3PEHA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of a thienopyrimidine derivative
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
261
structure length
261
Chain Sequence
b'ESMESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin homolog
molecule tags Chaperone
source organism Plasmodium falciparum 3d7
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of a thienopyrimidine derivative
rcsb
total genus 78
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pehA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pehA01
4EFUA 1AJ6A 1GKXA 2FYPA 2WERA 3B26A 3R4MA 5M4MA 4P8OA 3C0EA 4YKYA 3CGZA 3K97A 1TIDA 3RLRA 2YK2A 4FMTA 3B28A 3QTFA 2YE5A 2UWDA 4XKKA 4WUCA 3LPSA 3EHFA 4R3AA 2YKCA 1I58A 3U2DA 2YE7A 5C93A 4R1FA 4FCQA 4MPEA 1UYHA 2ZBKB 2XHRA 4JASA 3R4OA 2XX5A 2YKBA 3OWDA 5M4HA 4CWRA 1AMWA 2K5BA 2IWXA 5J71A 2VW5A 2YI7A 3R4NA 3FT8A 4O09A 4URMA 3OW6A 4CE1A 2BU2A 4DZYA 5J6AA 3T10A 1KIJA 2CG9A 2BRCA 2H55A 2IWUA 2Q2EB 3GIGA 2GFDA 3A0ZA 5IN9A 4AS9A 3FV5A 4EM7A 4HYPA 1MX0A 4BQJA 1Z5CA 2YEEA 4BIZA 5L3JA 1Z5AA 2VCJA 5CTXA 1S16A 4ASGA 3Q5JA 1AH8A 2WI3A 4HXZA 1YETA 2ESAA 3PEJA 4Q20A 2WEQA 1YT1A 4CWPA 2IWSA 3HYYA 1I5CA 2ZDXA 1UYKA 1B3QA 4XCLA 2YEFA 4CWTA 4EGKA 1UYGA 4U93A 2WI6A 4HXWA 2WEPA 2FXSA 1BYQA 4K4OA 4L8ZA 2ZDYA 1YT2A 3ZM7A 1ID0A 4KSGA 4YKWA 4E00A 1NHHA 1ZXMA 2VWCA 4L91A 2Q8IA 2O1WA 3A0TA 2WI5A 2YEDA 4V26A 4HZ5A 1UYEA 4KTNA 4XIRA 3T0HA 5CPHA 4BQGA 3O0IA 5CTUA 1EA6A 4LWHA 4CWFA 2QFOA 3A0XA 2QG0A 3A0YA 1YT0A 4O05A 2O1VA 1UYLA 4FPPA 3VHAA 4E01A 2IORA 2YJWA 4YKTA 3RKZA 4EFTA 1Y8NA 4XIPA 5M4KA 3TZ5A 4AWPA 1TILA 1ZXNA 4DUHA 4JQLA 4XCJA 4JAVA 4BIUA 4URNA 4ZKIA 1L0OA 4AWOA 1I59A 4LWIA 2YK9A 2YEGA 1UYCA 2YKJA 1KZNA 1BGQA 1TC6A 3VHDA 2IOPA 1US7A 2GQPA 3T1KA 5CTYA 2EXLA 2XD6A 1YESA 2YE8A 4LPBA 4CWNA 1YSRA 3ZXOA 4LWEA 4LP0A 4XKAA 3HYZA 4I5SA 1QY8A 2YEAA 4KFGA 4KP4A 2BSMA 4L94A 1ZW9A 4KSHA 2XJGA 2WI1A 1QYEA 2XABA 3EHJA 4XE2A 3PEHA 3GIFA 1Y8PA 4XIQA 1PVGA 2YECA 5FNCA 4GGLA 1JM6A 1Z5BA 3RLPA 4XDMA 4U7OA 3G7BA 3OWBA 4L90A 4CE3A 1EI1A 4MOTA 5D7DA 2QG2A 1MU5A 2IOQA 5FNDA 4H85A 2YKEA 2YE4A 4MBCA 4GQTA 4R3MA 3B27A 3G75A 4O0BA 4PRVA 3INWA 4GFNA 4MB9A 4EMVA 4ASFA 2FWYA 1Y4SA 2YE6A 2YEBA 5FWKA 3D0BA 4XD8A 1UY7A 2O1UA 2ZKJA 3GIGB 5M4NA 3ZKBA 2BU7A 1UYIA 5CF0A 4ASAA 3CWVA 1S14A 3G7EA 2YEJA 5F3KA 4CWSA 2VCIA 3A0RA 1H7SA 2C2AA 3EHGA 4ASBA 4BAEA 3K60A 1TH8A 4E02A 3RLQA 3BMYA 4L93A 1UY9A 3KE6A 2XJJA 2XDLA 4B7PA 3DGEA 3K99A 2E0AA 1UY8A 3C11A 4U7NA 2BU8A 2CCTA 3H80A 4V25A 2WI2A 3OMUA 3TTZA 4PRXA 2BT0A 1BKNA 2AKPA 2CCUA 1TBWA 3WQ9A 3TUHA 1AH6A 3SL2A 4WUDA 1UYDA 3NMQA 1YERA 2XJXA 1Z59A 2XX2A 3EKRA 2PNRA 4HY1A 4XKOA 2WI7A 2BTZA 4P7AA 3D36A 1NHJA 4CWOA 2XHXA 2Q8FA 4BXIA 1OSFA 3B24A 4XTJA 4W7TA 4YKZA 5D6PA 3K98A 3CRKA 3OPDA 4HZ0A 5CTWA 2JKIA 2XCMA 1UYFA 2Q8GA 4LWGA 1BXDA 1H7UA 1I5BA 3O6OA 3VADA 4YKUA 2BZ5A 1I5AA 4AWQA 2FWZA 3B25A 4UROA 2HCHA 4URLA 1YSZA 4ZVIA 1ZWHA 3T2SA 5D6QA 4EEHA 4FCRA 3CRLA 2Q8HA 1UYMA 4YKRA 3R4PA 3ZKDA 4PL9A 4NH9A 1I5DA 1GKZA 1YC1A 4H81A 5F5RA 4NH7A 5FNFA 4NH8A 4XITA 1B63A 3IEDA 2BREA 2BYHA 4I3HA 3WHAA 3Q5KA 5M4EA 2QF6A 2XX4A 2HKJA 4MP2A 3VHCA 3HHUA 4B6CA 4CWQA 2YI5A 3BM9A 3EKOA 3ZXQA 5M4PA 4LWFA 3TZ2A 4HY6A 2XDKA 2XHTA 4QPKA 1YS3A 4O04A 4GT8A 1Y8OA 2YGAA 5GGZA 2YI6A 3R92A 1NHIA 4H7QA 5D7RA 1U2OA 1TC0A 2YGFA 4JAUA 2WI4A 2XK2A 2YJXA 3HZ1A 5BOCA 3CGYA 3TZ4A 3T0ZA 4WUBA 2YGEA 4YKXA 1UY6A 4EGIA 1YC3A 2YE2A 4MPCA 2YKIA 2H8MA 3EHHA 4MP7A 1THNA 3HZ5A 1B62A 4MPNA 2BU6A 3U2KA 4CE2A 1QZRA 2YE9A 4YKQA 2BYIA 3INXA 3JZ3A 2XDSA 1GJVA 3O2FA 2CCSA 3LNUA 3FT5A 3H4LA 4XC0A 1YC4A 2CH4A 4HYMA 4O07A 3D2RA 5D7CA 3Q5LA 4PU9A 2BU5A 3GIEA 1R62A 4FCPA 1AM1A 2JJCA 3A0WA 2YI0A 2YE3A 5IDJA 3U67A 4EGHA 4GEEA 2HG1A 2XDXA 1U0ZA 1A4HA 2YEHA 3HEKA 4KQVA 3MNRP 3R91A 3TZ0A 5BODA 2CGFA 4X9LA 3QDDA 1Y4UA 4QPJA 5IDMA 2XDUA 4GCZA 2YEIA
chains in the Genus database with same CATH superfamily
1IXMA 1P1LA 1C1BA 4JI7F 1RT3B 2PIIA 4Z37A 3GR1A 1FWKA 1RT7A 4NLRA 4QWCA 3NGRA 2ZOMA 4PUOB 3UD4P 3T9NA 1HQ2A 1ZPWX 2ZDPA 3A3NB 3M2RB 1RUSA 4F50A 2QL9B 1ZM3A 1O6XA 3CCSS 2UUWA 3T5LA 1EARA 1MX0A 4DL3A 5BXIA 4ECUA 4FS1A 4XPEA 5A6WA 4CLYA 1SJ1A 1JXLA 4P6QA 2NXNA 3EWGA 2DHSA 1OYEA 4ZJOA 4U7CA 1YDLA 2WEPA 3PJ9A 3VAFA 1XK8A 3AAWB 1HNVB 1RTDB 2CQDA 4KTQA 5ETQA 2CJ9A 3B4MA 1DQ8A 2JLFA 1XQIA 4PRFA 3HD2A 2G4BA 2WI5A 3K8VA 1UW9A 1D3WA 2POKA 2N4DA 5KFXA 4EYHB 2MKHA 3M05A 4GVBB 5I42B 1TK0A 2LEPA 3H2VE 1AZSA 3CCUS 4EFTA 3SSSA 2B8PA 1YJUA 4ID5B 5IM0A 1PJ7A 4RU2A 4URNA 1QTNB 2R2UA 5KFEA 2D3UA 3ZTOA 5BYRA 1G6BA 2B8QA 4YMEA 2MXYA 1OO0B 1F3VA 1T0TV 2J8SA 2VOPA 3V4IB 1OPZA 1Y4ZB 3ILJA 3MR6A 4DZDA 5AXLA 3HYZA 1C1CA 4ILLA 2XGPA 4KP4A 1CS4B 5CD4A 3JB9k 2WI1A 3CJ3A 2BQUA 4IR1A 4K4ZA 3MMAA 3DMJA 3CD6S 3D4JA 3IAS9 3KK3B 3VZHA 3OD2A 3G7BA 4KKOA 4DPXA 2ZM6F 3JQKA 2NSCA 4N7TA 5KG6A 4U6PA 2DHXA 4DQQA 4J90A 2BYCA 3MR5A 3SSQA 3KJVA 4GFNA 3FCHA 2DY9A 3W5YA 1LEOA 5HBMA 4OL8A 2J8AA 3I0RA 4XD8A 3BGOP 1KLMA 2WB4A 4DBQA 3C66A 3J81Y 1T05B 2CG4A 1RKJA 1S1TB 2HHSA 3FBCA 3PO5A 1JLEA 2CPEA 4DR5J 1OY9A 1EZZB 4D3HA 4WIIA 5B0EA 1NBEB 4ILMA 3BMYA 2ACYA 3QBCA 3VTIA 3R5BA 1K0TA 4YN3B 1FJGJ 3EPGA 3PKMA 2OI2A 2CQIA 4RJVA 2RF2A 3M2UB 4TLQA 1VQMS 2YXLA 1IXKA 3K5MA 2EG2A 1IR2A 1VLOA 3N28A 1Q1KA 3O3LA 2W4PA 4USJC 1XWLA 1T9TA 2BTZA 5U47A 2PFDA 2HFSA 3GFXA 4DV6F 1U0HA 3LP0B 1SH2A 1FKAF 4X4UA 3PG9A 1JLCB 2BVZA 4GKKF 1H3DA 3GLJA 1RTHA 2BDPA 1BXDA 2YNIA 5CAAA 4PQAA 2FY8A 2B9EA 1FJCA 1JJ2R 2W9BB 3R97A 2RRNA 3H2UB 3U7JA 4AQYF 2AYGA 1HBNA 5CZVA 4C0BA 3R4PA 2XHCA 1FEHA 2CYYA 2A0FB 4IUFA 2ILYA 4XITA 3DRPA 4J7CA 4DOZA 2B6AA 2FJBB 5L1LA 3TW0A 1FE4A 1QE1A 3AY0A 2AD9A 4EBDA 5L1JA 4WZQA 2XHTA 3BF4A 3ZTRA 4PQUA 2HMIA 4CQ1A 2F40A 4K4UA 5KG3A 1FWLA 2IM3A 1PYSB 4NCAA 4EUVA 2I2YA 4DQRA 4ILRA 4DU8A 4OV1A 3JSMA 3TZZA 1REGX 4EGIA 1FT8A 2FZGB 3CT9A 4F4ZA 1V6HA 5AE3A 1TTHB 2BANA 4RLEA 4OZ5A 3LF0A 4I6WA 4FBTA 4Y65A 2DNLA 1MMNA 4ETXA 3DLEB 3GIMA 1RTZA 3ZXWA 3F41A 1VFJA 1APSA 5KOXA 4GEEA 4IH7A 4X9LA 1X4BA 2JC0A 1Y4UA 1JLBB 4GO7X 3BH7B 1GKXA 3KLHA 4P8OA 3KK2B 3BN4A 2MQOA 1WC3A 4DG1B 4NX9A 4NLSA 4TU7A 1OS5A 4UOFA 4OLPA 4NXNJ 4B9UA 3MMJA 2QA4G 4DSIA 2YE7A 2R7RA 2LFVA 4FCQA 1HR0F 1RHQB 2JX2A 1JLBA 2HHPA 2OSRA 4IKAA 2DJWA 1VS3A 3WZ0A 3FT8A 1QE1B 4B3TJ 4XAKA 2CJXB 3JSBA 2ROEA 2HVEA 3T6BA 1KIJA 4K2JA 1R27B 4MKYA 3DM2B 3FV5A 5A76A 2ZE2A 3QIPA 4BIZA 4JV5F 1Z5CA 3W66A 2V8GA 1NCLA 1HW8A 1FTCA 3SIPB 3DFEA 1KNZA 1YRTA 2IWSA 1I5CA 2XMWA 4JI2J 2DH9A 1RCXB 2C2KB 4IOBA 5KOWA 3EX7B 1ITPA 1S1VB 4JI2F 3KLFB 2JVOA 4ZITA 5JUMA 4DR1J 2HNYB 2PE8A 4ECWA 3D0GE 3GIRA 4LIWA 3UN5A 2Q8IA 4CLTA 1YZ6A 2QA4S 2KB2A 4CP5A 2XNRA 1PCAA 1LQ9A 4JP8A 3A0YA 2O1PA 4X4QA 1SC1B 4RR5A 1UYLA 4R25A 5HMWA 1JLGA 5H9EJ 3BBCA 2YNGA 4XIPA 2B5JB 3O8WA 4ED1A 3KK2A 2HEKA 2AX1A 1AUDA 5F41A 3EYZA 2YKJA 1MWYA 1H0HB 4TY8A 1TUGB 3PRDA 4USTA 3G86A 3NXZA 4N8NA 2HNDA 3HVTA 3QT5A 1T94A 3VAKA 2R2SA 1AT1B 1BWVA 3QT8A 3KHRA 3PW2A 2YPZA 3GJRB 2VICA 2DH8A 2BJEA 2CVIA 4DQPA 1S7HA 1N54B 1VHIA 1SVDA 2Y1RI 4XE2A 2ROGA 1SJFA 2A18A 2O66A 4ZPBA 3RB6A 1L3UA 4K5SA 3OWBA 1X9WA 4ANDA 3ICLA 1RTJB 2ZD1B 2E5GA 4PG4A 2CJYB 1OY6A 3W2WA 1SIWB 4P73A 1GK8A 4ZVSB 1T03A 2VG7B 3B27A 5IT4A 4OZJA 4QU7A 2RQKA 2J6UA 3W60A 2PD1A 1UYIA 2RVJA 4G1PA 3PW7A 4FYVB 2CPZA 2DNYA 2OPQA 2PA8D 1VHFA 3I0SA 2J9CA 2ZVSA 1Y10A 4C8LA 3W9HA 4B7PA 3P5BP 4DSKA 5DDPC 1OSDA 1LXNA 1WEXA 1C0TB 3DNCA 2A10A 2WI2A 4FS2A 2DY1A 3VF0B 2VPYB 2PI4A 3KOAA 4DPOA 2ZDOA 3FCVA 2AZ3A 3ET6A 3K57A 1MWQA 3PV8A 3BGRB 4A8FA 1GTHA 1VRUA 5G0RA 4DR3F 3B24A 3ZZYA 3MOJB 1WHYA 2IC3B 4WCEQ 1KC8T 3UDEA 1ZAXA 2VJVA 1C1CB 1GMUA 2MLZA 2A3JA 3ITHA 2GX8A 2HVDA 1ZWHA 1W25A 3GFYA 1RT4B 1FXRA 4PWUA 4OI3A 3M32A 4LF6F 2ALZA 3B78A 3HO1A 5FNFA 2UUCF 3CD0A 5HLFA 1F6TA 1U7LA 5HQ8A 3MPWA 3HT0A 2R7VA 4WE1A 2Y8WA 3SDEA 1FK9A 3BQ2A 1XN9A 3HHNB 2LXIA 3IS9A 4EK2A 2V8DA 4ZS6A 2HWIA 2E5LJ 1TKTA 3SSRA 3HULA 2K3KA 3QSIA 1EHWA 5K20B 5LMNF 5J1PA 1V5IB 5AT1B 3HHDA 4U8VA 4DSFA 3HZ5A 4YB7A 3SDEB 2VL1A 5ETSA 1GTEA 2B3TB 3M7VA 3O2FA 2IVYA 5CA5A 3LNUA 4CYUA 1CJKA 3MPYA 2DGXA 3A3OB 4USKA 2VG7A 1TL7A 3CGIA 2H51B 4ZVRB 4H54A 3D2RA 1DTTB 2PO4A 1F5BA 4CM0A 3K5LA 3NBPA 1VGYA 3OTCA 3TAMA 5C5JA 4OYAA 1AB8A 1B70B 3BS9A 2YI0A 3GSDA 3HKZD 1VC5A 4YB6A 2CNKB 3LOUA 2R3VA 2JDJA 3FNNA 4A8XA 2YVSA 5LSLA 3BO4A 2K7JA 5IOLA 1MW7A 3KJFB 3J80U 1ZYQA 3TX0A 4DV1F 1FJGF 5DS7A 3W5ZA 1RABB 4DXLA 1FRXA 2ZBCA 2ZBKB 4JASA 4I68A 2GIQA 2BQ3A 3HSDA 3AQPA 2HPUA 4CH0S 1WF0A 4P7TA 5DGBA 1PGZA 4CIOA 1HNXF 1WHVA 5DM7Q 1U2RA 4ZN1A 2NPIA 3AJDA 4G1QB 2QYGA 4ED5A 2F4VJ 2HNDB 4Z7CA 5HROB 1FD8A 5F9NA 2OMOA 4AE5A 1KWMA 3WDOA 1R43A 1PAEX 4ASGA 4M5KA 4CLZA 1BXNA 2Y9HA 4OX9J 2R7SA 2R7WA 1S1UA 5LMUJ 3E2EA 3VWSA 2JEFA 4DDFA 3PHEA 4BLGA 1HBUB 4PXBA 2XNQA 1LWFA 1V3SA 5E33A 1PO6A 1FNOA 2QSFA 4MK9A 1YT2A 4G65A 1QSSA 1B7FA 5LSRA 1U1NA 1UFWA 3CCMS 2CZ4A 4V26A 4XIRA 1BHNA 2WVBA 4PG7A 5KAKA 1RT3A 2UVWA 3QRPA 1VR6A 1RJJA 4DFPA 4QQBA 4ZPVR 2YNFA 1P1TA 5B0GA 3W2VA 4DUHA 3C14B 3UPFA 2GO8A 1SB6A 1RSCA 4TY8B 5KT5A 1JJ4A 2YE8A 2ZD1A 2K1RA 3TZWA 4DJBA 5BJRA 1RT7B 2WVDA 2KYZA 3QJJA 4ZP7A 4I5SA 1RWWB 4ED7A 2V2ZA 1HFEL 2XY5A 2EI5A 2AZ1A 5ETPA 5E3RA 4PPDA 3LH2S 3W61A 1Y8PA 1N36J 1V3ZA 4OYOA 1LWEB 5GAHI 1TV6A 3IG1B 5KG1A 2G0IA 1U09A 1FEEA 2DRDA 1N36F 1ZA2B 2UXBJ 1QVGR 5D7DA 1MU5A 4HL9A 3OBIA 1VQ4S 3IR6B 3HFKA 1UWAA 4F02A 2V67A 2YEBA 2C42A 3TANA 2UU9J 1DRZA 1ELOA 2O1UA 1S9EB 2W24A 3NGTA 4QPTA 4ZCMA 2JWNA 3PIOQ 2B56A 1QAIA 2ATLA 4TNOA 2W7PA 2DXFA 4DSEA 1Q86T 3A0RA 4FXVA 1YSJA 2HK2A 5KTQA 3HDSA 5HJYA 3KE6A 2DHHA 3WIUA 3K99A 1RYSA 3DGEA 2PFFB 1NZ8A 5IV3A 4USUA 3LAMA 4ZPCA 1S10A 4CLUA 1YZ7A 4DMZA 5KFUA 2E1AA 4ZLJA 3F73A 3AHPA 3CJ0A 3DU6A 2ADBA 1AA1B 3A8JA 2LVWA 3OVBA 4J9KA 1SC6A 1T02A 4CNYA 3EXYA 2W25A 2XSFA 2XX2A 1EP4A 3IGNA 2HS3A 3SV3A 1AFJA 2N3LA 2BOPA 4DL4A 4W7TA 2VH7A 4A8SA 2KHCA 3H90A 4KGVB 2HYIB 1S6PB 1UVMA 1VK3A 1JJHA 5IT9Y 1S6OA 3ETOA 3JS9A 3S6EA 5M2UA 3HK2A 3QAUA 3GYNA 2GVZB 4OI1A 1FVQA 3W62A 3MXHP 3NBPB 1S1WA 2HCHA 3AQOA 3QZ8A 1F60B 4FCRA 2C3YA 1HLWA 1X0FA 2Z56B 1Y3JA 1ULRA 4CO5A 2XCPA 5ETTA 2I9SA 2BXJA 2UV8A 4C97A 3RB4A 3QLHA 4DR6J 3CXCR 2KL8A 3LW5C 2FHJD 3HLUA 2MGZB 4P52A 1GMWD 5IQQA 1Y8OA 4ER8A 4RBVA 5A8RB 4DWIA 2J76E 2KM8C 2HGLA 1QAYA 4C8NA 2XHWA 4ZP9A 2YJXA 5DG7A 4U67Q 1RB0A 1UY6A 1R6VA 1FXLA 3MEGB 2EPIA 5THWA 3W64A 1Q8LA 1F0XA 5DG9A 2BYIA 4P2XA 1E6VA 3W5XA 5KG2A 5K5MA 4K0KF 1NHKL 2BEFA 2JNJA 1N5SA 2HBZB 1YC4A 4J9UE 3HZEA 2OEJA 1HBMA 2ZC3A 5D7CA 4P2SA 3BGLA 3QGIA 2HHHJ 1J5OA 2NUUG 2OEKA 3R5GA 1YJTA 2B43A 2R2TA 1OY8A 4R8UB 2JJCA 2JLGA 2HFVA 4LFBF 1CPZA 1P9QC 3RU0A 2NZ4A 2P2CB 3UI3A 3NCQA 2RRAA 3ZFVA 3OHAA 4KQVA 3C15B 4DUYF 4EFUA 3L3CA 2WERA 4YKYA 5E0OA 4RL1A 3Q2TC 1SH0A 3W3SA 1IJFB 1B3TA 4YQWA 4OZ0A 3MWBA 2W9BA 3TNVA 4RUAA 2Z2LA 2YWEA 3SFGA 3ZO7A 1R8BA 5B0CA 2E5JA 4MK7A 4WU2A 1KONA 4LR7A 4ZHRA 4U95A 2KH9A 4RNNA 2J0QD 1TKXA 3L4BC 3T10A 5B0DA 2CG9A 4PZVA 2ZJQQ 1U49A 4O3NA 3MDFA 4OYPA 3Q24A 2OGUA 4ZVGA 4B3OB 3Q5JA 1AH8A 2WI3A 1S59A 4C2MA 4HXZA 2ZNZA 4ID5A 3FSIA 4LF9F 1S48A 5B08A 2H48B 1B3QA 2FYXA 1TU0B 2KN4A 3T1AA 5LJ3Y 4B08A 2VUGA 1HWIA 3H4BA 3CCWA 2HRYA 2ZDYA 3SCLE 1X4HA 4KGKA 5HVGA 2MQMA 4CLSA 2QO3A 1H38A 4DS4A 1L3TA 3Q8VA 4IG0A 4RO0A 4OQJA 4O3OA 2BQRA 4HZ5A 4FPRA 3N5FA 1U45A 5IC4B 2XLIA 5HVFA 1FFGB 2Q43A 1DBDA 3C3LA 4P75A 2VD3A 2YPYA 1CJUA 4E01A 1RWUA 4DV3F 2SXLA 4QYZK 1JXVA 2FZCB 2N7YA 3H8YA 2N82B 1L0OA 3HHLB 1VRUB 3GCXP 4LWIA 4NLGA 1PBUA 1CSJA 4IYQA 1U6FA 2MGZA 4XPCA 3V81A 5KFMA 1VQ5S 1TC6A 5CXTA 1US7A 2GQPA 3MEDB 5I4MA 2XD6A 2M0GB 3R2DJ 1TMJA 2AGPA 3I5CA 3ZXOA 2K1RB 2QT7A 4Q45A 4X84A 4C11A 4FF1A 4DZ6A 2EKNA 2KYXA 2VOOA 5E3PA 4F25A 2XMJA 9RUBA 2XJGA 3HM9A 1LWEA 2WSEC 2IRYA 5FNCA 4I1TA 4H4OB 3AA9A 3GV7B 5C2CA 3CDEA 3EDQB 2V4RA 3DGPB 2YKEA 4IH5A 1T03B 5GAGI 4EMVA 5IQ6A 4HT7A 1WF2A 1RK8A 2RE1A 2ZKJA 4LBHA 3FZBA 4GVBA 2OFGX 3DI6A 1S12A 2B4OA 4OHWA 1S14A 4KC5A 1MMDA 4WTYA 1FRIA 3BN7A 4BAEA 4O44B 1JNZB 2J9DA 2Z4PA 2AGOA 3FZ2A 1WI6A 2HHXA 2BU8A 1OMSA 3FEZA 4X62F 4YR3A 4MIAA 3CDAA 4RW7B 3H42A 5KFTA 5A8KA 5C25A 1TFWA 4MMOA 1QAXA 4ZCLA 1SKSA 2FB0A 3S01A 4C7QA 3A1YG 5DZ6A 1IM6A 2A2DA 2WI7A 1K9MT 5MLCV 2UUBJ 4XTJA 1YJNS 2BJ9A 3KLIB 1VCTA 3MFIA 3OPDA 3W65A 2GJFA 4IG0B 2Q8GA 4C3LA 2H1YA 3TWZA 3R5AA 3PO4A 4NMLA 3GV8B 1IKXA 1TV6B 2NS1B 3IG1A 5D6QA 3ILOA 2W2PP 3CCLS 3PHTA 4ZP6A 3QNWB 3I0SB 3UQSA 5GAHU 1NDPA 5AE2A 4NH8A 1WG4A 4CNZA 4I3HA 1FTRA 1DURA 4X4SA 3Q5KA 3IXQA 1RHRB 1H2VZ 5HVHA 4DR2J 4W92B 5IWAF 2KU7A 4KT0C 1LOUA 1UZHA 1UL3A 2FJWA 2X1BA 2DK2A 2EFQA 2NSBA 4LR9A 7AT1B 2MLYA 3PJXA 3R6LB 3ENWA 5IXUA 3VGVA 4MP7A 1CULB 2CXEA 4AQYJ 1A7GE 2HFUA 1LWFB 4CE2A 5MAOA 5AXNA 1KOOA 4NPOA 4ZVPB 5K8PA 3CJKB 1YRXA 3SMZA 4ZLPA 5D6GA 4XC0A 2PEBA 4OX7A 1IBKF 1VBKA 1HWUA 4ZVUB 2YKMA 4FXWA 3QSYB 1R62A 3PX0A 2VG6A 1N0VC 2IM1A 1RAHB 5AXKA 1M5PC 1N5TA 1XC9A 4KHMA 2FLNA 4UQGA 4I2PB 3DDNA 5M4MA 1X4GA 1TL3A 4MYUA 3IFEA 1S1UB 2APOA 2BRLA 3M8RA 2ZJPQ 4XKKA 3BSCA 1SC4B 3LGNA 2RQ4A 2ZH2A 1YTYA 3KNGA 4MPEA 1NRKA 2AT1B 6AT1B 3I4HX 1UP1A 2YKBA 4C8KA 1UVJA 3M4XA 2W1BA 4UUWA 1RZMA 4Q0BB 1KQKA 5LXRA 2VW5A 3R4NA 2HHTA 5KT7A 3M8QB 1WC1A 2VFVA 2VV5A 1XR6A 3DXSX 3UNGC 1OSCA 1R6YA 3QJLA 2WVFA 2ZITA 3GJTB 1Z5AA 2H9ZA 4EMDA 2DNHA 4OX9F 2D9OA 4JI4J 4NCBA 2UZAA 4NI2A 4HH1A 3U02A 2QL7B 5FDLA 1X8DA 1FI4A 3IR7B 2XZWA 5KFFA 1O51A 4YHHJ 4HH0A 2JH3A 2K2PA 4NASA 3FK4A 4I69A 3OFHA 2DB1A 1VYAA 2VWCA 2HKEA 4K2XA 4JYAF 1HBOB 1XMQF 2JZ5A 1DQ9A 3D54A 3RBXA 1M5OC 1T9XA 3R7BB 3TYTA 3GQCA 2NXEA 1F5CA 2W8LA 2DNZA 3VAJA 4RWWA 4C8ZA 2P8IA 1WI8A 2YJWA 1WEZA 4Q8EA 1U1KA 3TAPA 3PYFA 2MQQA 1K47A 2I5JB 2ZVIA 3EZ5A 1NHVA 2V2QA 2AEFA 4F3MA 1UYCA 3OLBA 4PKDB 2RB7A 2MZSA 1RT1A 1YSRA 4Y2IA 1WDDA 4DR7F 1LW2A 3LWMA 4ZKAA 4RNMA 3BKTA 1QY8A 4JI1F 3RBZA 4WKRA 4YS2A 3DLJA 3LWLA 4TVAB 3BEGB 1Q8KA 2BW7A 4CI0B 4C0HA 1T3OA 3D3CJ 5KFSA 2FD2A 2LDIA 2Q79A 1R0BG 2OPPA 2O67A 4CE3A 1VRTA 1BGXT 2IY5B 5F0UA 1U1LA 5JMNA 2CQ4A 1BQMA 5HMYA 4ASFA 1UPPA 3DLHA 2LDYA 1OIAA 2E5LF 2LECA 5FWKA 3DKDA 4ZK7M 3ONQA 1CULA 3CDWA 3EZUA 3OTBA 5KT2A 3CWVA 2B7BB 4GRSA 2C3PA 3IWXA 2DR8A 2AMCB 5J2QB 1TH8A 5B0AA 1VOMA 4OFZA 5DG8A 3UWTA 2YX7A 1N5YB 3QGHA 2Q6BA 1ZM2A 1XJWB 3QO9B 4HTIA 1UFLA 1FJ7A 4I64A 4XIUA 2CCUA 1TBWA 4IO9Q 3WQ9A 2I6WA 3KG1A 4QW9A 3V6DA 2YBVA 1HPZB 4IH6A 4NZ0A 3NMQA 1DARA 2H4YB 2CQHA 4Q0BA 2PNRA 1UETA 2VA3A 4TXSA 1MG7A 2RU3A 2GZOA 2GIRA 3H98A 4DL7A 3L09A 2B9WA 2YNFB 5ETOA 4F4AA 4LVNP 1EJ7L 6FD1A 4F8RA 4UROA 2RDDA 4URLA 3EMTA 3DDIA 2GQQA 2ATCB 4MKAA 3K5OA 4HHHA 1HQUA 4OI6A 1I5DA 3V4MA 2RIJA 3FQLA 3AD8C 2BREA 3QT7A 2Q1LA 2PMZD 5M4EA 2NREA 3P5TL 2EBEA 4J9RA 3VHCA 4CWQA 5HBMB 4HY6A 4DL2A 3ISND 4WWSA 1PAUB 2QYCA 2WBRA 1FXDA 1ZZFA 2NPFA 1Y0HA 2G9OA 2EFGA 1VRQC 2V4JB 3IO1A 2QTWA 4MPCA 3EHHA 4CLLA 3V5RA 1EETB 3IM8A 3U2KA 4PAAA 1FDNA 4BHQA 4BBYA 3UR0A 2CH4A 3W2WB 2DGUA 4Y0FA 3NWRA 3GIEA 1C1BB 1IKWA 3RRHA 1RT6B 1RE1B 3V81B 1SXLA 1VBXA 1WOPA 1NMEB 4DCPB 2R8GA 2YEHA 2GNKA 1WOSA 1U6ZA 3PFOA 2CGFA 2I8EA 4LIRA 1D9DA 5IDMA 1N8RT 2C3OA 1WKKA 5CABA 2HIQA 2FJXA 3B28A 3QTFA 2F9JA 1WHWA 3DLBA 3KG0A 1D1UA 4E98A 4M5GA 2Y1JA 3K5NA 4R5PB 1WG1A 4A8KA 2XQCA 1X60A 1R8CA 4CRJA 1RT2A 3OT9A 1N48A 2Y1LB 2BRCA 5A0YA 2IWUA 2Q2EB 4RUCA 2GJ2A 2GFDA 4DR3J 1F9EB 3AH6A 4P72A 3GILA 2WVCA 2EWHA 1RTHB 3ZZUA 2W9CB 2VCJA 2RUGA 2VBYA 2ESAA 4KSEB 3MAQA 2XSJA 1U6BA 2ZDXA 1S1XB 1TFYA 5LOQA 1H74A 4EBEA 2YQ0A 3OR1A 1BY9A 1S72S 1FNXH 1F5AA 4WKYA 1HWKA 1YITS 2HHQA 3AT1B 3CE8A 4L8ZA 4Y6IA 4MH8A 5EWFA 2CWKA 3OL6A 1ID0A 3FQKA 1HNZJ 3DLEA 3OJUA 2AJ1A 3AFGA 3A0TA 3L7PA 2QV6A 4DV0F 2XG8A 2VU5A 2G2YA 2UUCJ 4FVCA 3G8SA 4LWHA 5E3CA 1RHJB 3SCKE 4WFXA 2YWFA 4RW8B 2DCLA 4LF5F 2HGNA 4Y2AA 4PG8A 3FFIA 1GX6A 2RHQB 3TJ8A 2X1FA 2IMWP 1VQKS 2ZM6J 4Y28C 3CC2S 4GKKJ 4ZDNA 1VJQA 1I59A 4X65F 2FY1A 3W8PA 4N47A 1WUUA 2OPPB 1VQ7S 2XY6A 4LPBA 4CTAA 3GPAA 4ERDA 3GU0A 2XGQA 3U27A 3AOBA 1UWBB 3MUVP 1RKIA 5M2PA 1TP7A 4NE9C 1UPMB 3MM5A 4ECSA 1IR0A 2F4FA 1HL6A 3GIFA 4URSA 3OTDA 3O2IA 4LRFA 5C42A 3RR7A 3VCDA 3Q8UA 1CJVA 4OHXA 2ROPA 4U7OA 3DM2A 2UP1A 4L90A 2F8EX 4MOTA 1U25A 2QG2A 3I56S 3N9UC 3BR8A 1JLCA 3MPUB 1M1HA 1VISA 4O3SA 3INWA 4Q7AA 2LXFA 1TL1A 4Q2MA 4F0HA 2FWYA 1SKUB 1B0TA 4M63A 3JTPA 2FJAB 2W4CA 1WHXA 4L75A 4NLYA 3BR9A 4CCHA 3I6PA 1NK7A 3G7EA 4LJMA 2H5IB 4OZNA 1AROP 1RLCL 1WSVA 2UUAJ 2M70A 2V0NA 1U26A 1UY8A 3P49B 5HATA 3H80A 2YX1A 2UV8G 4NMXA 4NLWA 2CNLB 3SQGB 5KFZA 1HR0J 2DNPA 3TTZA 1TK5A 3M6UA 1KDNA 3MTKA 4ATNA 1J27A 5AE1A 4F04B 4PG6A 4U7UD 4P7AA 2XMKA 3M1VA 2QLBB 2J5AA 4QPXA 1B99A 2XI2A 4WP8A 3CD5A 1YX2A 1KVJA 2IHR1 3C6TA 4X66J 1EKRA 3CTRA 3I31A 1UYFA 2AF6A 2RKIA 5DDQC 3MMAB 2I0XA 2XC9A 1RT2B 4KYZA 3NMRA 5H9FK 2DRBA 3A8KA 2BJ3A 3FFIB 4KR0B 1HYSB 2MEWA 3QATA 2EBGA 1GXUA 3G6XA 4RWXA 3KLEB 2CUYA 2HRUA 1LW0A 1Y9OA 2BR0A 4KO0A 4I2PA 2LYVA 2GW8A 2ASLA 1TKDA 2V4JA 3IC1A 3HHUA 2XEXA 2YI5A 4HHJA 4NI2B 4U7UK 1PILA 1YS3A 4RU9A 4A8YA 4B3MJ 3R92A 1U2OA 5HP1A 1TC0A 2YGFA 3W7BA 4PCQA 4Z2XA 4GKJF 3T1HJ 4DR7J 2AJFE 3N6MA 3VVTA 1PYOB 4U96A 1XBWA 3CUNA 2H8MA 1W2IA 2LA4A 1S9EA 2AW0A 3N6NA 3HZGA 4DHVA 1S0VA 1REVA 4Q5VA 1MU2A 4DR6F 1S97A 2W2OP 1TUVA 2ZNYA 2W9CA 4I7FB 3H5YA 1AZSB 3OPKA 2YWGA 4C6AA 4F0KA 1GNKA 2LKZA 2YKMB 5F8MA 4IRKA 1Q53A 3MD3A 1S1XA 4UOHA 4U8YA 4K4WA 2CJKA 4B3TF 1DFDA 4KPCA 2HG1A 4DPTA 2HBQB 2V2VA 4AT1B 3R91A 3TQ1A 2HNYA 3QDDA 4QPJA 2QRRA 1UKUA 4NWBA 4ES3A 1RWVB 4AYBD 3UR3C 4DV6J 3OSNA 1VQYA 2JSXA 2RS2A 4C8YA 2WB1D 5IV4A 2HNZB 3WHIA 5FJ4A 4DQSA 2FUG9 3P45B 4KAIA 5HN0A 2FHMA 3ZNUA 2MKKA 2K5BA 1TVRA 1SBRA 4B17A 5J71A 1IKWB 2V2KA 1HD0A 4EBCA 1FJEB 3GIJA 4DZYA 5J6AA 2ZZNA 2HMIB 4PYAA 2H55A 4ZVQB 2GQCA 2BJ1A 3A0ZA 4X4TA 3KJQB 4B3RJ 2YEEA 2WW4A 3M8PB 2M3DA 1YHQS 1FVSA 3HYYA 2FGCA 3DRSB 3UFCX 2XLJA 2MHEA 2MPUA 4ID8A 2E7WA 4UOGA 1NPPA 1WG5A 5D4NA 2F7VA 3R7SB 2XYPB 1X4EA 2HS0A 3QGGA 4H4MB 3OR2B 2GO9A 3T41A 3C46A 3NNCA 2BM1A 2DNKA 2XB2D 2GGPA 3KHLA 7FD1A 3J7YU 3SQGA 1CLFA 3O0IA 4USMA 1ICEB 1TKZA 2N7CA 1YT0A 4DV5J 1SCJB 3JYTA 1S0MA 2FVRA 2GS8A 2J0XA 2QA1A 4ITSA 2CDQA 3VHAA 3C8YA 2ABYA 3K7RA 1L3SA 2PT0A 4LREA 1TILA 5J2PA 1UEVA 2JLEA 4ED4A 4XCJA 4BIUA 4K5RA 4KQZA 2R7QA 5L46A 4QW8A 4JB8B 1RU1A 4JI0F 1QTMA 1QAJA 3W63A 2IRXA 2C3MA 4DSLA 3P8BB 2EXLA 3GG0A 1YESA 2PGCA 3I87A 3ENQA 4BWJA 5BYSA 4P9SA 4JI1J 2M7SA 3TEGA 2D3ZA 3R7NB 3GYXB 3H59A 2XM3A 4J9QA 2V8VA 3NS7B 1VLYA 2IDLA 5K14A 2YECA 4GGLA 1EI1A 2ZOGA 1I6JA 3A4TA 4IFYA 1LW0B 4NLPA 3KHHA 3V6DB 3LALA 4OZLA 4EEYA 4CO4A 4ETZA 1BQMB 4R3MA 4C3MA 2C2ZB 1XMOJ 3T5KA 4MB9A 1HI8A 2YE6A 3I0RB 2HVIA 5AJ3J 2JOQA 2H54B 2ILZA 4HHUA 1FKPA 5F3KA 5LM7E 4LRCA 3ZC4A 4LF9J 4HDHA 4QWDA 2E5HA 4FYWB 3HHLA 2XDLA 3M8WA 3CJ8A 5FDLB 3C11A 4DCJB 3CCRS 2VFUA 3HSJA 3Q2SC 3HXMA 1RT1B 3OMUA 2B9XA 3OFFA 2DHGA 1JLFB 2UXCJ 2L08A 1HD1A 5B0BA 3OL8A 5HO4A 1HBMB 1M5VC 5L1KA 4HY1A 1F2HA 3D36A 1D09B 5KFVA 3IMQJ 1XIQA 3MCNA 4QR1A 3TRGA 1REVB 2CPYA 3NRBA 2GMJA 1LW2B 3BGUA 4HI1A 4WYWA 1KS2A 1RAOA 1PJ5A 4X62J 3D1HA 2ZOFA 4LQ9A 2X7IA 2C1IA 3T2SA 4NRTA 4EEHA 1RT4A 2HVZA 1OYDA 3TA1A 4NH9A 2F4VF 4H4MA 3IWNC 1GX5A 4PXCA 1GH8A 3NCRA 4ES1A 4M5DB 4WIQA 1HHQA 1G2EA 3ILIA 1NSQA 4A8WA 5F8HA 1YBUA 2YGAA 5GGZA 3ULHA 4OLOA 2FVQA 2CFXA 1BMQB 2VFSA 1M1GA 2AYMA 1DLOB 3NKYA 4QIEA 4WFNQ 3GB0A 1THNA 1B62A 5E3AA 1N56A 1ZBTA 4FF4A 1RWXB 4EZ6A 1F9FA 3FJ2A 2D3OR 2KKHA 3EM1A 1QUVA 4V1Ak 1UAWA 1YJWS 4QYZJ 3CJSA 1ACMB 4PUOA 3E01A 5CYJA 2HS4A 3LPYA 1QLNA 1HHTP 1IWAA 2CIMA 1W2BR 1EP4B 1VC6A 1JKHA 3M8QA 4RW8A 2VQEF 1FK9B 2ZH6A 3OTEA 3NG8A 3LP0A 1RHUB 1Y5NB 1MLAA 1TUWA 3OTOJ 2IYIA 4YR2A 2HQFA 4O3PA 3C2PA 1A4HA 3HHLD 4G6VB 3MNRP 2YWWA 1IKVB 2XDUA 4GCZA 2YEIA 3MR3A 1CC7A 2DGWA 2FYPA 2YQ3A 4RW9B 4PYDA 4DUZJ 2CADA 3MEEB 3RLRA 3CIMA 2E44A 3NY0A 4DV2J 6FDRA 4M5NA 4B9MA 2QZ8A 4QU6A 2XHRA 1RTDA 2OPSA 2YNGB 4RKUC 1VBYA 2OSQA 4USWA 2AWZA 4ZCKA 2HLUA 3SI8A 4O09A 4AL5A 3K59A 3D3BJ 2BMBA 3CMAS 4EFAC 3P96A 1GMWA 1S6PA 4Y2CA 3DHWC 2AV5A 2QG9B 4AS9A 5F8IA 3RBEA 1NDCA 4M1KA 4TQRA 4PEOA 4NYOA 2HHIA 1L3KA 3GV5B 2XMAA 1MN9A 1NDKA 2V8HA 3D66A 1IVZA 3VAIA 4U93A 2FXSA 2XYHB 2OAUA 1UCNA 3SCJE 1NEEA 4PABA 3CMES 4I2QA 5LT5A 1Z2ZA 1X4CA 1M1KT 1YK9A 2XZDB 2QG0A 3JQMA 2M52A 3QIPB 1A0OB 5KFWA 5LJ5Y 2IORA 2BX6A 2YQ1A 3G4SS 1FE0A 3PNIA 4ED8A 2QA2A 2V4QA 2M9KA 1FX2A 1KQFB 2YEGA 2JEJA 1Z1ZA 1HI0P 3OL9A 4K4XA 2WONA 3A13A 2ZH8A 3T1KA 2HQ3A 2JRSA 2V9WA 2IIHA 1EX8A 4HEA9 4KY3A 4UZCA 3W1YC 5F9LA 1ZW9A 4IOCQ 3EHJA 4NEZA 2WVEA 3CCJS 1U1OA 4RX6A 3RLPA 3DI6B 3T19A 1HQUB 2GAHC 4C11B 3CF5Q 2YE4A 4GQTA 1OQ6A 4YP3A 2V68A 1FD2A 1DQAA 1HNIB 1P27B 3QPIA 4CM2A 3CMQA 1RT5A 3T9ZA 1UY7A 3WX8A 2HQCA 2NZCA 1DLOA 3THTA 2BKNA 4ASBA 5DQIA 4I7FA 4ALZA 1JIHA 4ZHRB 1B7YB 5LMUF 3W8GA 3PKYA 2HHHF 1IUJA 1C0UB 1QSLA 2CKWA 3BPSP 2L41A 1Y5LB 1AH6A 4HT5A 4ELUA 4QWAA 1BD6A 1UYDA 1S9FA 4AL7A 4LBPA 3EKRA 4F36A 4YDDB 1VQSA 3TJAA 5F8LA 4LT6A 2QN6B 4W90B 4ZVOB 4YB5A 5F3TA 1SQEA 4LF7J 2HNZA 4A8OA 5KFOA 1PIEA 4HZ0A 3HHLC 1FA0A 3FGVA 1RP5A 5BYQA 4N77A 4QWEA 3NMAA 1KFDA 2BRKA 2NR0A 5C2GA 3ZZPA 2C2OB 1CJUB 3TP2A 1YQHA 1YBTA 1LFPA 1Y11A 3EE3A 3DOKA 4KBIA 3KTQA 1BUXA 1CJKB 2Q66A 2WAQD 3WHAA 2KFNA 3T1YJ 3VQTA 4GC6A 2KTQA 2DXEA 3L9ZA 4TYBA 2OPRB 3N79A 3PRVA 2YI6A 5A8RA 1U47A 5D7RA 2HW3A 2KVQE 2V8PA 3LO3A 4ENOA 2R4FA 3BGRA 1WKLA 1D9FA 2DBBA 4DN0A 4O3QA 4DFJA 4TY9A 2DGOA 2F1FA 4GO5X 2L48A 1VRTB 4NCGA 4A48A 4LMZA 2JJ4D 2EG1A 3V6KA 2PEHA 2AX0A 1CC8A 4DL5A 2AU0A 4F2RA 5HL7Q 3GZ7A 2R2RA 1QVFR 3Q23A 5H9FJ 2VBZA 1GEHA 2WCXA 3P4UB 2EK6A 2AYEA 3Q0AA 3D6FB 1HYSA 3QZ7A 2XDXA 1NK0A 3TZ0A 3OXFA 2VDHA 1AW0A 5HLFB 1TQLA 2FLLA 3I4PA 2IPOB 3GG1A 4CLFA 1X9SA 4FMTA 3I96A 4WF9Q 4WZMA 3U2DA 3DLKA 3HHEA 1IN0A 2O01C 2C3UA 4BC9A 4F3OA 2B51A 2QLXA 4PXEA 1BQNA 3IBWA 2QX0A 3MMCA 1TL3B 2BU2A 3TX8A 1X7VA 3M32B 4LFAJ 5IZHA 2AGQA 3HKWA 1CEZA 4HYPA 1S6UA 2EK1A 3GWCA 5BR8J 2KG0A 1YG0A 4DV3J 3U1NA 2AHOB 3KLGB 3H40A 3C16A 5KFLA 3MEGA 2QGFB 3BQ0A 3K2YA 2C2DA 2RUSA 4DR4F 4FZVA 8RUCA 5D3GA 3RW6A 3BO3A 4A46A 3DXBA 2HZCA 5ETMA 2OLWA 3LANA 2CJQA 4TU8A 1UYEA 3KKFA 4CLPA 2VG6B 1EA6A 4QIFA 2OPRA 2BABA 3CJTA 1FWPA 3Q22A 5HSPA 5D0EA 2D1CA 4AL6A 1SL2A 4JV0A 3RYLA 5E5NA 4A8MP 1Y8NA 2J9EA 5DRKA 1ZXNA 3G8TA 3DU5A 4LRAA 2LQBA 4AWOA 3OFEA 1KQSR 1KZNA 4LR8A 4RNHA 3UD5A 3FVYA 5B7WA 1VQOS 3PIPQ 1ZPVA 4E2FB 4O3RA 4LWEA 2QJ3A 2H5JB 1U4BA 5D0HA 2Y0BB 2YEAA 2BSMA 2R9LA 1TVRB 1IKXB 3GYGA 3PEHA 4M5MA 3G6VA 3LUYA 2HZVA 1Z5BA 1OPIA 2UXDJ 2KT2A 3I5AA 2RQMA 3KG4A 4MBCA 3TEHB 3CCVS 3QAEA 3EGNA 4O0BA 2OUGA 2GVZA 3QT6A 4NLQA 3GIKA 2FLOA 5I3UA 1RU2A 3AB2B 1S99A 1JNRB 3GIGB 4DUZF 3B6BA 3BKFA 1NSPA 1PG5B 2DIVA 1TKZB 3OR1B 3ILLA 2YKOA 4ASAA 2KRBA 2FLPA 1L5UA 1HW9A 3KK1A 4WFZA 1RTJA 4G1IA 3EHGA 3RB3A 1LKZA 2GVDA 2EFPA 3ZTPA 2YKNA 1R3NA 1DAXA 1H2TZ 3HPOA 1X9MA 2QMUB 1L3VA 3MHYA 1VIOA 3UCZP 3MM9A 4YFUA 2UXCF 3MOZA 2ZH5A 2G1DA 3CWJA 2EC0A 3CPWR 2Z30B 3AOAA 1UEUA 3KK1B 2LQ9A 2DPJA 5F0WA 1Q95G 4KO0B 1YERA 3MM7B 1Z59A 4Z7YA 4KV8A 5JXSA 1TELA 2MKCA 2B7CB 4YKZA 4JI3F 5E3QA 4TU9A 3KLIA 2XI3A 3AXMA 1MROB 4X4OA 3CRKA 1SL1A 2HAIA 3VADA 3FSXA 2M8HA 5GADI 3G2XA 2FWZA 1VQ8S 1K1SA 1YSZA 3BO2A 2MKSA 4J9MA 1N32F 4D3GA 3BKUA 3MMCB 1LWCA 3SFUA 3NAIA 4OZ2A 1SJ3P 3D6TB 3NEKA 4JYAJ 1GKZA 4H81A 3F0NA 3WX4A 2CNNB 3J7ZT 3UCGA 4N41A 2ZC4A 2XWYA 3OVAA 1U1PA 2MQNA 3EKOA 3TAMB 1JLQB 1F3FA 4FKYA 3GP9A 3NGDA 1JLAB 1BLUA 1NHIA 5K8OA 1FNMA 2FQQB 3FCWA 4I56A 2HWTA 3R3TA 5IT9U 4C8MA 4V19X 5L38A 2HBYB 4DX8H 2K3IA 3DLGB 1S6QA 5J2MA 2C1EB 3MCSA 1N4LA 3INXA 1C2PA 4NYPA 3JXOA 3MM8A 3H4LA 4DV5F 2UUAF 4CT9A 4N76A 3BBBA 1C4CA 3PYGA 4K0KJ 1LXJA 3I9ZA 4HLBA 5D4PA 3IN5A 2N3OA 4B3MF 4EWTA 3S5TA 2ZZTA 1K73T 5EWEA 1YKWA 4C98A 1U2FA 3H7HB 3AODA 1CJVB 5EX3A 3TVYA 1IJEB 4YY3F 1NK4A 1RAIB 3FDSA 4O4RA 3MR2A 2Z2YB 1NK6A 3DYAA 3HJFA 1DTTA 4P7VA 4M5LA 4FXDA 3KJVB 2YY3A 4NXMJ 4OHVA 3B54A 3SYZA 2XTJP 1I58A 3FEYB 3R2CJ 4ZPWR 1FDDA 4JUZA 4ECVA 1T05A 2VA2A 1B0VA 3MUMP 2CQ3A 5DDRC 4CWRA 2IM2A 1UVNA 2QIFA 2L3MA 3EJMA 2VBWA 3TOQA 2DVIA 1SV5A 3UD3P 5FD1A 2JVRA 2M88A 1HQEB 4FPIA 2XULA 4YDXA 2D74B 3UVJB 2OJ3A 3N5BA 5J1EA 4N56A 2W7AA 5HQMA 3LP1A 4ZIVA 1S16A 4ELVA 3J81j 3POTA 3EZOA 3PEJA 4MFBB 8ATCB 1HARA 1K44A 3LMMA 2VFTA 2XS5A 4PWWA 2NXCA 3K5PA 2ASDA 2YNHA 3M9NB 2KFYA 3UCUP 4H4OA 3MAAA 4GKJJ 1BYQA 4USHA 2KFZA 3ZM7A 4LSNB 2WSCC 4DFMA 1AXQA 2E1MC 5D4OA 3RAQA 4OYBA 1WSRA 3P3DA 3QRQA 4KTNA 3CW2C 2KDOA 5SZTA 4LFAF 1DHMA 5K14B 3T1YF 3M8ZA 2CPHA 1VJWA 2MQPA 4KGXB 2XMUA 1H72C 5K8NA 4QCLA 2WBMA 4KE5A 4CO2A 2CPJA 1XMBA 1Y5IB 3FC9A 3KNAA 4J9LA 5CYQA 2YK9A 3GMGA 3OUYA 4ZJQA 4WP3A 3DRYA 2IOPA 2VDIA 2XWXA 4BS2A 2VC0A 2CJAA 2CDRB 4MKBA 2LEBA 2IVFB 4KFGA 4WYLA 4NLOA 4OJGA 2QFIA 3BDEA 4ICLA 1KEKA 2HQDA 1YJVA 4YB1P 2VC1A 4LF8J 3HVRA 3AOCA 2Y8YA 3G87A 4DU7A 2RQCA 1T11A 4J9OA 4IFYB 4FF2A 2KO1A 5FNDA 1WTBA 4X4VA 4UUXA 4QJVA 3CULA 4X4PA 3G75A 4PRVA 1KQGB 1AUSL 1K1QA 3OLAA 3KDNA 4B3RF 3MPDA 4ZPTR 1LWCB 4PR6A 1UW4A 1M0SA 2YEJA 3R6GB 1HMVA 2C2AA 4HKQA 1WC5A 4V19J 2YWKA 4KPYA 2D7SA 2LU2A 2VG5B 2ZKUA 1WC4A 4OYIA 4HYKA 2XJJA 2E0AA 3UDVA 3DMJB 4I2QB 2ZH7A 2ZUAA 3M8YA 5JENA 1VIXA 4U7NA 4LSLA 1KFSA 3NOCA 1YIJS 2L9WA 2QSWA 4NCGB 3H20A 3KUGA 2E9TA 2HIYA 2RH3A 3CEDA 1XMOF 4ECYA 4AXJA 2XSJB 1ZTTA 4WUDA 2FTKA 3DYAB 1FRHA 3GSIA 3QYYA 2XJXA 4P74A 3KLHB 3EVWA 3GONA 2Q8FA 3A8IA 1OSFA 1EAYC 4CLWA 3CCZA 1WNEA 4IRCA 1S77D 1DTQA 2Z58B 3D67A 3M2VA 2VPXB 4CO0A 2BE2B 3TUJC 4N5SA 2XCMA 4LWGA 1H7UA 3SEOA 4YKUA 1PYTA 3B4DA 2U2FA 2YKPA 2OHDA 1SC3B 3BSAA 3CRLA 1AFIA 4YKRA 1TAQA 4MYTA 2HURA 5EUHA 3TUZC 4PL9A 5F5RA 2ZHBA 4O23A 2PI5A 2XZTB 4HI2A 1NJXA 2F3JA 4QR0A 4ZVFA 4JI3J 4LF5J 5A2QY 2CQCA 2G13A 1KBRA 3QWPA 3VZIA 1RXOB 1KHVA 2ZEJA 1ZM4A 2BW2A 2DIUA 2P6TA 4LFCJ 4L72B 1Q4RA 5KT3A 2MSTA 3DOMB 5DGAA 4IRDA 1HNZF 4WUBA 2HFNA 1MSWD 2AKWB 1YC3A 3LP2A 1S9GB 3QFHA 1UFKA 4RW4A 2K7KA 5D4LA 1N34F 4YKQA 2W2NP 2KG1A 1JJCB 3PDNA 4EYIB 4F4KA 1CJTA 2LCWA 2LXUA 1T8EA 5EWGA 3WC0A 1H73A 3UDCA 2MJUA 4JV2A 3A0WA 2X3GA 3G96A 1IQTA 2M8DB 4M5HA 2CQ0A 4OJ3A 3QMQA 3OVSA 4XTTA 2KJVA 1MNEA 5F8JA 4DL6A 5KFAA 3JAMU 3Q83A 3HEKA 3C15A 5HANA 3IA0A 2BZ2A 5F8GA 4I4BA 2KI2A 5DJBA 3H5SA 1R31A 1UTAA 1HIYA 5IS2A 5A8WB 2MJNA 4R8UA 1GQEA 1U1RA 4J9VA 5D3GB 2VKRA 5C93A 1N6QA 2ZZMA 1UJ5A 2FHKA 3GCWP 4RBTA 4DV7F 1FCAA 3JSYA 2XX5A 1RCOB 4A8QA 1AMWA 3OXLA 4ICLB 4MIBA 4I6YA 3D9BA 2VFRA 4IFVA 2AJ2A 3I32A 1S0NA 4E8UA 1NSAA 5L39A 2QLJB 1N33J 4PWDB 4C8OA 1Q81T 3GIGA 1NK8A 4XDDA 4G3IA 3MECB 2WTFA 1LFWA 1UWBA 4H4KA 3KLGA 4CWPA 1FHTA 1LV5A 4KJIA 1WC0A 2JFKA 1JKHB 4F3QA 3CCTA 4JI4F 2YEFA 2G2ZA 4LRBA 5KG5A 5GMDA 4PG5A 1J5EF 1YRUA 2Z8QA 2FJEB 1JLEB 4O4GA 1FKPB 1PSDA 4YOEA 2F9DA 1F2GA 1T9UA 2HRTA 4L91A 1BQNB 3ETMA 1HBOA 3H5XA 1RHMB 4MK8A 5GAEU 2IMOA 4P71A 3T0HA 2MB0B 3CYGA 3UVJA 3O44A 2EFOA 3EVOA 3VGTA 4WP9A 2K8GA 4YKTA 2F8HA 4NLDA 3D1OA 2DRAA 4E72A 2E7XA 2W01A 1Q78A 2FGOA 3CJRA 4USIA 2XLKA 2ZJRQ 1V5VA 2KT3A 3W9JA 1FX4A 5LL6d 1BGQA 1LK7A 3MCOA 1RBOB 3RUBL 4LSNA 2XMVA 3BZQA 1WELA 1SL0A 3S7RA 5IFMA 3G82A 1WWHA 3HSZA 3HVWA 1J5OB 1RWOB 3PY8A 1PVGA 3DRRA 4C4WA 1IBLJ 3CJ5A 1JM6A 2BKPA 3KMSA 1U48A 4J37A 3UN2A 4C3KA 2DD8S 3HFVA 4ZVTB 3AJ1A 2FTRA 1YI2S 2D3O1 1TKTB 2MLXA 1NXIA 4ZMMA 2VQFJ 4K4TA 5CYMA 3IBFB 4ECTA 3W9IA 2W7OA 2BU7A 3NGUA 1FDBA 4NL5A 5C24B 1IKYB 2UUBF 4ZPAA 4IG3B 2XO6A 4H4KC 2NXUA 4WFYA 4FDFA 2MZJA 1H7SA 4E02A 3VV2B 4IFVB 3FKBA 5GVQA 2DGTA 1DY3A 3NP5A 4ED0A 3ISNC 5G0RB 3IRWP 3GTYX 4OMFG 2O5DA 2OTLS 3GFZA 2ZWOA 3UE2A 4V25A 4B3SF 4L73A 2BT0A 2ZH3A 5CQGA 1BKNA 4L3NA 2FVCA 2CZ9A 2R8HA 2JEGA 1W7WA 1RACB 1NJIT 1QM9A 3D1QA 3G9CA 1IM4A 2G1HA 4I0WA 4CWOA 2IDEA 2K06A 3VAMA 4QBUA 3BREA 3M6XA 4DR2F 4PQUB 3G6YA 2IVMA 4CTAB 3VQSA 4B9TA 2H4WB 4HVZA 1Q5YA 5IM0B 5I3PA 2EKYA 5ETNA 3KWMA 1KLNA 3QLHB 1Q7LB 2DR7A 4OHYA 4CH7A 5DLGA 3TVKA 2B0GA 3B25A 3VGSA 4PXDA 4KH0B 1RT6A 5EN1A 2MZQA 1V9OA 3DN9A 2DISA 1ZS6A 1VC0A 2EFNA 4UT4A 3R27A 1G1XA 1NK9A 3FBFA 5KFPA 3RB0A 1NB2A 1YJRA 3PYEA 4I67A 1YC1A 3WC2A 5KFRA 4B9NA 4DPWA 3VVUA 2GA7A 2QF6A 4E0DA 5M4PA 4I6AA 3TUPA 2XDKA 2X51A 2CA9A 1MROA 2BA9A 3GE9A 2R7TA 4CH1A 2OELA 2ZBPA 2HHVA 3MECA 2XK2A 2V63A 3MTJA 3HZ1A 3K89A 4AUKA 3MMBB 3WBZA 3Q8SB 3CC7S 2ZKTA 2EFVA 2E1RA 3D0IE 3D7SB 4DX5A 1WOOA 2BU6A 2Z0GA 3HJVA 2DNGA 1EB0A 1WF1A 4M95A 3RRKA 3J7A1 1LWXA 2DR9A 4TLRA 1G7CB 5KG4A 4QWBA 3OR2A 4ANCA 3LTOA 3H5UA 4O07A 2YKNB 1JLGB 1XR7A 2GGPB 3TI0A 2J6SA 1W26A 4WPAA 4ED2A 3DRSA 2VONA 2Y3YA 1WJ9A 5DLFA 1XNQJ 1Q7YT 1UZDA 4OX6A 3K8WA 1CVJA 2LP4A 2YH0A 5GADU 3ZTSA 1N52B 3SCIE 3QFWA 2JFDA 4W4MA 3S1TA 1TIDA 2RDIA 1N34J 3MUTP 2R42A 2YE5A 2UWDA 3LPSA 1O8BA 2YKCA 3CCES 4R1FA 3PW4A 5D8HB 1U1QA 5SUHA 3M8PA 3GJQB 1NKBA 3OWDA 4DS5A 2W4DA 2R8IA 4RW6B 4DLGA 2YI7A 3OW6A 4F2SA 4EGLA 2FVPA 4Y2KA 4URQU 2J0WA 4S0MA 2ADCA 2RSQA 4JV5J 2ZBIA 1U8SA 3J7YI 1A9NB 3EDRB 4BQJA 2PN6A 3H0PA 5L3JA 5CTXA 1HA1A 1RTIB 2COLA 1RA7A 2KJWA 3AB4B 3LA0A 4XK8C 3OFGA 4Q20A 3TA2A 2NCKL 3C6UB 1ZZNA 2KXFA 1NKCA 4EGKA 4NLXA 4F4YA 1UYGA 2J6TA 4FBUA 4DF4A 2FC8A 1D8YA 5KFDA 1WTFA 4FVMA 2DT9A 4E00A 1HNXJ 4JI6F 2KXHA 2RHSB 2XYGB 4NA2A 4NZ6A 1ROFA 3V6HA 5CPHA 4JI8F 5ETLA 4G1QA 3MAHA 5HMXA 3TO8A 1X5SA 4JI8J 1UVKA 1TK8A 3BV8A 1M5SA 3V2UC 2W2MP 3CJ4A 2A2CA 4U9RA 3R1HA 2BE2A 2V9KA 3C14A 5GMEA 1NNDA 5L9XA 4RW9A 4EI2A 1RHKB 4QOTA 2GJIA 2C1GA 2RKIB 5I3UB 1J5EJ 2VPWB 2D9PA 4MT1A 1X4DA 1KTQA 1Q5VA 3SZ2A 3AXKA 3NAHA 2QLFB 2ZBQA 3E01B 3LQVA 3CB4A 2R7OA 1RWPB 4WJBA 1IWGA 1NDLA 1QYEA 3C16B 4LF8F 2LMIA 2I38A 2W9AA 3KK3A 2CZVC 1ZH5A 3MEDA 1YVFA 2MY7A 3I5BA 1HBNB 3QO9A 1MWZA 4HR2A 1VQNS 3I9V9 3FRZA 1T95A 2D41A 1Y4SA 1SI9A 3KHGA 3D0HE 3CDBA 3FMWA 4CO1A 3D0BA 2RAQA 4JOUA 3DRXA 5DO2A 2BUNA 3IS9B 5T7LB 1GXTA 5J1EB 2R8JA 3MEKA 5BR8F 1FERA 3FUYA 4O4GB 3L7OA 4P10A 4LBIA 2RDJA 1ZA1B 3ZNJ1 4USVA 1UY9A 4TN2A 1FRKA 1NJWA 3R5DA 1YJ7A 3ITHB 3Q8QB 2VKZG 4OJ1A 2IFXA 3ZZ0A 5KT4A 2AKPA 3VHQA 5I42A 2BJ8A 3PYDA 1RAAB 1Q8IA 1UA0A 3NNHA 5C42B 2XHXA 3GR0A 2RF2B 3M2UA 3M30A 2IJNA 5L8RC 3N4WA 5KFHA 3M6WA 2CQBA 2JKIA 2JEIA 3TA0A 1S76D 4NZ7A 5KFBA 1I5AA 3ADAC 2MYFA 5F3ZA 3ZZTA 3DRRB 3OL7A 1RI7A 4KGMA 2HWHA 4OYMA 2MMYA 1U0SA 2C2NA 1I1GA 3PJWA 1PBAA 2F63A 4OZ1A 4N8OA 2L9NA 2H3EB 3KLEA 2MSSA 4ZVEA 2CQ1A 1VQ9S 2XX4A 1D0EA 1N5YA 1YJ9S 3N0VA 4KKOB 4Y3CA 3PX4A 3KMQA 1CQNA 1NPKA 4GT8A 3HFZB 1KLMB 3H25A 1G4CA 3F44A 1RTIA 2GAGC 3FBEA 4FYDA 3TARA 3R5JB 2F65A 2XS2A 1CS4A 3TZ4A 2VZ9A 1S4FA 2YKIA 1S9GA 5AJ3F 2ZH9A 2OD6A 4W98A 2GCFA 2IYGA 2V69A 2JL9A 4A47A 5DQGA 1VQLS 4F67A 1UJ4A 4DV2F 3TZXA 1IBKJ 5T14A 1SJRA 3CD7A 3WQPA 2HQIA 1RWNB 2VHGA 2EXUA 1R7IA 1RYRA 3RAXA 4MKVA 7FDRA 2MZ1A 4FCPA 5DETA 3RTVA 4C9DA 1EETA 1R0CB 2MKYA 4PPZA 5KG7A 5J2PB 1U1MA 2KVIA 5C7PA 2GV1A 1AJ6A 3R4MA 4NLVA 3C0EA 3CGZA 5HQLA 2RU9A 5CHCB 2VASA 2WZ1A 2E1PA 3BBFA 1BQXA 4Y00A 4DV7J 3JYTB 2WSFC 1KD1T 1VMBA 4LF4F 4QZVB 3KLFA 3R4OA 4B3SJ 3GIIA 2IWXA 2OTJS 2FZKB 2LQ8A 1LK5A 4CE1A 1WKJA 5CH7B 5IN9A 4QR2A 2IJRA 2E7VA 5HAOA 4UZBA 5ETRA 2B5JA 4Y2MA 3ISZA 3EXCX 4XCLA 3OV7A 3SQOP 4CWTA 3MPVA 2DTJA 3R8YA 1HBUA 1NJYA 4LRDA 1TZ0A 1OWXA 3O1LA 2CWXA 4KSGA 1NHHA 2ASJA 1V3RA 2EC2A 2O1WA 3DCAA 2IA6A 4KH1B 3JSRA 5LSOA 2YEDA 3ENAA 2OKQA 1T7PA 4NA1A 3SV4A 3CO9A 1XMQJ 4CWFA 2QFOA 1FRJA 2UUTA 1MU2B 3K17A 2F5GA 1MMLA 2EEYA 2CQ2A 4FPPA 4B02A 3TZ5A 1IBMF 2WW8A 1FKOB 5EHHA 4ZVHA 3U1MA 4DUTA 4JQLA 2J7KA 2JHEA 4JAVA 1SH3A 3FSYA 1SKWA 3N01A 3JTNA 4UOCA 2EVZA 2B9YA 2VODA 4CWNA 3HVTB 1DTQB 1HWJA 3AD7C 1ZETA 2GC8A 3R1LA 4LF6J 5DDOC 2BM0A 4L94A 3FBBA 2XABA 1N5VA 2DO4A 4XIQA 4Q8FA 1M5KC 3RGIA 2W8KA 4ZLLA 4X2BA 4DLEA 4DX7A 2BKOA 4Y34A 4WU3A 4NOHA 5HROA 4JI5J 3MURP 1TR0A 3O5TB 3QJPA 4M5JA 4JV1A 3OSPA 3MCMA 4MFBA 2P9GA 3MD1A 4O0IA 3BGFA 2XCAA 5CYMB 2QLWA 2UVUA 4HDGA 4NXMF 4DSJA 1WD6A 3CCQS 3HCXA 2CPIA 4DCOB 3RRGA 2X3DA 4F4WA 1R0AB 4HACB 4OX8A 4KHRA 3TJ9A 4LF7F 3QRRA 1QD1A 4DL0C 4L93A 1SV5B 2EW9A 2FIUA 3JAMY 1N5QA 2CCTA 4OZ3A 1NPRA 4ED3A 1NUEA 3TVZA 4PRXA 4K7QA 4O0NA 3BJYA 3RJMB 1NU4A 5ADZA 2QE5A 3HX9A 2FVSA 4XKOA 2H65B 4DV4F 1S7IA 4LSLB 3VAHA 4KHPF 3M30B 4F26A 5L9NA 3ELHA 2BACA 3MZIA 2KZMA 3EPIA 3LP1B 2P9CA 2XS7A 2BE7D 2DHAA 2OMLA 1XNRJ 3MM6B 3UN3A 4UW2A 4ZVIA 5T41A 1RAJA 2ACMA 1VBZA 3E51A 1RADB 3KUHA 5DQHA 2YH1A 4LF1A 2KHDA 4OIXA 2PC6A 3G82B 4QIVA 3ZKDA 1PJ6A 3IEDA 3T5JA 2DCUB 4MP2A 2HKJA 1YGYA 1ZTWA 1GAOA 3ZXQA 4OHZA 4CLKA 2BANB 3VGUA 4PWDA 2NLWA 3KYLA 4C0OC 3QGPA 4H7QA 3MM8B 4QYRA 1IQZA 2AQ4A 2KM8B 4JAUA 3KXDA 1P6TA 4JI0J 4YKXA 1FESA 1Q0NA 1YLXA 2HLTA 2MZRA 3PXGa 2YE9A 3PZPA 2C2EA 1SIZA 3HP6A 1QSYA 4WK3A 3V4IA 1EQ0A 2WRMA 2XO7A 1HWLA 2HFOA 4IDKA 1S1WB 2RD5C 3PW5A 3E3XA 1R8PA 2IAJB 1ZAWA 4R0EA 5K8MA 3DC2A 3PTWA 1PC5A 1ZOTA 1JLFA 4EGHA 2AEJA 3BQ1A 1S79A 4EZ9A 5J2QA 3OW2R 2G0CA 2ALYB 3OTOF 2IJFA 2D69A 1EQMA 3K97A 2R7UA 2MQ8A 5KFJA 3CC4S 1G3OA 3EUNA 3IAM9 4WUCA 2AEMA 2WOMA 5HMZA 1T3NA 3M9OB 1NLKL 2MZTA 3M8SA 4URGA 4JBCA 4NRUA 2DXDA 4IOAQ 2QC3A 1E6YA 4URMA 1RA6A 3F56A 5KFKA 2UU9F 2VQFF 3M2VB 2LQJA 1UA1A 2AIRB 1RBLA 2CPFA 4RNFA 4F4XA 2V94A 4K4SA 4R0JA 1QY7A 3HVAA 3MM6A 2CAJA 5D78A 2AP6A 1YT1A 1NJZA 1UYKA 4MTPA 2HAFA 3HF5A 4KV8B 3CNQP 4HXWA 1GMVA 5JVGQ 1H2UX 4K4OA 2IC3A 1O5JA 1KRPA 1FFWB 1ZXMA 1JMTA 3TR5A 1Q79A 3A12A 1N32J 3BPDA 2KRRA 1N33F 3G6ES 3D2WA 9ATCB 4NLUA 5J1NA 2RJZA 2HQGA 3A0XA 3WIVA 5GAGU 2MDAA 3FRYA 1N6QB 1U2CA 2O1VA 2DYAA 3PR5B 3RKZA 2GHVC 3D68A 5M4KA 1X0PA 4AWPA 3TAQA 3RBDA 4RW6A 2HGMA 8AT1B 2DITA 1B0PA 2FHJA 4TKTA 2KZZA 3MM5B 5FLXU 2BJ7A 2J7WA 4ANEA 3BM7A 5J2MB 1ZAVA 5ETKA 5CTYA 2RNEA 3GFHA 2OH2A 2AJ0A 5FIIA 3RR8A 3NL0A 4F0MA 3FEXB 4LP0A 2C2MB 4X64F 2YTCA 3IBCB 3MM7A 1BC6A 4MIWA 3LP2B 4LVOP 3Q8PB 2E5IA 1RGVA 2RILA 5HJXA 3Q8RB 3CDUA 1H7XA 2MQLA 1VK8A 3ZZRA 1C4AA 5EDWA 2GMLA 4KFBB 2Y1IA 1XR5A 2R7XA 4KRWA 3T3FA 3HSGA 2J7UA 2NQPA 1XTZA 3ZKBA 3DLGA 3MM9B 1RISA 2DEJA 1U24A 5CF0A 1TL5A 2CPDA 2GIFA 4DFKA 4Q2LA 1UMJA 4DV1J 3DGVA 1FDAA 1B4SA 4DEZA 1RBAA 3RLQA 3C6UA 3TQEA 4TQSA 4DR4J 4ECXA 2LA6A 4OYXA 4DQIA 2UXBF 2KXNB 1JXEA 1KOHA 3IRXB 1JLQA 3CJKA 4ED6A 4ELTA 4MJKA 5JVHQ 1NH7A 2V6AA 4ZN3A 1SKRA 1HMVB 1PKUA 1RWMB 2M4MA 4DUYJ 1KP6A 2B4VA 3X3UA 3GJSB 3EICA 2OEMA 2AJ4A 4BXIA 4UQTA 4KB7A 3CVKA 1A6LA 3LPEA 3L7UA 3DGPA 4NXNF 4EO8A 5CTWA 5ETVA 4AXIA 1I5BA 2FC9A 4IO1A 4AWQA 5JJBA 3NLCA 4X66F 4M5IA 1DJ0A 2Z57B 1GFWB 4AD6A 2YNHB 1QUPA 1SJ4P 2Q8HA 4RBUA 1URNA 1HPZA 3H4DA 3DOMA 1B63A 4KHPJ 3UDLA 4J9SA 3BM9A 1NM2A 2UXDF 3TZ2A 1HNIA 1X4FA 3NNAA 2HK3A 4QPKA 3T6JA 4MAKA 1FF2A 1F9HA 2X1GA 3T1HF 4TYAA 1SQFA 2VQEJ 2Z2MA 2ZH1A 2XY7A 2CQPA 1XNRF 5BOCA 4K59A 3P6YC 3CGYA 1S5ZA 4DR1F 1N88A 4FNHA 1SJQA 3OUYB 1U02A 2MKJA 4CZCA 4B9LA 2P9EA 1IBLF 3JZ3A 3UNYA 4DR5F 4L6V3 4EU0A 3DOLB 3FT5A 4RNOA 4HYMA 4ECQA 3MMBA 2VJUA 3Q5LA 2RMLA 2UVVA 3HD1A 5KG0A 1SUQB 3VR1A 2RS8A 2H5EA 5CYQB 1RWKB 1JX4A 2VIHA 1YBAA 1U8WA 2XBPA 1NO8A 2J0SD 4KIAA 2ZHAA 5C24A 1FRLA 5LXYA 4IR9A 2DPIA 5B09A 3QWUA 4XO0A 2RT3A 2WK4A 1Y3KA 3G71S 5BODA 1RDRA 1T9VA 4C48A 2I5JA 2CVEA 1URRA 5KFCA 4NYZA 1E6YB 2YK2A 5J2NB 4RUBA 4ES2A 3X1LB 1HQEA 4UY85 2JC1A 1B64A 2AJQA 1NH8A 1P9YA 2DGSA 1HI1A 2CQGA 5K9FA 1CG2A 4FYYB 2YX4A 3DOKB 5M4HA 1UVIA 1NB7A 1XNQF 1R8HA 1H6KX 4FN5A 1HKAA 2CPXA 1TMMA 5J2NA 2IAJA 4DN9A 1I5OB 1TKXB 2VPZB 3IGVA 4DV4J 1CBKA 1WDTA 1T9YA 5D15A 2HVHA 2W2QP 4LF2A 2QL5B 2QMXA 2OD4A 3IP0A 3D6HB 3RG6A 4K4VA 2OP5A 2BBEA 4B9VA 1IR1A 4HTJA 1K0VA 2U1AA 2WEQA 2CJBA 3I55S 1K8AT 3EGZA 1H7WA 4UTGA 2VBXA 4BDPA 3J81U 4ECZA 4X4NA 2HZAA 2YKQA 4OV6A 4HACA 4YUDA 4YKWA 5H9EK 2E9ZA 1XERA 5L1IA 2A6OA 1Q82T 1KSPA 2FDNA 1FFSB 1EKSA 2IBKA 2DNNA 5H1SV 2YKAA 2LU1A 3BDPA 1X5TA 3PW0A 1X4AA 5A8KB 5C25B 1I3OB 1HNWF 2Q6CA 4IQXA 2N4CA 1D8ZA 4M8LA 4ZKIA 1TL4A 2DR5A 1HNWJ 2FPHX 1KR4A 2RRBA 1Q8BA 2QMWA 3VHDA 1WC6A 3VALA 1EIYB 3E8OA 3A8EA 4NEYA 4KFBA 4XKAA 4B3OA 3B82A 1WEYA 4DV0J 2DGQA 2G0JA 4R5PA 4KSHA 4DPUA 1TL1B 5CCLA 1NKEA 2IM0A 2O3DA 3BH6B 3HHKA 3LGHA 2HFZA 3NCPA 4RW4B 4XDMA 2IBOA 1QJHA 2DNRA 2OPQB 1O0PA 3POTB 4ZJLA 3KJNB 4X4RA 2B4UA 4A4JA 2GFFA 3KFWX 4ZLNA 4K50A 1NHUA 1RQ0A 1ZM9A 1UEKA 5CD4H 1C0TA 2IA0A 5D77A 3CJ2A 2BV3A 2MHNA 3D5MA 4CWSA 4OYWA 3M9MB 3DOLA 4J5OA 4AFFA 2UVRA 1RAGB 1Z4UA 3K60A 1VQ6S 3VAGA 1WORA 3HMJG 3NWGA 2LQ5A 4JI7J 3HI9A 3SBMA 5M2RA 4DX6A 1CJTB 3BYPA 4FP9A 4KGZB 4RW7A 4CT8A 3G8QA 5KT6A 1Y7PA 2DH7A 5IC6B 3HT3A 2CRLA 1SUQA 4OJHA 5F8NA 4BCAA 1FO1A 1NHJA 4WTOB 1S6QB 4Q44A 4LUBA 3BYRA 3OHBA 1FKOA 4WK1A 2BE9B 1UJ6A 4CWBA 4LF4J 3O6OA 1IBCB 2BZ5A 1I94F 4GC7A 3LGMA 2FJVA 4Q43A 3MEEA 1RT5B 1I94J 5A2QU 1D9AA 2E1CA 1JWWA 1X5OA 1BE4A 3AJ2A 2DEIA 3DLKB 4LQ3A 2ZFHA 1FRMA 1R0AA 4CDIA 3UO0A 5E41A 3CSKA 2OPSB 2V50A 4NH7A 2HBRB 1RAEB 3PR4A 3DRPB 2BYHA 4WXOA 3JTOA 4NLTA 3ENVA 5KFQA 4B6CA 1KN6A 3R9LA 3M6VA 3THVA 2Y0SD 4X65J 2PMWA 2E29A 2HHWA 4O04A 1Y00A 4L76A 5ITHA 1S1VA 4CYUB 1NAQA 1KVKA 2PDAA 2ZH4A 3PRBA 4YHHF 2WI4A 1OJ4A 2VB6A 2DO0A 2VF3A 3T0ZA 2BOAA 1YWXA 2DKOB 5CZXA 1Q16B 3PM9A 2B4PA 2NUHA 4OI2A 4J9NA 1GJVA 2CNOB 2J9DE 2CCSA 1AYEA 2OO4A 3TZYA 2A6MA 5HK4A 3N6LA 3TUIC 2F8MA 4ZCIA 5IT0A 2YNIB 4PU9A 2PMHA 1IBMJ 2BU5A 1RLDA 1R8AA 1JQGA 4WE1B 1AM1A 4RZRA 4J9PA 1M90T 4RUHA 3Q86A 2IRUA 1S49A 5G4DA 1IKYA 1CQMA 3BB5A 4OI0A 1GXLA 3PFEA 1VQPS 1QDUB 3BSNA 2M2BA 4YY3J 4P2FA 3U67A 5HI7A 3B26A 3OXGA 3OQ2A 4DI6A 1U0HB 3O6QA 1KTVA 2WONB 3IWLA 3EHFA 4R3AA 3IM9A 4WFAQ 2XMTA 1UYHA 2ZUGA 2BJDA 5RUBA 3QQCD 2E66A 3PCOB 4K4YA 1S57A 3UW1A 4L74A 2V34A 3RW7A 2B6AB 1NZAA 4WXWA 2C22A 2OIHA 4BWMA 5HP1B 4EM7A 3I82A 4QIGA 1YETA 3S8SA 4K8RA 2C28A 3MF5A 1X31C 1NK5A 4DF8A 2VG5A 3JSMB 3J7Z5 3DDKA 4EO6A 3AD9C 1LNQA 2WOMB 2WI6A 3J7AN 3ZTQA 1SQGA 4QIWD 5B0FA 5KFNA 2HSEB 1VDHA 1S1TA 2E9RX 3US5A 4ZP8A 3R5CA 4FKXA 3IR5B 3EVMA 5LMNJ 1F1BB 5EGYA 5KFGA 4J91A 2DGVA 2YWHA 1KHWA 4ZA1A 4BQGA 5CTUA 3V6JA 4ZIWA 3EGVA 5IWAJ 4O05A 3Q8YA 3CO0P 3QIDA 3MI7X 3PACA 1S4EA 1JB0C 4RPFA 1WACA 3D28A 4WBFA 3ET6B 3ZZZA 3C6TB 3KDOA 1NSKL 3EGWB 2LLZA 2A1BA 2P6SA 2LEAA 3U1LA 4M5DA 1N0UA 4YR0A 1E6VB 2ZBRA 5D0GA 3OJSA 4X64J 2ASYA 2QFJA 1I51B 2HG4A 3MR7A 2Z2ZA 4F7VA 2C2RA 5AXMA 3FMBA 2NYIA 4L3KA 4NA3A 2GHWA 2XMMA 3H2LA 3A3PB 5KFYA 1DZ5A 3NGKA 1TAUA 5T7LA 2CG8A 1HNVA 2P5VA 4IG3A 2IOQA 5DM6Q 4H85A 2FHOB 2I1RA 1UVLA 3Q89A 4OI4A 2HHUA 4GMKA 1Z2LA 4LFBJ 3B8HA 1XEZA 5M4NA 1H98A 1PC4A 4IQMA 3T5HA 1R89A 3MAAB 3RZAA 2VCIA 3KLVA 3THPA 2V5HG 4ZOSA 3DHXA 2GVDB 2DNOA 1KVIA 3PX6A 1RAFB 2G2OA 4CO3A 5A6PA 2QEXS 2PA3A 3MGJA 3ZZOA 1M5HA 4JI5F 3K58A 1J2VA 3NGSA 3K0JA 3TUHA 3C19A 2ZWPA 1TL7B 1T9WA 5FLXY 2M5YA 2GMHA 4XDCA 3SXLA 2MY8A 5I3QA 5EX0A 2MKIA 3SL2A 2DNQA 4IDKB 4B9SA 3PVXA 1X5PA 2WHOA 5D0RA 3M1VB 1JK9B 2AYBA 5A8WA 4BC7A 3MFHA 1C0UA 4YEAA 1JLAA 5D6PA 3K98A 1OQ3A 3AA8A 1S0OA 3RAMA 3DLLQ 4GVLA 5DZ7A 2GHPA 1KKHA 4DG1A 2L9DA 1VI7A 3CJQA 1MN7A 2ERRA 2GQ2A 2MTLA 3J80Y 1UYMA 4JI6J 1F51A 1BWEA 2NXJA 3NS6A 3M2RA 4LWFA 1GT8A 5E7OB 2DNMA 2DR6A 3D6MB 4LSZB 5A0YB 2NYHA 3JQJA 3LAKA 4P2MA 4FF3A 4O44A 4DPYA 2YGEA 4LFCF 3L95X 1SPBP 2YE2A 4OYZA 3KUEA 4FNIA 2R8KA 4MPNA 3BSOA 4WFBQ 2KT5A 1QZRA 5GMKa 2OFHX 3IRXA 2XDSA 5GAEI 2X1AA 2ZHOA 1IKVA 2FJDB 3CIZA 4ZPDA 1P8GA 2YE3A 4FYXB 5IDJA 4ECRA 4M94A 5CCMA 3NS5A 3NOGA 4UF4A 4UY8T 1HHSA 2PSZA 1U0ZA 2ZE2B 3W2VB 5E2QA 5KFIA 2Q3PA
chains in the Genus database with same CATH topology
2FLLA 1AJ6A 3R4MA 3DDNA 3I4PA 5M4MA 4NLVA 3C0EA 3CGZA 3GG1A 1X4GA 1P1LA 1C1BA 1TL3A 4MYUA 2RU9A 1X9SA 3IFEA 5CHCB 4FMTA 3I96A 1S1UB 2VASA 2APOA 2BRLA 3M8RA 2ZJPQ 4WF9Q 4WZMA 3BSCA 4XKKA 4JI7F 1RT3B 2PIIA 3LGNA 3GR1A 1BQXA 4Y00A 2RQ4A 4Z37A 2ZH2A 1YTYA 3U2DA 3JYTB 2WSFC 3DLKA 3KNGA 1KD1T 1RT7A 1VMBA 4NLRA 4QWCA 4MPEA 1NRKA 4LF4F 3I4HX 2ZOMA 3HHEA 4QZVB 3KLFA 4PUOB 3R4OA 1IN0A 1UP1A 2YKBA 2O01C 2C3UA 4BC9A 4C8KA 3GIIA 1UVJA 3UD4P 3M4XA 4F3OA 2B51A 2IWXA 4UUWA 4Q0BB 2QLXA 1KQKA 4PXEA 5LXRA 2OTJS 2VW5A 1BQNA 3T9NA 3R4NA 2HHTA 3IBWA 1ZPWX 2ZDPA 3M2RB 3MMCA 1TL3B 5KT7A 1LK5A 3M8QB 4CE1A 2BU2A 4F50A 3TX8A 1ZM3A 1X7VA 5CH7B 2VFVA 2VV5A 1XR6A 3DXSX 3M32B 5IN9A 3CCSS 3UNGC 5IZHA 4QR2A 2AGQA 1OSCA 2UUWA 1R6YA 3T5LA 3QJLA 3HKWA 1CEZA 4HYPA 1S6UA 2EK1A 1MX0A 4DL3A 2ZITA 3GWCA 1Z5AA 2H9ZA 2DNHA 2KG0A 4OX9F 1YG0A 2B5JA 2D9OA 4ECUA 4FS1A 4Y2MA 3U1NA 4NCBA 3KLGB 2UZAA 4XPEA 3ISZA 5A6WA 1SJ1A 3H40A 1JXLA 4P6QA 5KFLA 3EXCX 3MEGA 4HH1A 3U02A 3OV7A 4XCLA 2DHSA 5FDLA 3BQ0A 3K2YA 4CWTA 1X8DA 3MPVA 2C2DA 4U7CA 2DTJA 4DR4F 4FZVA 3IR7B 5D3GA 2XZWA 5KFFA 1HBUA 1O51A 2WEPA 1NJYA 3RW6A 3VAFA 1XK8A 1TZ0A 1U1PA 3AAWB 1OWXA 4HH0A 2JH3A 1HNVB 3BO3A 1RTDB 2CQDA 3O1LA 2K2PA 4KTQA 4A46A 2CJ9A 4I69A 3B4MA 3OFHA 3DXBA 4KSGA 2DB1A 1DQ8A 2JLFA 1NHHA 2ASJA 2HZCA 4PRFA 1V3RA 2VWCA 4K2XA 2O1WA 3DCAA 2IA6A 4JYAF 1HBOB 2G4BA 2OLWA 1XMQF 2JZ5A 3JSRA 1DQ9A 3LANA 2CJQA 5LSOA 2WI5A 3D54A 3K8VA 5HLFB 2YEDA 4TU8A 1UYEA 3KKFA 2OKQA 1T7PA 4NA1A 1D3WA 2POKA 2N4DA 3SV4A 5KFXA 2VG6B 3CO9A 1M5OC 3TYTA 4EYHB 1EA6A 4CWFA 4QIFA 2OPRA 2BABA 2QFOA 3GQCA 1F5CA 2W8LA 2MKHA 3M05A 1FRJA 2UUTA 2DNZA 3VAJA 4RWWA 3Q22A 1MU2B 4C8ZA 1MMLA 5I42B 2CQ2A 2D1CA 1TK0A 4FPPA 1WI8A 2LEPA 4AL6A 2YJWA 1SL2A 4B02A 4JV0A 3RYLA 1WEZA 3H2VE 5E5NA 4Q8EA 3CCUS 1U1KA 3SSSA 3TAPA 4A8MP 1Y8NA 4EFTA 3TZ5A 1IBMF 1YJUA 1FKOB 2WW8A 4ID5B 5EHHA 2J9EA 5DRKA 4ZVHA 5IM0A 2MQQA 1ZXNA 3U1MA 3G8TA 4JQLA 2I5JB 2J7KA 2JHEA 3DU5A 4RU2A 4JAVA 1SH3A 3FSYA 1NHVA 2LQBA 3N01A 3EZ5A 2R2UA 1SKWA 4AWOA 3JTNA 5KFEA 2D3UA