3PEJA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of macbecin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
258
structure length
258
Chain Sequence
ESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin homolog
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of Macbecin
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Chaperone
total genus 75
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pejA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pejA01
1QZRA 4R3MA 4BXIA 2YJXA 4YKTA 5FNFA 2O1WA 2XD6A 3TUHA 1BGQA 1I58A 4CE2A 2HKJA 4KQVA 2H55A 3WHAA 4O05A 2WEQA 3A0TA 3FT8A 3VHCA 4E01A 3HYYA 2GFDA 1UY9A 2YE7A 3C0EA 4PL9A 2Q8HA 2YEEA 3RKZA 4BAEA 4DZYA 1QYEA 4V26A 2FYPA 4XKKA 4YKYA 3T0HA 2YE8A 2QFOA 3D2RA 3O0IA 4E02A 3ZM7A 1BXDA 4KP4A 3A0ZA 1UYHA 3QTFA 2XCMA 4CE3A 2YEDA 3B26A 4B7PA 2BU8A 1YS3A 1PVGA 3FV5A 2XX4A 4XCJA 2XHXA 3Q5JA 3EKRA 1AH8A 1Y8PA 4L90A 1UYMA 1AJ6A 3G75A 3B25A 2QG2A 3EHFA 3ZXOA 4Q20A 3ZXQA 2C2AA 5D7RA 4EGIA 1QY8A 2WI2A 5M4KA 1AH6A 4XITA 4K4OA 4BIUA 1MX0A 5IDJA 2EXLA 2YKJA 3D0BA 3JZ3A 4FCPA 4FCRA 4WUBA 2YEGA 3EHJA 4UROA 2HG1A 2CH4A 4FPPA 2H8MA 1UYGA 2YEAA 2VW5A 2Q8GA 3KE6A 5IDMA 3CWVA 2IWUA 5CTYA 5L3JA 2BREA 2BT0A 2ZDXA 5FNDA 3HHUA 1Z5BA 4QPJA 3INXA 2FXSA 4GQTA 4KSGA 1UY7A 4ZKIA 2BU7A 1YT0A 4XCLA 3TTZA 1I5DA 3H80A 2ZBKB 2FWYA 1THNA 3EHHA 3OWBA 4EEHA 3O6OA 3B24A 4EGKA 3CRLA 2XJXA 2YGFA 1B63A 4MOTA 5F5RA 2XHTA 1H7SA 5D6QA 2YE9A 3U2DA 1KZNA 2WI3A 4WUCA 4L93A 1YC4A 3GIGB 3LNUA 2QF6A 4XC0A 2JKIA 2JJCA 4CWNA 2WI1A 2CCTA 2QG0A 4LP0A 2XK2A 3A0RA 1I5CA 3ZKBA 4B6CA 2YK2A 1UYIA 1US7A 4FCQA 4GCZA 3T0ZA 4AWQA 1R62A 3R4MA 4WUDA 2YE3A 1ZWHA 5FNCA 1GJVA 1YERA 1Y8NA 3INWA 2BTZA 2IORA 4CE1A 2YEBA 3DGEA 2XDSA 2BYIA 4EFTA 5CF0A 2YKIA 2YJWA 3IEDA 3BMYA 4NH8A 2IWXA 2YEHA 2WI6A 4GGLA 5M4HA 5GGZA 4KFGA 5J6AA 3EHGA 3RLRA 4O0BA 3A0WA 2XX2A 2YI5A 4MBCA 2FWZA 4BQGA 1JM6A 2BRCA 3R4OA 1TILA 4YKZA 2YGAA 1Z5CA 2YE6A 3K97A 1BYQA 3Q5KA 4R3AA 1Y4SA 5BODA 2CGFA 3PEHA 4E00A 4CWFA 4PRVA 4EMVA 3A0YA 4LWFA 2XDKA 1ZXMA 1S14A 1B62A 4LWEA 3WQ9A 1UYFA 2XDUA 4FMTA 4XTJA 1TIDA 4W7TA 1YSZA 4O09A 2BYHA 4L91A 1UYEA 5IN9A 4XKAA 1L0OA 4KSHA 3BM9A 3ZKDA 2GQPA 1YC3A 2CCUA 3VHDA 4LWGA 2YK9A 1EI1A 3G7EA 3CGZA 5M4MA 4U7OA 4PU9A 4XKOA 4MPNA 2YGEA 2O1VA 4JAVA 5FWKA 4U7NA 5F3KA 4HZ5A 2BU6A 4EFUA 4H81A 3LPSA 4AWOA 1I5AA 2YI0A 3R92A 2ZKJA 4XIRA 2IWSA 1YC1A 4YKXA 4ASFA 2O1UA 4DUHA 2VCIA 4MP7A 2ESAA 3R4PA 4YKRA 5M4NA 1B3QA 4L94A 3TZ0A 3HEKA 4H7QA 4LPBA 5J71A 3VHAA 3K98A 1Z59A 4MPEA 5CPHA 3RLQA 3NMQA 3SL2A 2Q8FA 1MU5A 4H85A 5M4EA 1ZW9A 5D7CA 2XJGA 1I59A 3G7BA 2YKBA 3HZ5A 1NHJA 4CWRA 2YECA 5CTXA 3A0XA 2K5BA 3D36A 3RLPA 4YKWA 4JAUA 4JASA 4GT8A 4I3HA 4AS9A 1A4HA 3C11A 3OMUA 2ZDYA 4ASGA 4XDMA 4GFNA 4O07A 4L8ZA 2XDXA 3R4NA 4U93A 1OSFA 4HXZA 1TC0A 3OPDA 2YKEA 5D6PA 4MP2A 4AWPA 2VCJA 4BQJA 1EA6A 2YEIA 3FT5A 4YKQA 4X9LA 2YKCA 1KIJA 1YETA 4HY1A 4XIQA 1BKNA 4PRXA 4URNA 4MB9A 1YT1A 3EKOA 4HZ0A 1Y4UA 2YE4A 3QDDA 1TBWA 1NHHA 1UY6A 2Q8IA 1U2OA 2YEFA 3HZ1A 3H4LA 4ASBA 4EGHA 1UYLA 4NH7A 1I5BA 3OW6A 2YE5A 4LWIA 5CTWA 1ID0A 1NHIA 1GKZA 2WEPA 2WERA 1ZXNA 4YKUA 3R91A 4CWOA 1U0ZA 4V25A 4CWQA 2XJJA 1GKXA 3TZ4A 2IOQA 4P8OA 5C93A 1YESA 2PNRA 3CGYA 2AKPA 4O04A 3VADA 2XABA 2XDLA 2WI5A 1Z5AA 4ASAA 1YT2A 1YSRA 3TZ2A 3T2SA 2WI4A 1Y8OA 1S16A 2YI6A 3O2FA 4XE2A 3TZ5A 4BIZA 2XHRA 3T10A 4HXWA 1UYCA 2YEJA 3K99A 4KTNA 4P7AA 5CTUA 2CCSA 5BOCA 2CG9A 2IOPA 1AM1A 3U2KA 3HYZA 3GIEA 1UY8A 3U67A 1UYDA 2YI7A 3B27A 2XX5A 2BU5A 3Q5LA 4URMA 3OWDA 3PEJA 2BU2A 4GEEA 2VWCA 2Q2EB 2E0AA 4I5SA 4HYMA 4HYPA 2WI7A 3B28A 4CWPA 3T1KA 1H7UA 3CRKA 4HY6A 1AMWA 4XD8A 4R1FA 5M4PA 2BSMA 4CWSA 1TC6A 3GIGA 4ZVIA 2BZ5A 3K60A 4QPKA 3MNRP 4EM7A 2YE2A 1UYKA 4MPCA 2HCHA 3GIFA 5D7DA 2UWDA 4NH9A 4CWTA 4JQLA 4XIPA 4LWHA 4URLA 1TH8A
chains in the Genus database with same CATH superfamily
1TL3B 4KBIA 2UV8A 1D8YA 4IYQA 3VGUA 2MB0B 2HKJA 4B3TF 1UJ6A 4QYZK 1T0TV 3CC2S 5IOLA 3IR7B 2R7OA 4QOTA 1YIJS 2WBRA 1D9DA 1JNZB 5LSOA 5F8MA 3OFFA 2YE8A 1VK3A 1VRTB 5K8NA 3FCHA 3O0IA 4QQBA 1SJFA 3D54A 1KONA 4CE3A 3WDOA 3NLCA 1SIWB 3B26A 4KGMA 3MAAB 4RU2A 1YS3A 2Q66A 4GKKJ 1FDNA 1AH8A 3HF5A 4OYZA 1HNVA 2DPIA 4CLYA 2ZZNA 2IM3A 3HJVA 1ZTTA 4PPDA 2CPZA 2IIHA 4ANCA 1HWJA 2V8PA 1BQNA 1WACA 4LRBA 2BOAA 2D9OA 2HHPA 2NLWA 2VUGA 4FCPA 5RUBA 2CPDA 4MIWA 4LR8A 2C2EA 4OZNA 4PWWA 3F44A 5CYMA 3BYPA 4HHUA 5KFDA 4ED2A 4Y2IA 5LMNJ 3OTOJ 3B4MA 1TTHB 2FZCB 3P49B 3L09A 1TL1A 5LOQA 4DUYJ 4LMZA 4G1QA 1S1XA 2BBEA 4YQWA 1RWKB 4JV2A 2VH7A 1B63A 2XHTA 3CJRA 5J1NA 4AQYJ 1QJHA 5KFFA 4FS2A 4UTGA 1FD8A 2YX1A 5A8WB 3EPIA 4OZ3A 2CJQA 4PXDA 5DG9A 2O66A 1S9GA 1F9EB 3T0ZA 3H90A 2PGCA 2A0FB 2H5JB 3KHLA 1FXRA 1TKTA 3SV3A 2YEHA 5E3QA 3EGZA 4GGLA 3OD2A 3GTYX 1S1VB 3S7RA 4AXIA 4KH1B 4ZVUB 2WRMA 4A8MP 4Y2AA 2OPPA 4MBCA 3QFHA 2J5AA 3UVJB 3PW5A 2ZJQQ 4DUZJ 1HI8A 1KN6A 1F5CA 4N77A 2GHVC 3W9IA 4DR7J 4TNOA 3W60A 2CGFA 3IRWP 5G4DA 4LWFA 2JRSA 4QIGA 4ELTA 4ZVRB 1WD6A 2RMLA 2DTJA 4IH6A 1FF2A 4DV5J 1WEXA 3LGMA 4EYHB 3JQKA 2FLLA 2WOMB 2MLYA 1WORA 3BDEA 4TYAA 3TJAA 3BGRB 3H2LA 1CJUB 1HNWF 2ZVSA 2DKOB 3AJ2A 3QGIA 4G65A 2C2NA 3TANA 4X62J 3T1HJ 5A6WA 4Q2LA 4E2FB 4LF9J 3CPWR 2J9CA 4ZP9A 4A8XA 2XC9A 4DPXA 1KVJA 1LWFB 4USVA 2W9CA 3HEKA 2HAIA 4ETZA 2C3OA 3MD3A 4NLPA 1WG5A 1RISA 1TUGB 3W9JA 3MM6B 1QLNA 3WQPA 1IKWA 2V4QA 3HO1A 3RLPA 4YKWA 1T11A 4GT8A 1FFGB 3HFZB 1JLAB 4PXBA 3DU6A 3AA9A 3BS9A 3MUTP 2EKNA 1OS5A 2JNJA 1RLDA 4R0JA 4LSLA 1IBLJ 1TC0A 3W9HA 5JXSA 2M88A 3C66A 2MGZB 3H5XA 2DHXA 1KS2A 1T3OA 4ATNA 3EKOA 1VIOA 3HHLB 2OAUA 1VJWA 1ZAXA 2R2RA 5L1JA 3HZ1A 5IWAJ 3K8WA 2P6SA 9ATCB 4LWIA 1KTQA 1YSJA 3MEKA 3LP1B 4YKUA 2QL5B 5CXTA 3UCUP 3A3OB 2F4VJ 4O3NA 1JLBA 1S9EA 5GAHI 4ETXA 5CA5A 3GG1A 3RU0A 2VFVA 4HDGA 4K4SA 3MM9B 4BIZA 1V9OA 2IOPA 4AT1B 5H1SV 1RYRA 3OBIA 1JLQA 4GVBA 2BU5A 4MH8A 2J7UA 1PYSB 4J37A 3HZGA 5FLXY 3T5JA 5C24B 3ILOA 3M1VB 1X4AA 2AJ2A 4YR3A 1OY8A 3R6GB 3TAMB 1U0HB 1NZAA 3OL7A 3DM2B 3N6NA 3UNGC 2QIFA 2HS0A 4QYRA 4DL7A 5D15A 1FNOA 3R2CJ 1CJTB 1TK5A 3I4HX 1YG0A 3DLGB 3M2UB 1ZBTA 3KLEA 4R3MA 1NZ8A 3VAJA 2KT2A 4UQGA 4TQRA 4YKTA 2AEMA 3U27A 3DRRB 4PUOA 4DEZA 1RAHB 2YQ1A 3VHCA 3HXMA 4O44A 1N34J 1PC5A 2GFDA 4ZITA 1HBUB 4DR1J 3M30A 2COLA 4F3OA 1QYEA 2XMMA 2VKZG 4USJC 4E02A 1WSRA 2ZWPA 1SC3B 1GEHA 1RCOB 3LO3A 1FRLA 2PIIA 3G96A 1OPIA 4B7PA 2XX4A 3ISNC 1HD0A 3BB5A 2HFNA 1FX2A 1NDKA 4ECUA 1F3VA 1AJ6A 2HQDA 2PI5A 4RWXA 4E72A 2UUTA 3A8KA 3A3NB 5JENA 1CS4B 4ZVQB 2L9DA 2GQCA 3N9UC 4LF1A 2UVRA 2XHCA 3I9V9 3MOZA 5KG4A 3Q8VA 2EVZA 3D66A 3D6TB 3KLFA 1HI0P 4CLKA 3EM1A 2HAFA 3MM5A 5A76A 2PA8D 3PVXA 3R5GA 2EK6A 4DL6A 4MKVA 4FS1A 2R7XA 4MYTA 5K8MA 2UXBF 2YXLA 3IG1A 5D6QA 4RBTA 2X3GA 3PKYA 4CWBA 1LW2B 1YC4A 1MNEA 2MKSA 3PR4A 3AJ1A 2JKIA 1C0UA 2QG0A 3A0RA 1CC7A 3Q8YA 1U8WA 3DLKA 1F2HA 2Y0SD 3CCLS 3H5UA 1MROA 4WUDA 1S10A 2H48B 2HBRB 1SQEA 1YX2A 3DGPB 4CM2A 2BYIA 2VOPA 2QLJB 3SZ2A 2IWXA 3TUIC 2WI6A 5M4HA 1NDLA 3WIVA 2E9ZA 2N4CA 5KFBA 3SSRA 1PILA 2RDIA 5DG8A 4J5OA 4NL5A 5LSRA 4TY8A 3DXBA 2QE5A 2B4VA 1YKWA 4GMKA 4QPTA 4RNMA 2HNDB 4JV0A 2ZH4A 1E6VA 3I82A 1RWPB 1DRZA 4CWFA 4Q44A 1U1KA 4EMVA 1DTTA 4I2PA 4USUA 3EDRB 2WB4A 5K9FA 3UW1A 4J9LA 3P6YC 2KU7A 3TNVA 4PWDB 1TIDA 3E8OA 3CJ0A 1S0NA 4CT8A 4O09A 2HS4A 3CTRA 3IRXA 2QN6B 1FRMA 4KSHA 2MHEA 1YC3A 2ACYA 3EDQB 3M9NB 3PYGA 3KWMA 4AYBD 3C2PA 1VBZA 3HFKA 1UA1A 3IXQA 4HVZA 2WK4A 2MTLA 1AW0A 1RHKB 4DCOB 5G0RB 4KE5A 4H4KC 4DLGA 4I0WA 5LSLA 2LCWA 2FVQA 1QM9A 4X4SA 4YHHF 2B56A 1D8ZA 1QAYA 1IBKJ 1MWQA 1TZ0A 2XMVA 1DJ0A 4GC7A 3KHHA 4FP9A 1WC3A 3LP2A 1RTHB 2ZDPA 4Y28C 2PD1A 1CJKB 5IT4A 5IQ6A 4I7FA 2I6WA 2PN6A 2KXNB 2IY5B 1GMVA 4H54A 1NKCA 2BJ8A 1TU0B 4ZP7A 3MAQA 2AJQA 1ZTWA 3SDEB 3AJDA 1X4GA 4L72B 3GJQB 2DHAA 1B7FA 2BEFA 2BXJA 3IMQJ 3SXLA 1U49A 4B9SA 5DZ7A 1G3OA 1PBUA 1FA0A 2YNHB 2R9LA 5K20B 1GMWD 3BPDA 3NGSA 4V25A 3W7BA 4ZVFA 3MR7A 1D3WA 3SCJE 4ZVPB 3QBCA 1R27B 3OR2A 3WX4A 4M8LA 3BGLA 1Z5AA 1DBDA 3TUZC 4OYOA 3THTA 4DV0F 1REVA 3SIPB 3MMCB 3QLHA 1XQIA 2HNZA 1Q8KA 2XMAA 3LTOA 1D1UA 5KG7A 4LRCA 1VQYA 4Q2MA 3Q2TC 2MMYA 4XPCA 3D6HB 3KLVA 1ZZNA 2VWCA 4M63A 3MM7A 4I5SA 1RUSA 4B3OA 1SH0A 1S0VA 1ZAVA 1RP5A 4ECWA 4ZN1A 2IAJA 4RNNA 1AMWA 5M4PA 4ZVSB 2GAHC 4ZVIA 2HQ3A 4RUCA 8AT1B 1QUPA 2P6TA 1N5SA 2DEIA 4ZS6A 3GIFA 2GVDA 3PRBA 2UWDA 2XBPA 4ANDA 2RIJA 1ELOA 2I1RA 1H2TZ 2WONB 4BXIA 4OMFG 1U45A 3O6QA 1S4EA 4E01A 5IT9Y 2HZCA 3HVRA 6AT1B 4U8VA 4B02A 4F04B 3GYGA 2AEFA 2G2OA 5A2QY 3PACA 2HZVA 4UT4A 3JSMA 3NMRA 4NZ0A 4NE9C 3BQ2A 1VQ5S 2WSEC 4KSEB 3L95X 1Q8BA 1FRIA 4DDFA 5KFAA 4WTOB 1ZPWX 1O5JA 2IM1A 2XCMA 2YEDA 2XLKA 2CRLA 2W7AA 5D8HB 3EZOA 3PRVA 4MIBA 5J1EB 4U6PA 1LW0A 1UYMA 2IVYA 4EU0A 2Y3YA 1FTRA 3I6PA 2LDIA 2CQ3A 3NXZA 2WI2A 3HP6A 3KKFA 3ZZYA 3T6BA 1H74A 2DXDA 3IGNA 1V3ZA 3OR1A 2GJIA 1KDNA 1OYDA 3NBPA 2ZH6A 2KYXA 5HROA 3HT0A 3I5BA 1UYGA 4ZHRA 2IMWP 4AUKA 4M5MA 3GMGA 1FCAA 1IQTA 4DV2F 2CQDA 2IDLA 1CQMA 5ETTA 2XCPA 2FVRA 4Q0BA 2ZDXA 1FFWB 1I94J 1SC4B 3OTEA 2AT1B 3TTZA 5DDQC 4CH7A 1FEEA 4EEHA 2ALZA 2YGFA 2BZ2A 3W1YC 4B3MJ 4ALZA 2I38A 4WUCA 3DLJA 1MMNA 3Q23A 3R6LB 3MMBA 3A12A 3J81Y 4F0MA 2XK2A 1H7XA 5F8IA 5ETRA 1RT6B 3ILIA 1S48A 1XBWA 4W98A 4F50A 1Q86T 3W2WA 1HWIA 5FNCA 2ADCA 4KY3A 2BTZA 4F3MA 2R7RA 3TQEA 1VGYA 2Z8QA 4LBHA 3SMZA 3CJQA 1HNWJ 3FJ2A 5B0BA 2GA7A 2DY1A 4DX7A 5EWFA 2PDAA 3R4OA 2XHWA 1TILA 3JTOA 4NMXA 1XERA 5HP1A 4DR6F 4JI0F 4K4ZA 2W2MP 1Y4SA 4X4NA 1YVFA 1XEZA 5F9NA 3P5TL 4E00A 3CJ5A 1ZXMA 1NB7A 3EZ5A 4QPXA 1UWAA 1M5OC 4OZ1A 2BDPA 1PJ6A 4QR2A 2BYHA 3ENVA 3GV8B 2ROPA 3DOKA 4C48A 3R27A 2G0JA 3DLHA 5JVGQ 3C6UA 1S6UA 2UUWA 1RT4B 1Q1KA 5T7LA 5F0WA 3CF5Q 1S72S 2CIMA 2CJXB 3EWGA 1S6QB 3UDCA 2C22A 5IC6B 1HQEB 4UW2A 1OJ4A 2ZKJA 2BJ1A 2EFOA 1S9FA 3GLJA 2MJUA 4E0DA 4L94A 3HHLD 2WZ1A 4WKYA 2R42A 3KK1B 4DQPA 3RR7A 3MR3A 3G6YA 3K5MA 3EGNA 3QO9A 3NMQA 4B3RJ 4KFBA 1HHTP 5M4EA 3WHIA 4NZ7A 4WYWA 4JI3F 8RUCA 4RUBA 1TMJA 3VAGA 2BQRA 4QYZJ 3FFIA 1U6FA 1IR1A 1SH3A 2OTJS 2ZBRA 4NRTA 3O3LA 2AYGA 3BSOA 1HQ2A 1N8RT 1M90T 1KVIA 1I51B 5D0HA 1GXLA 2ZDYA 4ASGA 2B6AB 4RW6B 4DPOA 2MLZA 2HHVA 1T9WA 4YP3A 4ES2A 4HXZA 1VYAA 2EKYA 1F5BA 3H20A 5D77A 3S5TA 3N5FA 2MKYA 2AJ4A 4HI1A 2W8KA 2W2NP 2V94A 2H9ZA 2YKCA 3TRGA 4WFBQ 1QY7A 1NJZA 5HVGA 3AB4B 4I1TA 5HN0A 4X4VA 4WE1B 4JB8B 2GIFA 1ZETA 3H4LA 4ASBA 3ITHB 3UR3C 2V2QA 1WOOA 3HVTB 4ID8A 2WERA 1TQLA 3K58A 3RB0A 5KFJA 1DY3A 2VJVA 3D4JA 3D6MB 2AKPA 2MPUA 2XDLA 1KP6A 4UUXA 1YT2A 3T2SA 3K99A 3JQJA 3IBCB 2XCAA 1RHJB 1SCJB 4LF2A 1VQKS 4OYAA 4GEEA 4AL6A 5GAEU 1RTIB 5JVHQ 2ZDOA 3B28A 3T1KA 2SXLA 4DF4A 1TL3A 2HVDA 4F4AA 2C2DA 4Y65A 5HQLA 5J2MB 1JQGA 2XY6A 1WHXA 4K0KJ 4I6YA 2VC1A 5DGAA 3RGIA 3F0NA 3WC0A 4XIPA 2L9NA 2BE2A 1X8DA 5DO2A 4YKXA 4MKAA 4C11B 4CO3A 1WC1A 2XD6A 3TP2A 3VR1A 1NJXA 2HNYA 3A0TA 3L7UA 3HFVA 2BANB 3HYYA 3DRXA 3MURP 2CUYA 1Q53A 3DHWC 3ZTPA 1UCNA 2OO4A 2CPYA 1QVFR 3TA2A 1Q5VA 5D3GA 1UYHA 1MSWD 4PYDA 4DR5J 3J81j 5BYRA 7FDRA 2CZ9A 2DNMA 1PIEA 3QIDA 1CSJA 4WXWA 3K5OA 2DGUA 1WKJA 3AHPA 1HNIA 3EVWA 4JI4F 1T8EA 3V81A 4NCGB 3HHDA 2B4OA 2HFUA 1MX0A 4YUDA 3D0BA 3A8EA 1U26A 4N8OA 3GJRB 5CCLA 4WUBA 4J9QA 1HNXJ 2B51A 2BKOA 1IQZA 2QGFB 4U7UK 2J6TA 4Q5VA 1H38A 3CD6S 2FYXA 1RYSA 1JLFA 2MZJA 3POTB 2BREA 4IG0A 1QE1B 4LF6J 3HHUA 3GR1A 1CQNA 5A8WA 1X4EA 1IKVB 3CRLA 1R8PA 1H7SA 1LXJA 3CJ3A 1GXTA 2X1AA 2KJVA 4M5HA 3LNUA 2WHOA 5AXLA 3R8YA 5A8RB 1ZM4A 1L3VA 2CCTA 1SKSA 2B4UA 4J9KA 3OJSA 2YE3A 2VIHA 4LR9A 1SPBP 2B4PA 3OVSA 3NCQA 3U1MA 5CF0A 1J27A 3DI6B 3BMYA 2Z2MA 4ZDNA 1RABB 1SI9A 4PG5A 2ZBQA 3EHGA 2IC3B 2EWHA 3VAIA 4C8NA 3CSKA 3HLUA 3GFHA 1RU1A 3S6EA 2YGAA 4ECXA 1PC4A 2XZDB 4DR3F 5C7PA 5E0OA 2CQPA 1HNZF 1YGYA 5EGYA 2WTFA 2VPWB 4QU6A 1RTJB 3BGRA 1V3RA 1CJUA 1LOUA 4QIFA 2YKNA 1S1UA 2X3DA 5GMDA 1X5TA 4N8NA 2B9WA 1YRXA 4IDKB 5CYJA 4DX8H 2D41A 2HS3A 3MHYA 3U1LA 3BM7A 2D9PA 1C1CB 2KVIA 3UFCX 1B0VA 1DURA 4CRJA 1BLUA 2RRNA 3HD2A 1S49A 4DLEA 5M4NA 4R5PB 1B3QA 4EUVA 1NSKL 4TYBA 3MM6A 4RZRA 4QBUA 2VFTA 5JMNA 1VHIA 2Y1JA 1J5EF 2DY9A 2QLBB 4DSJA 2RUSA 2K06A 1VJQA 4FYXB 2LQ5A 1IBMF 3DMJB 2KYZA 4XO0A 4Y2KA 4DV1J 3RB4A 1X4DA 3QWPA 1TUVA 1FFSB 5HI7A 4IOCQ 4CWRA 2HFZA 1VRUB 2CZVC 1N6QA 4RWWA 3X1LB 4RUHA 2ZE2A 5M2UA 3MEEB 1HHSA 2VOOA 4YB1P 2R8HA 2B8QA 2MGZA 2NPFA 2DYAA 1YBTA 3CULA 5K14A 2EFQA 3GU0A 4QIEA 3THPA 1NU4A 1A6LA 1EIYB 5F0UA 3BSAA 3R5JB 5BXIA 3MD1A 2ZM6J 3J81U 1FKPB 4DG1A 2VFSA 3MPWA 1B4SA 5HLFB 2CXEA 4B9LA 4IH5A 2IVFB 4NA2A 4ZPWR 4KR0B 2E1PA 2IVMA 3QFWA 1ROFA 4X64F 3NKYA 5F41A 3HVAA 4JI1F 2KB2A 2HQIA 4PWUA 2KI2A 2FZKB 4DF8A 1OSCA 2LXIA 1FK9B 4NLSA 4B9MA 1WOSA 1NKEA 4DV3F 3PNIA 2NSBA 2CPJA 3LPYA 4R8UB 2XHRA 5C24A 2CG9A 5BJRA 4ED4A 4NX9A 3TAMA 1RACB 4PXCA 3DM2A 3FNNA 2W4PA 1VBXA 4MMOA 4F4ZA 3SSQA 4DV7F 2DRBA 3NMAA 1UJ4A 4CWPA 2P5VA 2B9XA 1YBUA 2FC9A 4LSZB 5I3QA 3A4TA 4XD8A 3DCAA 4IOAQ 3DLGA 3GIGA 2CADA 4FN5A 5GMEA 3N5BA 4JI7F 3DRRA 3FSIA 3K59A 4ZPTR 2G1HA 2QEXS 4DL2A 2OLWA 1EAYC 3NWGA 2P8IA 2O1WA 3JYTB 4V19J 4WZQA 5GAGU 1B99A 1AFJA 3L9ZA 2VL1A 3VF0B 1RWXB 4L74A 2WSFC 1YDLA 1BWEA 3QIPB 1KRPA 4DV2J 2R7UA 4K2XA 2RNEA 2KO1A 3Q24A 3OSPA 3AODA 4XCJA 1CS4A 1VISA 5T14A 3NAIA 4IFVA 1Y8PA 4L90A 4RUAA 4Q20A 3GG0A 2J0QD 3IAS9 2NXCA 4UF4A 3R1HA 1FHTA 2NS1B 1VBYA 3RR8A 2CQ2A 4FPPA 2FGCA 2WCXA 3BBBA 3KE6A 3UN3A 1QSSA 5CTYA 3MR5A 1UPMB 1GK8A 1GAOA 4K4WA 2RF2A 1JJHA 4ID5A 1HR0F 2GVZB 1K8AT 2CWXA 1SC1B 1TKXB 1Z5BA 3S8SA 4C8YA 1LW2A 4EYIB 4KSGA 1UEKA 2YQ3A 1SBRA 4OQJA 2BU7A 3KLHB 2C1EB 1VDHA 1T03A 1CULA 5CD4H 5F5RA 1RT1B 1T9VA 5DDPC 3U2DA 2VU5A 4LIRA 3T3FA 3C6TB 1VHFA 4OJHA 4JI0J 1AUDA 3DRSA 4IQXA 2XSFA 4RJVA 1W26A 3M2VB 3G8QA 2LKZA 1R62A 2H4WB 4JBCA 2IFXA 3ZTQA 3AY0A 3FQKA 4QWCA 2HNDA 4ZVTB 3JXOA 3TW0A 3TR5A 5B0CA 1MG7A 2HVEA 2VQFJ 1X5SA 2Z0GA 4ELUA 4O0BA 2PMHA 1IM4A 2Q3PA 2B7CB 1R0AB 1K73T 2Y9HA 4BQGA 2OD4A 2ATCB 2FHJD 1S4FA 3VAKA 4PWDA 2HSEB 4J9OA 3G8TA 3PYEA 5DDRC 4C97A 1JIHA 3A0YA 3ZTSA 1TL7A 1M5KC 2QYCA 4FMTA 4ENOA 3G6XA 1MU2B 1X4HA 5D78A 2J0WA 5I3PA 2QMUB 4RNOA 1UYEA 1R6YA 4O0IA 4DV4F 2OGUA 4IRCA 3H7HB 2EPIA 4U7OA 3MZIA 4NYPA 5E3PA 4JAVA 5LL6d 4U7NA 5F3KA 2MZTA 3PJXA 3BKUA 3BN4A 2FLOA 3LPSA 3DFEA 1JJ4A 3R4PA 4HT7A 1U1MA 1VQ4S 2GAGC 3NGTA 2HK2A 3ICLA 2CA9A 1RTHA 4LPBA 1RB0A 3K98A 2JOQA 3Q8SB 4G6VB 1CJKA 3EVOA 3RB6A 2FJWA 4ZLJA 2A18A 1TFWA 4ERDA 3KK3B 4H85A 1ZW9A 2CQGA 1PGZA 1I6JA 1M0SA 4DZDA 1S6PB 4YR2A 2ZWOA 4DL4A 3GP9A 5I4MA 1HPZA 1BQXA 2K5BA 1MWYA 2VJUA 2VQEF 1PCAA 4B3SJ 1XC9A 4AS9A 1FI4A 3SDEA 1A4HA 3KDNA 3IAM9 3E3XA 4FYDA 1OQ3A 1VQNS 4IQMA 5HAOA 3KOAA 5A8KA 1D9FA 3N01A 1X0FA 5LMUF 4X9LA 1YETA 1BKNA 4USMA 5IM0B 4URNA 3FSYA 2E5HA 1FKOA 2E7XA 3SQGA 3KFWX 2DPJA 1Y4UA 3PCOB 3UDEA 2YNFB 5CHCB 4TXSA 3BZQA 4BC9A 2UVVA 2E9TA 3ENAA 1X7VA 4HACA 1ZXNA 1R3NA 3QGGA 3MMCA 2YWEA 2WW8A 4WF9Q 2QLFB 1M5PC 3K8VA 4JOUA 4BLGA 3CGYA 4O04A 3OUYA 4LVNP 4ZVGA 3JSRA 1ZYQA 3CVKA 4WU2A 2VFUA 2K7JA 3TZ5A 1QTNB 4KTNA 2CCSA 2RJZA 4GRSA 5GAHU 4PPZA 7AT1B 3A13A 2A1BA 1RQ0A 2UVWA 1NPPA 1TAUA 1FNXH 2RQKA 1X9MA 3TA0A 5ETPA 2IBKA 3SCKE 1SUQA 1JLCB 5KFVA 3MPYA 3K60A 4MFBB 4DR2J 4DFMA 2J9DE 5LJ3Y 4MPCA 4F26A 5D7DA 1C0TA 2KVQE 3PR5B 4G1IA 2DRDA 1WNEA 1BGQA 1I58A 3KG4A 3K5NA 2CNKB 1KLNA 1FJGF 3VAHA 2V4RA 4Y34A 4LVOP 5IV4A 2E5LF 1RWMB 1NK6A 3QT5A 4C7QA 3CE8A 3GR0A 4XKKA 5J1EA 2CDRB 3TO8A 1JB0C 4FF3A 2J7WA 2GHWA 4FYYB 4CLSA 1LWCB 2VA2A 4MT1A 3FV5A 2BUNA 2HGMA 3TZWA 1TMMA 5KTQA 3AXMA 2MQQA 2CZ4A 2RS2A 5CYQB 1RTDA 2WSCC 3LMMA 4O3SA 3BDPA 1RT5A 1TKZB 2RVJA 3Q0AA 3RRGA 2X1FA 2YKOA 2OSRA 1LK5A 3OSNA 1KTVA 5FDLB 4B9VA 4RNHA 4AL5A 3CWVA 2R8IA 2F8MA 4O23A 5F8GA 1Y5NB 1DTQA 2E5IA 2YX4A 1THNA 2DGQA 2V68A 3B24A 3SSSA 5KFNA 4ED6A 3DRYA 2QYGA 1B0TA 3DLLQ 3GCXP 4DR3J 1YJVA 1HNZJ 3KYLA 2ZNYA 4P2FA 3QATA 3RW6A 4MK9A 2AJFE 4C9DA 1HMVB 2HFOA 1US7A 4V19X 2QC3A 4ZA1A 3HSDA 1ZWHA 3OTCA 1TK8A 2W24A 4F25A 5KFQA 2FHMA 4K4YA 5L46A 2YJWA 1R0BG 4OV6A 4YMEA 4Q8FA 1IXMA 3L4BC 3CMES 1KOOA 4JP8A 4NXNF 1BQMB 5ETKA 1L3TA 2FWZA 2DT9A 2YVSA 2DISA 4YKZA 2VG5B 4F4KA 3PW7A 1NH7A 2L41A 5GADI 2MDAA 4KH0B 1KKHA 4FYWB 1QAJA 4LWEA 3TUJC 3WQ9A 2LLZA 1KFSA 1RT4A 5K8OA 3W62A 1H0HB 2OSQA 4L91A 4W4MA 4B9NA 5KFTA 3VGVA 2QLXA 2UXCF 4KV8A 2V6AA 4XKOA 3ZZOA 2V4JB 3J80Y 3Q2SC 4M95A 5EWGA 2L3MA 3TZXA 4IOBA 3C14A 5GVQA 4CLLA 1DQ8A 5FJ4A 3B4DA 2FHJA 2F1FA 4X4TA 2DEJA 4OX9J 4ASFA 2XMTA 4ED0A 4ZKAA 2ZOFA 2V8GA 4A8SA 1XNRF 5AXNA 3UD3P 1VK8A 1QSYA 4A46A 4MPEA 2RUGA 1MU5A 3LPEA 2XJGA 1I59A 2DHHA 2B9EA 3G8SA 4ECTA 5CTXA 4AD6A 5F9LA 2N7CA 4CLFA 5IFMA 1X4BA 3TZYA 4XIUA 3HZEA 5F8HA 2VG6A 4DV3J 1YJUA 2HWTA 2XSJB 4K2JA 1FT8A 1OSFA 2HKEA 3ZC4A 3BGOP 4IUFA 1X4FA 3N79A 8ATCB 4K4XA 2QFIA 5KFMA 4IR1A 1DQ9A 1NK5A 5KFGA 4XAKA 3O8WA 2GJFA 4JI5J 3W8PA 1UY6A 3CJ4A 1PJ5A 1U2OA 4DV7J 2GJ2A 4EK2A 1BWVA 3CDBA 2RDJA 2KJWA 2YWWA 4ZOSA 3C16B 3S1TA 3ELHA 3PTWA 2CNOB 4KHRA 4ZLPA 3EX7B 5HO4A 1HFEL 4UOHA 2CNLB 1Q16B 1APSA 1YESA 3LGHA 1AZSA 2WI5A 4KC5A 1S16A 5C2CA 4CO1A 1HBNB 4ZJQA 3V6KA 4ICLA 4IRDA 4LQ3A 2CQBA 2GQQA 1H98A 1MN9A 3D9BA 3D1HA 2NYIA 5HATA 1HKAA 3M7VA 2QZ8A 2UUBF 4KHMA 2Q2EB 4QW9A 2QV6A 2WI7A 2HHQA 4CO0A 4CNYA 5EWEA 1NJWA 4FZVA 3VZIA 1UVKA 3AA8A 3DLEB 1WHYA 3AT1B 1N5YA 2HHSA 4X66J 3VAMA 3L3CA 1RBAA 3TVKA 2FJAB 2BANA 2F40A 3BQ0A 2HHTA 4URLA 2N3LA 2YTCA 3ZZZA 5ETMA 5FNFA 1JLEA 3OT9A 3FCVA 1KHVA 3NGRA 4WKRA 2JC0A 2O5DA 3T1YJ 2A2DA 3T0HA 2JLGA 5T41A 3ZNUA 4RU9A 1HIYA 3LUYA 2G9OA 4I2QA 4M5DB 3CC7S 5HBMA 4Y6IA 2PMZD 1FNMA 2DH7A 4WK1A 2XHXA 3BBFA 2ZKTA 2KL8A 1WKLA 2VD3A 2C2AA 1FVQA 1VR6A 5M4KA 3P5BP 1IJFB 1XMBA 3UNYA 3NCRA 4P2MA 2H54B 1KOHA 4Q7AA 2DXFA 4NZ6A 5KOWA 4KHPF 3H0PA 2HHUA 1B64A 3B78A 1N0UA 2POKA 3ET6B 1N32F 4ZPAA 5A0YB 1TFYA 3GYXB 1R8AA 3MM8B 3PXGa 4QPJA 2ZZTA 2V50A 3NNHA 4GQTA 1GX5A 2XS2A 4I6AA 5BYSA 3AQPA 3IC1A 1QUVA 3CGIA 2AX0A 9RUBA 2EG2A 3LF0A 2MKHA 3EJMA 2IHR1 4IH7A 4HHHA 4KKOB 4WP9A 5KFYA 1YK9A 3WZ0A 4PYAA 4ZCLA 4FNHA 5E5NA 4LP0A 1UVNA 1NJYA 4FCQA 1UFWA 4NLUA 4HH0A 4UOCA 2YNGA 5E2QA 3CXCR 1S7IA 1ZA2B 2IORA 1WTFA 3JQMA 1RE1B 3PX4A 4DV4J 2YQ0A 4ED5A 1RHRB 1DZ5A 4RW8A 4LF8F 1RT7A 1HBOA 3G6VA 4K4UA 2EBEA 2OHDA 4M1KA 1M5HA 3PFOA 2BRCA 1RTJA 1RAIB 4LSNB 1VQSA 4P72A 3K97A 1NB2A 4OYXA 1S7HA 4IDKA 4YB7A 3KDOA 5IZHA 4LREA 4WWSA 4PRVA 1ZM9A 1ZS6A 1NRKA 3HT3A 1C1CA 2P2CB 4F0HA 1YSZA 4I56A 1PSDA 2MSSA 1P1TA 1RBOB 5DM6Q 1S1TB 1M1KT 1EETB 3ZO7A 4ECZA 4R5PA 4PU9A 5H9EJ 3V4IB 2O1VA 2C3MA 2IRYA 3FRZA 5FWKA 4ZK7M 1UP1A 3GWCA 2CJBA 3PG9A 3PM9A 2GFFA 5CYMB 2ESAA 1HLWA 3TZ0A 1L3SA 2MQ8A 4H7QA 1XMQJ 2QA1A 3K17A 3LA0A 1R8HA 5C5JA 4DPUA 4P7TA 2E1CA 1TL1B 5AE3A 2RRBA 4G1QB 2M9KA 1X9SA 4ED3A 2V2KA 2F9JA 2F3JA 4WIIA 3PHEA 4RW9A 2FTRA 4WPAA 4PQUB 5L9NA 2RS8A 2E5GA 2AGPA 2XMUA 1NM2A 4RO0A 1U25A 1ZA1B 3M2RB 4M5LA 1IN0A 2HHXA 5D0RA 3CCRS 4P10A 5HLFA 3HSJA 4QCLA 4NMLA 2XI3A 4CH0S 1TKTB 3FT5A 4YKQA 4LF5F 5KG6A 1KSPA 4NCBA 1YJNS 1YJWS 2AYBA 3Q8PB 2ATLA 1GKZA 3M05A 4P2XA 4R8UA 2W7OA 2R2SA 2V8VA 4MKBA 2O1PA 3EVMA 3I87A 3NY0A 3R97A 4P8OA 2D3OR 4RR5A 3OFHA 1YLXA 1IJEB 1PO6A 1GMUA 3TI0A 1WDDA 3O1LA 4I68A 3TZ2A 4PQAA 4ECYA 1H72C 1Z2ZA 3PO4A 2FJDB 4OZ0A 2YNIB 3GIEA 2MXYA 2JL9A 2AU0A 3B27A 5EN1A 1JLGA 1LV5A 2F8EX 3PY8A 3BGUA 4FPRA 4OL8A 3IM8A 1IKXB 3C15A 1S99A 3CJ2A 3MNRP 3FZ2A 4ED1A 2HHWA 2HCHA 4YY3F 2C3UA 1QZRA 1KHWA 3G87A 1QSLA 1DQAA 2HW3A 3M9OB 1YI2S 3RBEA 2ZHOA 3WHAA 3ETMA 2K8GA 2WEQA 3QIPA 4P73A 4ANEA 4N56A 3NWRA 4CLUA 3QJPA 1IWGA 4C3KA 5CZVA 1HHQA 1VMBA 3J7AN 1M5SA 2F65A 1OO0B 2G2ZA 1P1LA 2QFOA 1FJ7A 4LSLB 3UCGA 2B3TB 2GHPA 6FDRA 3ISND 2XO7A 3EKRA 5CAAA 4HHJA 2CPXA 3GV7B 4CLZA 3G75A 1RAFB 2GNKA 4CLTA 1KLMA 1M5VC 3ZXOA 2ZEJA 1K1QA 2V69A 4QIWD 3A8IA 1FRXA 3HVWA 2AJ1A 1U1NA 3M8SA 4DN0A 2ZH1A 2GVZA 4UROA 1JLBB 5SZTA 4HL9A 2HG1A 1S9EB 3RUBL 4OI2A 2VW5A 3NG8A 4D3HA 3AH6A 2PO4A 1S6OA 3KLHA 4J9SA 4K4TA 1RGVA 1VQ7S 3C46A 4FNIA 1RT1A 3LANA 2L08A 1Q8LA 4DSLA 4DL3A 1JLQB 4MYUA 1JX4A 2C42A 3HSZA 4WJBA 4C0HA 3C6TA 2YKPA 4JI8F 4L3KA 1YT0A 1B3TA 2FWYA 1PG5B 3O6OA 3IO1A 3M2VA 3C3LA 3GSDA 1RT3A 4WK3A 2XS7A 4DV6J 2QF6A 3BBCA 2Z4PA 5A6PA 5DZ6A 1H2VZ 1WC0A 4H4MA 4ES3A 1O8BA 1EX8A 2J6UA 3CDEA 4JI2J 3CD5A 3KLEB 3CCZA 2XNRA 5KT4A 4LF7J 2BE7D 5D4LA 3IEDA 1N36F 1FE4A 1F9FA 4Y2MA 3W65A 4F2RA 4LF4F 4PUOB 4N76A 1UZHA 2LVWA 1TKDA 4O44B 2EFVA 2VC0A 1Q81T 2YI5A 3NGKA 1NK8A 2G0CA 1HYSB 4P74A 1M1HA 2B5JA 1U1QA 2V63A 3DC2A 1MU2A 1X4CA 3V6DA 3T6JA 2ZJPQ 1LWXA 1XNRJ 4FKYA 3DN9A 3NOGA 1S14A 4P52A 4W7TA 1N0VC 5C25B 2GX8A 2HVIA 3D1QA 4CYUA 1L0OA 3FQLA 3AOAA 3M8QB 2DR5A 3W2VB 3I0RB 1E6YA 4RW7A 5AXKA 3VALA 3KHGA 2J8SA 3KLFB 5J1PA 1NPKA 5I3UB 3SI8A 1HWUA 1FERA 3D6FB 4XIRA 4MP7A 1U1PA 3MM5B 2QMXA 2XWYA 4EZ6A 1A0OB 4RBUA 4D3GA 1U47A 2CQ4A 5KG0A 1AT1B 2JHEA 2PA3A 4FKXA 3IS9B 4WFAQ 2ZBCA 3SCIE 3M8ZA 3W3SA 4KGZB 5I42A 2KFNA 2DGSA 4LFAJ 3G7BA 4FVMA 3HZ5A 5E3CA 3RBDA 1N88A 3OVAA 2ZZMA 1JXVA 2PI4A 5LMNF 1HW8A 3OTOF 3T9ZA 1C0UB 1GNKA 2KFYA 1HW9A 2AP6A 1XR6A 4TQSA 3DLKB 3KNAA 4DUYF 5HMYA 4DSKA 1MROB 2KHDA 4DS5A 3GZ7A 2DGTA 4OHWA 3FGVA 3W5YA 4AWPA 2F63A 4ZIVA 1B70B 4AQYF 2AYMA 1KIJA 2DK2A 3CCQS 1UTAA 3ILLA 1VC0A 3T5LA 3KMQA 2RRAA 4TY8B 4W90B 2YWKA 5B09A 1FWKA 3MXHP 5HK4A 1E6VB 2HGNA 5AT1B 3R91A 4CWOA 1S1WB 4CWQA 1GKXA 4P7VA 4GC6A 3IM9A 4KPCA 4GKJF 2FB0A 2M4MA 3BH6B 4CM0A 1NK7A 4ASAA 2GMJA 4BCAA 2DGOA 3K89A 5ETOA 2X1GA 1Y8OA 2B7BB 1QTMA 3MMAA 3Q8QB 3BN7A 4ZLLA 5CTUA 3IRXB 4Q8EA 4NLRA 3HYZA 2LU2A 4DUZF 4M5NA 4DR7F 4XPEA 2XX5A 1JLCA 4NEYA 4DUTA 1EP4A 2MKIA 1TUWA 1H7UA 4TY9A 3QRQA 4DQIA 3CRKA 1MLAA 3AD7C 3ETOA 2FUG9 2XWXA 2YY3A 2MJNA 1TC6A 4DV5F 1U1LA 4PR6A 3MPDA 4JI6J 2V34A 2IM0A 1CG2A 3ENQA 1UYKA 2DD8S 1L5UA 2HBZB 5L1KA 1Q95G 4L75A 3E01B 4UUWA 4FF2A 1U02A 1VQ8S 4CO5A 4X62F 2XZTB 2VG7B 3T1HF 2UUAJ 4LF9F 2Y1LB 3TUHA 3LP2B 3DHXA 1NK4A 3FT8A 2XYPB 4I7FB 3DYAA 1LWCA 2W9AA 3I32A 1NO8A 2GZOA 1FWLA 3MCSA 2W4DA 4MK7A 1SJQA 3QWUA 2LQ9A 1N32J 1FX4A 2M70A 4KP4A 3A0ZA 3QTFA 3IBFB 3ONQA 2VF3A 4OI4A 5KT6A 2V2VA 1Q4RA 3I5AA 2HHIA 2KH9A 4DL0C 2NCKL 1XR7A 2HWIA 1TKZA 3BREA 4FXDA 3O44A 3DDKA 2XS5A 1NSQA 5KFOA 1AH6A 1SQGA 5DRKA 3Q8UA 3TZZA 5FDLA 4K4OA 1URNA 2Z30B 3R5DA 3MEGB 1RCXB 4HI2A 1VI7A 1VS3A 2ASYA 3DOLA 1P8GA 5HVHA 3R3TA 2F8HA 1BXNA 2YEAA 1NUEA 3B8HA 3PKMA 1HI1A 4CTAB 4DS4A 3CMAS 3LGNA 1PAEX 5HMWA 4N47A 2UV8G 5HJYA 3LALA 5IWAF 2U1AA 3M4XA 3ENWA 5FNDA 4O4GA 2LEAA 2BE9B 1TVRA 3KLIA 1KFDA 2DB1A 2BYCA 2Y8YA 4XCLA 2F4VF 4X4UA 3I31A 2FY8A 4KT0C 4ZCKA 3CT9A 4WFYA 3MM7B 1HMVA 1JJCB 4M94A 2ILYA 3OHBA 1KNZA 1T95A 2IAJB 3FMBA 3OFGA 4IFYA 2WI1A 2QMWA 3CEDA 1JJ2R 4B6CA 2GVDB 1SB6A 3GIMA 1BQMA 2E5JA 1L3UA 3QZ8A 2PEHA 3GIRA 2KT3A 4NH8A 3J7YU 5LT5A 4KFGA 1JMTA 2GQ2A 3FRYA 2UU9J 1X0PA 3JSMB 1RA6A 1Z5CA 5KFXA 2R8KA 4R3AA 3V2UC 3BSCA 5BODA 3MR6A 3CJ8A 1RHUB 5AXMA 2H3EB 2D3ZA 2R7TA 4KYZA 2JC1A 1N34F 2HMIB 2LECA 4G1PA 4LUBA 5EX3A 5M2RA 2LA6A 2BW2A 4WCEQ 2VONA 2CQ0A 3RAXA 2YK9A 4DL5A 5KFCA 5M4MA 3BKFA 5BR8F 3OR1B 2XMWA 1Y0HA 4ZVHA 2MZ1A 2O67A 1PJ7A 3NBPB 5HROB 2R7WA 1NHKL 4YR0A 4A4JA 4O3PA 1YZ6A 4B3TJ 4ZHRB 2IWSA 1WI6A 3OHAA 3ZZPA 4N5SA 2OIHA 2V2ZA 1D09B 2LFVA 1UWBA 3IBWA 3M8YA 5CPHA 2VKRA 4IO9Q 4RLEA 2DGVA 4C8MA 2VA3A 3OL6A 2NXJA 2RQMA 4NRUA 3NL0A 2I5JA 1RT2B 1I1GA 3CDAA 2UUCF 1IKYA 1UMJA 4OHYA 2XSJA 3D36A 1PYTA 5KFKA 2M52A 2PE8A 2UXDF 5L39A 1X60A 2D3UA 2Z57B 2RU3A 5H9FJ 1NAQA 4WP3A 1UFLA 4UY85 3R4NA 3W2WB 4XK8C 1Q78A 3OPDA 4B9UA 5D6PA 3CJSA 2KRRA 3CO9A 3C16A 5HQ8A 2G4BA 1SV5A 1YT1A 1P6TA 3BJYA 2R3VA 1KQFB 2EFNA 3CD0A 4FDFA 1FJEB 5LM7E 2OMOA 2YEFA 4L76A 2AEJA 1EB0A 2M8DB 2QL7B 4NWBA 2CJKA 1HBNA 3LP0A 1U0ZA 4PKDB 1U7LA 5DJBA 4A8QA 2QSFA 3CW2C 3AQOA 2W8LA 4YY3J 4OIXA 2W9BA 3D7SB 4F4WA 1LWEB 1UYCA 2YEJA 5BOCA 1GQEA 1AM1A 2E1RA 3DOKB 4OFZA 5ETLA 3NGUA 1QDUB 1UY8A 3C6UB 1UYDA 3NS5A 1RTZA 3CC4S 4NPOA 1CVJA 5T7LB 2J76E 3RG6A 3PEJA 1FWPA 3KJVA 4QU7A 1X9WA 4OYBA 1NMEB 2DHSA 5DQIA 3ZTRA 2RT3A 3VQTA 4CWSA 3G2XA 2YE2A 2OPQB 2Q6CA 3QO9B 2N3OA 2IYIA 4KFBB 4UQTA 3H2VE 2QA4G 1SC6A 1RI7A 1JKHA 4CE2A 3RRHA 5FLXU 3B82A 4O05A 2KKHA 1RAJA 3QPIA 4NCAA 2OELA 5D0GA 2VDHA 4PL9A 2ALYB 2GMLA 2DRAA 3NCPA 2Y1RI 2GIRA 4V26A 1G4CA 3DRPA 4E98A 1YTYA 4OJ3A 3OFEA 2L48A 4RPFA 2KG1A 1ZH5A 4WFZA 2VASA 2MZQA 2RSQA 2VV5A 2JFKA 1RWNB 2RH3A 1X5OA 2W4CA 3P8BB 4RW4B 2R2TA 3HKWA 3Q5JA 3CMQA 4CZCA 1CC8A 2GC8A 4DU7A 2FHOB 1RJJA 2RHQB 4PCQA 3OJUA 4HEA9 3ET6A 4XITA 4ECVA 1XIQA 3W64A 3BEGB 3KK2B 2E44A 1NHUA 1O0PA 4BIUA 2E7WA 2ZFHA 5A0YA 2HLTA 3M8RA 2HBYB 3KTQA 1T9XA 4J91A 3MM8A 4ZMMA 3GV5B 1FDBA 2ASJA 5B0DA 2Z2LA 2CKWA 4BHQA 1UEUA 3JB9k 1F9HA 2XI2A 4F36A 5J2PA 4FF1A 1PKUA 4KAIA 4KGKA 4M5GA 4DX6A 1XN9A 4TVAB 2LU1A 3I5CA 1T05B 6FD1A 4ZKIA 3M6VA 3W66A 2FJBB 3D68A 1H2UX 1C4AA 3EHHA 2HFVA 3ZNJ1 4EGKA 2XJXA 4MOTA 2CFXA 4ILMA 2C3PA 3OLAA 4QZVB 2LXFA 1WELA 3CJKB 2RB7A 3CWJA 1C1BB 4XC0A 3R9LA 4CWNA 3MPUB 3BQ1A 3K0JA 3OXFA 1WF2A 3ZKBA 4DN9A 1UYIA 5L1LA 2P9EA 4AL7A 2O01C 3I55S 4J7CA 3GFZA 2BM1A 2BE2B 2ZITA 2KTQA 2DH9A 2KDOA 3VVUA 3KJQB 4U8YA 4A8FA 3RBZA 2LYVA 4EFTA 1G2EA 2HNYB 4LSNA 2AWZA 3EYZA 1N56A 5KG1A 3O5TB 4NASA 3A0WA 1Y7PA 1FJCA 2NXUA 4H4OB 4ZIWA 1R31A 4P71A 1WOPA 2HWHA 1BYQA 5D3GB 3R7NB 4MKYA 4U96A 5KFUA 4X4OA 3PEHA 5KFSA 4OI3A 3RAQA 3H5YA 4F0KA 1S1TA 1EETA 2MY7A 1TP7A 2XDUA 1RXOB 2XQCA 1HWLA 1U48A 3V4IA 5K5MA 1HBMA 5J2NB 1F6TA 1AROP 2Z2ZA 5GADU 2BQUA 3PFEA 3TEGA 5IN9A 1VBKA 1SJ1A 2ASDA 1HNIB 5C42A 4DFJA 2YPYA 3V81B 4LWGA 1EI1A 2NPIA 5ETQA 5HSPA 3H2UB 4DCPB 4OLPA 1VLYA 4H81A 2IRXA 1NKBA 4IR9A 2O1UA 2IJRA 4DUHA 2J9DA 4YKRA 3M6UA 3IFEA 4X4QA 1JLFB 2OTLS 4EO8A 2EC0A 4IG0B 3IR6B 4PQUA 1EQ0A 4YB5A 2Q8FA 4ECQA 1GMWA 3D1OA 1YITS 3M2RA 3P45B 4QW8A 4C0OC 1SL0A 2YKBA 2YECA 1VCTA 4JAUA 4JASA 2C1IA 4I3HA 3HHNB 1I94F 2Z56B 5KFLA 4GKJJ 3FBBA 1VRTA 2LEPA 4KRWA 1Y5IB 2YH0A 2VZ9A 2YKEA 4IG3B 3MAAA 4Z7CA 4B3MF 2ZH5A 5LXRA 1OWXA 1NHHA 4WYLA 4UY8T 3I96A 4EGHA 1UYLA 1I5BA 1LNQA 3OW6A 2YE5A 4J9MA 2KT5A 2BRLA 2UXBJ 2ZH3A 5B08A 3H4DA 2CQ1A 2GO8A 2YNIA 1BD6A 3FUYA 1XWLA 4C8OA 2R8GA 2IYGA 1S1UB 2YKNB 2ZJRQ 2AX1A 4NLGA 1D0EA 3O2FA 3UN2A 1U4BA 2FHKA 4TU7A 3R5AA 3J7A1 3RZAA 3H25A 1K9MT 1HQUB 4DR4F 2FIUA 3SBMA 1IKXA 1SIZA 3SFGA 1ZM2A 1L3KA 2FJVA 2E0AA 3IN5A 4ZVOB 2C2KB 2GGPB 3JS9A 1XR5A 2HRTA 2J8AA 3K2YA 1U0SA 1B0PA 3MTJA 5BYQA 3HPOA 3MPVA 1NSAA 1V6HA 1XTZA 3THVA 4O0NA 4ED7A 2DCLA 3R5BA 2U2FA 1WDTA 2QX0A 3MWBA 3V6HA 1S1VA 4K5RA 2PMWA 1U1OA 1N6QB 3V5RA 2YE7A 3QJJA 2ZE2B 2Q8HA 2BV3A 4FF4A 2YEEA 4U9RA 3N6MA 1V5IB 2H51B 1X31C 3UVJA 4B3RF 1VC6A 5K14B 3AOCA 2JVRA 1U2CA 4LJMA 4B9TA 2HGLA 3NRBA 1MWZA 4OI0A 3KUGA 1Q79A 4DG1B 5EHHA 4MJKA 1N48A 5IT9U 2BJEA 3EHFA 1Y3JA 2A6MA 4MIAA 2WOMA 1GH8A 4BBYA 5JUMA 1R8BA 1KC8T 2G13A 2IJFA 1F51A 4CT9A 4NEZA 3HI9A 2FLNA 5A2QU 3PRDA 3MR2A 3DKDA 4CI0B 4YHHJ 2KM8C 5CCMA 1YZ7A 2XLIA 3QSYB 2KFZA 3FMWA 1LXNA 1EKRA 3TVYA 2MY8A 1BUXA 3CO0P 5KG3A 2C2ZB 2IDEA 3W5ZA 1U6BA 3FSXA 1LWFA 1W25A 3CCUS 1WG1A 3FZBA 5D4OA 2I0XA 3DXSX 1TR0A 1UY7A 4X65F 3D0HE 2K7KA 2ZBIA 4HDHA 2LXUA 2JEJA 3BPSP 3FK4A 4OJ1A 2NXNA 1A9NB 2YE9A 2YWFA 1NJIT 4P9SA 1OMSA 3GIGB 1RWUA 2JJCA 1JLAA 2JFDA 3OV7A 4GCZA 3EPGA 2AF6A 2PFFB 2NQPA 1REGX 4QWDA 2MZRA 4LFCF 3EXCX 2CPIA 1HYSA 3B6BA 3KMSA 5J6AA 1JK9B 3CIMA 3HULA 2QTWA 5BR8J 3HHLA 2RQ4A 2BJ9A 2XM3A 1FXLA 5KAKA 4DV0J 4K0KF 1JM6A 4LRAA 5KFPA 1DFDA 1V3SA 1FDAA 2DITA 3OLBA 4I69A 4OLOA 3Q5KA 3LP1A 4LBPA 5C25A 3DGVA 1PAUB 2YKMB 2WVBA 1EKSA 3TX0A 1UEVA 1SL2A 2AD9A 3M8QA 3W2VA 3I0SB 3MECB 2HRUA 4OYWA 3I0RA 4Z7YA 4IFVB 2CJAA 5B0GA 3UQSA 3MM9A 3GJTB 2C28A 5IQQA 4Z2XA 5AJ3F 1KVKA 4C8LA 1RWOB 3BM9A 5I3UA 3K7RA 3NGDA 2CCUA 2LEBA 2UUCJ 3MGJA 2GW8A 1QD1A 4QIVA 3MDFA 5F8NA 3PJWA 4ELVA 4OYIA 4U7UD 2UXDJ 3M1VA 4EWTA 5ADZA 3FBCA 3IS9A 2H1YA 4DR5F 4KO0B 3F41A 2XGQA 3UD4P 1WHWA 4XDCA 2AYEA 1U0HA 1WC6A 4KPYA 2C3YA 1N5VA 2RF2B 4ID5B 5H9EK 3AXKA 4DSIA 1U09A 1Y5LB 3LWLA 2PC6A 1EQMA 1CJTA 2E1AA 3M2UA 4JV5F 4WXOA 1HNXF 2YBVA 1T03B 1CULB 3IWLA 3BO4A 1IR0A 1P9QC 2DNRA 3T41A 1HBUA 3DRSB 3JTNA 3CCSS 4LF6F 3HK2A 3GSIA 4GFNA 4XDMA 3OVBA 4L8ZA 4EBCA 4U93A 1DLOB 4GVLA 4I6WA 5SUHA 3TQ1A 2OEKA 4MP2A 2YEIA 3KJNB 2VBYA 2DO4A 2DR9A 4PG6A 1JXLA 2XULA 5KOXA 1S1WA 2WVEA 2ZOGA 4DOZA 1NH8A 1KR4A 3TA1A 5CTWA 2ABYA 1XMOF 2DNQA 2WEPA 2W25A 2J0SD 5IT0A 5C93A 2JX2A 1A7GE 1TL7B 3GIJA 4FBUA 2X51A 2YI6A 4HXWA 3L7PA 4IRKA 2VPYB 4USIA 2DNYA 2PEBA 3Q5LA 4HLBA 3TOQA 3M32B 3OWDA 3W63A 3GIKA 5E7OB 4O3RA 3UD5A 4HYPA 3OL9A 3PYDA 5IC4B 4JV1A 3E01A 1J5OB 4OX7A 5D6GA 3IP0A 4R1FA 4TN2A 3QT7A 2VG7A 2BZ5A 1ZOTA 4TLRA 4QPKA 2DNZA 3CDWA 1VQOS 3GCWP 4L73A 2YWGA 1FTCA 1BC6A 2FZGB 4DR6J 3BGFA 1WTBA 3DGPA 1Z4UA 3CCWA 2XYGB 1S12A 1UZDA 2JEIA 1HPZB 1W2IA 1SKRA 2K3KA 3CUNA 4BAEA 1RDRA 4K8RA 3GIIA 2BABA 1RAOA 3QJLA 2D3O1 3D2RA 4J9PA 3AFGA 1SKUB 1YBAA 2C2MB 2HPUA 5A8KB 4DV1F 1F60B 1UL3A 4UOGA 3R7SB 4DFKA 4YN3B 1KEKA 3OW2R 3MEGA 1FKOB 2HZAA 3EMTA 3SQGB 2A2CA 2FVCA 4C6AA 3EGVA 2KZMA 3ZXQA 2ZKUA 2IA6A 1C4CA 3PIPQ 2HQFA 4DI6A 2R7SA 4CTAA 1U2RA 4USHA 2AKWB 2QFJA 2YKJA 4HACB 1K1SA 3CJTA 4JI3J 2ZM6F 1IR2A 2MQPA 3ILJA 4I4BA 3OUYB 1EHWA 1KQGB 5G0RA 2DR7A 2QA2A 4C2MA 3ZZUA 4HT5A 5FD1A 4BC7A 1N54B 5ITHA 1UVLA 3INXA 2ZC3A 1YJ9S 3H80A 1VC5A 4DBQA 2VPXB 1SUQB 4PG7A 1ZM3A 2D74B 2JZ5A 1VQ6S 3M8WA 3VVTA 1I5CA 2YK2A 4EZ9A 1C0TB 2WAQD 3CCJS 3R4MA 1ICEB 1N5TA 2VDIA 2AZ1A 4OYPA 1FESA 3VWSA 1TAQA 2ZH8A 2XYHB 2DHGA 4YDDB 2W2PP 3A3PB 2XY5A 2HMIA 2YNHA 5CD4A 2MZSA 2ADBA 2JSXA 2EI5A 3H4BA 4JYAF 4M5KA 1B62A 1NDPA 3CYGA 2ILZA 4KIAA 1UYFA 2R4FA 3BV8A 4XTJA 2KN4A 3OQ2A 2VBZA 1FE0A 3H5SA 3QGHA 1TV6B 3W8GA 2GQPA 1RTDB 3CCMS 3ZKDA 2LA4A 3VHDA 1WF1A 1H7WA 1RT5B 4DJBA 2YGEA 3Q8RB 4EBEA 4ZJLA 1T9YA 2EBGA 4Q45A 5DLGA 4M5JA 4Z37A 2ZUGA 4NLWA 4AWOA 3NOCA 3FC9A 2CQCA 3U02A 5IV3A 1WG4A 1GXUA 3KXDA 4EBDA 1RT2A 5J71A 3VHAA 3PX0A 1Z59A 4PZVA 2K3IA 3JSBA 4AXJA 5M2PA 1Q8IA 2WONA 1DTQB 4LRFA 2MLXA 4YDXA 1QAXA 1IWAA 5B0EA 5MAOA 4DHVA 3A0XA 3QAUA 1S5ZA 2CPEA 4YEAA 3C11A 4CIOA 4JI4J 4O07A 2V9WA 2XDXA 1Y10A 3GONA 2MQNA 5DDOC 1Z2LA 5FIIA 3EE3A 2Q1LA 3A8JA 4C3LA 3DDNA 2E66A 2FJEB 3GJSB 3LAKA 4X4PA 4MB9A 4QWBA 2FY1A 4DR4J 2QG9B 5ETNA 3SFUA 4F7VA 4DX5A 2GO9A 2Q8IA 2F7VA 4DWIA 3D5MA 1N33F 3VV2B 1R6VA 3N6LA 5D4NA 2RDDA 1LWEA 3QZ7A 2QSWA 2XJJA 3WBZA 2J7KA 3KJFB 4JUZA 2PNRA 2VQFF 1R8CA 1YSRA 2ZOMA 3VGSA 3T10A 1SH2A 3U2KA 4A47A 2ROEA 4ER8A 2IBOA 3FCWA 4KV8B 4IO1A 2B9YA 1RSCA 3C14B 3C8YA 1KQKA 2ASLA 1IM6A 2OPQA 2XNQA 2QLWA 3QRPA 5KT2A 2J9EA 5F3ZA 4OZLA 2Q79A 1FRHA 1O6XA 3BO3A 1RU2A 1RT6A 1BHNA 3HJFA 4X2BA 2FJXA 1Y3KA 5E3RA 1NLKL 3BH7B 3JTPA 2QJ3A 2EXUA 2YJXA 2XEXA 2HQCA 4OZJA 2OPSB 2VB6A 2KG0A 4J9RA 4DZYA 2AJ0A 4XDDA 2FYPA 1URRA 4RW4A 3BKTA 1OIAA 2VG6B 3OL8A 1IVZA 3ZM7A 1S79A 1GTEA 2HYIB 2QRRA 5DM7Q 2ZD1B 3IWXA 2HEKA 1TELA 1BMQB 2NREA 5F8JA 3KK2A 4DXLA 4X65J 4B3SF 1DARA 2HLUA 4U95A 2Y8WA 1SL1A 3M8PB 3DOMB 4EI2A 3NEKA 3EZUA 2HG4A 1J5EJ 3GPAA 4FCRA 1RKIA 2YEGA 1S6QA 1IBMJ 3DNCA 2OUGA 3HMJG 1HQEA 3MEDB 2H8MA 1AZSB 1T05A 4NLYA 3AB2B 1B7YB 2YH1A 2YWHA 5HVFA 3KK1A 1FVSA 1Z1ZA 2NUUG 3G4SS 4ICLB 4LFCJ 3D0IE 2CYYA 1YWXA 2KHCA 4U67Q 1EJ7L 4I67A 2FXSA 4Y00A 3CJKA 2FTKA 1C1BA 1SVDA 3VTIA 4FBTA 5HMXA 3KUHA 1GT8A 5J2QB 1YJTA 1NSPA 2OFGX 2WBMA 1G1XA 2DIUA 1ITPA 4MAKA 1YRTA 4RKUC 5DS7A 2MKJA 2AZ3A 1N5YB 4OI6A 4HR2A 1NBEB 3UDVA 1F2GA 2B6AA 4RW6A 2RKIB 3KG0A 4PRFA 4MTPA 3O2IA 1EZZB 4X64J 4H4OA 4JI1J 2VICA 4CE1A 4CH1A 1S0OA 2XDSA 1JLEB 5AJ3J 2YKIA 3CCES 5GGZA 2ZHBA 1S59A 2WVDA 4CO2A 2EG1A 1OPZA 2CG8A 4TU8A 3RLRA 4DR2F 3NP5A 4NI2B 4WE1A 3ITHA 2ZBPA 4K5SA 3HVTA 2BOPA 2CWKA 5J2NA 2ERRA 1TK0A 4ZLNA 1I3OB 2PT0A 3B54A 4Y2CA 4I2QB 1Y11A 2UZAA 5HBMB 1VQ9S 2GV1A 3ADAC 2XDKA 2ZH7A 4URSA 3PW2A 3GILA 3QAEA 4F2SA 1HARA 4O3QA 4JV5J 1RAEB 4S0MA 3ZZRA 3KLGB 4JI7J 2FPHX 1ZZFA 3G7EA 2I8EA 3MCNA 4Q43A 4MPNA 2H5EA 5EX0A 2BR0A 4C3MA 2BKPA 1UJ5A 1RTIA 3FVYA 2BU6A 3Q22A 3GFYA 3HKZD 2VCIA 2B43A 2OPRB 2HBQB 5LJ5Y 4X4RA 5J2MA 3HHLC 2ZC4A 2CAJA 2BM0A 3ZZ0A 3MF5A 1WEZA 5JJBA 4C11A 4EFAC 4NYZA 5HL7Q 3MMJA 4HYKA 3LH2S 2X7IA 1NHJA 2XMKA 3VGTA 1XMOJ 1YQHA 4BWMA 3SQOP 4IG3A 4YS2A 2DIVA 3T5HA 5CZXA 4KJIA 4PEOA 3UCZP 1RZMA 2YNGB 2CPFA 2IM2A 1IXKA 5DLFA 3H8YA 4NOHA 5D0EA 3U7JA 4WBFA 4ZPVR 1YJRA 1NXIA 2ZUAA 5IXUA 3DU5A 4PRXA 1IUJA 4RW8B 1RT7B 2BRKA 5H9FK 1HBOB 1AUSL 5CQGA 2M3DA 3RTVA 3IR5B 2YE4A 3D3BJ 3QDDA 1S57A 1HR0J 2XG8A 4NCGA 2DGXA 1SJRA 2DH8A 3G82B 4OZ5A 5KFEA 1RHQB 3TZ4A 2BJ7A 1HQUA 2DNPA 4ECRA 3T5KA 3H98A 1OQ6A 3RYLA 3K57A 1XNQF 2V67A 4XE2A 1HWKA 1V5VA 1N4LA 2J6SA 3HD1A 3POTA 1MW7A 2CNNB 1QE1A 1MN7A 2GGPA 2YI7A 4URMA 1IKVA 1CJVB 3H42A 4EMDA 2P9GA 2DNHA 4U7CA 4HY6A 2K1RB 3L7OA 4WU3A 2V8DA 2FQQB 4UZCA 3PW4A 5A8RA 1NCLA 4GO7X 1AXQA 4P2SA 2G2YA 4PXEA 2HVZA 4NH9A 3RJMB 4OV1A 1VOMA 5ETVA 4CCHA 2RHSB 2HQGA 3UE2A 3DI6A 1FDDA 4RW9B 4OX9F 3HX9A 3VHQA 1P27B 1T02A 1UY9A 4F67A 1R89A 4WP8A 4F8RA 3C0EA 2NUHA 2AMCB 2IC3A 3FEXB 5L9XA 3N0VA 3GE9A 3PX6A 2BW7A 3MUMP 3R7BB 4ZP8A 2VPZB 2AGOA 1BXDA 5CABA 3NS6A 3WX8A 3SV4A 5L1IA 2BU8A 2E9RX 5KFRA 1TL4A 3UDLA 2XY7A 3PZPA 1PYOB 5GMKa 5D7RA 1NDCA 4MK8A 2VFRA 3PW0A 3T1AA 1W2BR 5IDJA 5HJXA 3RRKA 4USTA 2FDNA 1HNVB 4FPIA 2WW4A 4ES1A 1AYEA 3FEZA 3EICA 2CH4A 1H6KX 4K50A 2BKNA 1BQNB 2O3DA 2Q8GA 2JDJA 5IDMA 2G1DA 4EGLA 1WI8A 4JI5F 2KZZA 4KGXB 2APOA 2VQEJ 2IRUA 1T3NA 3TAQA 1IBCB 4E8UA 4TU9A 1JLGB 2MEWA 3M6XA 1I5DA 4DMZA 3DMJA 5L38A 3OWBA 4LFBF 2OEJA 1WHVA 1ULRA 5LMUJ 2LQ8A 3RW7A 2W2OP 1VRUA 2WI3A 2DNNA 4O4RA 2P9CA 1S1XB 1WWHA 3W5XA 3C15B 3TVZA 3PO5A 3MEEA 4M5IA 3CB4A 4A48A 2FVPA 2I2YA 4JYAJ 2V0NA 2A10A 1Q82T 4WIQA 1Y8NA 1HA1A 2XO6A 3INWA 1T9UA 3DGEA 2C2OB 2DXEA 1FRJA 4URQU 1S9GB 1FKPA 1R0CB 2PSZA 2W01A 4LIWA 4P6QA 2YKMA 3UPFA 2XX2A 3FDSA 4X66F 2OMLA 3I0SA 1KD1T 3MECA 5DQHA 2F5GA 2RAQA 2E7VA 2MKKA 4DCJB 2AV5A 2NR0A 2AIRB 4F3QA 2OPPB 3PV8A 4DPWA 3LW5C 2B0GA 1FK9A 4GO5X 3D67A 3PYFA 2M5YA 1RK8A 3MCMA 1KLMB 2QL9B 5KG2A 1UVIA 2CVIA 4KO0A 2ZHAA 3T1YF 4P75A 5KFZA 1T7PA 4HTIA 2AGQA 4G3IA 5L8RC 4LR7A 1RWWB 3TAPA 1N52B 3R92A 3SEOA 4AFFA 3BO2A 1YC1A 2NYHA 1FJGJ 3LAMA 3EXYA 4DQSA 4DSFA 4NLOA 3DLBA 2E5LJ 4ECSA 3VAFA 3GB0A 4J9NA 2CQIA 1UA0A 2NXEA 4NLTA 3IA0A 5D7CA 2D69A 1Q5YA 1WJ9A 2W9CB 4NLXA 3J80U 3J7YI 3JYTA 4F4YA 1N33J 3R1LA 3DDIA 3QMQA 1RT3B 1DLOA 4NA1A 3RB3A 3OMUA 3OTDA 4OHVA 1Y9OA 1IKWB 2OH2A 1H73A 4H4MB 2DO0A 2GIQA 1U24A 2YKQA 2DGWA 2CJYB 4NLVA 1R43A 5B7WA 4PABA 4YFUA 1RBLA 4L3NA 2JEGA 3X3UA 4HZ0A 1W7WA 3QRRA 1TBWA 3JAMY 1WUUA 5KT3A 4J9VA 1WEYA 5ETSA 2FD2A 2NSCA 1F0XA 1MMLA 2B5JB 3PJ9A 3G71S 4DZ6A 4O3OA 2LDYA 2B8PA 4DPTA 2Q43A 3V6DB 2JLEA 2M7SA 4C98A 1Q7YT 2IOQA 3TJ8A 3VADA 4F02A 1NNDA 3A1YG 3M32A 4FXVA 3Q83A 1UVMA 2WI4A 3KHRA 4FYVB 1SKWA 2OEMA 2M0GB 4CYUB 5THWA 1TKXA 1J5OA 7FD1A 3T9NA 3UN5A 4CDIA 4ED8A 3CDUA 5DETA 1E6YB 4RW7B 2HHHF 2N7YA 3KNGA 4WFNQ 4HYMA 1CBKA 3ISZA 4GVBB 4NXMF 1UPPA 3W61A 4NXNJ 2EW9A 1O51A 3ZXWA 4CWTA 3OPKA 3ZFVA 1TH8A 2ZVIA 1PBAA 1RA7A 3QGPA 2V8HA 5I42B 1DAXA 1SJ3P 5DGBA 2NZCA 2XLJA 3J7Z5 1HD1A 2KXFA 1RWVB 4EEYA 2IA0A 3CIZA 2EFPA 3RKZA 3N28A 4QWEA 1NK9A 2Y0BB 2IJNA 1RLCL 1R0AA 5KT7A 4LQ9A 1XMQF 3KUEA 5F8LA 3MFIA 1S0MA 3AOBA 4CO4A 2UXCJ 3CCTA 3P3DA 2XTJP 3M30B 1LK7A 1PVGA 3LWMA 3V4MA 2BX6A 2ZH9A 5LXYA 4A8KA 3TWZA 2QA4S 3E2EA 2PFDA 3B25A 2QG2A 2FLPA 3FBFA 4EGIA 2FVSA 1QY8A 2JH3A 2YPZA 3I4PA 2HVHA 5HMZA 3JZ3A 4K4VA 5HANA 4LBIA 4WZMA 3U1NA 3FKBA 1Q0NA 1RAGB 3RAMA 2MKCA 5DQGA 3K5PA 4A8WA 2ROGA 3MMAB 3HCXA 5L3JA 1FXDA 3M9MB 2BT0A 4ZP6A 3I56S 1NK0A 4GKKF 2GCFA 3D28A 4WTYA 3UR0A 1ACMB 4J90A 1XK8A 3KK3A 3IGVA 2ZBKB 3MFHA 3PIOQ 2XGPA 2CPHA 1C2PA 4ZCIA 3NNCA 1S6PA 1EP4B 3BR8A 1Y00A 1KQSR 2X1BA 3H40A 4PG8A 4L93A 4RL1A 4USKA 3IG1B 4F4XA 1EARA 1NEEA 2RILA 4OZ2A 1Q7LB 1UW4A 2DVIA 2KM8B 1U2FA 2DCUB 5E33A 2KRBA 2CDQA 2DR8A 3C19A 4DQRA 2MHNA 4Y0FA 1SXLA 5IM0A 4OHZA 1FO1A 1YJ7A 5AE1A 4R25A 4KQZA 2CVEA 3DYAB 1VIXA 5B0AA 2R2UA 1K0VA 2H4YB 3HHKA 1JXEA 2YNFA 5IS2A 1OY6A 3CD7A 4TLQA 2Z2YB 2YX7A 3R2DJ 4K59A 3NAHA 2YE6A 4B08A 3CNQP 3M6WA 4NYOA 1AB8A 2XB2D 2UUBJ 3MOJB 2ZH2A 1TV6A 3H59A 4HH1A 1QAIA 1I5OB 4N41A 4CP5A 4I64A 4V1Ak 1UFKA 4KTQA 4XKAA 4CLPA 3QQCD 2F4FA 3GQCA 3F73A 2VODA 1DTTB 4I2PB 3WC2A 2RD5C 2MQLA 4RX6A 3ZZTA 4HZ5A 2RE1A 3DOLB 1I5AA 2YI0A 3TUPA 3UO0A 1P9YA 1UW9A 2RU9A 4MFBA 1G7CB 2GMHA 1OY9A 4Y3CA 2AQ4A 4O4GB 1TVRB 3KLIB 4C8KA 2UP1A 3SL2A 4QWAA 3CCVS 3FBEA 5KFWA 2BACA 2N82B 3HHEA 2LQBA 2MSTA 4IFYB 5K8PA 4YOEA 2Z58B 2HIQA 4DQQA 2IMOA 3BR9A 1CPZA 3K5LA 4BS2A 4NLDA 1CLFA 1XNQJ 1UVJA 4KHPJ 5MLCV 1H3DA 1EA6A 2LQJA 2JWNA 4XIQA 3GFXA 4KB7A 1HL6A 4NA3A 4URGA 4DV6F 1WF0A 1LEOA 3QT8A 1FEHA 4R0EA 1SJ4P 5E41A 2A3JA 5CYQA 1BGXT 4OI1A 2J0XA 1NHIA 1FKAF 3AD9C 4JI2F 3TJ9A 2QO3A 4LF7F 3PDNA 1ZPVA 1FRKA 4C4WA 3D2WA 4ILLA 2R7VA 2M2BA 1BE4A 1JNRB 2MYFA 5F3TA 1IBLF 1XJWB 3LOUA 3QSIA 4IKAA 3VCDA 2VBXA 3AD8C 4P7AA 5GAEI 2DJWA 3U67A 3P4UB 2D7SA 3OR2B 3D0GE 2ACMA 2OJ3A 1KBRA 1REVB 3QLHB 4ILRA 4K7QA 2HNZB 5C2GA 1AFIA 1DHMA 2LMIA 2EEYA 2MQMA 2CJ9A 1SQFA 2BSMA 4LF8J 2HFSA 2AHOB 1OSDA 4ZJOA 4WFXA 4J9UE 1UWBB 4B3OB 2OI2A 3BYRA 2OPSA 5U47A 3UI3A 4JQLA 4BDPA 1OYEA 1N5QA 3BF4A 1VLOA 4LRDA 4RBVA 4ZCMA 4FVCA 2E29A 4CQ1A 2I5JB 4KQVA 2H55A 4BWJA 2A6OA 2VBWA 1IKYB 4QJVA 2ZD1A 3T19A 2DR6A 2HURA 4TKTA 2VG5A 4YKYA 4UOFA 2H65B 2FGOA 4ZPDA 1UKUA 5KFHA 3J7ZT 1GTHA 2BJDA 1FD2A 3AAWB 4LFAF 2Y1IA 3M8PA 5DG7A 3MI7X 3DOMA 1U6ZA 1UAWA 1SV5B 2R8JA 1YRUA 2HK3A 2HIYA 4LFBJ 2HRYA 4QR0A 3MEDA 1LFPA 4OHXA 3QT6A 1R7IA 1LW0B 2LP4A 2ZNZA 2V4JA 2EXLA 1Y4ZB 2JEFA 4DR1F 1RHMB 3LP0B 3EHJA 1K44A 2OP5A 5EUHA 3JAMU 4KGVB 2KXHA 5HQMA 2E1MC 2W9BB 2IWUA 1T94A 3US5A 4C0BA 5J2QA 1LFWA 4OX6A 4ZVEA 4C8ZA 4A8YA 3E51A 3OXGA 3KJVB 4NLQA 2V9KA 2IPOB 4Q0BB 2RKIA 2I9SA 2XZWA 3SCLE 4HKQA 4LF5J 1KZNA 5KT5A 1RKJA 1U1RA 3P96A 3Q89A 1F5AA 4FXWA 2D1CA 3FEYB 4EO6A 4OYMA 3UWTA 1AA1B 4AWQA 2GS8A 3S01A 3TX8A 1GFWB 4DFPA 1GJVA 1F3FA 1VQLS 1YERA 3Q86A 1YHQS 4NI2A 2FC8A 1F1BB 2YEBA 3MMBB 1MMDA 5KG5A 3ULHA 1JKHB 4A8OA 2H5IB 3WIUA 4QR1A 3VQSA 2DNOA 2WVCA 4H4KA 4PAAA 1S76D 4JI6F 3IWNC 1VQMS 1BY9A 3DRPB 1K0TA 2L9WA 1LKZA 4ZPCA 4ZN3A 2UUAF 3G86A 3KLGA 3NS7B 4UZBA 2W1BA 3G9CA 2BA9A 4ITSA 1CEZA 5HP1B 3QYYA 5EDWA 5CH7B 3TYTA 2WB1D 2JLFA 2MQOA 3BSNA 3CGZA 4AE5A 2Q6BA 3VZHA 1VFJA 2W7PA 1JWWA 1J2VA 2OPRA 1KWMA 3HM9A 2DNGA 1QVGR 2DBBA 4EFUA 2BJ3A 2CQHA 4RNFA 1GX6A 2BQ3A 2BMBA 5J2PB 2V5HG 2C1GA 3JSYA 3DLEA 2QT7A 2M8HA 1WC5A 2EK1A 4USWA 3MUVP 3RLQA 2F9DA 2UVUA 1RAAB 4XTTA 3QNWB 3PHTA 1D9AA 2WVFA 3D3CJ 3TEHB 2CG4A 1VRQC 4W92B 3NNAA 2C2RA 5KFIA 4PG4A 3LQVA 3KG1A 3N4WA 3FFIB 2XMJA 1LQ9A 3F56A 4OJGA 1RADB 2OFHX 2AW0A 2OKQA 3EUNA 5D4PA 4M5DA 1WKKA 2VCJA 4BQJA 2G0IA 2DNKA 4B17A 3TARA 2OD6A 3SYZA 4HY1A 2VHGA 1ZAWA 3RBXA 3G6ES 4ZPBA 1IBKF 3HDSA 3G82A 2HHHJ 4CLWA 3MCOA 2N4DA 1UETA 4HTJA 3OXLA 4DSEA 3R5CA 4NH7A 1WC4A 1ID0A 5AE2A 4NXMJ 4CNZA 3ZTOA 4JI8J 2RQCA 2EC2A 1X5PA 1TL5A 1M1GA 3EGWB 3I9ZA 1NPRA 2XABA 2EFGA 1HBMB 4L6V3 2UU9F 1NHVA 4DU8A 1CJVA 2YKAA 1S97A 2BVZA 1G6BA 4DPYA 5C42B 2DNLA 1T9TA 2K1RA 1K47A 1VQPS 2K2PA 3OTBA 4X84A 3MTKA 5E3AA 2BU2A 1U8SA 2JJ4D 1N36J 2R7QA 2NZ4A 4LF4J 5B0FA 2JVOA 4KKOA 4YB6A 3V6JA 3HSGA 4LT6A 1WSVA 4EM7A 4OX8A 4N7TA 5GAGI 2W2QP 1S77D 4LWHA 3MAHA 3GYNA
chains in the Genus database with same CATH topology
1TL3B 3NWGA 4CO5A 4X62F 2VG7B 4KBIA 3T1HF 2UV8A 1D8YA 4IYQA 2YJXA 2O1WA 4LF9F 3TUHA 3LP2B 2MB0B 2HKJA 2XEXA 3JYTB 4B3TF 4OZJA 4V19J 1UJ6A 4WZQA 5GAGU 3DHXA 1NK4A 3FT8A 2OPSB 2VB6A 1AFJA 3CC2S 2KG0A 4I7FB 3DYAA 2VL1A 3IR7B 2R7OA 4QOTA 1LWCA 3VF0B 2W9AA 3I32A 4J9RA 1YIJS 4DZYA 2AJ0A 4XDDA 2WBRA 1NO8A 2FYPA 1URRA 4RW4A 2WSFC 3MCSA 1D9DA 1JNZB 2W4DA 4MK7A 1OIAA 5LSOA 2VG6B 5F8MA 3OFFA 1SJQA 1VK3A 3QWUA 1BWEA 2YE8A 1VRTB 3OL8A 2LQ9A 3FCHA 3QIPB 5K8NA 3O0IA 3ZM7A 4QQBA 2M70A 1S79A 4KP4A 3A0ZA 1GTEA 1SJFA 3D54A 2QRRA 2HYIB 1KONA 3QTFA 4CE3A 5DM7Q 1KRPA 3WDOA 3NLCA 2ZD1B 2R7UA 4K2XA 3ONQA 1SIWB 2RNEA 2KO1A 3IWXA 3B26A 4KGMA 4RU2A 1YS3A 4OI4A 5KT6A 2NREA 2Q66A 5F8JA 1Q4RA 3I5AA 3Q24A 3OSPA 2KH9A 4XCJA 4DL0C 3KK2A 1FDNA 1XR7A 2HWIA 1TKZA 5T14A 3NAIA 1AH8A 3BREA 4IFVA 1Y8PA 4L90A 4FXDA 3HF5A 4RUAA 3O44A 3DDKA 2XS5A 1HNVA 2DPIA 4B3SF 1DARA 2HLUA 4Q20A 2ZZNA 2IM3A 3GG0A 1SL1A 5KFOA 1ZTTA 2J0QD 4PPDA 2CPZA 1AH6A 3IAS9 3M8PB 5DRKA 1HWJA 5FDLA 4K4OA 1BQNA 1WACA 3R1HA 1URNA 3EZUA 1FHTA 2D9OA 2HG4A 3R5DA 3MEGB 2HHPA 2NLWA 4HI2A 2VUGA 2NS1B 4FCPA 4FCRA 2CPDA 1VI7A 1RKIA 2YEGA 1VBYA 1S6QA 4MIWA 3RR8A 3DNCA 1VS3A 2CQ2A 4OZNA 2C2EA 3HMJG 1HQEA 2ASYA 3MEDB 3DOLA 1P8GA 3R3TA 2F8HA 4FPPA 2H8MA 2FGCA 3F44A 2YEAA 2WCXA 3B8HA 1T05A 4NLYA 5CYMA 1HI1A 3PKMA 3AB2B 3KE6A 4CTAB 4DS4A 3CMAS 2YH1A 2YWHA 3LGNA 1QSSA 3MR5A 5CTYA 5KFDA 4ED2A 5HMWA 3KK1A 4N47A 1FVSA 1Z1ZA 2NUUG 4Y2IA 1GAOA 2UV8G 4K4WA 2RF2A 1JJHA 3LALA 3B4MA 3G4SS 4ID5A 2U1AA 3M4XA 5IWAF 3ENWA 1HR0F 4ICLB 1K8AT 3P49B 3D0IE 2CYYA 1YWXA 5FNDA 2KHCA 4O4GA 4U67Q 2LEAA 1TKXB 1Z5BA 3L09A 1TVRA 3KLIA 1TL1A 1KFDA 2DB1A 4I67A 2BYCA 3S8SA 4C8YA 1LW2A 4LMZA 2FXSA 4G1QA 4EYIB 4Y00A 3CJKA 4KSGA 1S1XA 1C1BA 2YQ3A 1SBRA 4OQJA 2BU7A 4XCLA 2F4VF 3KLHB 2BBEA 3VTIA 4X4UA 4YQWA 3I31A 2HW3A 1T03A 4KT0C 4FBTA 4JV2A 4ZCKA 5HMXA 3CT9A 4WFYA 3MM7B 2VH7A 5CD4H 1HMVA 4M94A 1B63A 2XHTA 1GT8A 5F5RA 2ILYA 1RT1B 5J2QB 1YJTA 5J1NA 1QJHA 3OHBA 2OFGX 2WBMA 1G1XA 1KNZA 5DDPC 3U2DA 1T95A 2IAJB 3FMBA 2DIUA 5KFFA 4FS2A <