3PEHA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of a thienopyrimidine derivative
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
261
structure length
261
Chain Sequence
ESMESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin homolog
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of a thienopyrimidine derivative
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Chaperone
total genus 78
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pehA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pehA01
1UY7A 3INXA 4KP4A 2BREA 1YC1A 2XDUA 1A4HA 4LWHA 4R3MA 3OW6A 5J71A 4AWPA 3RLQA 2FYPA 2ZDYA 3B25A 2HCHA 2YEEA 4MBCA 4EM7A 4BQJA 4XCLA 1U2OA 3CGZA 4ASGA 2XJGA 4EMVA 1BXDA 1AJ6A 5CTXA 3A0YA 1EI1A 4P8OA 4DUHA 2E0AA 1QZRA 4AS9A 4GT8A 2CCSA 2ESAA 3U2DA 1AH8A 1Y4UA 3DGEA 4WUBA 2GFDA 2WI7A 2Q8GA 3KE6A 4GGLA 4U7NA 1UY9A 2PNRA 2BT0A 1H7UA 4KQVA 3RLPA 1Z5CA 4XTJA 1MX0A 4ZKIA 3C0EA 1UY8A 2XJXA 2YGFA 4O09A 4XD8A 2XDXA 3ZKDA 4KTNA 2BRCA 3JZ3A 1NHIA 1QY8A 3A0RA 4GEEA 2YGEA 2BU7A 2WI5A 1YC3A 4LWIA 5IN9A 3CGYA 3NMQA 2H8MA 2XHXA 1YSRA 3T0ZA 3Q5JA 4HYPA 4QPKA 1NHJA 4MP7A 4HY6A 1TIDA 5D7DA 5M4HA 4L90A 4KSHA 1AMWA 1ZWHA 2YEIA 3D0BA 5CPHA 2O1WA 4L8ZA 2YKEA 2XDSA 4CWRA 4EGIA 5CTYA 4ZVIA 3PEJA 2XX5A 3QTFA 3D36A 2FWZA 2QG0A 3CWVA 1B3QA 3T10A 3MNRP 1AH6A 2BYHA 1U0ZA 4PL9A 4LP0A 4HYMA 1YT1A 2FXSA 1YESA 4FMTA 1TC0A 1TILA 4L93A 4H81A 4CWOA 4R3AA 1OSFA 3OWDA 4FCPA 2VCJA 4CE1A 2XJJA 1UYIA 2IWSA 3G7EA 3CRLA 4YKTA 3FT8A 4URLA 2WI2A 4NH8A 3R4OA 3R92A 2XK2A 4E02A 2BZ5A 4GFNA 3U2KA 4NH7A 2YEDA 2VW5A 1BYQA 4I3HA 4B7PA 3ZKBA 3A0WA 4LWGA 5D6PA 2YKJA 3T2SA 3INWA 4AWQA 4MPCA 5CF0A 5BODA 2JJCA 4R1FA 5C93A 2XDLA 3K99A 2QG2A 4XE2A 4CWQA 1I58A 5M4PA 2YI6A 1YERA 2JKIA 3A0ZA 2BU6A 2CGFA 4I5SA 4BIUA 4QPJA 1ID0A 2BU5A 2WI6A 2WERA 1UYHA 2YE9A 2CCTA 3TUHA 4GQTA 1TH8A 4KSGA 3K98A 4ASBA 4XIRA 4HY1A 4U93A 3OMUA 2WEQA 2YE5A 3GIGB 2YEHA 3GIGA 5FNCA 5IDJA 4AWOA 3QDDA 3O0IA 1YETA 4HZ0A 4XITA 1AM1A 3GIFA 4YKUA 1I5AA 2H55A 2XHTA 4BIZA 4CWSA 4E00A 1UYCA 1ZW9A 4XKAA 3C11A 3RKZA 4O05A 4H85A 3R4PA 2AKPA 4JAVA 1YS3A 4BAEA 1JM6A 3SL2A 2O1UA 3LNUA 1I59A 4Q20A 3B26A 2YE3A 5IDMA 1MU5A 4K4OA 4PRXA 2HKJA 2YKIA 4XIQA 1R62A 4EFUA 1UYLA 5F3KA 2IOQA 2YGAA 2BU8A 4CE2A 2YI0A 3HZ1A 4P7AA 4O0BA 2Q2EB 4JAUA 3TZ2A 3Q5KA 4CWFA 2YK9A 5L3JA 4FCRA 2VWCA 2YKCA 4LPBA 3T1KA 4ASFA 1Y8OA 3G7BA 1GKXA 4BXIA 4O04A 3VHDA 1YSZA 4EGKA 2XHRA 4ASAA 5J6AA 4LWFA 5FNFA 1UYGA 2XABA 2CCUA 2ZBKB 1UYKA 4B6CA 2IWUA 2CH4A 2IOPA 3FV5A 4EEHA 3R4NA 1B63A 3OWBA 3VHCA 3TZ0A 3G75A 1YT0A 2BU2A 3BMYA 3HHUA 3EKRA 1H7SA 1NHHA 2WI1A 1Y4SA 3U67A 4URMA 1I5CA 1TC6A 3IEDA 3D2RA 2YEGA 3B24A 4H7QA 1THNA 4WUCA 2Q8IA 2XDKA 3LPSA 2YE7A 4CWNA 4XIPA 4YKXA 5FWKA 1TBWA 1Z59A 1UY6A 3PEHA 4XCJA 4YKYA 3K60A 1KZNA 5M4NA 4YKWA 2BYIA 3CRKA 3WQ9A 1KIJA 2ZDXA 4MB9A 5CTWA 3ZXQA 2XX2A 4GCZA 4UROA 4YKQA 4V25A 2WEPA 1US7A 4MP2A 4HXZA 1Z5BA 2YJWA 2ZKJA 4JQLA 1UYFA 1YC4A 1I5DA 3BM9A 3EHHA 3A0XA 2YI5A 4PRVA 4CWPA 3HEKA 3EKOA 2WI4A 3VHAA 2IWXA 3FT5A 4YKRA 5FNDA 5M4MA 3EHJA 2YK2A 1I5BA 1UYDA 3O6OA 2YE8A 3GIEA 2QFOA 5D7RA 3EHGA 2Q8FA 1EA6A 2YEBA 1YT2A 1BGQA 4L91A 5CTUA 2YE4A 4FPPA 4L94A 3R91A 2QF6A 4MPEA 1UYEA 1UYMA 2Q8HA 4JASA 3TZ5A 3VADA 1BKNA 3B28A 5GGZA 4XKKA 3EHFA 3HYYA 2YE2A 2YECA 4EFTA 2XCMA 2YEFA 2GQPA 4BQGA 4CWTA 2YKBA 4V26A 4DZYA 2IORA 4NH9A 1PVGA 2UWDA 1ZXNA 3Q5LA 3ZXOA 4LWEA 4X9LA 4W7TA 2YEAA 2HG1A 1Y8NA 5M4EA 3TTZA 1L0OA 3K97A 3H4LA 4E01A 2YI7A 1GKZA 1QYEA 1B62A 3TZ4A 4WUDA 3HYZA 2YE6A 3R4MA 3ZM7A 4PU9A 4URNA 4MPNA 3RLRA 2YEJA 2VCIA 2BTZA 3B27A 1Y8PA 4EGHA 1ZXMA 4U7OA 2EXLA 1S14A 2O1VA 2BSMA 1S16A 2FWYA 4HZ5A 2CG9A 4MOTA 2XD6A 1GJVA 4O07A 4YKZA 2WI3A 4XDMA 5D6QA 5D7CA 5BOCA 2K5BA 2YJXA 5F5RA 3WHAA 1Z5AA 3H80A 3O2FA 3HZ5A 3OPDA 3T0HA 5M4KA 4HXWA 4XKOA 2XX4A 4KFGA 4FCQA 4XC0A 2C2AA 4CE3A 3A0TA
chains in the Genus database with same CATH superfamily
1S6PB 3I5AA 1WG4A 3QT6A 1BE4A 5E41A 4Y2MA 3ZZOA 4MIAA 5I42B 1Q78A 3KYLA 2KJVA 2AT1B 4G3IA 4ID5A 1CVJA 4XCLA 1OYDA 1G6BA 5ETOA 1TL5A 4N7TA 4Q0BA 4K2JA 1LKZA 1ZZNA 1JLGA 2W9AA 2W01A 2LEAA 3Q8SB 2DGQA 2LXUA 4ZKIA 2YGFA 4LIRA 4B3OA 3JQJA 4ENOA 1HLWA 2ZZNA 2NPFA 5C2GA 2LDIA 3T5LA 4ED7A 1M90T 5L8RC 2K1RA 4USMA 2E5JA 3M2RA 5M4HA 4L90A 2FZKB 4IH6A 2P6SA 2GGPA 4N76A 3NGDA 1FVQA 5J1PA 4M1KA 1YJVA 3M30B 2VA2A 3WHIA 4LF9J 5HI7A 2XX5A 4AL6A 3LAKA 2HVZA 2XHCA 1MW7A 1IQZA 1LEOA 1APSA 2QLBB 1F3FA 1WNEA 4CO2A 2GA7A 4KGKA 1H2UX 4CE1A 3E2EA 3HP6A 2OEMA 2JL9A 2I5JA 4RX6A 3MM5B 3LPYA 1PYSB 3RTVA 4FYYB 1WHWA 3GJQB 1CPZA 2CUYA 1KDNA 2FGOA 4MPCA 3OL8A 3ET6A 2XDLA 5GAEU 3T1YJ 4XE2A 4FF2A 2B43A 2YNIA 4ID5B 3N6MA 2HQCA 2JEIA 4GVBA 3TNVA 2XO7A 2W9CA 1RT1B 3QRQA 1UFWA 2YE5A 2FHOB 3IAM9 3NBPA 4UUXA 3VF0B 3OSPA 4RW4B 4JI1J 3EGZA 3IWLA 2AGPA 2YQ3A 3ZNUA 5D0HA 5L38A 3UD3P 1IKVB 1AROP 3ITHA 4EYHB 1TL1A 3NMAA 1I1GA 3TAQA 4E2FB 3R4PA 3B4DA 4JYAJ 1YS3A 5IOLA 2YX7A 3V6JA 2CZVC 2I1RA 1EAYC 2QFJA 2EG1A 1TKZA 2L48A 3SI8A 3JSYA 1MU2A 3EZ5A 4J9PA 4DMZA 4Q7AA 3CCSS 2P9GA 3MI7X 5F3KA 4U9RA 2BU8A 4ILRA 2DEIA 1ZH5A 1RSCA 4J9QA 1U49A 1TAUA 2ZKUA 3SSSA 2EBGA 4EMDA 4QR2A 3C8YA 3LAMA 2A1BA 1WOOA 4M5JA 2N3LA 4BHQA 2G9OA 1I51B 2GVDA 1UYKA 4KFBA 2MQ8A 5DG9A 4UOGA 3ULHA 2MPUA 1YT0A 3HHUA 1KVKA 3UFCX 1RAHB 3GILA 1NHHA 4NXNF 4ZLNA 2UXBJ 1THNA 2JH3A 2YQ1A 1FVSA 2F4VJ 1UY6A 3PEHA 5U47A 4UOHA 3HVTA 4XO0A 3RB0A 3TVYA 3ZXQA 2W9CB 4OZLA 1SJ4P 2WEPA 1Z5BA 2DHSA 4OYPA 4RZRA 2RQMA 3BH7B 1KS2A 3KLHB 6AT1B 3CMAS 4K2XA 5AJ3F 4F25A 2GIRA 2FZGB 4HTIA 3DLEA 2PFDA 3MMAA 4YKRA 3D7SB 4GO5X 3EE3A 2BW7A 3ITHB 1TL7B 2EWHA 1TL1B 4MIWA 3HHLA 1RACB 3GJTB 4DQSA 5K14A 2QT7A 2CQIA 4OI2A 3OSNA 1A6LA 1MU2B 3UWTA 3W2WA 2H5JB 5LSLA 2YE2A 4O3PA 4IO9Q 2MKKA 5K9FA 4ZCMA 4G1PA 1D8YA 4W7TA 3VHQA 2V2ZA 1S6UA 2XQCA 3FCWA 2QA4G 5B0EA 3H4LA 1DTTB 4N8OA 1X7VA 2YI7A 3CE8A 4WUDA 2CJYB 2JVRA 1Z1ZA 4NEZA 4NYOA 3M6UA 2GVDB 3TJAA 2CAJA 1GX6A 1YZ6A 2BTZA 2OGUA 3U1MA 2EXLA 3TWZA 4CCHA 4A8QA 4GVLA 4B9LA 3NP5A 4BWMA 3IXQA 4DR2J 1XQIA 4YKZA 4WP8A 5BOCA 2ZWPA 3FZBA 4PPZA 3TJ8A 1PBAA 2E7WA 3OLAA 2DPJA 2B8QA 3B82A 1N5SA 4P7TA 4IRKA 5M4KA 2ZKTA 2XMUA 1HNXJ 4KFGA 5DM6Q 1N5TA 4URQU 4CH1A 3INXA 2RB7A 4XPCA 2XDUA 1NSPA 1A4HA 2DGXA 2W1BA 4USJC 3OW6A 1FRIA 5J1NA 4DPUA 4QPXA 3DLEB 3CTRA 2CFXA 3HHEA 4J9SA 4RUBA 2JEGA 2XGQA 4GT8A 3HDSA 2WK4A 3CD6S 1UY9A 1TK5A 4M5NA 5K14B 2F1FA 4DR5F 2HGMA 5EWEA 4M5LA 1GT8A 3W2WB 1QSYA 2LVWA 4ES2A 3UCZP 1OMSA 2V9KA 3PM9A 3HK2A 2WI5A 3PW2A 5KT4A 1M1HA 1FF2A 2RE1A 2XHXA 4HYPA 3WC2A 2J5AA 4DS4A 4ED3A 1IR1A 2AYBA 1KLMB 1OO0B 3HVWA 4PG5A 2M3DA 2O1WA 2RS8A 1JJCB 4X4NA 2HW3A 3A3OB 4ED8A 1FCAA 1N56A 4CLYA 3N6LA 4KJIA 5DRKA 1LFPA 3I6PA 2BYHA 3E3XA 2C2ZB 2FXSA 1UCNA 4L93A 3RZAA 2LQ8A 1H7WA 3CVKA 4J37A 3F44A 1XR5A 4BCAA 4NH8A 3DGPB 2RF2A 4GFNA 5LXRA 1TFYA 3R6LB 2BZ2A 2HLTA 4R1FA 2V0NA 4H4KA 5LSRA 1FRMA 2HAFA 1MMLA 4JBCA 2JKIA 1K73T 3QRRA 2HZVA 2KH9A 3GYGA 4F7VA 3C14A 4N77A 1KTQA 5AXMA 3CCQS 3OHBA 4M94A 5IS2A 3OMUA 4AWOA 4J9MA 1U48A 1GQEA 3HLUA 1KKHA 2CQ0A 4QW8A 4I69A 4HT5A 5J2MA 1JNZB 4I56A 2IPOB 4DQPA 1T94A 2DTJA 2WOMB 1HMVB 3EGVA 4ECYA 1YHQS 3IFEA 4LSZB 3TX0A 1VQMS 4UUWA 5GAEI 1NH8A 2VFSA 3KK2B 4NI2A 4K4OA 2LDYA 4PRXA 3CULA 4K4SA 2B9WA 1TUGB 2HAIA 2RDJA 2F9JA 3T5HA 5KFQA 4DQIA 2WHOA 2VA3A 1VBXA 2MQPA 4QU7A 1JLBA 3CF5Q 2BJ7A 2KZMA 2YK9A 2DH8A 2YWGA 2FZCB 1U0HA 4OX7A 4PAAA 4DV7F 4EGKA 3CT9A 4F3QA 2RUSA 3PRBA 4B6CA 1LW2B 2DNZA 1DFDA 3R4NA 5DQHA 3POTA 2MY8A 1WC1A 4MKBA 2AHOB 4TKTA 4IQXA 1YITS 4URMA 1GXUA 3HHLC 1SKWA 1VRUB 2V50A 2HMIB 3DFEA 2Y1IA 4KBIA 1U02A 4DQRA 4YKYA 1Y4ZB 3MR6A 2F40A 2BYIA 4L3NA 4ZN1A 4F36A 3T1HF 3GSDA 4YKQA 3TX8A 4KTQA 2E7VA 2WAQD 1D0EA 2OPPA 3M32A 2YJWA 4KKOA 2DVIA 4LF1A 3Q2SC 1QAXA 4ETXA 5J2MB 3UN3A 2YNGA 3FRYA 4CWPA 4DEZA 3RRHA 3HEKA 3VHAA 2VB6A 3UD4P 3VAGA 2YE8A 1UJ6A 2MGZA 1UWAA 1ZM9A 4K5RA 2XMKA 2Q8FA 4I6WA 1C4AA 4OV6A 4F0MA 3TZ5A 2V8VA 3BGOP 1U1PA 3VADA 4NLVA 4C0HA 1JXLA 4J9RA 4CWTA 5IT9Y 4G6VB 1S1TB 3SV3A 4CP5A 1R8HA 1S10A 1PSDA 4IG0B 4LWEA 4X9LA 1LWCA 1UEUA 1U0HB 4U67Q 4J91A 2D3ZA 2DBBA 4HKQA 2C42A 2E9TA 2G0JA 1QE1A 3ZTSA 2HNDB 4CO5A 4CZCA 1NJIT 4CYUA 4Q2MA 5HMYA 2BOAA 3PX0A 3CC2S 3AJDA 5D7CA 2LMIA 3GSIA 3WHAA 3R6GB 4IOBA 1VQ4S 4FF1A 3K58A 1EZZB 1D9AA 4KV8A 1WEYA 3M32B 1VC6A 1ZM2A 2UV8A 4AWPA 2CPZA 3RLQA 3OFHA 4NMXA 3K5OA 4B3MJ 1GH8A 2CJ9A 2MJNA 2WVEA 5AXLA 5J2NA 2BE7D 3H5UA 5CTXA 3A0YA 2RDDA 2E0AA 1TMMA 1HHQA 2GCFA 2E29A 2M8HA 4F4AA 1EJ7L 5IQQA 3J7A1 1FDDA 3QJJA 5HANA 3G6XA 4NRTA 1FWLA 3KJFB 3A0RA 4USIA 2C3YA 1XNRF 1BMQB 5IN9A 4DX5A 2H8MA 3VZIA 1Z4UA 3TVKA 4CT9A 4X66F 2AJ1A 3DLGB 3TZXA 3AJ1A 4QIGA 2HS4A 3OT9A 4P52A 3WBZA 1U1QA 4H4KC 5DQIA 1F9EB 2PD1A 3C2PA 3BSCA 2P9EA 4QQBA 4YS2A 3V4IB 5B0FA 4WBFA 5FIIA 3VQSA 1RAIB 4ZVTB 2MKJA 3HO1A 5M2PA 4LBIA 4DOZA 1U8SA 4F3MA 1T95A 5KFTA 2MZJA 1IN0A 4FCPA 1R0AA 2KT2A 1RAGB 1YSJA 4KQZA 4F4XA 1YI2S 5HN0A 1RTHB 3WX8A 2ZOGA 3L3CA 3GIIA 4H54A 3A0WA 2KB2A 1DURA 5KG6A 4A46A 1RAOA 1T7PA 2QYGA 4NZ6A 2ZM6F 3RB6A 1E6YB 4IDKB 2VDIA 4QPJA 3EPIA 3L7OA 1KFSA 3SCLE 1CJKA 2JLFA 1KQSR 3K98A 4LRAA 4ASBA 1ACMB 3DHXA 2JX2A 4FPIA 4LMZA 2QA4S 1YETA 3MUMP 3CGIA 4LFAF 3NL0A 3M6XA 1EARA 4AYBD 5LMUF 2XBPA 4E00A 4JI0F 3H8YA 4DBQA 1DQ8A 4OZJA 3FQKA 5C24A 3KLGB 5T7LA 3NEKA 4HDGA 1A7GE 2GFFA 2YKQA 1PGZA 5M2UA 4DPWA 3KMSA 3DXBA 4LF6J 3CXCR 4IYQA 2VQFF 4OV1A 4ECXA 2YKIA 1IUJA 4EFUA 1O51A 3M1VB 1Y10A 1HHTP 2X1FA 4P7AA 3DI6B 3J7Z5 4CQ1A 1CS4B 3WIVA 1FE0A 5B0GA 3UR0A 3JYTB 1SQEA 2YVSA 2NUUG 1XMQF 5HQ8A 3JB9k 5GAHU 4BXIA 4ASAA 5JMNA 1S72S 4RO0A 5G4DA 1RADB 1R89A 1X4DA 4PYAA 1J27A 3V6KA 2IOPA 1UKUA 1R0AB 4EEHA 2BRLA 2DNGA 3NNHA 4NPOA 4C7QA 2KI2A 1RT7A 1NXIA 1T03A 3BQ0A 2LU1A 4FVMA 4EZ9A 5KT7A 5KFVA 1VLYA 1ZPWX 3JTNA 3GTYX 1S7HA 4PRFA 2E1MC 2HWTA 2BXJA 3PX6A 4BLGA 2H1YA 3PACA 4LBHA 3K60A 5KFGA 1EQ0A 1HBNB 2ZBCA 2DNKA 2GO9A 5BJRA 3R5BA 2V4QA 2VZ9A 3WQ9A 2VUGA 1CJKB 1ZM3A 4AL7A 1FDAA 3CO0P 1US7A 1VK3A 1SJRA 3TA1A 2IHR1 3PFEA 2XY5A 3EYZA 1I5DA 2KJWA 8RUCA 1KQFB 3D0IE 4ELVA 3DU6A 3EKOA 4DS5A 4BS2A 2BA9A 4Q8FA 1Q79A 3CW2C 1C1CA 5IXUA 5DS7A 1X5OA 3WIUA 2YXLA 4U7UK 2H54B 2AJQA 1S5ZA 3HCXA 2DGUA 4LFBJ 2XCMA 2XTJP 2YEFA 1XNQF 5JVHQ 2GMHA 4C48A 4MKYA 5F41A 3BBBA 1HNWJ 1RBAA 5B08A 4RW6A 1ZA2B 3PTWA 2YNHA 3AFGA 1FXDA 1RDRA 1RT3B 2M8DB 2OFHX 1X8DA 2OKQA 2BJEA 4HHHA 2DR8A 2HFOA 1QAJA 2IM0A 4ICLA 2XCAA 3CJ2A 5MLCV 1ZXMA 1ELOA 1QUPA 1RT7B 5A76A 2UXCF 5D4LA 4M5DB 4ILMA 4X64F 2Z0GA 3IRXA 4CLLA 1Q5VA 5D6QA 2NREA 1REVA 3NGRA 3TP2A 3SMZA 1Y3JA 4J9VA 3W7BA 2EEYA 3ISNC 2JLGA 3W8GA 1A9NB 4L74A 1B0PA 3BGRB 3QPIA 3DLJA 4AQYF 3A4TA 3CCVS 1T9UA 2R8JA 2ZJRQ 1UEVA 1UFKA 2W7AA 2AGQA 2HFVA 4NZ0A 3SYZA 4QWAA 1ZYQA 1C1CB 1YBUA 4MK7A 4CO0A 3DGEA 1TVRB 2YH1A 3KLEB 3MM6A 3LW5C 1L3SA 4QIEA 4DHVA 2ILZA 1WC6A 2VFRA 2VG7A 2KXNB 3FBBA 2XJXA 2XDXA 2B6AB 2OIHA 4OJ3A 2JRSA 2HHPA 3Q86A 5ETNA 2JC0A 4JI4J 1KR4A 3DHWC 2VPWB 5KG5A 4RW6B 4ECTA 1HIYA 2YNHB 2DGVA 3PYDA 3QSIA 4IFVA 2RQKA 3TQEA 3PO4A 2GHWA 4DV5F 4ICLB 3I9ZA 1DARA 4P74A 3QZ8A 1VGYA 2XC9A 3CWVA 3DRPA 1JQGA 4Z7CA 3OR1A 4F04B 4ZCKA 3H42A 2V68A 3Q89A 1M0SA 4HYMA 2CPEA 4PWDA 3M7VA 3RBZA 1REVB 2ZJPQ 3W9HA 2VCJA 4DN0A 3ZZRA 1H3DA 1JNRB 4DV3J 4URLA 3KWMA 1EQMA 3H5YA 1VQKS 3N5FA 2BZ5A 4OFZA 2LKZA 3GFZA 4NLRA 3ZKBA 2X3GA 1QD1A 5BODA 2UUAF 2CWKA 4TU8A 2YY3A 3W5YA 4C8MA 2WI6A 2MMYA 4OHXA 4C8LA 4ELUA 3GIGA 3LUYA 4L3KA 1C1BA 3MM6B 5F9LA 1WHYA 1WF2A 2CNOB 4BIZA 4ZVSB 4M8LA 2VG7B 1WC5A 4IRDA 2DNHA 3M4XA 3N6NA 4F2SA 3RKZA 1F60B 1TL3B 2YKNA 3BEGB 4I6YA 1RT4A 3MMCA 4OX6A 4TY8A 5T14A 2OMLA 2BM1A 3RRKA 1IR2A 4USUA 4CNZA 4W90B 1J5EF 1X5SA 2MKSA 4KHPJ 5HATA 3QYYA 2CPHA 2Q6CA 4DR7J 5H9FJ 4B3TJ 2DHAA 3OR1B 1RK8A 3HKWA 1RAEB 4LR9A 5K8OA 1FFWB 1GKXA 3GV8B 1Q53A 4F3OA 2KKHA 4LWFA 2CDRB 5CYJA 2MQOA 3QQCD 1T11A 5DETA 2CH4A 4LF9F 3DKDA 2NQPA 2IJFA 5CABA 1FNOA 3LGHA 4QWBA 1AT1B 3EKRA 3RR8A 2P9CA 2VL1A 1I5CA 2V94A 3FBCA 1F1BB 3C6TA 3X3UA 4DG1B 1VQ7S 2FTKA 5JXSA 2NSCA 3LPSA 3GIKA 4YKXA 2U2FA 2YH0A 1Z59A 4N56A 3M8SA 4UW2A 2MLXA 3O5TB 4JI3J 1NEEA 4OI0A 2DPIA 4Y2AA 3J7YU 2HGLA 2KN4A 3CCUS 2DITA 4ZJLA 1SL1A 5CH7B 1R6VA 1HD1A 4V25A 4K4WA 4ECSA 1TKDA 3N0VA 1HBUA 4DLGA 3CJSA 1F51A 4HVZA 4L73A 2K3IA 3DRSB 1C0UB 2G13A 1JLQA 4QYZJ 1EX8A 2NXEA 5SZTA 1S0NA 1N0UA 4CO3A 4RU2A 3MFIA 1JJ4A 4IH5A 4ZHRB 3K59A 1D09B 2EXUA 4L91A 5CTUA 4MPEA 4JASA 5GGZA 1NPKA 3EHFA 2HS3A 3W9JA 2YKBA 4C3LA 3EVWA 1QLNA 5MAOA 4RPFA 4EYIB 5M4EA 1VOMA 4OZ5A 3QLHB 5D0RA 3SIPB 4E01A 1LK7A 1P6TA 1TV6A 3THPA 3D6MB 5C7PA 4DL0C 1VBZA 2QO3A 2PDAA 2XGPA 2VOPA 3GWCA 5DDQC 1WDDA 4YP3A 4H4OB 2HK2A 3C6TB 3BYRA 5EUHA 4Y28C 3J7ZT 2L9NA 2ZHAA 2WBMA 3UDEA 5T41A 3P96A 3HZ5A 4CT8A 2M5YA 3MCOA 5GMEA 1KQGB 4K0KF 3DLBA 2HHXA 2DR6A 5C42A 4ZPBA 3OLBA 2UXBF 2LU2A 3UNYA 4EFAC 3M8QB 1Q8BA 4O3QA 4P9SA 2CPIA 2KU7A 1HBUB 5CYQA 3BV8A 2GQQA 5K8PA 5KOXA 5LT5A 2F4VF 4JI5J 3SCIE 1CSJA 3QGIA 1C0TB 2YEEA 2C1EB 1AB8A 3VCDA 2PMHA 7FDRA 4RJVA 1BC6A 4ASGA 2D74B 4ZA1A 2ZE2A 1WWHA 2Z30B 1RHRB 2EKYA 3GFXA 3FVYA 2J0XA 3KJNB 3MMBA 3AOBA 4UY85 4NLPA 5A0YA 4ERDA 1IBKJ 4ECWA 2ZH8A 4MTPA 1MROA 3U27A 1SVDA 4CLWA 1YC3A 2B9EA 1DAXA 1RAAB 2YKAA 1VIXA 1XERA 3IM8A 5SUHA 4QPKA 1IR0A 2BRKA 3QAEA 5D7DA 1BGXT 4DX7A 2CQ4A 4KSHA 3EWGA 3FEXB 3NXZA 1CJTB 3MM8B 3M9OB 1T05A 1FTRA 3KG0A 5KG1A 3MFHA 1UETA 4LRBA 3QTFA 2OAUA 1S79A 5KFUA 4ZP7A 2COLA 4LREA 1KWMA 1RISA 3HHDA 5HAOA 2XMTA 3M2UB 2XJJA 4NLSA 5KFOA 4F4YA 4A8XA 3FMBA 3IG1A 1U8WA 2IM1A 1YJWS 5C42B 2PGCA 3I55S 4DR2F 4C3MA 2YKJA 2J6UA 1LXNA 3EM1A 3MURP 2HZCA 2N7CA 2W9BA 1F9HA 4M5HA 4U6PA 1HNXF 1GFWB 2Z2MA 1S6QA 2R42A 4USVA 1LWEB 4OHZA 5HMXA 2L9DA 3LO3A 4HY1A 2JFDA 4KC5A 4IOCQ 1GXTA 3VAMA 4R8UA 3CCLS 1HI0P 3ONQA 4GC6A 1O6XA 5A0YB 4KAIA 4DR4J 1VQPS 3LP1B 5CAAA 1SIWB 3DMJA 4Y34A 4XKAA 1HQUA 1MROB 3AA9A 4XTTA 5EWFA 4YB5A 2IC3A 2DR9A 3HFVA 4MIBA 4WKYA 5D8HB 2BV3A 1RU2A 1QTNB 3L4BC 3SDEA 4XK8C 4K5SA 1DRZA 2ZOFA 5CD4H 1SV5A 1U7LA 3QGPA 1NLKL 3Q5KA 2KM8B 4TU7A 3QIPB 4LPBA 3BB5A 2X7IA 5ETVA 3R1LA 2W7PA 1VC0A 3MCSA 2UUCJ 3LH2S 2XNRA 2LQ9A 1VQOS 1LW0B 2E44A 4ILLA 4ZVGA 3QBCA 2FD2A 3DRYA 2I2YA 4FP9A 2MXYA 4B3SF 3NKYA 2XEXA 3EVMA 3CNQP 1FEEA 2HHSA 1TK8A 4FS1A 1JXVA 3R1HA 5FWKA 1TBWA 2VG5A 1I94J 4USTA 3PIPQ 1YWXA 4RW7A 3CRKA 5CTWA 2C2DA 2ZH5A 5KFNA 2Y0SD 4X4QA 3W61A 1RXOB 2FC9A 4PEOA 4OYBA 4JQLA 2V8GA 4OL8A 1Y00A 2LQJA 1PKUA 2ZBRA 3NOGA 1N48A 2JSXA 3C6UA 3LPEA 2Z2YB 3I31A 2LQBA 3EHJA 3G86A 5KFCA 2BM0A 2WVCA 5A8KA 1RTJA 4ELTA 3PRVA 2IC3B 4P72A 3G82B 2ATCB 1R8CA 2EK6A 4ZPWR 4B17A 3J7YI 3VWSA 2HHVA 1F0XA 1S4EA 3NCRA 2QC3A 3MR3A 3Q5LA 3ZXOA 3H2UB 1ZBTA 5D4OA 2AIRB 4C98A 1OPIA 2CNLB 4QIVA 1CJUB 2D1CA 5LSOA 4I2QA 2YE6A 2BACA 3V81B 4URNA 3PYEA 1RB0A 4OZ0A 1YRXA 4KHRA 3SBMA 2JEFA 2PI5A 1NJYA 3EGNA 4LUBA 1ZS6A 4PQUA 2BSMA 1S16A 4Y2IA 1UPMB 2Z58B 1GJVA 1HYSA 2CRLA 4I6AA 2OD4A 1V9OA 2K5BA 3LF0A 3QFWA 2PT0A 2VG5B 2M0GB 3LTOA 1LNQA 1IKYB 2Z57B 2ROPA 1RT6A 3WZ0A 3QAUA 2F7VA 4AT1B 3BO4A 4A8MP 2R7VA 3UDLA 2PFFB 2VBYA 1X4GA 3GV7B 3G8SA 1X60A 4NA2A 3NAIA 1ZAWA 4ATNA 3UR3C 2JDJA 3ZZPA 3C6UB 4DL2A 1D9DA 2JNJA 4JV5J 1E6VA 1URRA 2E1RA 3PYFA 2HVHA 5HQMA 1VS3A 2M70A 1RTJB 4F67A 2EFNA 2ESAA 1BWVA 3DM2A 3HSGA 5HVFA 4O4RA 1ZOTA 7AT1B 2BYCA 4KQVA 1HPZA 1Z5CA 4FN5A 2OFGX 4DFKA 3BF4A 3D3BJ 3ZTRA 3DOKB 4G1QA 1UY8A 2ROEA 4QIWD 5LMNJ 1NHIA 1GMWA 4KHMA 4WP3A 2CJAA 4LWIA 1F3VA 2RT3A 2JLEA 5KG3A 4CTAA 4F4ZA 1RHKB 3CJKA 4I7FA 3F0NA 4HI2A 4ED6A 3C15A 2Z2LA 1HWKA 3QT8A 3GONA 1MNEA 3T6BA 5CTYA 2MEWA 3BDPA 2ROGA 3QJLA 4DR6J 1U0ZA 2GW8A 1KQKA 1HYSB 1NNDA 5AE1A 3DLLQ 1OWXA 2FJAB 4P2XA 1U47A 2L41A 2HVDA 3QSYB 2XNQA 1RTZA 3D9BA 4YKTA 3CRLA 4Q45A 2XSFA 4J5OA 2J9DE 1RT6B 4FYWB 5THWA 2XK2A 2WCXA 2O5DA 4ZP8A 1J5OA 1UP1A 5KG7A 3FSYA 2GJIA 1CLFA 2PC6A 3H5XA 3NGUA 3OFEA 4FYDA 1B99A 4Q2LA 1JJ2R 2M7SA 3PV8A 2VH7A 3IAS9 5M4PA 1P8GA 4MJKA 3OVSA 4XIUA 4BIUA 3VVTA 3FNNA 1R27B 1PG5B 5RUBA 2XMVA 3R7BB 4ZVPB 3L7PA 1QVFR 1D1UA 3RU0A 3MM7B 2IVFB 1FRJA 2PO4A 3ZC4A 4K59A 3GIFA 1I5AA 4DUYJ 2AEJA 4B3MF 4U96A 4B3RJ 2P2CB 1HPZB 4EUVA 3AY0A 2GQ2A 2BJ8A 4Y6IA 1JLFA 1SKUB 1S1XB 5M2RA 5D6GA 3JS9A 4X66J 4WK1A 2O1UA 2BANA 2V4JA 4JI8F 1I59A 3K5PA 4JV0A 1XBWA 2XWYA 2ERRA 1PC5A 4G65A 2UVRA 3C15B 4JV1A 4E98A 4LR8A 4K4ZA 4XAKA 3FUYA 2YWWA 4CLUA 4MAKA 3OUYA 3TZ2A 1PJ6A 3OXGA 4UY8T 1WHVA 2YKCA 5H1SV 4FXWA 4O0NA 1OSDA 3G7BA 3P4UB 2BQUA 3MPDA 2LXFA 3EGWB 1CQNA 2NS1B 3G2XA 2J6TA 2FJDB 2IWUA 4N5SA 2YKPA 3FC9A 4DX8H 3TZ0A 2P8IA 4ZVUB 2HKEA 3OTOF 4DF8A 2BUNA 4PUOA 3RUBL 1Y4SA 4LIWA 4H4MA 2UVVA 3D2RA 2R7XA 3R3TA 1N5QA 1Y5LB 2YQ0A 1XEZA 3AD9C 2N4DA 1GAOA 2XX2A 2CJKA 3NMRA 2C22A 4Q8EA 1SUQA 3CJ3A 3RBDA 1ZM4A 3HZEA 2BE2A 3NAHA 1KEKA 8AT1B 1S1WB 2RQ4A 2FUG9 2RHSB 2D9OA 3MGJA 3PKYA 1VFJA 3D1QA 3F73A 2XMJA 4FPPA 1F6TA 4ZLLA 1UVLA 2Q8HA 3H5SA 2GJ2A 1AUDA 2XCPA 3MEDA 4C9DA 2GQPA 3HX9A 1F5CA 2DNPA 1WC4A 2WVDA 3M2VB 1T0TV 2W2NP 5J1EA 3MF5A 2HNZA 3ZZYA 5C25B 2E5LJ 2MZSA 3K97A 1IKXA 2V69A 1UTAA 4OI1A 3BKUA 2I0XA 1HQEB 1OSCA 1Y8PA 2YNFA 2BBEA 1M5KC 3K57A 2V6AA 3PJ9A 4FYXB 1NDLA 5D4PA 4FVCA 2XD6A 4DL4A 4H4MB 2WONB 1RA6A 1HNVA 1UL3A 2CQGA 4DPOA 1Q82T 2R2SA 1XMOF 4FKXA 3ILLA 1BQNA 3NCQA 1HI8A 2FGCA 2ILYA 1HL6A 2DHXA 1FRKA 4J9OA 3GIJA 2C1IA 4R25A 1RHQB 2HHWA 4WKRA 4RUHA 2MQQA 1SUQB 4AFFA 2GAGC 3KFWX 4LWHA 2OI2A 3KOAA 4C0BA 4EM7A 1P1LA 3FQLA 2PN6A 1VQ8S 1XK8A 2U1AA 4ED2A 2C3UA 1AFJA 1B4SA 2GZOA 4P71A 3UI3A 1VR6A 2E5GA 4O3RA 4DL6A 2HFZA 2FTRA 3PG9A 2ZH1A 4BDPA 5AE3A 3HHNB 4B02A 4NLWA 3BQ1A 2HEKA 4RW8A 1WSRA 3CJ5A 4DJBA 4ZVOB 3G4SS 3AT1B 3DOLA 4DV1F 3MEDB 4XD8A 1RWXB 4CWBA 5HJYA 3RR7A 1TK0A 3DOMA 1BLUA 4I0WA 3NMQA 3BSAA 4NMLA 1IKXB 2H65B 4NCBA 1AMWA 2YEIA 4LF7J 2GAHC 2ZH3A 3R7SB 1L3UA 2Q66A 2C3MA 1FFSB 2CVEA 2DHHA 1BHNA 1YBTA 2OPSA 4XPEA 3HVRA 1TU0B 2DXDA 2J76E 3UD5A 3SFUA 4L72B 3PR5B 1K44A 1UAWA 1Q0NA 4LP0A 2G1HA 2QL5B 3QATA 4X64J 1YT1A 5AXNA 3PNIA 1EKSA 4A47A 1HNVB 2WSCC 1UYIA 2MYFA 2W2MP 3G7EA 1M5OC 3R92A 3MPUB 2ZC4A 2KG0A 1BYQA 4LR7A 3TA2A 3FFIB 2NLWA 2MZRA 2QG2A 1YERA 4PCQA 1FWPA 2RH3A 2OD6A 2WERA 1U2CA 2M4MA 1RGVA 3T19A 3ZZUA 4ZP9A 1NSQA 3M8WA 1VMBA 5FNCA 4DZ6A 4OJHA 2W2PP 1PC4A 5KG0A 4RW8B 3U1NA 1T9WA 4EK2A 4I4BA 1JLAB 3MCNA 4DU7A 5HLFB 4F50A 4ES3A 1RJJA 3IR7B 4WU2A 4NXMJ 4L76A 4M63A 4CH7A 2V8DA 3SQGB 3D6TB 1R6YA 3VVUA 3B26A 3BBCA 3I9V9 3NOCA 5L1LA 2ZWOA 1JK9B 3HZ1A 1LWFA 4HT7A 2GHVC 3PHTA 3CIZA 4JI4F 2OPSB 3IA0A 1FJ7A 4OZ3A 5KFWA 1JLCA 4NE9C 4OMFG 2ZZTA 3IP0A 3RAQA 4KGMA 1F9FA 5IZHA 4QYZK 4Q44A 1S59A 3FBFA 2DD8S 3J80Y 3RG6A 1SJ1A 4FBTA 1NHVA 4UQTA 1R8AA 2RMLA 2RKIA 1HR0J 3B4MA 3TUJC 1JX4A 2C2MB 3B24A 3R97A 2VJVA 1R8BA 2MJUA 2QL9B 3UCUP 2XLKA 1CJVA 1YTYA 4DV3F 3MPWA 2KVIA 2FIUA 3LMMA 1OPZA 1Q5YA 3G6VA 3O1LA 3MOJB 4TLRA 5BYSA 3GR0A 3I5CA 2FVRA 4A8OA 4LSLA 1QAIA 4LQ3A 3Q83A 3M8PA 3BSOA 3GG1A 1N6QA 4P2FA 1NDPA 4DL3A 2QA1A 1RABB 3MEEB 2YWEA 2UU9F 4QWDA 2DB1A 2MQMA 1EKRA 1KN6A 1EA6A 1SC4B 1YT2A 4ECQA 4E0DA 1W2BR 1U6ZA 4ZMMA 2DR5A 1J5EJ 5L39A 2VV5A 4S0MA 2IJRA 1HD0A 2IMWP 2K3KA 4EFTA 3KK1B 4IUFA 3M6VA 2OH2A 4DZYA 2OMOA 5BYQA 1RLCL 4NX9A 1FKAF 5G0RA 5F3TA 2HBYB 4JI2J 2GIQA 2GHPA 4C8YA 3W8PA 1VJQA 4CNYA 3RLRA 1N33J 4LFCJ 1VQYA 4MFBA 1UVJA 4KHPF 4EGHA 3HFZB 5L1IA 4DR7F 4B3TF 2FWYA 2R7UA 5D3GB 2B56A 1NH7A 3W63A 2WI3A 4RNFA 3RBEA 1H98A 2OTJS 4XDMA 3MECA 1CJVB 2GJFA 3TZYA 4X4TA 4KY3A 1AYEA 3OPDA 3LA0A 4CE3A 5LJ3Y 2EG2A 4CM2A 4O23A 1PAEX 2VF3A 2G0IA 5F0WA 2FVQA 4I67A 4YOEA 1SH2A 4LSLB 3RRGA 2FYPA 1NK0A 3M8PB 4FF3A 4JI3F 1U2OA 1N6QB 3JQMA 2WB1D 3O8WA 4CDIA 2IMOA 1FX4A 4Q0BB 1N36J 1HWJA 1JLGB 2CCSA 1HQ2A 4IFYA 2IJNA 4WFXA 2RSQA 2ZVSA 3C46A 2C2KB 1WI6A 2ASLA 1PAUB 2K7KA 3CJTA 4XTJA 2J7KA 1V3ZA 2GIFA 2WVBA 3EZOA 3ZZTA 4B3OB 2ZHBA 1CC7A 3BR9A 2KL8A 1RE1B 1S9EA 2BU7A 3QGGA 2XY6A 2DCUB 1EB0A 5FJ4A 3V4MA 4OYZA 5G0RB 2K1RB 1NHJA 3M2RB 2LLZA 4X2BA 1MLAA 1S0MA 2GGPB 4B9SA 2FHJD 1NZ8A 3TW0A 1RTDA 1HARA 4LF5F 2XDSA 2GNKA 4PXBA 5KFFA 2FWZA 3K89A 3UO0A 1YJTA 4X62J 2V5HG 3NCPA 1FDBA 2A18A 2NPIA 1VRTA 2QN6B 5EDWA 2I8EA 3OWDA 2NXUA 5A8RA 1YG0A 3MECB 5HP1A 1RKJA 2XMAA 2I5JB 4K0KJ 3HSDA 5KFAA 1DHMA 2BKOA 3UNGC 2YEDA 2G2OA 3K8WA 3HMJG 2UV8G 2AJ4A 1MG7A 4YR0A 3INWA 4AWQA 3ET6B 6FDRA 5F8LA 3C16A 4RR5A 3ENQA 2AKWB 2YNIB 4GVBB 3PW0A 4I64A 5ETRA 4QYRA 5K8NA 5HROA 2HQFA 3ZXWA 5J2PA 1Y5IB 5IT9U 1I6JA 3QDDA 2ZD1A 1V5IB 3NBPB 1SJQA 3DDIA 3TR5A 4JI5F 1YX2A 3N79A 2H55A 3QIDA 4CWSA 4X65J 3PZPA 3LALA 1X4AA 1YIJS 1XIQA 1UVMA 1U09A 4K4UA 1WEZA 2FPHX 1TKZB 4UTGA 3RGIA 3SQOP 2VOOA 2GMJA 1X4EA 1TKXA 3T41A 1IBKF 1R62A 1L3KA 4DSIA 4CE2A 3BZQA 9RUBA 1SL0A 2IDLA 1VQ6S 3K5MA 4O0BA 4IRCA 4P2SA 2WSEC 1OY9A 1JWWA 1RCXB 4Q43A 4ANDA 2UUBJ 3CJQA 1FKPA 2IA0A 3PY8A 3VAJA 2XABA 2CCUA 1W25A 1H0HB 4KFBB 5A8RB 5HP1B 1DTQA 4NLYA 3HT0A 3OWBA 1YBAA 3KLIA 3BMYA 4HDHA 3DGVA 4YHHJ 2DNMA 2DYAA 2LEBA 3U67A 4QBUA 2PMZD 3R2CJ 5E2QA 4AE5A 2QTWA 2O01C 2KT3A 4AD6A 1HBMA 4LF8J 5IC6B 3HVTB 2EKNA 4OI6A 1NKBA 3AXMA 2DY9A 3JSMA 3FMWA 2QLFB 4NZ7A 3Q22A 1ICEB 1U24A 1X9SA 5HROB 4MP2A 2ZNZA 2FY1A 3H7HB 4WFNQ 2HBQB 3MMAB 1KHWA 1KNZA 2LECA 1N5VA 4X4VA 3M8RA 1CC8A 1LOUA 3HHLB 2QE5A 4NCGA 2XM3A 1RZMA 4L94A 2B9YA 3IR6B 2SXLA 4OYWA 4DR4F 5I4MA 2Y3YA 3ZTQA 1TKXB 3LGNA 4RWWA 5GAGU 2IORA 3JTPA 5B0DA 3D6FB 3G87A 4USKA 1B64A 2UP1A 1PILA 2CNNB 1B62A 3BPDA 2WVFA 4PU9A 1NJWA 2V2QA 4EWTA 2BMBA 4DLEA 4IG3A 3KLIB 1YRTA 4NWBA 1X0FA 5BXIA 4B3SJ 2ZBIA 5D78A 1RWVB 1KBRA 2J7WA 1NK5A 4QIFA 3I4PA 1JLEA 3CPWR 5KFIA 2UUCF 2HIYA 4O4GA 2EC2A 5JVGQ 3CEDA 3HJVA 4ETZA 2FHMA 4GKJJ 2VC0A 2MLZA 3OTCA 3JSMB 1I5OB 4X4PA 2C1GA 3IGNA 4V19X 2ABYA 2BREA 2GO8A 3V6DA 1DLOA 4RW9A 3DNCA 4TVAB 5F8MA 2XO6A 1I94F 1KTVA 1HWUA 3CSKA 5CA5A 3QNWB 5E7OB 1NZAA 5H9EJ 3P5BP 3P49B 3CC7S 4BWJA 4QR1A 2ZDOA 2KFYA 2HHQA 2IAJA 7FD1A 2ASJA 2WW8A 2WI7A 4NCGB 2H9ZA 2I9SA 2FLNA 2PNRA 3G96A 1Y9OA 5I3UA 1T9XA 3IMQJ 2YGEA 2DEJA 3CGYA 2MKCA 1GK8A 4HYKA 1YSRA 1N0VC 1F2HA 3FKBA 4WP9A 3OTEA 2FHKA 2YKMA 1B3TA 5F8HA 2KVQE 4URGA 1G1XA 2YKEA 2VIHA 3EXYA 2W8KA 3UW1A 4ZVIA 2CQ1A 3P5TL 2CPFA 4IG3B 3JTOA 2EFQA 1FJGJ 2XB2D 1SC6A 4GMKA 1FK9A 5FLXU 1YESA 1VC5A 4H81A 3FBEA 3D6HB 3DRRA 3HSJA 2X1BA 3BGFA 1HI1A 1UFLA 5L1KA 1JLEB 4LRFA 1QVGR 2XG8A 2GS8A 2XZDB 4KRWA 4DR3J 4O4GB 3CO9A 2RF2B 4OX8A 3R4OA 3BR8A 1GMVA 4MK8A 4QR0A 3PR4A 2VU5A 4NH7A 2XLIA 4HACA 3H2VE 4E8UA 3T2SA 4JB8B 3MR2A 3UDCA 2JJCA 3AODA 1DLOB 4RW9B 1RWPB 2CGFA 2BW2A 2BU5A 2B4PA 5B7WA 4I68A 1S9GA 1UYHA 1S97A 3C14B 2J9CA 2ADCA 2CCTA 2AF6A 3PKMA 4A48A 3EDQB 1FT8A 3SCKE 4U93A 2YEHA 2VPZB 3CWJA 2BKPA 4RU9A 2IAJB 2B7BB 4X4OA 2XZTB 4OI3A 5K20B 3VAKA 4MKAA 2IYIA 3DYAA 4WFYA 4JV5F 4WE1A 1WHXA 3VV2B 2J9EA 3F56A 3C11A 3RBXA 3OQ2A 3TUPA 3CC4S 4WZQA 2J9DA 3LNUA 3MD3A 4B9UA 4NI2B 2CQPA 2B51A 3EVOA 1S99A 5FDLA 2L08A 4P73A 1HW8A 3BKTA 5E3PA 1YJ9S 1VK8A 3UVJA 5LMNF 2AYGA 2C2EA 2DNLA 3WC0A 4OX9J 4YEAA 1JLBB 1IBLF 3G8QA 4CWFA 1EETA 4HLBA 2F4FA 4EEYA 1LFWA 1DZ5A 3MTKA 5AE2A 1VYAA 1FK9B 4KO0A 1KFDA 1YSZA 1TMJA 3WQPA 5FNFA 1VCTA 3HULA 4DV4J 4A8KA 4V1Ak 4B9VA 3PYGA 3VHCA 2G2ZA 3POTB 3GYXB 1NHUA 5IV3A 4DR6F 1IM6A 4FNIA 3R5DA 4HACB 4GO7X 1G4CA 1AFIA 2Q8IA 1JKHA 1B7FA 2V2KA 4XCJA 4IQMA 5B0CA 2E1AA 3V5RA 3SFGA 1YRUA 2AYMA 2XMMA 4ZP6A 5ETMA 1IKWA 4WYWA 4JOUA 1S9GB 3B54A 5GMKa 3PHEA 1OQ3A 1W26A 2OPPB 4KKOB 3JQKA 1YC4A 1PJ5A 2LYVA 2OEKA 3MM9A 2YI5A 2YNGB 3AQPA 1EP4A 5FNDA 4WYLA 1UYDA 1AXQA 3THTA 2FLPA 2MGZB 3OXLA 3GJSB 3KJVA 2F5GA 4JI8J 4F4KA 2IY5B 4DUYF 2GC8A 2J6SA 1UPPA 2W24A 4B3RF 2AEMA 4XKKA 3VR1A 3A13A 2YECA 4Y00A 4BQGA 1UVKA 2EI5A 3DCAA 4Y2CA 1LWCB 5A6WA 2GVZA 4EBCA 4PYDA 1RTIA 4K4XA 1FDNA 2J8SA 3V2UC 2WRMA 4KO0B 2FVPA 3LP0A 2NYHA 4NEYA 3B27A 4KGVB 2DGSA 1QE1B 4A8WA 3OTOJ 3BQ2A 2RRAA 4CYUB 1QDUB 4HZ5A 2CG9A 4MOTA 3DLKA 4YY3J 3ZFVA 1H72C 2DXFA 3QO9A 2ZUGA 5GAGI 1JKHB 2OTLS 2HHUA 3H80A 1KSPA 2XX4A 1IKWB 3A0TA 3LOUA 1S6PA 2XS2A 4KV8B 3EDRB 2OP5A 4KIAA 2AGOA 3ZTPA 1YGYA 1SBRA 5I42A 1NB7A 3O2IA 4P2MA 2P5VA 1NB2A 2CIMA 2CQDA 2MTLA 1A0OB 2R9LA 1EP4B 2DNNA 1WG5A 1AJ6A 3AH6A 5J2NB 3KUGA 3VAFA 3MCMA 4NYPA 1QZRA 1UMJA 2JZ5A 4WUBA 4DV2J 3KJQB 3VGSA 2FLOA 2KFNA 2V8PA 3ENAA 2H48B 3QMQA 3C66A 5F8NA 4WF9Q 3ENWA 3NLCA 2ASYA 3KG4A 3JZ3A 1QY8A 1N4LA 3W66A 1YJUA 3HHLD 3J7AN 4DPXA 3DC2A 2YPZA 3EZUA 1IXMA 1ZWHA 2DGWA 4X4SA 5GVQA 2C28A 2KYXA 2F9DA 3R9LA 4PABA 3I96A 2HQGA 5DDRC 3Q8VA 5J2QA 2E5LF 3T10A 5KFBA 3MNRP 3W9IA 2OSQA 4C0OC 1FRXA 3FGVA 5L9NA 5IV4A 5AXKA 1WTFA 3QO9B 1XMOJ 5KG4A 1NSKL 3FEYB 3KLVA 3MM5A 1B0VA 2LQ5A 4KT0C 3FDSA 4NRUA 2FJVA 1IJFB 1X5TA 4I3HA 5BYRA 5F8IA 5C93A 1DJ0A 4ZOSA 1I58A 2YI6A 2ZH9A 1R31A 4TNOA 3A3NB 1ID0A 2EFPA 4WWSA 1N34J 4LF4J 2NYIA 4FDFA 2OEJA 2Q6BA 3MD1A 3THVA 1RT1A 1Q1KA 2WTFA 4ZCIA 2HFSA 2FJXA 4HZ0A 3CMQA 6FD1A 4LSNA 3DU5A 2PA3A 4N47A 3GMGA 5IQ6A 4RW4A 5F0UA 4FS2A 4RUAA 4DV1J 5KFDA 1Z2ZA 1HKAA 1IKVA 4TXSA 5C24B 5T7LB 5DG8A 4H85A 3DLHA 1O5JA 4A8SA 1JM6A 3QFHA 1BY9A 2VFUA 4PWWA 1ROFA 3MUTP 1YLXA 1KOHA 3QT5A 4YDXA 2VKZG 3KHGA 4MYUA 4KH1B 1UEKA 2Q2EB 2OELA 5J2QB 2VFVA 3H2LA 2Q79A 4QW9A 2K8GA 4LF7F 2AW0A 4P7VA 1FD8A 3W62A 1UYGA 2Y1LB 2ZBKB 4RBVA 1W2IA 4UOFA 2NXCA 3I5BA 1H2VZ 4PXCA 2LA6A 1T03B 3K5NA 3QZ7A 4KGZB 2HHHF 1H7XA 2CKWA 3KDNA 4PG8A 3I56S 1Q95G 3KUHA 2YE7A 2AEFA 3AOCA 2DO4A 4LRCA 4DR1J 3OTDA 4KE5A 3QJPA 1KIJA 2K2PA 2RAQA 1M1GA 2GMLA 2ZKJA 3JXOA 5CXTA 1URNA 5E3AA 1UZHA 5EHHA 1WSVA 3KLHA 1RKIA 4LSNB 3NWRA 3I32A 4DF4A 3BYPA 5F3ZA 2W4PA 3O6OA 4PXDA 1TL7A 2CQCA 4DV0F 4DL5A 4WU3A 2D3OR 4RNNA 4CLPA 4UZCA 1BWEA 3CCJS 1TAQA 3IBFB 3CCWA 1H2TZ 2MQNA 4NXMF 4ZPTR 1U0SA 2UWDA 1FXLA 1ZXNA 2V67A 4KSEB 2CDQA 2I38A 3AQOA 5HBMA 3TTZA 1L0OA 2YWHA 1DTTA 1SB6A 2AX0A 3BN4A 1CQMA 1N52B 4Z7YA 2HBZB 2KRBA 4MPNA 2Q43A 4RBTA 1PYTA 2RU3A 1MWZA 2ZVIA 2PSZA 3HT3A 2OUGA 3JSBA 3G9CA 2JVOA 2C3PA 4F0KA 5DDPC 3M6WA 2VPXB 3IRXB 1LWXA 4GKKJ 3R5AA 5F5RA 3ELHA 1ZZFA 3UPFA 4F26A 4CIOA 4HXWA 1TZ0A 1Y0HA 3MAAA 4XC0A 2C2AA 3S6EA 1HR0F 3PW4A 1KVIA 1UJ5A 3ZZ0A 3D54A 3D3CJ 1NK6A 3B8HA 2HFUA 3RAXA 4D3GA 4EGLA 3SSQA 3B25A 3ZTOA 2R2TA 2R7RA 2E5IA 4EMVA 3C3LA 1FO1A 5E5NA 2UU9J 5EGYA 1QSLA 3K2YA 4P8OA 2B9XA 2IVMA 3GIRA 3AHPA 4W4MA 2QMUB 5HVHA 2CADA 5HJXA 3KE6A 1T9YA 3D0GE 5ETQA 2CQ2A 3W5ZA 4PR6A 2H4YB 1YJRA 4ALZA 3A8IA 4ED5A 4U95A 4OYMA 2QV6A 4MP7A 4HY6A 2HWHA 5HBMB 2CXEA 4O44A 4NLQA 4DFPA 4IFVB 5IWAJ 1KLMA 1PJ7A 4TLQA 2IM2A 1LQ9A 3R5GA 3CCZA 4CWRA 1FKOA 3FK4A 3T9NA 4IO1A 5D77A 3DRPB 4DV6F 1UVIA 1NU4A 4JI2F 1YVFA 2M88A 1K47A 2ZHOA 1QM9A 1UA1A 1X9MA 1TC0A 1TILA 4PWDB 1RAJA 4HL9A 2C2NA 1IWGA 1N32J 1N33F 4LFCF 3M8YA 2FVCA 4BBYA 3MPYA 4DSFA 3FT8A 4NLGA 3OFGA 2DXEA 3DGPA 3P8BB 3MAAB 2R7TA 2E9RX 3IS9A 4QZVB 3FJ2A 3T1AA 3D0HE 3HVAA 5K8MA 3L95X 2A6MA 3ETOA 3BKFA 3O3LA 2W25A 2IM3A 1S76D 1U1OA 2B7CB 4RNHA 4PG7A 1GX5A 3VZHA 4TY9A 3TUHA 2VASA 4RBUA 1WD6A 1VIOA 4OHWA 5GMDA 3GIGB 1WEXA 4NASA 3O0IA 4TQSA 2D3O1 1VHIA 2RJZA 1AM1A 1C1BB 4WTOB 2XI2A 2PI4A 4K4TA 1T9TA 1M5VC 4ECRA 3W3SA 1UYCA 1ZW9A 3GP9A 2WOMA 2YKNB 1HMVA 4JAVA 1N36F 5KTQA 1KC8T 2KHDA 3FRZA 1RT4B 3MMCB 4TY8B 1Q8KA 4O44B 2EBEA 4YN3B 2R2RA 1MU5A 3KK2A 3H4DA 1IJEB 5IT0A 4LF5J 4OZ2A 4F4WA 3MZIA 1WKKA 3IBCB 4M5IA 3ISND 4ZPDA 1FKOB 4G1IA 2ACYA 1O8BA 3E8OA 3NS5A 3GCWP 4ASFA 2HGNA 1Y8OA 3OJUA 3BREA 1X4BA 2CVIA 4ZLJA 5ETSA 1LW2A 3KHRA 3FV5A 4XDCA 3K17A 1B63A 1RLDA 5GADU 4M95A 4PXEA 3G75A 4ECUA 2OSRA 3D67A 4JI7J 4X62F 3AD7C 3MEKA 3IS9B 1TC6A 3IEDA 4LF2A 1VRUA 1XR6A 4WUCA 5B0AA 4KGXB 2HMIA 1NDKA 4EBEA 1TUWA 4YKWA 4QU6A 4YFUA 3LANA 2NCKL 2NSBA 1U25A 3J81U 4UROA 2XS5A 3ADAC 3MWBA 1NPPA 4MMOA 1UYFA 1OIAA 1K0TA 3VGUA 1P9YA 1JLQB 1IXKA 2GX8A 5CHCB 4PRVA 3D5MA 2BABA 1DQ9A 3AB4B 5A2QU 2YK2A 4HTJA 1RWMB 1HNIA 4AL5A 2C3OA 5D7RA 4PG6A 4DN9A 3N4WA 1HNZJ 1K1QA 2FC8A 2FJBB 1VQSA 4MK9A 1TR0A 5EX0A 1ZTWA 1M5SA 4TN2A 3T6JA 1RA7A 1SKRA 3B28A 3IO1A 4X65F 3HYYA 2IBKA 2BDPA 1S9FA 3JSRA 3BH6B 4NH9A 1S1TA 3CYGA 1CULA 3G71S 4ZJQA 4QPTA 4IG0A 3Q8YA 4C8ZA 1HBOA 1TV6B 4IKAA 4J9NA 1JIHA 1VRQC 3ICLA 1IVZA 2YEJA 3OFFA 1Q8IA 5ETTA 2F3JA 2RS2A 5H9EK 2LEPA 1NJZA 2HNDA 4YDDB 4ER8A 3NS6A 4ZVRB 2UUBF 3M05A 1YJNS 3PX4A 5CZXA 2MDAA 2CQ3A 1SJ3P 5BR8J 5HMWA 3UCGA 1YDLA 4UQGA 4CLKA 3VQTA 4WZMA 5DZ7A 1SKSA 1X5PA 3HZGA 5D0GA 1ZTTA 5EN1A 4YHHF 2HHIA 2QYCA 1UY7A 4EI2A 3K5LA 5CYQB 2R8GA 5DM7Q 3L09A 4MBCA 4LF8F 1YKWA 1X31C 2ZE2B 2ZEJA 4Z2XA 2R8HA 1HNIB 2BJDA 1DBDA 2CQHA 2VBXA 5B0BA 1JXEA 5KFJA 5DGAA 1IBMJ 1QY7A 4GGLA 3MMBB 4U7NA 2O67A 2QRRA 2YX4A 1D3WA 5DDOC 1NUEA 3ZKDA 4KTNA 1C4CA 1WC0A 2OPRA 3P45B 1P9QC 1CULB 3R27A 1RBLA 1TUVA 3T0ZA 3Q5JA 1G2EA 4ZS6A 3DLGA 1HBOB 1WELA 3IGVA 3QT7A 4YB1P 4KPYA 3EPGA 4L8ZA 1T05B 5KG2A 4OIXA 2Y9HA 3V4IA 4OYOA 4EGIA 2HLUA 1N88A 2FQQB 1B3QA 1AH6A 5D15A 2HVIA 3R8YA 3PIOQ 4FMTA 1K9MT 4YR2A 4HHUA 2ZOMA 3FSXA 1OYEA 2HWIA 4OYIA 2KDOA 3NG8A 2F8MA 3IG1B 4WFAQ 1X4CA 1SXLA 2QLXA 1RTHA 2B4VA 4WK3A 3MR7A 4YQWA 3GPAA 2MLYA 3O6QA 5CYMA 4CWQA 2NR0A 4DI6A 2W9BB 4HHJA 2YWKA 3D4JA 3KLFA 1E6YA 4K8RA 4B08A 4IDKA 1S6QB 1U1KA 2YE9A 3GG0A 4GKJF 4L6V3 4GQTA 1HFEL 4DSLA 3NGSA 1J2VA 2O66A 3MAQA 3N28A 2R7QA 1NK9A 4R8UB 4DQQA 3BO3A 2K7JA 4TQRA 3TRGA 4OHVA 4Z37A 4YMEA 4DFJA 1NM2A 4ZVEA 3A1YG 2VBZA 3DMJB 1HQUB 1MMDA 3DDNA 3KLGA 2OPRB 5DGBA 1UW4A 2AKPA 3MHYA 1RUSA 1H74A 5DG7A 2DIUA 1EIYB 4UT4A 3R7NB 3HFKA 4OJGA 2JWNA 2R2UA 2HKJA 5HK4A 4DFMA 3SDEB 4WIIA 1UYLA 3M1VA 1CBKA 2MQLA 3DI6A 1SV5B 3T3FA 3H98A 2AZ1A 1CS4A 4N8NA 2I6WA 1U1MA 4EBDA 3T1KA 3JYTA 4MT1A 3UN2A 3VHDA 3HD1A 1U2RA 2G2YA 1Y11A 3J81j 1H6KX 1P27B 2M9KA 2ZFHA 5CCLA 3HSZA 1FJGF 1S48A 3AOAA 2VFTA 2ALZA 4M5GA 1N54B 4RLEA 4DCOB 4CWNA 2DT9A 4X4UA 5CYMB 4A4JA 4RNMA 5ITHA 1RWNB 5M4NA 4ZPVR 4DR3F 1O0PA 1HBNA 3KLFB 4RW7B 4MB9A 5DQGA 1S57A 3FCVA 3SV4A 2CG8A 2JOQA 2EK1A 2ZH4A 2RQCA 5EWGA 3Q2TC 2E1PA 4DXLA 5ADZA 5F8GA 3SZ2A 1HWIA 4Y3CA 2XLJA 4NA3A 5GADI 1RBOB 1Q7YT 4CLSA 2ZBQA 2HFNA 1OY6A 4NLOA 1XC9A 3TOQA 5M4MA 3A3PB 4CI0B 2MHNA 4RKUC 5A8KB 2QFOA 5HSPA 3U7JA 2AJFE 1LK5A 3Q8UA 2APOA 1RQ0A 1IQTA 3OD2A 1VBKA 2NZCA 4AXIA 2UXDF 3IRWP 1IBLJ 3Q8QB 1HHSA 1T9VA 4LT6A 2ZH6A 5JENA 1Y8NA 1M5HA 4I2QB 1H38A 1QYEA 1GXLA 5E3RA 1RT3A 2XYPB 3R4MA 3ZM7A 1T3NA 2AYEA 1REGX 2VCIA 1JJHA 3M8ZA 4OX9F 5HL7Q 1RYRA 1U26A 2VC1A 4PQUB 5JUMA 2XMWA 2J0WA 2JC1A 4M5DA 3VTIA 1VJWA 2YKOA 3EICA 4JI6J 1R0BG 2FYXA 2MZ1A 2VJUA 1S1VA 4DV4F 1BXNA 3PJWA 1Z5AA 2AV5A 2DNYA 4K7QA 2R7SA 3ETMA 2ZZMA 1FTCA 1EHWA 5FLXY 2HIQA 3A12A 2KT5A 3R5JB 1VI7A 4FZVA 8ATCB 4DUZJ 1Q81T 3TAPA 4R3MA 1B70B 3BGRA 4C3KA 3BM7A 1N8RT 3AJ2A 1HWLA 4F0HA 2HCHA 1NBEB 4BQJA 3D2WA 3CGZA 1TKTA 4L75A 2MZTA 2KG1A 3JAMU 1DY3A 1E6VB 3GLJA 3BN7A 2ASDA 1T8EA 3KDOA 3HI9A 1FE4A 1QTMA 4DUHA 3O44A 1NKEA 1KD1T 1WKJA 2W8LA 1K0VA 3DM2B 3OVBA 1TVRA 2Q8GA 1UW9A 2AJ2A 2Z56B 4U7CA 4QWEA 3KLEA 1UA0A 2BT0A 2R7OA 1H7UA 1WF1A 3H90A 4G1QB 3TYTA 2QL7B 4B9TA 1K8AT 2DNRA 2B6AA 4GEEA 2KRRA 1S6OA 1X4FA 3UN5A 1L3VA 4OI4A 3W60A 3H20A 4EO6A 2A10A 5KFRA 2CG4A 3J80U 1TIDA 4CTAB 4FYVB 3CJKB 2J0QD 4I7FB 1U1LA 1MSWD 4FKYA 2H51B 5LOQA 3UQSA 2VD3A 4Y0FA 2AD9A 3AB2B 5IM0A 1Q86T 3PEJA 4KPCA 3BS9A 3CCES 1NDCA 3A8KA 1H73A 2DO0A 4LJMA 3I0RA 3MOZA 2MSTA 2WBRA 4LVNP 2NUHA 3MEGA 1S1VB 4RWXA 5L9XA 2IWSA 2VQEJ 1GTHA 3H4BA 5EX3A 1SH0A 2WI2A 2J8AA 1J5OB 3G8TA 2MSSA 3ZNJ1 3FSIA 4YY3F 4LWGA 2QGFB 2HQIA 3W1YC 3QWPA 3RYLA 1WORA 4J90A 2HS0A 4ECZA 1NSAA 2CQBA 2O1PA 1TKTB 2HVEA 2CZ9A 2KO1A 2MZQA 5KFXA 1FJCA 4YB6A 3Q8PB 5IDJA 3I4HX 4NLTA 1D8ZA 2XHWA 3ILJA 2Z2ZA 5KT3A 1RYSA 1ZAXA 2V34A 1FHTA 3TVZA 2KTQA 3MTJA 1JLFB 2IFXA 4I1TA 1TL3A 4DCJB 5E3CA 3AA8A 4BAEA 2BANB 2V4JB 5LXYA 4IH7A 4DV2F 2HPUA 2XS7A 3GQCA 2JEJA 3H40A 4K4VA 1TELA 3MXHP 3D1OA 2IOQA 3IWNC 2YI0A 2DCLA 2RVJA 3QGHA 5IM0B 3OUYB 3LP2A 4JAUA 1PBUA 2ATLA 1FI4A 4DCPB 3I0RB 5AT1B 3H59A 3SXLA 5J6AA 2XHRA 2WW4A 3MEGB 1AZSA 4TYBA 2F8EX 2DH7A 3B6BA 1IBCB 1KVJA 5CD4A 2BU2A 1VDHA 4PUOB 2Z8QA 3GIMA 2QEXS 2PA8D 1D9FA 2X51A 3IBWA 2WI1A 4V19J 2N3OA 1IWAA 5F9NA 2OJ3A 1FNMA 4DG1A 4C11A 4IR1A 1OY8A 4XIPA 1FA0A 3IWXA 3ISZA 2R4FA 4JV2A 3UE2A 1SQGA 2Y0BB 2DKOB 2H5IB 4ZIWA 4NL5A 2BX6A 3CDAA 1T3OA 1KRPA 2YWFA 4WJBA 1XN9A 4ZN3A 2FJWA 2BE2B 3TUIC 3TZZA 1B7YB 4DUTA 3DRSA 2IVYA 1C0UA 2BQ3A 3EHHA 2BEFA 3FT5A 1N34F 4LF4F 2G0CA 3MMJA 1SL2A 1YK9A 3HHKA 3CJRA 4N41A 4ZHRA 3TQ1A 1BQXA 4ITSA 3PDNA 5K5MA 1UYMA 1R8PA 1GEHA 4NA1A 3DRXA 4I2PA 4O3OA 1BD6A 1VQ9S 2BJ3A 1PVGA 5J1EB 2HNZB 2G4BA 3LP2B 2XWXA 1TP7A 3QLHA 2JJ4D 3IM9A 3GFYA 4PQAA 5CQGA 2HRUA 4U8YA 1WJ9A 5C2CA 2Y1JA 1AZSB 2YNFB 3A8EA 2OLWA 3F41A 2HHHJ 1Q16B 2PE8A 3L7UA 2VBWA 3N01A 3TZWA 1VISA 2POKA 2E9ZA 4H4OA 4PPDA 4ES1A 3KMQA 3C19A 3PW7A 2YJXA 4C11B 3D66A 1BQNB 2A2CA 3IC1A 4ZVFA 2R7WA 2MKHA 3NS7B 2W4DA 4X84A 2HSEB 1SIZA 2B3TB 5DLGA 3I0SA 4KP4A 5GAHI 3M8QA 5J71A 2RDIA 4NCAA 3P6YC 3T1YF 2BR0A 1C0TA 3WDOA 4F2RA 1SC1B 4DR1F 2IIHA 3G6ES 1BXDA 1NJXA 2D41A 1FEHA 1FNXH 1Z2LA 3K7RA 2AQ4A 1EI1A 4DV0J 1FD2A 3U2DA 1AH8A 2W7OA 3W65A 4ZLPA 2KXHA 3H25A 3RLPA 4JI1F 3CD7A 3DOLB 4I2PB 3C0EA 2AJ0A 3Q8RB 3DOMB 3KTQA 4JYAF 1AA1B 3GE9A 2CPYA 1RWUA 1NK8A 1BUXA 5JJBA 4NYZA 3D0BA 4WIQA 4O3SA 1MN9A 5KFYA 1CJTA 3MM8A 1ITPA 1NO8A 5E0OA 2QMWA 1CEZA 4J7CA 2X1GA 2Q3PA 2W2QP 4NXNJ 4B9MA 5KT5A 2V8HA 2EPIA 3VGTA 1S1UA 3M2UA 1QUVA 4CLZA 1WOPA 2CPDA 4DSKA 2D7SA 3TANA 3LWLA 4F02A 1KHVA 2MKIA 4USHA 3K8VA 3Q24A 1N5YA 2VDHA 1RT5A 4ZPCA 3I0SB 4GKKF 4DDFA 1R7IA 3PW5A 4E72A 1RWKB 2CZ4A 4JP8A 1C2PA 5AJ3J 4A8FA 3A0ZA 2F65A 4PG4A 1KP6A 2KHCA 1WI8A 4I5SA 2L3MA 1LWEA 5LJ5Y 1TH8A 1XMBA 4KSGA 1B0TA 2LP4A 1GTEA 1U1RA 4XIRA 2R8KA 2C2OB 4FBUA 2IDEA 4R0EA 2MHEA 1Y5NB 5ETKA 4BC7A 2XHTA 3US5A 2H5EA 5ETPA 3SEOA 3LP1A 2EFVA 2JFKA 3QWUA 1NK7A 2FJEB 3SL2A 2IA6A 2DRDA 3ILIA 3S8SA 3CCRS 3TEGA 3HJFA 1X9WA 2YE3A 5IDMA 4DZDA 4OLPA 2YX1A 3V6HA 3OVAA 4TYAA 2AZ3A 4R5PA 3B78A 5I3PA 2Y1RI 1GMWD 2YGAA 1LWFB 1V5VA 4C97A 4CO1A 4DV6J 3MPVA 3OW2R 1QJHA 3VALA 3PFOA 1SJFA 1JLCB 3QIPA 2LA4A 3H0PA 5IWAF 1SPBP 1S1UB 4Q5VA 2XYHB 3KHLA 2UUWA 1LW0A 2RKIB 3KG1A 1N5YB 3D68A 3IN5A 3GU0A 3CJ4A 1Q4RA 2UVUA 3HF5A 4CLFA 1RT5B 2CYYA 2FY8A 1IM4A 2XDKA 1RHJB 1N32F 5KAKA 4JUZA 3CDBA 2V4RA 2HURA 3EX7B 3S7RA 3OL9A 1R3NA 4WFZA 1AW0A 1V6HA 5KT6A 4MYTA 3RW6A 4UF4A 1T02A 1WC3A 4UZBA 4HXZA 3X1LB 2RIJA 4RUCA 2ADBA 3KUEA 2HHTA 2RUGA 1L3TA 3PRDA 2Q1LA 2D69A 4DR5J 2QFIA 2AX1A 2N7YA 2B5JA 2E1CA 2RRNA 1RWWB 1TL4A 3GIEA 1F5AA 2RRBA 2ACMA 2MKYA 3GV5B 4J9UE 2YEBA 4DPYA 3CCTA 2NZ4A 1BGQA 5B09A 2EVZA 4NLUA 1W7WA 3L9ZA 3TA0A 3G82A 3S1TA 2WB4A 2RU9A 2BQRA 2XSJA 2FB0A 4QJVA 4R5PB 2YTCA 5DO2A 2E5HA 1KLNA 1M1KT 1FRHA 1U6BA 3GR1A 2HG1A 2QA2A 3LWMA 2H4WB 1CJUA 2EFOA 4WTYA 4ZKAA 2ZJQQ 1VQ5S 3T5JA 2CJBA 3KNGA 3V81A 4MFBB 3CD5A 1V3RA 3KKFA 2OPQA 2RNEA 1S14A 4HH0A 3PVXA 2V9WA 2HG4A 2J7UA 4U7UD 3GJRB 2W4CA 2CJQA 4MH8A 2DGTA 2CJXB 4CLTA 3FZ2A 3RW7A 1RP5A 2OO4A 1VQLS 2QSWA 4CM0A 2RD5C 3I82A 5L46A 1CG2A 1IKYA 4ANCA 3QRPA 3NGKA 4ECVA 4JI7F 4DWIA 3AAWB 3KK3A 4HR2A 2YBVA 3M9NB 3K0JA 2A2DA 3GFHA 2DHGA 1U2FA 2DRBA 2DR7A 1RI7A 1FXRA 2B5JB 4DSJA 2E7XA 4ZCLA 4ZK7M 4AS9A 3BDEA 4IFYB 4YR3A 1Y4UA 2VICA 1U4BA 2B4OA 4QWCA 1MX0A 2XSJB 4O09A 1BQMA 3DOKA 2XI3A 3D1HA 1S9EB 2BRCA 3S01A 4K4YA 2IRYA 1HNZF 5C5JA 1GNKA 4D3HA 2HQ3A 1S0VA 4RNOA 1RTDB 4DV7J 5CPHA 4R0JA 2CPJA 2DY1A 2DGOA 2UZAA 3M9MB 4EO8A 2OPQB 3D36A 2F8HA 2QG0A 4KB7A 2X3DA 4DX6A 2EFGA 4PL9A 3ZO7A 3NWGA 4FXDA 1YJ7A 4P75A 2JHEA 3CMES 1VRTB 4R3AA 3MDFA 3WX4A 1ZA1B 3BGLA 3KNAA 2VODA 2CWXA 3VGVA 3T1HJ 4E02A 3U2KA 2GQCA 3ZZZA 3KK3B 4AXJA 4B7PA 2P6TA 3HXMA 5CF0A 1SQFA 3C16B 3KXDA 5BR8F 3OR2A 3D28A 2WSFC 2A0FB 1K1SA 4ANEA 4AUKA 3S5TA 4A8YA 1WUUA 2BU6A 3I87A 4LQ9A 3U1LA 3GZ7A 2YPYA 4LRDA 4ZDNA 5J2PB 2LFVA 2D9PA 3BGUA 2ZD1B 1S12A 2KM8C 3MM7A 2BE9B 4OQJA 4YKUA 5D4NA 4MKVA 3TUZC 4ED4A 4OZNA 4GC7A 4ED1A 2H3EB 3W2VA 3J81Y 4OHYA 4HI1A 4USWA 1BQMB 4UOCA 3OJSA 4P6QA 3BO2A 4C8NA 3TJ9A 1WKLA 2ZUAA 4O05A 1S1XA 4KYZA 1IBMF 4Q20A 3SCJE 1HW9A 5HQLA 4Y65A 4DL7A 5A2QY 1ZETA 1X4HA 2PEHA 4XIQA 1WACA 1WDTA 4K50A 2CNKB 4FXVA 2VG6A 3SSRA 4FCRA 2VWCA 1NMEB 3GYNA 1NHKL 1PIEA 2DNQA 1FKPB 1KONA 1DTQB 2BOPA 1F2GA 3CB4A 2DJWA 1NCLA 5KFPA 1H7SA 2QIFA 4NLXA 2HQDA 2G1DA 4C4WA 4OJ1A 4LVOP 2YEGA 2FLLA 1RCOB 4CH0S 3OR2B 1HBMB 2Y8YA 5I3QA 2QMXA 3BJYA 5KT2A 2QLWA 1YQHA 2ZDXA 1DQAA 2ZITA 1RWOB 3HM9A 3PJXA 1SC3B 3ILOA 3CJ0A 1VHFA 4Y2KA 2CA9A 2DIVA 1F5BA 4WFBQ 3A0XA 3BM9A 1PO6A 4XDDA 2IRXA 2XY7A 3FCHA 3W2VB 5KFEA 1WG1A 5HMZA 1P1TA 2IWXA 1S1WA 1I5BA 1XNRJ 2EC0A 2KFZA 3GCXP 4URSA 5F8JA 4ZITA 1XTZA 1LV5A 1S77D 4DU8A 3OTBA 1VBYA 3EMTA 1GMUA 2FHJA 3CJ8A 1NKCA 1MN7A 4FPRA 3TAMA 2UUTA 2PIIA 3M2VA 1LXJA 3TO8A 2HBRB 2VG6B 2YEAA 5KFMA 5C25A 3HD2A 5HVGA 1FJEB 3TZ4A 3HYZA 4QCLA 1HQEA 2VHGA 3VAHA 1S7IA 5FD1A 2R3VA 4O0IA 3TARA 5KFSA 2Y8WA 2RHQB 4W92B 5KFLA 5CZVA 1VQNS 4TU9A 2CPXA 4O07A 2V2VA 2WONA 4CO4A 2ZDPA 3BPSP 1RU1A 2A3JA 4PWUA 2C2RA 1NK4A 5DJBA 2ZM6J 3EXCX 1XJWB 3T0HA 4ID8A 4XKOA 5KOWA 3PO5A 4FCQA 5E33A 1U6FA 3VAIA 4C8OA 2BJ1A 1YC1A 2AU0A 1WF0A 2KXFA 3V6DB 4LFAJ 2KZZA 2XULA 2ZDYA 1JMTA 5IC4B 3Q23A 1UJ4A 5LMUJ 4PKDB 4NLDA 2LCWA 3CD0A 2XJGA 4JI0J 1FRLA 3PXGa 3MUVP 2KYZA 1OS5A 2QSFA 1Y3KA 5D0EA 3NRBA 3DXSX 3LGMA 2GFDA 3ENVA 1I3OB 2RILA 2HYIB 4ZVQB 2VQFJ 4ZJOA 4O3NA 2FVSA 2N82B 3GB0A 4ED0A 2EW9A 5I3UB 2UXDJ 3FEZA 2WZ1A 1UVNA 4C2MA 3TAMB 4EU0A 4GRSA 5DLFA 3HKZD 3BSNA 3OL6A 1XMQJ 2Z4PA 2OHDA 2YKMB 3RJMB 4LF6F 4F8RA 4CRJA 1TTHB 2K06A 1VLOA 3CDUA 2HRYA 4OLOA 3RB4A 1ZAVA 3Q0AA 4OYAA 4OZ1A 4CWOA 3DRRB 1OSFA 3NGTA 5LM7E 1SCJB 2E66A 1MWYA 3NY0A 4WCEQ 1ZPVA 1YZ7A 4IR9A 4J9LA 4C6AA 2FDNA 4LBPA 4ZVHA 5A8WA 2VW5A 4M5KA 5D6PA 4JI6F 4YUDA 3FFIA 2M2BA 1ULRA 3K99A 3RAMA 3OPKA 1JB0C 1WOSA 1AUSL 2QLJB 3OHAA 1UWBA 1OJ4A 2DISA 2QG9B 3CIMA 1U45A 2VKRA 2ZC3A 3G6YA 4DUZF 3P3DA 9ATCB 2WEQA 3DN9A 4HH1A 1QAYA 2HRTA 2N4CA 2IRUA 3KHHA 3IR5B 4XITA 3CDWA 2L9WA 1NPRA 1QSSA 2A6OA 1FERA 1JLAA 3DYAB 4WE1B 5HLFA 1XNQJ 2DRAA 1R0CB 3SQGA 2DK2A 1S49A 1M5PC 2MY7A 2D3UA 2BJ9A 2ZH2A 4M5MA 1TFWA 5FDLB 2XZWA 1RHUB 2XYGB 2HZAA 1RT2A 3UVJB 2NXNA 5IT4A 1S4FA 2QZ8A 4YB7A 4LFBF 2HNYA 1RHMB 2QX0A 2UVWA 3CDEA 1EETB 5L3JA 2J0SD 2X1AA 1NRKA 3T5KA 2NXJA 2UXCJ 1FFGB 1HNWF 3MAHA 4DSEA 3UDVA 3DDKA 3W64A 4IOAQ 4O04A 3BBFA 4OYXA 1FESA 4NOHA 2V63A 4QOTA 4C8KA 5KFHA 1R43A 4HEA9 4KR0B 2ZBPA 3E01A 5A8WB 1G3OA 4H7QA 2PEBA 1RAFB 5LL6d 4AQYJ 4KH0B 3MR5A 2VQEF 1KZNA 1FWKA 4ZPAA 3N5BA 5IFMA 4PZVA 2AP6A 1X0PA 3U02A 4WXWA 2LXIA 4BC9A 1U1NA 5L1JA 4GCZA 1UWBB 2AWZA 3AD8C 3OL7A 5KFZA 1PYOB 4ZIVA 1PCAA 5H9FK 4WPAA 1L5UA 5ETLA 3MM9B 4WXOA 4FF4A 1XR7A 3NNCA 2B0GA 2WI4A 3OV7A 3MEEA 4P10A 1WTBA 3N9UC 3EJMA 2BVZA 4DPTA 5DZ6A 3KJVB 2DNOA 1Q7LB 3OBIA 4X4RA 3EHGA 4EZ6A 3E51A 3NNAA 3T9ZA 2YE4A 2ZNYA 3R91A 2QF6A 2ALYB 3LQVA 1UYEA 1TQLA 3EUNA 3JAMY 2M52A 1BKNA 2VONA 1RT2B 4RL1A 3KK1A 4DV5J 2BKNA 4V26A 2HNYB 3W5XA 1OQ6A 1HA1A 2AMCB 2MB0B 5KFKA 2IYGA 2GVZB 5A6PA 3R5CA 4U8VA 3R2DJ 3OXFA 3CCMS 1MWQA 1RTIB 1Y7PA 2B8PA 1GKZA 1UZDA 2VPYB 1S0OA 4W98A 3M30A 1SH3A 3LP0B 2GV1A 2O3DA 1G7CB 2F63A 2W2OP 4FNHA 4U7OA 2ZH7A 1MMNA 1NAQA 2O1VA 2B4UA 2R8IA 3TI0A 1FX2A 1Q8LA 3AXKA 3HPOA 5E3QA 3DLKB 2DH9A 3E01B 3CUNA 5D3GA 1KOOA 1SI9A 4B9NA 2HK3A 5CCMA 4J9KA 2UUAJ 3O2FA 2QJ3A 3A8JA 3PCOB 3RB3A 2IBOA 3TEHB 2PMWA 1XWLA 5HO4A 1V3SA
chains in the Genus database with same CATH topology
1S6PB 2FHMA 2KT5A 2VC0A 3I5AA 3OTCA 3JSMB 4X4PA 3OLBA 2UXBF 1WG4A 2LU2A 3IGNA 1VI7A 4FZVA 4V19X 4EFAC 2ABYA 3M8QB 2GO8A 2BREA 1Q8BA 4O3QA 2CPIA 2KU7A 5E41A 4Y2MA 1Q81T 3ZZOA 3TAPA 4MIAA 5I42B 4R3MA 1HBUB 5CYQA 1Q78A 3V6DA 3BGRA 1DLOA 4C3KA 5K8PA 2GQQA 3BM7A 5KOXA 5LT5A 3AJ2A 1N8RT 2F4VF 1HWLA 3KYLA 4RW9A 3DNCA 3SCIE 1CSJA 2KJVA 3QGIA 4G3IA 1C0TB 5F8MA 2HCHA 2YEEA 4ID5A 1CVJA 1I94F 4BQJA 4XCLA 3VCDA 3D2WA 2PMHA 3CGZA 1KTVA 1HWUA 1TKTA 3CSKA 5CA5A 2MZTA 7FDRA 1BC6A 4ASGA 1G6BA 2D74B 2KG1A 1E6VB 4ZA1A 3BN7A 2ASDA 5E7OB 2ZE2A 1NZAA 5H9EJ 1T8EA 1TL5A 1WWHA 3P49B 3CC7S 3HI9A 4BWJA 1FE4A 1QTMA 4DUHA 3O44A 4QR1A 2ZDOA 4Q0BA 1NKEA 2KFYA 1LKZA 1KD1T 2W8LA 1ZZNA 1K0VA 2HHQA 1JLGA 2IAJA 3DM2B 7FD1A 2ASJA 2WW8A 3OVBA 2W9AA 2WI7A 4NCGB 2H9ZA 1TVRA 2EKYA 3GFXA 2LEAA 2Q8GA 2I9SA 3FVYA 4U7CA 2J0XA 4QWEA 3MMBA 2FLNA 3Q8SB 3KLEA 2PNRA 1UA0A 4NLPA 2R7OA 5A0YA 4UY85 1H7UA 2BT0A 2DGQA 5C42A 1WF1A 3G96A 4ERDA 2LXUA 4G1QB 3TYTA 4ZKIA 4ECWA 1Y9OA 5I3UA 2YGFA 2ZH8A 4B9TA 4MTPA 4LIRA 1K8AT 4B3OA 2DNRA 2B6AA 4GEEA 2KRRA 2YGEA 1MROA 3U27A 1S6OA 2ZZNA 1YC3A 1DAXA 1X4FA 2NPFA 3CGYA 2YKAA 2LDIA 3T5LA 2MKCA 4OI4A 1VIXA 1L3VA 4HYKA 3H20A 4EO6A 4ED7A 1XERA 1M90T 1YSRA 2A10A 5SUHA 1N0VC 5L8RC 5KFRA 4QPKA 1IR0A 2CG4A 2BRKA 2K1RA 3QAEA 1TIDA 2E5JA 5D7DA 4CTAB 1BGXT 3M2RA 3CJKB 2CQ4A 4L90A 5M4HA 2J0QD 4KSHA 4I7FB 1U1LA 4IH6A 2P6SA 2GGPA 2FHKA 3OTEA 1MSWD 2YKMA 4N76A 3NGDA 1FVQA 5J1PA 3FEXB 4M1KA 1YJVA 5F8HA 3M30B 3UQSA 2VD3A 4URGA 4Y0FA 2VA2A 1G1XA 2YKEA 3MM8B 3M9OB 2AD9A 1T05A 3EXYA 1FTRA 3KG0A 5KG1A 2W8KA 3AB2B 3MFHA 3UW1A 5IM0A 1UETA 5HI7A 1Q86T 4ZVIA 2CQ1A 3PEJA 2XX5A 3P5TL 4AL6A 3QTFA 2CPFA 4IG3B 2OAUA 3BS9A 1S79A 3JTOA 3LAKA 3CCES 5KFUA 2HVZA 2EFQA 2XB2D 5L38A 1SC6A 4GMKA 4ZP7A 1MW7A 1IQZA 2COLA 1FK9A 1APSA 2DO0A 4LJMA 3I0RA 3MOZA 2MSTA 1YESA 1RISA 3HHDA 2WBRA 1WNEA 4CO2A 1VC5A 4H81A 2GA7A 4KGKA 4LVNP 2NUHA 3DRRA 3MEGA 2X1BA 2XMTA 1S1VB 3BGFA 1HI1A 3M2UB 1H2UX 1UFLA 4CE1A 2XJJA 5L1KA 1JLEB 4NLSA 4RWXA 5KFOA 2XG8A 5L9XA 4F4YA 1QVGR 3E2EA 4KRWA