 3C16A 2YWWA 1T0TV 1YBTA 1G3OA 2WRMA 2HS0A 4NEZA 3CJRA 1TL1A 4X65J 1JXEA 1WSVA 3FEXB 4OV1A 3M2VA 3O0IA 2IAJB 4P6QA 4GEEA 4PXEA 4KV8A 2HMIB 2GHPA 1ULRA 2HWIA 3CGZA 5HI7A 1Q7YT 1R6VA 5F0WA 5G0RB 1RT4A 4ZJQA 2F3JA 4USIA 4MPNA 2IA0A 1NPPA 2HVHA 1TK0A 3DRRA 2VA3A 5CAAA 1QVGR 3KLHB 1S1UA 3W2WA 3WQPA 2B9WA 3CIMA 3RBDA 1KLNA 1LWEA 3I0RA 4DSEA 1NDLA 3CCTA 4KGXB 3R5CA 3UNGC 2CPDA 4DU7A 1WNEA 3KMQA 2F8MA 2XGQA 2E5JA 1ZPVA 4IQMA 1C1BA 3JSMB 1B7FA 3RZAA 2YEJA 4LF7F 3MGJA 3QAEA 2VQFJ 2Z56B 5J2MB 3OTCA 5D7RA 1YRTA 1LK5A 1SJ1A 1WKKA 4KPYA 2XDXA 4QWEA 2CJKA 5LT5A 3UD4P 4B3RJ 1U6FA 4OYPA 5HVGA 3KFWX 4MKAA 1ROFA 1VLOA 1U1QA 3H42A 4YB5A 5C24B 5EN1A 2C2RA 1WEYA 2LECA 1DURA 4PRXA 1NK9A 3DLKA 2N3LA 4MB9A 5LJ5Y 4XC0A 4DV4J 1C0UB 2ZM6F 4IDKA 3GZ7A 4ZCLA 1TL4A 3K2YA 2JWNA 2GO8A 3PV8A 2R8HA 3PHTA 1UEVA 3C0EA 2R2RA 5LXYA 1UETA 1I59A 1VQYA 1X4FA 1RT3A 1DQAA 2NXCA 4P10A 3LP2A 4QWCA 1ZM3A 2ZJPQ 3CVKA 2U1AA 3MCMA 1UY9A 2XHRA 1MROA 1T9TA 3EKRA 4MPCA 5FDLA 4XDCA 1VGYA 2J9CA 3CULA 2YY3A 4ES1A 4DR6F 4LREA 1B0PA 4HHHA 2XMVA 4L3KA 4Y0FA 4WWSA 2FJBB 4PWWA 3GIIA 2QC3A 2ACYA 1H2UX 3HDSA 5LMUJ 2WI7A 1KR4A 5RUBA 2NPFA 3SDEB 4J37A 5HP1B 1SQEA 2HRTA 2NXJA 1XMOJ 1QSYA 3EDRB 2YH0A 2DO0A 4TU7A 1VISA 3WQ9A 3DYAB 2O66A 1RWXB 2VDIA 2ZH7A 2YPZA 3FUYA 2BJ8A 2DXDA 4O44A 4I6YA 3H90A 3KHRA 3RTVA 4UY8T 1T3OA 2OEKA 1MN9A 2OI2A 2ALYB 2LXFA 2KXHA 4NCGB 3MEDB 1RUSA 1V3ZA 4OHWA 4E0DA 2HHXA 4I7FB 4NLUA 2AJ1A 4K0KF 3MR7A 4Y3CA 2ROGA 2M9KA 5CCLA 4F50A 3BR8A 4WYLA 2XMKA 4H81A 2W9CA 1YJNS 4XIQA 3MMAB 2B51A 2F4VJ 3NWRA 2ZBRA 3AD7C 3W7BA 3DDIA 2CWXA 1KQKA 2FJWA 4NLVA 1NSQA 2ADCA 1N33F 4XPCA 2CJ9A 3MCSA 1SV5A 4GVBA 4NOHA 1FRHA 2V63A 1HQEB 1XERA 3QGPA 4ZPTR 2WI4A 2LP4A 1NK6A 1MG7A 1N4LA 2JEJA 1RCXB 5ETSA 1HBOB 2RQCA 3KNGA 4Q5VA 4XIUA 2DEIA 3CRLA 1HBMB 3ZO7A 4L94A 3DLJA 3WZ0A 1RLDA 2WAQD 4NLOA 1UPPA 2UXDJ 3WC2A 3HF5A 3L9ZA 1KTQA 1NSAA 2Q8HA 1T9VA 4LUBA 4ICLB 4WKYA 1N34F 1JB0C 4GVLA 2ZH8A 3B6BA 3OTEA 1GMUA 1REVA 3UDVA 3DDKA 2EFVA 3CEDA 4BQGA 3LNUA 2AYGA 1UYEA 1T9UA 5IC6B 3OXGA 4PG6A 2H51B 2MLXA 2KKHA 1S1UB 4WTYA 1TV6B 3WHAA 4ZP9A 4HLBA 3L95X 3VGUA 5ADZA 3C15B 3OTDA 4F0MA 2YJWA 5IC4B 2WONA 2R8GA 3DLLQ 2XS7A 3JAMU 4NLYA 4PWDA 1B0TA 3M32B 2HRUA 1X5OA 1PAUB 2V5HG 3FMBA 2VFUA 5I4MA 2OFHX 3UVJA 3DRPA 3PYGA 2FWYA 1VDHA 4DR1J 1SJ4P 1IBMF 4HYPA 1R0BG 1WC4A 3HD2A 4EBDA 2YKAA 4FYWB 2VFRA 2ZJQQ 1HR0J 3H0PA 5KFKA 4RW6A 5CYQB 3OUYB 4UUWA 4QBUA 1YDLA 1Z4UA 1VOMA 3OLBA 2YKEA 4C3MA 2HVDA 2UVVA 2E9TA 1B3TA 3I31A 3KLHA 1XBWA 2PT0A 2VOOA 5BYRA 3ISZA 5L1JA 3BBBA 4DJBA 3DFEA 4ECRA 1NJZA 3I5CA 2M3DA 4IG0A 2JKIA 3SI8A 1Q16B 4LR9A 4PG5A 4I2QB 1RWOB 2IM0A 4DPXA 2BRLA 2RDJA 2DH8A 4C97A 2HLTA 1IKVA 2HPUA 2EFNA 3I5BA 3SCKE 3T6BA 4C8NA 3Q2TC 5B09A 1FRJA 1UY8A 4F2RA 4N47A 4CLPA 5E33A 3MEDA 3QT6A 3U1MA 1HHQA 2DGUA 4CWSA 2PDAA 2M7SA 1I5DA 3M1VA 5AJ3F 1SQGA 1HWJA 3LPSA 1THNA 5D6PA 4N8NA 3VADA 4DL5A 2YKQA 3IR5B 5L39A 5CCMA 1HW9A 2XMUA 3T6JA 2NXNA 1VQ4S 3ZZUA 4IDKB 4DF8A 2QA1A 1U24A 3HHNB 4YEAA 5GMEA 3DYAA 3MPVA 4NL5A 5M4KA 3PIOQ 1TZ0A 4BS2A 2DRAA 2DXFA 1IBKF 2R7RA 4ZITA 1NM2A 1RWMB 3EWGA 1QSLA 1ZZFA 4AE5A 4U93A 4WU3A 2W24A 3AAWB 4CWFA 4G1QB 3CCQS 2FYPA 3GYXB 4NCGA 4DX7A 2GJ2A 1F6TA 3A3PB 1TC0A 4P7TA 3L7OA 4AL6A 3K57A 3HZ1A 2AKWB 1NZ8A 3E01A 3M8YA 3VZIA 3D1HA 2LQ8A 3K99A 2B5JA 3WX8A 2FVPA 4OI3A 3TOQA 1YTYA 3HSJA 4QQBA 3TZXA 1FKOB 4KQZA 2BKOA 3MOJB 4P2FA 4OX6A 4GVBB 1PC5A 1FFSB 2L08A 2HS4A 1OPZA 2B5JB 3A0WA 3AOBA 5KFIA 5HMZA 1CSJA 1LFWA 4CWRA 2ZD1A 1KRPA 3VHAA 3T0ZA 2O1WA 3OR2A 5JXSA 2L9DA 1TV6A 1S1TB 3EPIA 3JQKA 2DXEA 4WP9A 1F5AA 2HGLA 3JTPA 2GIRA 4QIFA 4ECSA 1D09B 1RADB 1VI7A 1OYDA 1OSFA 1KFSA 1BQMB 1E6YB 3GCWP 4DFKA 5C7PA 3I9ZA 4YB1P 4YB7A 1RT5B 3PO5A 2V4JB 1MLAA 4J5OA 1L3VA 4FYDA 1RBOB 3QDDA 1JLCB 1AROP 2AGQA 4JASA 3MR5A 2FIUA 1S97A 3GFHA 4LRDA 4ECUA 1F5CA 2COLA 2UUBJ 1WORA 3FBEA 3E3XA 3Q89A 4MKVA 4OI0A 4B7PA 1RWKB 3GP9A 3MAAB 2GQCA 2HHHF 1DTQB 3FK4A 5DG7A 2RT3A 4S0MA 4LWGA 5HBMB 3V81A 2HAIA 2KRRA 1PSDA 2AEJA 3K5NA 2OP5A 3QSYB 2ABYA 3OFEA 3CGYA 1TVRA 1P1LA 1BHNA 2M8HA 1YG0A 2XMAA 5LMNF 4V19J 4H54A 4LBPA 1UYMA 2X1FA 3CC7S 3UCUP 4NEYA 2Q8IA 3A8IA 5C42A 4Q8EA 3RU0A 4JI7J 3ZZ0A 2XBPA 2LU1A 4FF3A 1FJ7A 5DG9A 4MYUA 3R4PA 2E1PA 4LVNP 4AWQA 2JZ5A 4F4YA 1AMWA 4PG4A 1OWXA 2C28A 4OZ2A 2UUTA 3K8VA 3CCSS 3MEEB 1RGVA 4ASGA 2EK1A 3SQGA 1FNXH 3CC2S 5HLFA 1Q53A 4EBEA 4O23A 3DM2B 3H80A 2V9WA 3R3TA 1CJTA 2FHOB 4BLGA 3QYYA 2E7XA 4AL5A 3D7SB 3PW5A 2OPSB 2IMWP 4M5LA 2KDOA 1VRUA 2MZSA 4HY1A 2JVOA 2LXUA 4USVA 5D7DA 2VKZG 2HIYA 4N5SA 1MU2B 4MFBB 1UYGA 3D1OA 3MM8A 3QZ7A 4OFZA 4AWOA 2BX6A 4M5HA 1YERA 4GC6A 2VG6A 3PX6A 4ECTA 1TUVA 2VPZB 1X4EA 2HFZA 3LP0A 3ADAC 3CMAS 2XMWA 2ZH5A 4F4ZA 1YSZA 1MWYA 1KVIA 1S7HA 3UWTA 4J9KA 3NS6A 4CT8A 2HQGA 4HZ5A 1WHWA 4F67A 3P8BB 1J5EF 3VTIA 2A6MA 2QYGA 3HHLC 2BXJA 4V19X 4J9NA 3UDCA 1ZETA 1KP6A 5I42A 4CYUA 2DIVA 5HN0A 3MF5A 2UVUA 3ILIA 5DDPC 1TL5A 1YBAA 4HT5A 3DXBA 4LSLB 4KFGA 3L7UA 2YQ3A 1N6QB 2E7VA 3DC2A 3PG9A 4Q0BB 2OD6A 4KP4A 1LWEB 6AT1B 5IWAJ 3Q5JA 1NZAA 4OI6A 1U8SA 3A0YA 3MM9B 3KK3B 3D6MB 5HVHA 4C8OA 2IM3A 4H4KA 4HT7A 1CJKA 2DKOB 3QRPA 4PQAA 4P75A 3LOUA 4RNFA 2V68A 1DAXA 3TQ1A 1FEHA 4DR4J 3M9MB 2KFYA 2Z0GA 3E2EA 1NB7A 4JI2J 1PYOB 1RACB 1RT7B 4DCOB 2HGMA 4P71A 2WBRA 5K20B 3GJQB 3SQGB 4C0OC 3M6WA 3GR1A 3MM7A 5ETOA 2ZH1A 1UWBB 2CJBA 4L6V3 2QFJA 4TYBA 4CO4A 1WKLA 3NOGA 5KAKA 3GB0A 3DMJA 4OYWA 4DSIA 2YE9A 4ZIVA 4KHMA 3K8WA 1YZ6A 4URNA 3PJXA 2RKIA 1H38A 4I64A 1YRXA 2WW4A 2ZBQA 4KH0B 3FEYB 3IS9A 5ETMA 4CCHA 4ZPDA 2K1RA 4LFAJ 1K1SA 5AXNA 4DFPA 3MAHA 3H5YA 5CTWA 1RSCA 1UYDA 2HHIA 5K14B 3DKDA 2PMZD 1QSSA 3VGTA 3TX0A 2HG1A 3SIPB 2ZITA 3M2VB 1NJYA 1FI4A 4DXLA 3W5ZA 1W25A 2YKOA 1RISA 4MPEA 2H65B 3EJMA 2DR8A 3TJ9A 3ILLA 2EC0A 5KFJA 3MM5B 3I0SA 2BDPA 1BKNA 3EX7B 1KNZA 2GGPA 2XMJA 1X9SA 5HLFB 4JV5J 2W8LA 1L3SA 9ATCB 2YX4A 2YEHA 2J8SA 2M4MA 2DB1A 4R8UA 1VQNS 3RBZA 4MAKA 3RGIA 2G13A 2MKSA 1WKJA 2LFVA 1UPMB 2UUAF 4GMKA 4EFAC 4FBTA 4YFUA 4F3QA 3MUVP 3NNCA 2XLJA 4IH5A 1NJXA 4E2FB 4KFBA 3BKFA 1FVSA 1VR6A 2C2DA 2BKPA 1HNIA 2OD4A 1V3SA 2ROPA 3K17A 3M8RA 1N52B 3UW1A 2QLBB 4X62J 1NHKL 1QE1A 2VFVA 3IWLA 2Z4PA 2XJGA 1VJQA 3CB4A 3RYLA 2XYPB 2KT5A 1UVKA 2X7IA 4NLGA 1PIEA 1UVNA 4ZA1A 2W8KA 1WC3A 3IA0A 3BMYA 3J81j 5B0GA 2JHEA 3Q8PB 3LTOA 1BWEA 3BO4A 2KVIA 1XMQF 2B9EA 5D0GA 2VC0A 2BU7A 2CKWA 4ZKIA 4DR2F 2JLFA 3KK2B 1MNEA 1U6BA 1D1UA 5BOCA 2CG4A 4DV4F 1YS3A 2XI3A 1F2GA 3MEKA 5K8PA 1S14A 5FJ4A 1X0PA 2ZNYA 1YGYA 2DY9A 4ATNA 1G1XA 3ZNJ1 3OXFA 3WBZA 5B0DA 2C1GA 2HBRB 5D4PA 1VQSA 2CVEA 2XK2A 4I69A 3HYYA 3KJVA 3HZEA 1CPZA 4B3MJ 5FWKA 2EPIA 3BGRB 1PBAA 4DSKA 2DGWA 2HYIB 2XNRA 1WC5A 2BJ3A 1SJFA 3SBMA 1S9GB 5D3GA 4X64J 1H2TZ 3RW7A 2KM8C 2J0WA 4M95A 4XTJA 4P8OA 3NKYA 3MDFA 1TKXA 2QTWA 5FLXU 1WELA 2P6TA 1VRUB 3B24A 4ZVPB 3B4MA 2UV8G 2LEPA 3NCQA 2EXLA 3BPSP 3RRHA 3TANA 2R7OA 1NPKA 4RBTA 1NRKA 2RRNA 4HACA 3AXMA 3KOAA 4F3MA 1XMOF 3BQ1A 4GKKF 4W90B 2IRXA 3D4JA 3M32A 3W1YC 1LQ9A 4BWMA 4RUCA 3FFIA 3UDEA 2IAJA 5KFBA 1U1KA 5F8JA 1WTBA 3ILJA 3G96A 4ZVHA 2Q3PA 1I1GA 1OQ6A 3NBPA 4GT8A 2CYYA 2VQFF 1BWVA 4DX8H 3D3CJ 3W60A 1H73A 2CZVC 5ETRA 4MKBA 2FY8A 3TVZA 2FVRA 4ZVTB 2EKYA 5E3QA 3QGGA 3NP5A 3VAHA 2BOPA 4O3RA 2OELA 3FCWA 4A4JA 3NS5A 1NDKA 4ZN1A 2YXLA 3PFOA 2JEIA 1HNWF 2XDUA 4DUYJ 5K8NA 2A2CA 1S0VA 1DHMA 4N41A 3IRXA 1U4BA 3BN4A 3GILA 2R8KA 2XJJA 2QO3A 1HFEL 2KI2A 4PG8A 3PTWA 5M4PA 2EVZA 5E3AA 1XC9A 3KK1B 4CM0A 2FTKA 1Y5IB 2XWXA 4KO0B 5HL7Q 4DUTA 1PYTA 1EP4B 1KOHA 2VPYB 3R1HA 3THVA 4HY6A 2DH7A 3H4BA 3DLBA 2RQKA 2DR6A 4JV1A 4YKRA 1FDNA 2ZC3A 1SXLA 3FT5A 3ET6A 4KY3A 1V5VA 4O3NA 2O67A 2KH9A 1C0TA 3ZXWA 1Y3JA 4JI1J 4TQRA 2YJXA 2VU5A 3L3CA 2WI2A 1APSA 1K0VA 1WJ9A 3DI6B 3FSYA 2MKKA 4KSHA 2ZH2A 3CCVS 3C14A 2CPXA 4DR7F 2MMYA 1FE4A 4B3TJ 2GX8A 1Y7PA 3PW0A 3DOLB 4F4KA 3DLHA 1B62A 1FT8A 2IJRA 3AH6A 3U7JA 5KG7A 2JEGA 3TW0A 1M90T 3CJTA 3UE2A 2O3DA 3ICLA 5DQHA 1UW4A 1E6VB 4RJVA 4Y34A 5KT3A 1XR7A 4OYMA 5FNDA 3V6JA 2X3GA 1S57A 1UMJA 4O44B 3J7YU 2DRBA 6FDRA 1HBUB 1UJ6A 5IQQA 1KN6A 1IM4A 5T14A 4KAIA 2QZ8A 4LT6A 2F9DA 2RQ4A 5B0EA 5IT0A 2CG8A 3G87A 3M9NB 4ID5B 5KG4A 2QL9B 2VBWA 1RTIB 3W61A 4DV0F 4IFVB 2X1BA 3BO3A 2OH2A 4B6CA 4YHHF 3ZXQA 1EKRA 4FP9A 4Q0BA 1S9EB 2M52A 4R8UB 4E98A 4Y2AA 3MFHA 5I3UA 3LANA 4DZYA 2BYCA 1HPZB 2DGQA 4QR2A 1UFWA 2I5JA 3R2DJ 5F8IA 5J2PA 4Y2IA 2DISA 5CXTA 3PM9A 2YK2A 4N8OA 4ZN3A 3I4HX 4KGKA 1HNXJ 2V4JA 3OL6A 5GGZA 2OTLS 1EETB 1UP1A 3SYZA 3BM9A 4ECZA 3S8SA 4Q2LA 5IDJA 4F0HA 2R7UA 1UJ4A 4WE1A 1ZTTA 4PABA 2XB2D 1RT6A 4OI4A 2HKJA 4OYZA 1U2OA 1TL3A 3ITHA 4PG7A 4PKDB 2GCFA 1U25A 5C24A 2H54B 4QZVB 5KTQA 2MQPA 5AJ3J 4LF5F 4HTJA 5CH7B 2J8AA 2FZCB 1OS5A 4URGA 1Y8PA 3TZ2A 4PL9A 2XQCA 3P5TL 3D67A 1N5SA 2XO6A 1ZYQA 2HZVA 5KT5A 3B25A 3LF0A 3CWJA 3G82B 2HBZB 2NREA 2ZBPA 4AXJA 4DL7A 4NLDA 2RF2B 2WI5A 1H98A 4DI6A 4B3OB 2MGZB 2NLWA 4JI8J 4TNOA 3HO1A 1TC6A 2WI1A 5EWFA 4PWUA 2JRSA 4CLFA 1VC6A 2B4PA 2EBGA 2J0QD 3QIDA 4B9UA 1HW8A 2JJCA 3KLGB 1FWKA 1HBUA 2ZM6J 1RWUA 2ZUAA 4C8LA 4F4WA 1OJ4A 1WC6A 3I6PA 3S1TA 4USHA 2FYXA 1WSRA 1RAIB 1PO6A 1FERA 5HQLA 1JLFB 1AB8A 2CJQA 1PJ6A 1VQPS 5EDWA 2K8GA 3I9V9 2ZDXA 4X84A 4LWFA 3AY0A 2YNFA 4OHYA 1FKPB 3CO0P 2VZ9A 4USUA 2VJVA 2G9OA 1WTFA 2ESAA 1V6HA 2IPOB 2QA4G 5T41A 3NOCA 5KOWA 3A0RA 5K9FA 1RT2B 4K4WA 2F8HA 3M8SA 5HO4A 3I32A 1D8YA 1C1CB 4B9MA 4DV3F 4M63A 2FZKB 3LAMA 3CDWA 2B7CB 3UFCX 2QLXA 1RQ0A 5KG3A 1CEZA 3DOMA 1U45A 2BZ5A 5HQMA 2YVSA 1S77D 4DL2A 1XNRJ 1S1XB 4WUCA 3GG0A 2ZNZA 4QPTA 3Q8YA 2XDLA 2W2OP 3DCAA 3VAGA 1S0OA 3N6LA 4ECXA 1YT0A 2FWZA 4LRAA 2CCUA 1CVJA 1MMDA 1L0OA 3V81B 2IVYA 4NYOA 2R2SA 3UN5A 3CSKA 4WE1B 1T95A 2ZZNA 2UUBF 2PC6A 2ZZTA 3GONA 1UYCA 4CLYA 4QW9A 4RUBA 1PJ7A 2WOMB 1UVMA 1IR1A 1KQFB 3FSIA 1S9FA 1TR0A 4XDMA 1FFGB 3CJ0A 2LU2A 3C3LA 5L9XA 1HYSB 1IVZA 2MHEA 1ZAWA 1N0VC 1PAEX 2ZC4A 3VZHA 2XG8A 1B63A 2OJ3A 1LXNA 3RUBL 3RBEA 1RCOB 2CG9A 3CW2C 5GAHU 4O3OA 3FJ2A 3IBWA 3W62A 2BU6A 2A18A 1NPRA 1RU1A 3R7NB 2VHGA 2DNNA 3H5UA 3JYTA 2IM1A 4N77A 3LWMA 2HZAA 2YGEA 5L1LA 2D3O1 1REGX 1R62A 3GMGA 4WK3A 5DDRC 1JNZB 3KJFB 1NUEA 3PYDA 5KFFA 4IRCA 1QAXA 2OPRA 3MFIA 4DV1F 5KG0A 4DR6J 5DLFA 1JLAB 1JLCA 3SFGA 2HHUA 1FWLA 3HT0A 5E41A 4WK1A 1RWVB 3OTOF 4GKKJ 2DITA 3J7AN 2E66A 2W7AA 1UKUA 1GJVA 3P5BP 2EFQA 4DEZA 5J1EA 1AUDA 5L3JA 2FGCA 4RUAA 3J7ZT 2O1VA 1WC1A 3ZNUA 1VBYA 4DSJA 2HIQA 4NYPA 3TO8A 1R31A 3DXSX 3HK2A 3CJ8A 1Q82T 1PJ5A 1VQ8S 4HI1A 1N8RT 1GH8A 4USWA 2NSCA 1OIAA 4PXBA 1SH0A 2WVCA 1F3FA 4LSZB 2O1UA 2AJ4A 4DUYF 3DU5A 4DU8A 3P49B 2YWHA 2BV3A 2DGVA 1I94J 3BO2A 1Y4UA 1GMVA 4DV7F 3DGPA 2JC1A 2DHGA 1Z59A 1HR0F 4WUBA 3MMCA 4ELVA 3QJJA 4QPXA 2XCAA 2YECA 4OYXA 2MQ8A 3KKFA 1BQNB 1SC4B 1EETA 4Y2CA 4WYWA 1X4CA 3EGNA 3HHEA 1S72S 4MP2A 2GO9A 2K5BA 1HLWA 1X7VA 4H4MB 2GHVC 3EYZA 3C8YA 2GIFA 4ELUA 3AFGA 3AHPA 2AJ2A 1LWFA 4LIRA 4RLEA 2FZGB 4ECYA 4LQ3A 1J5OB 2FC8A 2MYFA 4KJIA 1N5YB 4RUHA 4PYDA 4ILMA 5DZ6A 1U26A 1ZM4A 1BMQB 2B56A 2BW7A 3DU6A 3MM6B 5ETVA 4WKRA 3HYZA 1Z2LA 2V34A 3RG6A 1PILA 2ZWPA 1C4CA 1I51B 5L38A 3PEJA 4DPUA 3S7RA 4M5DB 4GC7A 2UUCF 3CMQA 4K7QA 5HVFA 3T1AA 4C8YA 2DCUB 4YDXA 2K3IA 4OIXA 2HNDA 4WIIA 4W98A 2XX2A 2XULA 4OHZA 1NK5A 2C42A 4MFBA 5KFUA 1HA1A 4X4NA 4O05A 1ZS6A 4LF2A 4UOFA 3HZGA 1S99A 4XCLA 2B43A 2GFFA 1ZXMA 2V4RA 1AH6A 1YWXA 3D0GE 3RR8A 4LFAF 3ENWA 3GU0A 3KJNB 1RWPB 1H72C 1NSPA 4URMA 4NRUA 1U0SA 2CPIA 3DLGA 5A8WA 3CE8A 3K5PA 2OUGA 4MBCA 3JSYA 5JENA 3O2IA 1H3DA 2QMUB 4Z37A 2HBYB 1H7UA 2CPYA 3QBCA 1M5OC 4WP3A 4ED4A 4Y2KA 4JI4F 2BM0A 4LMZA 3A0XA 2MHNA 2BABA 1U1NA 2NUUG 3PR5B 4O4GA 3I0RB 2R7QA 1YSRA 3CYGA 4YKUA 3M4XA 3OT9A 3SV3A 3FBBA 3RAQA 4LSNA 2RJZA 2ERRA 4FNIA 1UYHA 1JM6A 3D66A 2D3OR 5KT4A 4G1IA 2GMLA 5KFPA 2M8DB 2J9DE 3OLAA 1HBNA 1EKSA 3A3OB 2ILZA 3V6DB 1TK5A 4YDDB 4WIQA 1JMTA 3SZ2A 2ALZA 3CCUS 2DGXA 2WSCC 5ETPA 1BXNA 4CQ1A 4RW8B 4K50A 3TUZC 2AMCB 2AWZA 5CPHA 2CAJA 4LIWA 2JEFA 4FMTA 1UY6A 4JI2F 2EW9A 1LW2A 2CDRB 4Z2XA 3SQOP 3H2VE 1RTJB 2QA2A 2KHCA 3K89A 3TX8A 2ATLA 3US5A 4RW4A 4NWBA 2NQPA 1BQXA 4ED3A 4I56A 3CCWA 5AT1B 4QYRA 3QO9B 1D9FA 2VF3A 4FN5A 3U2DA 5HJXA 4OX9J 3RLPA 2QN6B 3HEKA 3J81Y 2DTJA 1HNVB 2WB1D 2LEAA 3HXMA 2VWCA 4RW6B 2ZKTA 4RNNA 3QZ8A 5CTUA 3KG4A 3QO9A 4K0KJ 1V5IB 1W7WA 4U67Q 3T10A 2J7WA 2QRRA 1FTCA 4GCZA 2XSJA 3G75A 4DUZJ 3BBFA 1YT2A 2BJ9A 3QFHA 2PEBA 5E2QA 4DBQA 1K44A 4B3MF 2IBOA 4K2XA 1XQIA 2KT2A 2IRYA 2XDKA 1W26A 1TP7A 2CQBA 2QIFA 2VICA 1BGXT 2XJXA 4F02A 4LFBF 5C5JA 2QLJB 3B26A 3SSQA 2C3UA 2GV1A 2ZHAA 3TI0A 1VQKS 1Y8NA 2IA6A 5J2MA 1RKJA 5CYMB 4LSNB 3IMQJ 1HI0P 4AT1B 3AD8C 5AE3A 3O44A 3FQKA 5IQ6A 1YHQS 2W1BA 3AA9A 4X4OA 1S6OA 5J2QA 2R7TA 1A7GE 4IYQA 1HQUB 1RAHB 3EGVA 2FQQB 1R8CA 2HNYB 2QA4S 3BSOA 1FXRA 3EZOA 3PX0A 3S6EA 1IBLJ 4LWIA 4O09A 4F4XA 3ZKDA 4I2QA 1WOOA 3ZZYA 4ETXA 3CC4S 3M8PB 2V67A 1UZHA 4FF1A 2VJUA 3QATA 4YMEA 5FLXY 4QIWD 3KLIB 2FDNA 1U1RA 1JJ4A 2A10A 4N56A 4OZ3A 3RRGA 3TZWA 4JI3J 3OWDA 4UROA 1IXKA 1BE4A 4ZVOB 4N76A 3TARA 4LFCJ 5F8HA 2YH1A 1Q78A 3C19A 4WXWA 2BE9B 1S1VA 5IT4A 3MMAA 1LFPA 2VC1A 3OR1A 3VAIA 2JL9A 2YNIA 1LKZA 2WVEA 2YE3A 1R43A 1YC4A 2RILA 4A8QA 4C8MA 1HWIA 1AUSL 4M5GA 4MIAA 2HZCA 2R3VA 2R2TA 1X5PA 1OY6A 3AOCA 3LQVA 4C3LA 1RHRB 2HQCA 4PAAA 2B9XA 4LP0A 3TZ4A 2HG4A 4ZMMA 2VH7A 3BS9A 2YE4A 4IRKA 1T8EA 5ETNA 3MR2A 4F36A 1NK8A 2ADBA 2JSXA 2Q2EB 3SL2A 2J9EA 2PSZA 1NXIA 5J1EB 1B3QA 3EHGA 3RB0A 2ZBIA 3Q5LA 1JJCB 1N5TA 4NH9A 4DR4F 1TL1B 3IP0A 4EU0A 2AW0A 2H48B 1O6XA 2AJFE 2APOA 2YX1A 2Z2YB 2A3JA 3SMZA 5IXUA 4QJVA 2FHJA 1WF0A 4A8KA 1SIWB 1IKYA 1GX5A 1F5BA 1PYSB 2H5JB 3HFVA 2A2DA 3CD0A 2V6AA 3W2VA 3PRVA 3HFZB 1VRTB 1TIDA 2PEHA 1CBKA 2BT0A 3BREA 1UYIA 3QLHA 4U8VA 3M2RB 4JQLA 2CPJA 3PHEA 3M8WA 3VAMA 2YI6A 1TKTA 3CD7A 5GAGU 4M1KA 2OPQB 2J0SD 3UCGA 1HPZA 1QD1A 2JNJA 2VL1A 2CJYB 4LRCA 3FCVA 1U1LA 4R3AA 2W2NP 1RTZA 4AYBD 3RB4A 4Q7AA 2WZ1A 1NKBA 1GNKA 3HKZD 2KHDA 3EVOA 4O0IA 3N01A 4HHJA 1HNWJ 1A6LA 2CQPA 3SCLE 1ZAXA 2Z57B 1VHFA 4UOHA 4ZVQB 4KKOB 3RJMB 4B17A 4DV5J 4C0BA 3LO3A 4FXWA 3JS9A 3SSRA 5LSRA 3GFYA 2P9GA 2G0CA 2DH9A 4ZOSA 5C25A 1VQMS 4NYZA 2I2YA 3IAM9 4MK9A 2XM3A 4LRFA 2ZZMA 4TY9A 4FNHA 1QE1B 2ASJA 2YEIA 3CO9A 1M5HA 4GKJJ 5ETQA 1FVQA 3G2XA 3KYLA 4TLQA 1D9AA 2NUHA 3Q22A 3KG1A 1JLBB 2Y0SD 4KO0A 3TA0A 3KMSA 1UEUA 3GLJA 1VC5A 1JQGA 4HI2A 3CJ4A 2C3YA 4EK2A 2HNZB 1G2EA 3OW6A 4DQRA 1D9DA 4P73A 1HWUA 1NH7A 3PKMA 1YVFA 1S7IA 3BDPA 1LWXA 4JI0J 4NA2A 2QX0A 3CGIA 1X8DA 4WTOB 1SJ3P 1EARA 2D7SA 3JTNA 4KC5A 2NXUA 4ZP8A 1S76D 1TAUA 4JOUA 4DL3A 1T11A 1TU0B 2F40A 3B28A 3NCRA 2GVZB 3HHLA 5DRKA 1HQEA 2CQCA 4KIAA 2MZRA 2WB4A 1FJGJ 1CQNA 2D41A 3M2RA 1GQEA 5CTXA 5EUHA 5BXIA 4QCLA 1ELOA 1GFWB 3GJSB 3IBFB 2QV6A 3TUHA 4ZPBA 2Q8FA 2CQ2A 2DT9A 3A0ZA 1F9EB 4NA3A 2MXYA 5EGYA 1IM6A 1CJUB 1JLQA 3NGKA 2V50A 3HHLD 4RU2A 4OZNA 3DOKA 3Q0AA 4UUXA 1G6BA 3KLEB 1URNA 3OQ2A 1B7YB 3C6TA 1FXLA 4UOGA 1O8BA 2DHHA 3FKBA 5HJYA 1TILA 1XNQJ 1JLGA 1TBWA 3RR7A 2VCJA 3BBCA 2XC9A 3ILOA 1SQFA 4GKJF 1RK8A 4X64F 1GT8A 3ONQA 4KKOA 3A1YG 5IT9U 4EMVA 3M7VA 2YEDA 4U95A 2F1FA 4TY8A 3PJ9A 3JYTB 4Y2MA 3TJ8A 5ETTA 1QM9A 2BKNA 4P9SA 2VONA 4K4ZA 1WEXA 1M5SA 2BUNA 3MTKA 2L9NA 4XITA 3ZZTA 4ED2A 1LK7A 2XS2A 4FF2A 1ZW9A 3T1YF 3GPAA 3GYGA 3TAMA 3HMJG 3BZQA 1R8AA 5DG8A 5H9EJ 5CZXA 3LWLA 4UTGA 2MZ1A 1CC8A 1TKZB 2E44A 4LR8A 2QG2A 2KZMA 1U2FA 2IWUA 1GX6A 3H4DA 2WCXA 3QAUA 2I1RA 5EWEA 5MLCV 2L3MA 2DNMA 4KTQA 1TKZA 4ZKAA 2DCLA 3ZZRA 1MN7A 2N7CA 2EFGA 2R9LA 1VYAA 4NLSA 3P96A 2BJ7A 4IR1A 4DS4A 4ANCA 2ZBCA 1Y0HA 4DUZF 1N5QA 1QVFR 2SXLA 1J5EJ 4DPTA 3EHFA 1NSKL 4OJHA 2NZ4A 2MZJA 4IRDA 1FK9A 3C15A 1RKIA 2CNLB 3J81U 2PMWA 5M2RA 3AB4B 5E3CA 2F8EX 2HWHA 2VCIA 3M8QB 1CULA 1RAGB 1YT1A 4NPOA 5A8KA 3OL8A 4GRSA 1OY8A 5H9FJ 4KHRA 4C11A 4Q43A 4O0NA 2XZDB 3DOKB 3KG0A 3QT8A 3CNQP 4F8RA 3RW6A 3NAIA 4TQSA 1S16A 3A4TA 1O51A 3D68A 4ALZA 2V2KA 3CUNA 1PC4A 3PIPQ 1RB0A 4YUDA 1URRA 1IKYB 3OL7A 2IOQA 2RU3A 4B02A 4HXZA 2B8QA 4DQQA 1WG4A 1ZH5A 4KH1B 3DGVA 2CFXA 2YNFB 4QU6A 2ACMA 3W9HA 1X60A 3VHQA 5DJBA 5HP1A 5FNCA 4OMFG 3POTB 4YR3A 2WW8A 4ED8A 2KZZA 2CRLA 4QPKA 3T3FA 4ZCMA 1WDDA 1L5UA 5GMDA 4C0HA 5EX3A 4HDGA 4LVOP 4ED7A 1Q86T 1M5VC 1N0UA 4M5NA 2FB0A 4L76A 2FHMA 2V69A 2J6TA 5M4HA 2HKEA 2DVIA 4F2SA 2IC3A 3O8WA 1NJIT 4LF6F 2MKJA 1GAOA 1G4CA 3MWBA 2GJFA 1Q1KA 4WFYA 4PPDA 3C6TB 2WEPA 2UXCJ 3F41A 5KT2A 4DZDA 5C25B 1F2HA 3DDNA 2ASDA 2V8GA 4RW9A 2J76E 1EX8A 1I5AA 1M1KT 1S6PA 1FRKA 2AD9A 5AXLA 1DJ0A 3DM2A 5D15A 2G4BA 4EGKA 1AFJA 1Z5CA 2FVCA 3BF4A 1NHIA 4XIPA 1JNRB 1S6UA 3TRGA 3K5OA 1NK7A 2WI3A 3TQEA 4LF1A 3GIKA 1JLAA 5EHHA 2MLZA 2UUAJ 5L1KA 2DNRA 2E5GA 3TNVA 4C2MA 4XPEA 3G6XA 3TAMB 2BU8A 1MW7A 2AYMA 2ZVIA 5I3PA 2E1MC 1N54B 5K8OA 4R0EA 3CJ5A 3P6YC 5F8MA 2L9WA 2FY1A 5D77A 3G8TA 3G7BA 3HFKA 3JB9k 4WZMA 1RWNB 4X62F 1QYEA 4LFBJ 1V3RA 4RW7B 5IM0B 1SKUB 4OHVA 4X4QA 3BN7A 3RB3A 2VPXB 1MU5A 2W9CB 1XIQA 3D6HB 3DRPB 1TAQA 3FMWA 3I56S 2L41A 2GQPA 3IO1A 3CJKA 3HHLB 3TVKA 2DHAA 4ILRA 4CH0S 3C46A 4CTAA 2IDLA 5JJBA 3OTOJ 1IKXA 2KTQA 1VRTA 2PNRA 4PRFA 5D6GA 3HHDA 4B08A 3IBCB 4JI8F 1CJUA 1B0VA 4NMLA 2HW3A 5KFSA 1SJQA 3DHXA 5ITHA 1WDTA 4FYXB 3B78A 3D54A 1F9HA 4NX9A 3IAS9 1FNOA 2CQDA 4I2PA 3T1HF 2XS5A 4RWXA 1JLEA 4L75A 2OHDA 1SUQA 1F51A 2HCHA 3IRWP 3PRDA 2DBBA 3MD1A 2KL8A 3X1LB 3AD9C 1T9XA 3W9JA 4DV5F 4H4MA 4JI5F 1K73T 4WP8A 4FKYA 2IORA 1CS4A 3VAFA 3V6DA 3TA2A 3T1KA 2V4QA 3S01A 2GFDA 1JJ2R 3OTBA 1R8BA 5CYQA 3OUYA 1TL7B 4Q44A 1AA1B 1SH2A 3FVYA 1RT1A 4ZLPA 4YY3J 4R1FA 3H98A 5J1NA 1RAJA 4ECQA 2MQLA 2QG0A 4KGZB 4DV6F 2XNQA 2CJAA 2DIUA 4CO0A 1KOOA 1SBRA 2RDIA 2Z58B 2DNLA 4OJGA 2P2CB 5LSLA 1C1CA 2F9JA 3OBIA 5B0AA 2LQBA 2DD8S 4L90A 2WONB 2BE2A 1JKHB 1N32F 2ZEJA 4OZLA 3Q2SC 3FSXA 4DQSA 1UFKA 1WG5A 2AEFA 4MOTA 3D0HE 4B9NA 2XMMA 3FNNA 1GTHA 2KYZA 4PYAA 2B6AA 4EBCA 4BXIA 1NHJA 1GMWA 1Q5YA 4USMA 3NS7B 4KGMA 2WEQA 4U7CA 4NI2B 1RAOA 4OYBA 3MI7X 4JB8B 3CTRA 4X4TA 3ZXOA 4FS1A 1ZPWX 2QLFB 1HNZF 2VDHA 3ZTQA 2IJFA 1R0CB 3DGEA 2EBEA 3C14B 4PU9A 1OSCA 3PNIA 2IYGA 4MKYA 3EHHA 3BH7B 4CLWA 4ZLNA 4BHQA 2UUCJ 4OYOA 4K4UA 4I1TA 5GAEU 3CCES 2J9DA 1BD6A 2EFOA 2MY8A 4OJ3A 1SPBP 2XHWA 2EKNA 2Z8QA 2M5YA 4DQIA 2JFKA 2WI6A 4L72B 1FA0A 2R4FA 2QE5A 5FNFA 2HNDB 3OR2B 3C16B 2KO1A 4AL7A 1Q79A 3BSNA 1ICEB 3LP1B 4HACB 4GO7X 1BYQA 2BW2A 4WXOA 4EM7A 3JQMA 2G1HA 4XTTA 3GIGA 2BBEA 3FBFA 3TVYA 5HSPA 1HQUA 1FCAA 2D3UA 2RIJA 1X9WA 1RT1B 1UEKA 4K4YA 3KDOA 5M4EA 2A1BA 2Z2MA 1S49A 2DRDA 1ZBTA 2E7WA 1A9NB 1FHTA 1IR2A 4TY8B 3W64A 1T03B 1R3NA 4PUOB 3AJ1A 4WPAA 4M5JA 3MEGB 2DGOA 2QL5B 4C48A 1RU2A 4TVAB 2C3MA 2JLEA 2VV5A 4NASA 3X3UA 3DHWC 4ITSA 3MEGA 5F8LA 2B0GA 5M4MA 3BJYA 2XD6A 2CNOB 5CYJA 2XO7A 3CJ3A 3OPDA 3EDQB 4CT9A 4DCJB 1OMSA 5KFQA 2K3KA 2MTLA 2FPHX 2HAFA 4KE5A 1WF1A 4IKAA 3HHKA 4B9SA 5KFOA 1UWBA 3VCDA 2J5AA 5U47A 3JAMY 4TU9A 1C0UA 1P9YA 3AOAA 3DMJB 3ISNC 2I8EA 4CIOA 5IZHA 4ENOA 3T9ZA 3NY0A 1MX0A 2Q79A 2C1IA 1KTVA 3QWUA 3JQJA 5KG1A 1TH8A 5CTYA 1J5OA 4TN2A 2G0JA 1M1HA 3J7YI 5LJ3Y 4RBUA 1NHHA 5M4NA 1DLOA 2KFNA 2YBVA 3U27A 2YWEA 2EXUA 2IDEA 2VW5A 3QRRA 2DNZA 2HHQA 4TLRA 3TUIC 2ZH4A 2E1AA 5KFTA 4C11B 3R5GA 5THWA 1F9FA 1X31C 4NMXA 4Q45A 2RRBA 2JOQA 1E6VA 1T94A 2ROEA 1VQLS 3TR5A 2YNGB 2I6WA 5CF0A 3INWA 2RDDA 3KE6A 1O5JA 4P52A 2MSSA 3MZIA 1DTQA 2O01C 3BV8A 4J9OA 2OPPA 2LA6A 3V5RA 2W01A 2K1RB 3D3BJ 4NXNF 3ELHA 2RS2A 3N6NA 3A8KA 2F65A 4WBFA 6FD1A 3BSCA 3M2UA 5HK4A 4LPBA 2BMBA 1RJJA 5DGBA 1TELA 4CDIA 1NBEB 3BM7A 2P9EA 2F63A 2FUG9 3BYPA 4TKTA 3OWBA 1U6ZA 4GQTA 3BGUA 4KHPF 1XWLA 3MAQA 2UU9J 4KQVA 1Y10A 5KFAA 4CNYA 3FV5A 3PY8A 2GAHC 4UZBA 1S1VB 1HD0A 4WJBA 3LP0B 2CNNB 3GR0A 3KLFA 2YGFA 3CRKA 5HATA 2PFDA 2LQ9A 2C3OA 2BJDA 2LYVA 4MP7A 1KDNA 2RD5C 1KKHA 1HQ2A 3QT7A 2B8PA 2ZOMA 3B82A 3OFFA 2C2KB 1UFLA 1KLMA 4U6PA 2ZKJA 3QT5A 2Z30B 2FHJD 4C98A 5F3KA 2OPSA 1WI8A 5DETA 2Y1LB 3BKTA 1GKXA 3KK2A 3M8PA 3O1LA 4M5KA 2PD1A 1W2IA 3NXZA 2UXBJ 4YKYA 2BE7D 2NPIA 2CQHA 5J2PB 4CI0B 3KTQA 3K97A 5ETKA 1FDDA 4DHVA 1KD1T 3CIZA 4Y00A 2IVFB 4ECVA 2CNKB 3EGZA 2IMOA 1Q95G 2BR0A 4J9SA 2XTJP 3Q8RB 2RS8A 5E5NA 1YJVA 2X1AA 1QTNB 3W2VB 1SJRA 3SCJE 2IVMA 1FWPA 2RRAA 3CDBA 3W3SA 2XHCA 3T5JA 2FJDB 3PYFA 1HNXF 2DGTA 1I58A 4JYAJ 4KSGA 2YI5A 4HXWA 2FJAB 1K0TA 4IOCQ 1WC0A 4CYUB 3QGIA 2DHXA 2ZDPA 1IWAA 4DMZA 2VQEJ 1TKXB 2LDIA 3CJ2A 3MPUB 4H4OB 1RTHB 4KRWA 4EI2A 2Y1RI 3NNAA 1EJ7L 3NBPB 5GAHI 2EG2A 2V0NA 4NCAA 5J71A 1WI6A 4ED1A 2VA2A 5B0CA 1HHTP 2WERA 3QLHB 1N6QA 3GFZA 3H5XA 3OHAA 4DG1A 4CTAB 3DLEA 4DN9A 3O6QA 2UV8A 4RPFA 1IKXB 1GTEA 4WF9Q 1C1BB 3V4MA 4E72A 3VV2B 3F56A 1LW0B 2E5LJ 4UZCA 2HGNA 1YJ7A 5LSOA 4MIBA 2C1EB 4OI2A 3IWNC 3PCOB 2ZUGA 4JI5J 4JP8A 4O4RA 1RZMA 2Z2ZA 4UT4A 3M9OB 4XAKA 4F04B 3D0IE 2OTJS 3IR7B 3ZFVA 2W2QP 4I67A 2AYEA 1MMNA 2DNYA 1JJHA 3QJLA 1H6KX 1HIYA 4LF4J 1CG2A 3CCLS 4WZQA 2BVZA 4RNHA 2WVBA 2GGPB 1YJRA 2XY5A 4OQJA 4J91A 4JI1F 4HZ0A 1VQOS 4K4XA 1P8GA 3BSAA 3Q8VA 1Q5VA 4NZ6A 5H9FK 4DLEA 3ZTPA 1H7WA 3IRXB 1MU2A 3OJUA 1Q7LB 4AFFA 3VAKA 2MKCA 4B3TF 4NH7A 2BTZA 3QQCD 3DRYA 3Q8QB 3A8EA 1K8AT 1RWWB 1ZXNA 4JI7F 1FE0A 1WOSA 3NAHA 1RHUB 3G86A 5CYMA 4ZJOA 1IN0A 2IC3B 3B27A 4FKXA 3NLCA 1KEKA 4R5PB 2RSQA 2DO4A 4BAEA 2AX1A 1UY7A 2XGPA 3VGSA 2PIIA 4M5IA 5KT6A 2QJ3A 4ES3A 3VF0B 1CLFA 1FDAA 2ZH9A 3PDNA 2E5HA 3RAMA 2BYIA 1YKWA 5C2GA 3D0BA 3OFHA 5HROB 2QMWA 4Z7CA 4QIEA 2ZDOA 4DL4A 4ZK7M 2I5JB 2AX0A 5AXMA 3ZTSA 2HHTA 3RB6A 3O3LA 4UQGA 2AYBA 3VQTA 2WVFA 1U0HA 2LXIA 2WBMA 1HBMA 4RNMA 5DLGA 4MH8A 4DPOA 2H3EB 2Q6BA 2XYHB 2UP1A 4FCQA 3ZZPA 3KDNA 4C3KA 2ZD1B 3OVBA 3MEEA 1Y5NB 4YQWA 1UZDA 4CE2A 3HVTA 1XR5A 2OPRB 2C3PA 2JLGA 3M30A 2CQ1A 2V2ZA 3VWSA 3OJSA 1ZTWA 1DQ9A 1QZRA 1FESA 4J9RA 1S5ZA 3FZ2A 2Q43A 5SUHA 4YN3B 4QIVA 3UPFA 3W66A 3S5TA 5GVQA 4RW8A 2J6UA 4C8KA 2RUSA 2AZ3A 4DR1F 3HSDA 4ZHRA 2JC0A 3QIPB 4PXCA 3IGVA 3CJKB 1QJHA 4CO3A 1R8PA 3R7SB 5KFMA 2OLWA 1JIHA 4CLUA 3PVXA 2E1RA 3HJFA 3U67A 1XNQF 2KG0A 4ZHRB 1RTHA 3ETMA 3HKWA 5B0FA 5CABA 5DM7Q 1VK3A 1CC7A 1QAIA 3PEHA 2MJNA 4AD6A 4ZVRB 2OPQA 4HEA9 4EO8A 2HMIA 3M8ZA 1Q8IA 2CPZA 4OYAA 4HHUA 3RBXA 4J9MA 4NH8A 2FXSA 4KSEB 1FDBA 2VD3A 2OAUA 1VQ9S 4K4TA 4EWTA 2RHSB 1YC3A 3BGOP 1SL0A 2N82B 3OSPA 1Q4RA 1ZM2A 4MJKA 3K60A 4DR2J 2BACA 1HWLA 2VG7B 2DR5A 2HHHJ 1VBZA 2FD2A 1LEOA 4FZVA 2MQMA 4CLZA 3LGMA 5DQIA 4J9LA 3NCPA 4FPRA 2ATCB 1M5PC 3WX4A 3GWCA 1AW0A 2C2MB 1OY9A 1RTJA 2AQ4A 3DLEB 4MTPA 3INXA 1IKWB 2YNHA 4M8LA 3D2WA 4XIRA 5KOXA 5IS2A 1VBXA 3JTOA 3O6OA 1VIXA 3SSSA 4CO5A 4B3RF 3MMJA 4KFBB 4EUVA 2DGSA 2QT7A 1H0HB 1W2BR 2YNGA 1D0EA 4K5RA 3N9UC 3KLGA 2BEFA 4LQ9A 1MWQA 4BQJA 2CQGA 1YJWS 3W8GA 3R4OA 2RU9A 4K4OA 3ZC4A 1XNRF 2YE2A 1XR6A 3W5XA 2ZHOA 3HSGA 3RLQA 3FDSA 5JUMA 1HI8A 2KB2A 3SDEA 1I5CA 3DI6A 1N5YA 5D0RA 4U7UD 3SEOA 4KPCA 5H9EK 1F3VA 1VMBA 2CA9A 3AJDA 4R0JA 4ASAA 1X4DA 2BJEA 1X4BA 1TMMA 1WUUA 4DLGA 2WHOA 4DG1B 3BPDA 2QF6A 3MR6A 4UY85 1FFWB 3Q83A
chains in the Genus database with same CATH topology
1RT7B 1NU4A 1ZAXA 4I4BA 1ID0A 1VHFA 4R3MA 2HGMA 4YOEA 2WBRA 4KKOB 3SQGB 4C0OC 2V9KA 2FC9A 5KG6A 1YJUA 4B17A 3M6WA 4C0BA 3GR1A 3LO3A 3MM7A 4FXWA 4BWJA 4HYMA 3SL2A 5LSRA 3SSRA 2DPIA 3GFYA 1DBDA 3RKZA 2P9GA 2ZH1A 2G0CA 1UWBB 2CJBA 4JI6F 3WC0A 4A46A 4L6V3 5A8RB 1HARA 2DH9A 2QFJA 4TYBA 2OFGX 4ZOSA 4CO4A 5C25A 2W7OA 1VQMS 2B9YA 1VQ5S 5KAKA 4NYZA 3MECA 2I38A 1U1OA 3GB0A 2I2YA 3R4NA 3DMJA 4GO5X 3IAM9 4TU8A 4DSIA 7FD1A 2LQJA 2VPWB 2YE9A 2W9BA 2J7KA 1RYRA 4MK9A 3C6UB 4KHMA 5L8RC 1IQTA 2R8JA 2ZZMA 4IH7A 2Q1LA 4TY9A 3K8WA 1H7SA 4URNA 3PJXA 4FNHA 3CT9A 2RKIA 1QE1B 4YY3F 1FRIA 1H38A 4I64A 1YRXA 5DQGA 2ASJA 5F0UA 2GJIA 5FD1A 4OX8A 2YEIA 4WUDA 3O2FA 3CO9A 1M5HA 3FEYB 3R5DA 2AP6A 2XCPA 3IS9A 1FVQA 5F5RA 4KT0C 3SV4A 2B4UA 4CCHA 4ZPDA 5BYSA 5K8MA 3KYLA 4JAVA 2K1RA 2XDSA 3PR4A 5A8WB 4IUFA 1HBNB 4TLQA 1D9AA 2CCSA 3CCJS 1K1SA 2NUHA 5AXNA 3Q22A 3MAHA 4DFPA 2VG5A 3H5YA 1A4HA 5J2NA 5CTWA 3VALA 4J9PA 1P9QC 1X4AA 2GHWA 1I5BA 2RH3A 5KFCA 1HMVA 5K14B 3HVRA 1UYDA 2PMZD 3KG1A 1QSSA 2YI0A 1U1MA 1SV5B 1JLBB 3BQ0A 5KFHA 2Y0SD 4KO0A 2HG1A 5KFLA 3TA0A 2ZITA 1Y4ZB 3BQ2A 4RX6A 3M2VB 4X4VA 1NJYA 3KMSA 3PRBA 1UEUA 1SC6A 2C2AA 4H85A 1VC5A 4HI2A 5HMWA 2KN4A 1LOUA 3CJ4A 1W25A 2YKOA 4DWIA 1RISA 2C3YA 2HNZB 4EO6A 1G2EA 2VFSA 1NJWA 3OW6A 2XI2A 1FKOA 4DQRA 1D9DA 4C4WA 4MPEA 2CGFA 4L91A 1HWUA 1Y00A 2DR8A 2XABA 1NH7A 4DL0C 3PKMA 4KR0B 4NRTA 1U09A 2QFOA 4G3IA 4AUKA 4RU9A 3G6YA 4ECWA 3Q5KA 2ZE2B 1YVFA 4HL9A 1KVJA 3BDPA 2LKZA 4A8YA 2EC0A 4PCQA 5KFJA 1NHUA 4EGLA 2BM1A 4NA2A 1U48A 3MM5B 3H2UB 3I0SA 2BDPA 1FRXA 3CGIA 1X8DA 3C6UA 3H2LA 1SJ3P 2D7SA 1BKNA 3EX7B 1S1WB 1S10A 3JTNA 1KNZA 4QR1A 2W25A 4RWWA 4KC5A 2JX2A 2GGPA 2NXUA 2XMJA 3LP1A 4ZP8A 2HVIA 4XD8A 1X9SA 1S76D 1H2VZ 3N5FA 5HLFB 4DS5A 3H4LA 1D8ZA 1UYKA 1TAUA 3MM9A 2ZE2A 2W8LA 1RTDA 2M88A 4WCEQ 1L3SA 4NLTA 2YWKA 4JOUA 4DL3A 2YX4A 2XCMA 3VR1A 3OXLA 2F40A 1VIOA 2HFNA 2RF2A 1ZM9A 1JLEB 3CDEA 2CVIA 2YEHA 3NCRA 3B28A 2M4MA 2YWGA 2DB1A 3HHLA 2QLWA 5DRKA 4R8UA 1VQNS 1HQEA 3MOZA 2KFZA 2WTFA 2CQCA 4KIAA 4MAKA 2R7WA 2MZRA