3PEJA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of macbecin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
258
structure length
258
Chain Sequence
ESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of Macbecin
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Chaperone
molecule keywords Endoplasmin homolog
total genus 75
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pejA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pejA01
2WI4A 3A0TA 4BAEA 4MOTA 5J71A 1US7A 2WI7A 4NH8A 5CPHA 1Y8OA 3RKZA 2XJXA 2YE3A 3MNRP 3ZKDA 2AKPA 5F3KA 2Q8IA 1NHHA 2ZDXA 4XIQA 2BT0A 2BU6A 3PEJA 3INWA 2YEFA 2Q8HA 1YC1A 2BZ5A 2WI1A 3CRKA 3OMUA 4BXIA 2XX5A 4YKXA 2BU8A 4CWQA 4WUCA 4R3AA 4U7OA 4WUDA 4PU9A 1ZXMA 4E00A 4EFTA 3O0IA 1ZXNA 4PL9A 2YI0A 1Y8NA 2YKIA 1KIJA 4O09A 4EEHA 2WI3A 4ASBA 4DUHA 1TH8A 3BMYA 2YGAA 2YEGA 4XCLA 1I59A 3U2KA 2YKJA 4B6CA 2IORA 1UYMA 3U67A 2BU2A 2XABA 1B63A 4XKKA 4E01A 3T0ZA 4EGHA 2ESAA 4I5SA 3TZ2A 4BIUA 2YKEA 2JJCA 2FYPA 2CH4A 4ASFA 3B25A 5L3JA 2GQPA 4UROA 1S14A 3A0YA 4GCZA 3H80A 3VHAA 1THNA 3C11A 2FXSA 3A0XA 4QPJA 1ID0A 3GIFA 1Z5AA 1UY7A 3WHAA 1QZRA 5D7RA 3CGYA 4GEEA 4R1FA 1AH6A 1EI1A 1QY8A 4CWSA 2XHRA 4HZ0A 4CE2A 4L91A 2XDLA 3EHJA 3PEHA 2PNRA 3FT5A 1L0OA 3FT8A 4KFGA 3HZ1A 3G7BA 4XD8A 3Q5JA 5FNFA 4KSHA 4HYPA 1UYFA 2IWUA 1PVGA 4BQJA 4L94A 5M4PA 4FMTA 4YKWA 5FNCA 3ZXQA 5D6QA 3B24A 3O6OA 3GIGB 4XKAA 4H85A 3B28A 3A0ZA 1MU5A 2FWZA 4EGKA 4LWFA 2YE4A 4XITA 4I3HA 4BQGA 3ZM7A 1GKXA 2YGFA 4H81A 1JM6A 1BYQA 4V25A 2HCHA 2VWCA 1A4HA 1TBWA 2YE2A 3HEKA 2XCMA 1NHJA 2XX2A 4DZYA 4LPBA 1U0ZA 4NH7A 4O07A 5IDMA 3RLPA 3LPSA 3T0HA 1Z59A 2YE5A 4HZ5A 3OWDA 1YT0A 2HKJA 4JQLA 4JASA 3FV5A 4KQVA 4LWEA 4YKZA 3EHFA 3BM9A 4KP4A 3VHDA 2YE8A 2XJGA 4KSGA 2WEQA 4B7PA 3VADA 3K98A 4U93A 1BXDA 2IWXA 1S16A 1AH8A 3T2SA 5D7DA 3OW6A 4AWPA 1Z5CA 2CCTA 2YEAA 1BGQA 1UYKA 4FPPA 3R4PA 5BOCA 4W7TA 2BRCA 3GIGA 2QG0A 3ZKBA 3D0BA 4EM7A 3QDDA 1UYEA 2WI2A 2YEEA 3O2FA 1UY9A 1I5AA 1MX0A 1H7UA 3RLQA 1OSFA 2VCIA 1Z5BA 3HYZA 1UYLA 4FCQA 3K99A 1I5DA 4HXZA 1AJ6A 1YC3A 4XDMA 2XX4A 4MPNA 5M4HA 4XCJA 3JZ3A 3HYYA 3OPDA 2YE6A 2YGEA 3A0WA 3CGZA 2YK9A 2YI5A 3K97A 4HXWA 1Y8PA 4GT8A 4URMA 3VHCA 4PRVA 4XC0A 2XJJA 2HG1A 5J6AA 4AWOA 2Q8GA 2H8MA 2QF6A 1YT1A 4XKOA 3D2RA 4ASGA 3EKRA 3EHHA 4JAUA 2CCUA 2XDXA 4EMVA 1TIDA 1TC0A 2WEPA 3IEDA 4EFUA 4CWPA 4URLA 3RLRA 4URNA 2IOPA 1BKNA 4XTJA 2Q8FA 1NHIA 3B27A 4XIPA 4YKQA 2EXLA 2BU5A 2CCSA 2UWDA 3WQ9A 2YEJA 1EA6A 2XHTA 4PRXA 3OWBA 5CTYA 2FWYA 2BREA 2YEBA 4MB9A 2IOQA 2XDSA 2E0AA 1UY8A 2BTZA 3A0RA 2VW5A 3C0EA 2YJWA 1ZWHA 2WI6A 5CTXA 1UY6A 1GKZA 4YKUA 5M4NA 3R4NA 5GGZA 3R91A 2BYHA 2C2AA 2YEDA 2O1WA 1AM1A 3LNUA 4EGIA 5D6PA 3Q5KA 2K5BA 2YKCA 3NMQA 4FCRA 2ZKJA 4AS9A 5IN9A 3KE6A 2QG2A 4X9LA 3TZ5A 3GIEA 5M4KA 4AWQA 4ZVIA 2O1VA 2H55A 2YE9A 4CE1A 4L8ZA 1UYIA 3K60A 4CE3A 2XK2A 3INXA 4HY6A 5M4MA 1AMWA 3HZ5A 3EHGA 5FWKA 4WUBA 1YESA 2YI7A 1R62A 1B3QA 1Y4SA 4NH9A 4LWHA 2XDUA 4XE2A 1UYHA 4CWRA 4R3MA 4P8OA 4V26A 1YT2A 4LWIA 2WI5A 2BU7A 3TZ4A 2YE7A 2YI6A 1GJVA 4U7NA 4YKYA 4CWNA 5CTWA 1H7SA 4CWOA 2O1UA 2WERA 5CTUA 4L93A 4ASAA 4O05A 4JAVA 5FNDA 4XIRA 1YSZA 2YEIA 4ZKIA 5C93A 3CRLA 4L90A 4O0BA 5F5RA 1I58A 3B26A 2CG9A 3T10A 3D36A 5M4EA 3H4LA 1KZNA 3R4MA 3DGEA 4BIZA 3G75A 2YJXA 4O04A 1B62A 2IWSA 2YEHA 1YERA 4P7AA 2JKIA 3EKOA 3QTFA 4CWTA 4GQTA 3CWVA 4GFNA 3TZ0A 4HYMA 3SL2A 4HY1A 4YKTA 2BSMA 2QFOA 4E02A 1UYDA 2CGFA 3HHUA 3T1KA 4QPKA 3TUHA 3U2DA 1UYGA 5IDJA 4H7QA 1QYEA 3R92A 1UYCA 1TC6A 2ZDYA 4K4OA 2XD6A 1TILA 3R4OA 2XDKA 4LP0A 5CF0A 4MP2A 4MPEA 4GGLA 2ZBKB 2YECA 3Q5LA 4MBCA 1YS3A 2YKBA 4YKRA 5D7CA 1ZW9A 2Q2EB 4LWGA 4CWFA 1YSRA 1Y4UA 4FCPA 3TTZA 2GFDA 1YC4A 2XHXA 4MPCA 1I5CA 2YK2A 2BYIA 4MP7A 1U2OA 5BODA 1I5BA 3G7EA 3ZXOA 4Q20A 4KTNA 2VCJA 1YETA
chains in the Genus database with same CATH superfamily
4Z2XA 4YMEA 5J71A 3HVTA 5F3KA 3HVAA 4X4QA 3MUMP 1HNXF 1S99A 2XNQA 4CIOA 3H5YA 3BQ2A 2FD2A 4CM0A 2WI1A 3CCUS 2GIRA 4DV0J 3VGTA 1TAQA 4O44B 4PG6A 2JDJA 1IWAA 4R3AA 4ECXA 1VRTA 3TVYA 5GAEU 1P9QC 2V9KA 5CZXA 1NO8A 2Y9HA 4V19J 4PG8A 3DHXA 2HIQA 1J5EJ 1QAXA 3SDEA 4I2PA 2JZ5A 4NA3A 3U67A 1MROB 3GFZA 1U4BA 1M1KT 4LF4J 1M5HA 3Q86A 4NEYA 1UA1A 2EFQA 3H5SA 2GQPA 2ZH2A 1ELOA 3C46A 3P96A 3EE3A 4QWCA 2AD9A 2DGTA 5LMNF 2DNMA 1DTQA 1CC8A 3CC2S 3GONA 3MEEB 1BMQB 4G3IA 3O44A 1S1XA 5E33A 1ZBTA 4PYDA 1FXDA 3PW7A 3IXQA 5KT3A 4HYPA 4GO5X 1IBLJ 3GG0A 3T5KA 4B9SA 4XAKA 3P45B 3SCLE 3TEHB 3UDLA 5FJ4A 1JWWA 2GAGC 3UVJB 2UXDF 2DYAA 2EEYA 2N82B 4LF5F 3LP1B 2FUG9 5G0RA 4WKYA 3G6ES 4RX6A 1FTRA 3N6NA 2LYVA 1QVFR 1LK5A 2RRNA 3WIUA 4DZYA 3LP0B 5DGAA 4A46A 1FD8A 1PBAA 3MR3A 2MLXA 3NS7B 4HYKA 2ZE2A 4B3MJ 2JOQA 3FV5A 3M8SA 1NDKA 2C1EB 3EHFA 4JI0F 1CJTB 1TK0A 1SQEA 3DLEB 1HBUB 4B3TJ 4LFAF 4NX9A 2AYEA 2YWWA 3TVZA 3T2SA 5LSLA 3M8RA 4V19X 1NHKL 3J7ZT 2IM3A 5HBMA 2RT3A 2YNIB 4TY8A 2HBZB 5BYRA 4K4YA 3OXLA 2I1RA 4NXNF 3TJ8A 1MX0A 2DHXA 3E2EA 4O23A 2FC8A 2GIFA 2ADBA 3BSOA 2N3OA 3OVSA 4H4KA 2MJNA 3CUNA 2YKNA 5KT7A 4URMA 5MAOA 5KG0A 2XJJA 4DX5A 5IT0A 1F3FA 2IJFA 1RT2A 4M95A 2V63A 5KFJA 2R7OA 1VBYA 1YLXA 4A8YA 2YKPA 3WIVA 4URLA 4DV6F 4QPTA 3R7NB 2AT1B 4DV0F 1BKNA 4WTOB 1NHIA 2YWGA 1U09A 2RD5C 4ZJOA 4DV3J 3BO2A 2KDOA 3LH2S 3LWMA 3MMCB 1Q95G 2F4FA 2ZE2B 1RAAB 3DDIA 4NXMJ 1FJEB 1YITS 3TZYA 2ZH9A 2XMUA 2WK4A 3NNHA 2IBKA 4PR6A 1J5EF 5CTXA 1AZSA 1FRLA 1R8PA 3RR7A 2K3KA 4DPTA 2FVPA 2IRYA 1RISA 3B4DA 2DR5A 1SUQB 3MDFA 1XJWB 1JXLA 2ZH1A 4LRBA 4P75A 3W9JA 4A47A 2JL9A 3H2LA 2VFUA 2XEXA 3DRSB 3OR1A 3MGJA 1P9YA 2H65B 2E5GA 3TJAA 4IQMA 4L8ZA 4NE9C 3FRZA 2PFDA 2ZZTA 3CTRA 1DLOB 2LA6A 1IVZA 5GVQA 2HFSA 2CQ2A 5DGBA 4EU0A 2QMXA 1JX4A 4NI2A 4FN5A 1WEZA 2J8AA 1GQEA 2G2YA 1HARA 3LW5C 5CXTA 4ZKIA 3CRLA 3H8YA 2DGSA 2OSQA 1R8BA 3H4LA 2PE8A 3M30B 4FNHA 1C0UA 1FRKA 1SKSA 1NLKL 2UV8A 5HMYA 3QATA 2OD4A 2F1FA 3MOJB 4CWTA 4DG1A 4B3MF 4YHHJ 3R5AA 4TKTA 1Z2LA 4ES3A 1WUUA 3AOCA 1WTFA 3H2UB 5AE2A 1B99A 2XQCA 1H7XA 5HVFA 2V5HG 4DF8A 2GQQA 1C4AA 3ZZZA 2M5YA 3KLIA 4P10A 3NOGA 3Q8QB 1W25A 2E5LF 1KRPA 1YSRA 4LF5J 4NXNJ 1DHMA 2B4OA 4LFBF 3GU0A 2HS3A 2M9KA 1VFJA 1IKVA 3J81Y 3M2RA 2ZEJA 2W9AA 3DDNA 1HBNA 2RILA 2H4WB 1EARA 5DG7A 4E0DA 4YEAA 5DDPC 4ZVRB 4KR0B 1TUGB 2XJXA 1T9UA 2K7JA 5M2RA 3V2UC 3BKFA 4Z7CA 3A8IA 3IGNA 2OTJS 2YX7A 3MUVP 1Y5NB 3QBCA 1MW7A 2LDYA 2FJWA 4LR9A 4KKOA 4P6QA 1HNZJ 1C2PA 5C25A 4W98A 2C22A 4DI6A 1QSYA 1Y8NA 2FIUA 3EGVA 4WXOA 2YKIA 3IC1A 1VIOA 2KT5A 4YR2A 3MM8A 3IM8A 3TAMB 2D9OA 2RH3A 2G2ZA 3KLEB 2FYPA 3L7UA 4P71A 3MMBA 4DV7F 3G87A 4GCZA 1JMTA 4DV6J 4HI1A 1AW0A 1R3NA 3C19A 1HQ2A 1U26A 4YB1P 3A4TA 1QZRA 2XZDB 5D7RA 1H72C 4DV3F 4DCJB 4RBVA 2B43A 2XHRA 1HBUA 2QLWA 4NLWA 4NXMF 3UDCA 5FNFA 1H2UX 2RUGA 1LW0A 1UYFA 2QGFB 1HLWA 3CJ8A 3MAAA 3WQPA 1S97A 5B0CA 2DNHA 4TY8B 2W9BB 3KK1B 4I2PB 3M8QB 3IWNC 4OYWA 4QYRA 3NMRA 2HCHA 1TFYA 5EDWA 2YE2A 4ZLNA 4OZ0A 4HTJA 4MK7A 5KOXA 4USUA 4O07A 3T0HA 3V4IA 2OKQA 4YHHF 4YKZA 2GVDB 3JTOA 1F2GA 3ZNUA 4JI7J 3ZNJ1 3QFWA 2ZD1A 3VADA 3PV8A 2CG8A 1AH8A 3KLHB 5KG3A 3FBBA 1R6YA 5ITHA 5AXLA 1IKYA 4OZ5A 1X4AA 2E5HA 4I56A 5KFOA 2HVDA 1ROFA 5F8MA 4AQYJ 1BE4A 3R9LA 1U8SA 4KO0A 3O2FA 1K1SA 3SZ2A 4TU9A 4JI6J 4DV5F 4F36A 1XERA 1AJ6A 2HHSA 3VAMA 2CWXA 2XX4A 2YGEA 1SBRA 2YI5A 4QR1A 4X66F 2KG0A 1UW9A 4OI2A 2R8HA 5J2QA 3V4MA 4WF9Q 2HG1A 1TUWA 3ULHA 5DZ7A 1AXQA 4OHWA 6FD1A 2J6SA 4CNYA 5D0RA 4K8RA 2XDXA 5CQGA 3MPVA 1N33J 3VAIA 4CWPA 3T9ZA 3S8SA 3UWTA 3KLVA 2QYCA 4HR2A 3D6TB 4WK3A 1MNEA 4DDFA 4PRXA 3CDEA 5D77A 3BQ0A 3ISNC 4ED6A 3CD5A 1WOOA 5D8HB 1I3OB 1E6YA 5DQHA 1TKZB 3MXHP 2O1WA 3I96A 3FBCA 5HMXA 2XY6A 4Q7AA 3S01A 1I94J 1EX8A 2B4UA 4AS9A 2WVBA 2V6AA 4LF9F 5F8HA 4PYAA 2J76E 4G1QB 1T03A 2GHPA 1YJWS 1KFSA 1N32F 4QWBA 3MCSA 2RJZA 2LEBA 2J5AA 1YESA 4OYBA 1MWZA 3PNIA 5KFEA 2RRBA 3W60A 1GTEA 2FLLA 4ZLJA 4OFZA 1F5AA 4JI3F 2WOMA 2YE7A 2CJXB 5C2GA 4ZHRB 2HZCA 2HAIA 3IBCB 1DRZA 5IOLA 1ZOTA 2ASJA 2YEIA 1S7IA 4CNZA 4O4GA 4GVBB 5F8IA 4AXIA 2W4CA 3GWCA 2W9BA 1KZNA 2O66A 1HNXJ 1RTHA 4UTGA 9ATCB 4OZJA 5I42A 3CW2C 8AT1B 1VC5A 4GFNA 1IJFB 2APOA 4F4YA 1TKZA 1Q8IA 1VHIA 3L4BC 4JI7F 4J7CA 4J91A 2KI2A 3I56S 2RQMA 2AZ3A 4X84A 2AP6A 5IV4A 3OLBA 2BMBA 1ZA2B 2WVCA 3C14A 2KYXA 4K5RA 4YKRA 3HI9A 1A9NB 1Y00A 3UFCX 4LSLA 5B0FA 3J7YU 3I9V9 4P52A 3OFHA 4LF4F 2AW0A 1Q7LB 2IM1A 5JXSA 2UXCJ 4I67A 1I5BA 3TAMA 3DM2A 1SJ4P 1NDLA 3K5PA 3EGZA 5KFTA 4GKKJ 2BJDA 5C42B 1PC4A 3W62A 1NHVA 1TKTB 1NAQA 3CCVS 2Q8HA 1H98A 1S0OA 2W24A 4USKA 3AA9A 5ETLA 1YBUA 2IIHA 1FO1A 1HNIB 2IPOB 3CJKB 2YNHB 2UUBJ 1ZXNA 3GJSB 3GSIA 4ES2A 2V4JB 4TNOA 2P9GA 3EDQB 5F8LA 4Q2MA 4JI6F 4C98A 2YX1A 5ETTA 4DUHA 1WHYA 4OI6A 2W9CB 3U02A 4KY3A 1R0AB 4Q43A 2DGUA 2XGPA 2CXEA 5KFVA 2ASLA 1S1TA 1HHTP 3ZZOA 4C8OA 3KKFA 1I94F 3KXDA 4KRWA 4LF9J 4IRDA 3W65A 1LNQA 3GSDA 4AT1B 2VONA 3MR5A 4TYBA 1Q16B 1TELA 1S9GA 8RUCA 1KKHA 2AYBA 3A8EA 1S4FA 4OYPA 2R8GA 4JI3J 2IWUA 2DNZA 4YQWA 3A0ZA 1JLAA 1CULA 4P9SA 1Q8KA 1HWJA 1OQ3A 1FK9B 3T9NA 4JI1F 3LUYA 3ENAA 2RQCA 4JI8F 3DOKB 4ELUA 2N4CA 5IDMA 3IO1A 4HT7A 2OPPB 4IO9Q 2BM1A 2DNQA 3PHTA 1R43A 4ZVGA 5ETSA 1F6TA 4KQVA 4C3MA 2FVCA 2KN4A 1XQIA 2HVEA 1S16A 1FNOA 2D74B 1CS4B 4NOHA 1FJCA 3CCZA 4FPPA 1C1CB 1ZM3A 2JJ4D 2BV3A 2CPDA 1F0XA 2WSEC 3QLHB 4EBEA 3BSCA 1TL3B 4IFYA 3BBCA 3NLCA 3OL6A 1KVJA 4ECTA 3TI0A 2KM8C 5B0EA 5EX3A 3AY0A 2ZM6F 2HBYB 3CDAA 3OV7A 5KFKA 1JLFA 1VQNS 3LWLA 2Q3PA 4MJKA 2GVDA 3PJ9A 1TVRA 3W3SA 1YIJS 3I6PA 3EHHA 4JAUA 3DHWC 4C6AA 1VQKS 1FRJA 4NWBA 1M0SA 2H3EB 2Q8FA 3B54A 1TP7A 4AL5A 3VAGA 1SCJB 2GJFA 5BXIA 1DY3A 4DZ6A 1RWMB 1Q1KA 1HPZA 3N5FA 4LF6F 4IR9A 4MB9A 2KYZA 2JSXA 4XPEA 1B70B 4WCEQ 1HNIA 3PX6A 2AJ2A 3VR1A 1ZWHA 1X7VA 3X3UA 1WG5A 3AOAA 3IGVA 4O0NA 5DDOC 3U1NA 4PXBA 2DO0A 3D6MB 3TRGA 2YH1A 1D9DA 1EP4A 1AUDA 3JQMA 2WB4A 1AM1A 2Z57B 2E5JA 5L39A 2YNGB 4WYLA 3A3NB 3QMQA 4NRUA 3CMQA 5DQIA 1RAEB 1UCNA 4IKAA 2NREA 2CNLB 4WE1B 5L1KA 3M9OB 2BJ8A 2FLPA 3R2DJ 4UZCA 3CJQA 1UYHA 4YS2A 2IJNA 4RW8B 2VOOA 4CLKA 3SQOP 4UOGA 1PILA 4LF8F 2OEJA 5DS7A 2FQQB 1TL7B 1EKRA 1PJ5A 3I32A 2ALZA 2YWEA 4DR4F 4TVAB 4DXLA 3D36A 4PG4A 2VG5A 2LKZA 2KG1A 4FS1A 1S79A 2YJXA 2EPIA 1NH7A 1UVIA 1HHSA 5M2UA 1SVDA 3QTFA 2QZ8A 1U1QA 5I3QA 5F8NA 1ZAXA 3TZ0A 4HYMA 3HHLC 4HY1A 4EWTA 4EUVA 2G0IA 4RNHA 4QWEA 2W2MP 2X51A 1F9FA 2DEJA 3HK2A 3R4OA 5HANA 2ZJQQ 2YNFB 1S4EA 3GV5B 5L1LA 1B0PA 5KT5A 3CD0A 4LWGA 4KT0C 1X5OA 3U1LA 4FCPA 5IQQA 3WZ0A 3HHLD 3OLAA 1WKKA 1V5VA 2BYIA 4MP7A 2DVIA 4Q20A 4TXSA 2EFNA 2XSJA 3BKTA 3H59A 4JOUA 3JYTA 2A6OA 1U49A 2XYGB 5AXKA 1SKWA 4PG5A 4HL9A 3OR2A 3MR2A 3F56A 1KS2A 2E1MC 4WBFA 1BWEA 1IKXB 2ZKUA 2V67A 2Z4PA 2IJRA 1TZ0A 4U7OA 4EFTA 1VBKA 4DPOA 4ENOA 1PIEA 2CJYB 3BH6B 2A10A 3ADAC 1NKBA 2HWIA 4CYUB 5GAGU 2H51B 4DU8A 4WU2A 1T0TV 1H2TZ 2ACMA 4RNNA 2G0JA 3ZZUA 2ZM6J 3CIZA 2YKJA 2Q6CA 4Q44A 4L3NA 3C6UB 3NBPB 3N01A 2YWKA 3T0ZA 2XS7A 4OI4A 4F0MA 5A2QY 3CCQS 3D3CJ 2NZCA 5L1IA 3ZZPA 1B3TA 1K1QA 1V6HA 2FHJD 2ROPA 1NK5A 1APSA 1IKWA 4ECUA 1KD1T 1TUVA 3IR6B 2YQ1A 3ILLA 4Z7YA 1H3DA 2FJVA 5CYQA 2PNRA 3HZ1A 4F4XA 3CIMA 2FZGB 1GAOA 2NSBA 5D3GA 4Y2KA 1CSJA 2DHGA 2IM0A 3HHNB 4GO7X 3CJ4A 4I0WA 1D1UA 2AF6A 3OQ2A 3ZM7A 3K5OA 2VWCA 4J9QA 2DNYA 4J9UE 4JI0J 2M7SA 5CAAA 4LPBA 1YQHA 1BQXA 3MPWA 1N33F 2J0XA 1IM6A 1Z59A 1JLFB 4YN3B 3CCRS 2G0CA 3D1HA 4FF1A 4IFVB 1S59A 3TQEA 4RU2A 3FQLA 2HRUA 5DO2A 3IG1A 3FC9A 3TQ1A 5D7DA 4AWPA 4CO4A 2V4QA 3W5ZA 3PW0A 3M8ZA 1NHUA 3QT5A 1TL4A 4O4RA 3D0BA 1JB0C 1BY9A 3L7OA 4MK9A 4DR4J 5DQGA 4ZP8A 3IWXA 5B08A 2BE7D 2ZC3A 4HT5A 5D0EA 4RUAA 4B9UA 3K8WA 1QE1B 2ZH6A 2DIVA 2ZUAA 3QO9B 1YVFA 1N32J 4Q8EA 2Y0BB 4PQAA 3FSYA 2GO9A 2XBPA 2WEPA 3DLJA 3GQCA 1S0VA 3LALA 4AYBD 2GW8A 1NPKA 4ED2A 3EDRB 3PR5B 4U7CA 2FLOA 3AHPA 2IOQA 1UY8A 1IQZA 1MU2A 2FJXA 5D78A 3R4NA 1G4CA 3MHYA 2RQ4A 4PWUA 2UV8G 3E3XA 2DCLA 1RT3B 5IN9A 4IH6A 5B0DA 4XO0A 1X60A 2KXFA 1DTQB 2IBOA 1ZA1B 4OYZA 1JLBB 2EW9A 2D3ZA 3QGPA 2O1VA 1RT6A 2VBWA 1PJ6A 4HY6A 5FWKA 3CGIA 1YBAA 4WUBA 2C2KB 1N5TA 1RU2A 2P9CA 4QR0A 2DXFA 4P8OA 4J9PA 3MD3A 2WI5A 1FRXA 3VF0B 1GMWD 1EQMA 4CWNA 2VASA 2BE2A 1W2BR 2Y8YA 5FNDA 3E8OA 4UW2A 3NAIA 1I58A 3MF5A 3DN9A 4O44A 4HHUA 4GKKF 1R8HA 1OS5A 4K4VA 4NLRA 4OYOA 1B62A 2VC1A 3US5A 1FFGB 3U27A 2IWSA 1U0HA 2I2YA 1V3RA 5L46A 1VR6A 3EKOA 4LF7F 1YG0A 3W2WB 2KT3A 2HPUA 1SPBP 4XTTA 1VRUA 1U0SA 3MEGB 3BPDA 3R1LA 2UUBF 2YTCA 4P73A 1QYEA 2P2CB 5K14B 4A4JA 2XLIA 2XD6A 2IVYA 1S9FA 4ZJLA 4LFBJ 1RHMB 2XDKA 4DR7J 1FDAA 5DDQC 3Q5LA 2MKCA 1NZAA 2VPZB 1HQUA 1RT6B 1X4CA 2HGNA 3L09A 4DR5F 2CZVC 2LXFA 4C4WA 4CYUA 1XWLA 2A2DA 2VFSA 2HWHA 4C9DA 3J7Z5 2VG6A 2ZNYA 1U2FA 1TL1B 3PRVA 3DFEA 1QSSA 3V81B 2WBMA 4CO0A 1JJ4A 3NGUA 3H4DA 1FXLA 4CWBA 1F5CA 3CEDA 2MKSA 1NHHA 4XIQA 1ZPVA 1L3UA 1RAHB 5SZTA 1PYSB 4Q0BB 4FYYB 3UVJA 3MMCA 2BJ1A 4CTAA 2BU8A 3H42A 2C1IA 3O1LA 3H0PA 4I6YA 3I55S 2CDQA 2GX8A 4DLGA 1IBCB 2UUWA 3D0GE 1KIJA 4MKVA 3JTPA 1SUQA 1ZM4A 3SSQA 1K0TA 4JI8J 2YGAA 1NB7A 4M5JA 4DV7J 4E01A 3G6YA 2D3OR 3M6WA 3ONQA 2ESAA 4I5SA 4BIUA 1UEKA 3A8KA 4UROA 4KYZA 2RUSA 3SSRA 4USIA 3VHAA 2KL8A 1M5PC 4FYDA 1Z5AA 1HA1A 3ZTQA 2R4FA 4HVZA 4DPYA 4NA2A 4NZ6A 4DL5A 3NP5A 5KFXA 4FBTA 4CE2A 1IXKA 1HR0J 4DR6F 4ZCIA 4BLGA 4B9NA 3UPFA 2ZOGA 4L94A 5M4PA 3TUJC 4RW6A 4ZIVA 4XKAA 1PAUB 2Z30B 3UNYA 1MU5A 1NEEA 4YOEA 1JQGA 5HROB 2XG8A 3KLFA 1VDHA 1XNRF 3IA0A 3CJ3A 1A4HA 4USTA 1KVKA 3H98A 2RF2A 4WFYA 4DR3J 1RA6A 2ILZA 3EJMA 2YE5A 2EC2A 3UR3C 4ZN1A 4MIAA 3KG1A 3IN5A 4KSEB 4B7PA 3T5JA 1JNRB 1SKUB 4NCGB 3LPYA 3RU0A 3SXLA 3ICLA 2R9LA 1XMQF 1DZ5A 5BOCA 3G6VA 4DR7F 4H4KC 1WI8A 2HQDA 1FX2A 3GYGA 5LM7E 4X66J 2VFRA 2NSCA 2VU5A 2GHWA 1IR1A 5DJBA 4DSJA 3OPDA 3R5GA 3CGZA 2XYPB 4LF7J 4ZMMA 5LSRA 3VGUA 2VBYA 5HQLA 2C3OA 5CCLA 1IN0A 2ERRA 4CO3A 3ZZ0A 4N77A 1L3VA 2O3DA 4IG3B 1U2CA 3MFIA 3QJLA 4URNA 2DNRA 4PWDA 4MFBA 4XTJA 4JV0A 4NCBA 5HI7A 4EGLA 1FI4A 2HS0A 4JUZA 3Q23A 4OX6A 1EAYC 3I9ZA 4CT8A 5HJYA 3E51A 2CA9A 4NLGA 2YJWA 2WI6A 1CBKA 1Q8BA 4ERDA 3RAMA 2X1GA 2QJ3A 1IUJA 5A8WA 2GV1A 2M8HA 3R91A 5DM7Q 1XBWA 2YEDA 2CJQA 2OELA 4KQZA 4FCRA 2FVSA 3RRGA 1JXVA 5DG8A 3UW1A 1WSRA 4V1Ak 3OT9A 3QIDA 4RO0A 4EZ6A 2A6MA 4CLYA 1KN6A 3W2WA 2YE9A 3M2UA 2PGCA 1T9VA 3HX9A 4NLPA 3EHGA 3W1YC 1IR2A 1Z4UA 3CJ2A 4WTYA 1R62A 2BANA 3MM6A 1K0VA 5J2MB 5D4LA 1U1PA 1FDBA 1N4LA 3HHLB 2DNGA 2XULA 2YKAA 3RAQA 1IBKJ 3FFIB 3CMAS 1FKOA 4LR8A 4K7QA 4XIRA 5C93A 1RK8A 3I5CA 4L90A 2VICA 1XR7A 4H4MB 5KFBA 2Z2ZA 2GCFA 4F2SA 2V50A 2R2TA 2DRDA 3POTB 1RWNB 3MR6A 4UOFA 2YEHA 2JEIA 5EWFA 3RB3A 3CCMS 2D41A 1S12A 2OGUA 2BSMA 1MWQA 2E7WA 2CKWA 2NUHA 3U2DA 4OZNA 1HR0F 1QSLA 2MEWA 5KFFA 2D9PA 4P2SA 1R7IA 5KT2A 2VPYB 3CCTA 1FKAF 4LP0A 3KJVA 5GMDA 2V34A 3KMSA 4QIGA 4MBCA 1YS3A 3UD3P 2LLZA 4F02A 4P74A 2SXLA 1XNRJ 4ED5A 1Q79A 4GKJF 4XPCA 4MPCA 5J2QB 2O1PA 1SJFA 3I82A 1WELA 1N54B 3PW5A 5BODA 3G7EA 2BVZA 3LP2B 4DR3F 3JSMA 2OSRA 4DZDA 3T41A 4BAEA 4MOTA 2Q66A 2DNKA 4X4VA 2HZVA 3W5XA 4C48A 4QIVA 2ZDXA 5KG6A 3F41A 2BT0A 3JSBA 2KRBA 1UWBA 2XI2A 2CAJA 3CRKA 2CPYA 3NS6A 2I38A 5H9EK 1B7YB 2F7VA 3KOAA 1WJ9A 3OR1B 4E00A 3FCHA 2MSSA 1GXLA 2PMWA 1SJRA 4P72A 1ACMB 2L9DA 3TZWA 3NNAA 3B82A 3LAKA 2ZHOA 3DRRA 1QTMA 3DGPA 5F41A 2NXCA 4QYZK 1J2VA 1ZAWA 5JUMA 3HM9A 2X3GA 5SUHA 2IORA 3I0RB 2M0GB 3JAMU 4U8VA 4TLRA 1PC5A 5CA5A 1T03B 1A0OB 3N9UC 2J9EA 2C2DA 1YK9A 3AAWB 2JJCA 2DHAA 4KIAA 1PJ7A 2B9EA 2EWHA 1RYSA 3HHDA 2VQEF 3RAXA 2FXSA 3D54A 3TUZC 2MHNA 3OTOJ 2RDIA 3PFOA 4KTQA 2Z56B 1RDRA 1OWXA 2K1RB 1I51B 2NCKL 3S7RA 3S6EA 1WG4A 3BJYA 4AD6A 3M4XA 2PEHA 1MSWD 3GLJA 2XMWA 3Q5JA 4PZVA 3M6UA 4M63A 4BQJA 1HNWF 4GVBA 2V0NA 2G9OA 4EO6A 3PRBA 4OI1A 4YKWA 4L73A 1IBKF 5J2MA 3GILA 2B9YA 4MTPA 5AT1B 2CPXA 4PQUB 2YE4A 1TKXA 2P5VA 2YGFA 2AKWB 3VQTA 3BR9A 3VAHA 3KJQB 4H54A 2WBRA 4CO5A 3T6JA 5L8RC 5IT9U 5KFYA 1YT0A 2W8KA 4LRFA 4X62J 4ZCKA 1FE4A 2YQ0A 4PWWA 1CEZA 4RW7B 2PC6A 4KP4A 1R0BG 3HSDA 1HNVA 1RLCL 3M1VB 4LF2A 1REVB 1R89A 4ED8A 2V2ZA 5I3PA 2J6TA 3OW6A 1M5VC 2BE2B 1VI7A 1YDLA 2YEAA 1U1KA 4I2QA 1X9MA 2JWNA 5EWGA 5C25B 1UY9A 2WCXA 1N5VA 2P8IA 1BWVA 4GKJJ 1YC3A 2R2RA 5H9EJ 1WF1A 1FDDA 5E0OA 4GT8A 2CRLA 1N48A 5CH7B 4R8UA 4WFBQ 3NG8A 4PPZA 3CCWA 3MEGA 3OJSA 1R27B 5HLFA 3KK2A 5D0HA 1Y9OA 2IDLA 1T05B 3GIRA 2XHCA 1IR0A 4CCHA 1DAXA 3MCOA 3RLRA 3VZIA 5JVGQ 2C2MB 4XIUA 3B27A 2EBEA 4WFAQ 3DYAA 4WFNQ 2YEJA 2ZUGA 4NMLA 3MM7A 3MWBA 2B8PA 1YRXA 2BREA 2I8EA 4QBUA 3PZPA 1WC4A 1S1TB 2EI5A 2J0QD 1NPRA 4RBUA 1YSJA 1BQMA 1IXMA 2QRRA 2M2BA 2GMJA 4UUWA 3AXMA 3H25A 1RQ0A 3VCDA 2FZCB 2L41A 1KWMA 3MEKA 1GTHA 4FYVB 2HNDA 2OIHA 4CE1A 3SCJE 1VQSA 5M4MA 4KHRA 2F5GA 1AMWA 5ETMA 3ETMA 2RNEA 3D0HE 5KG4A 2V8PA 4LF8J 2POKA 3OHAA 4NYZA 3DRPB 4DR5J 2GAHC 4LWIA 2FYXA 1TK8A 2XMAA 4WU3A 3C3LA 4NL5A 1HNWJ 5G0RB 4DSIA 4OYXA 1SC1B 1RWWB 4AXJA 4O05A 1O5JA 3FEZA 2DD8S 2DPJA 5LJ5Y 1N5YB 4O0BA 2KB2A 3R4MA 4EBDA 4DHVA 3BDPA 2IRUA 3NCQA 5K8OA 3QWPA 5L1JA 4ANCA 1VQMS 3LTOA 3W66A 2CGFA 3PYGA 2OMOA 2YPYA 1NBEB 3ISND 3MM9B 2NYHA 2YKQA 4RLEA 4K4OA 1RAFB 4ECVA 1UJ4A 2FJBB 4CQ1A 3D6HB 1D9AA 4X4OA 3J7AN 1FX4A 1UZDA 1FWPA 4MP2A 2OHDA 1OQ6A 1NKEA 1Z1ZA 1HYSB 4IH7A 4YY3F 1FEHA 2FTKA 2DHSA 2ZH5A 3QJPA 4EYIB 5IM0B 5A0YA 3OFEA 3GIKA 3M2VA 1YETA 2KFNA 2HW3A 2CVIA 2YXLA 2DGXA 4ID5B 1Y8OA 3RKZA 2HNZB 3ZKDA 2ZWOA 1GXUA 3H2VE 4NLYA 3J7A1 1RTZA 1KEKA 2D3UA 3GR1A 3PEJA 1TKDA 4ED1A 1DTTA 2BBEA 1H6KX 5EUHA 4U7UK 4BXIA 3BZQA 2LQ8A 2QE5A 2JNJA 3IAS9 1T05A 3O2IA 1GMUA 2FTRA 1IQTA 5E3QA 4PL9A 3BH7B 1U6FA 2HHWA 4QIEA 1GMWA 3P5TL 2JLGA 4DQRA 3HP6A 1WSVA 1FFSB 5C2CA 1RTDB 2AJ1A 1WNEA 3MMAB 4XCLA 4Y65A 1SV5A 3GR0A 5KFWA 3RG6A 3TZ2A 3H40A 4M1KA 5HBMB 1RKJA 2W8LA 3D1OA 5L3JA 4WZQA 1S14A 1UWBB 9RUBA 4QW8A 4A8KA 3J7YI 1FDNA 2Y3YA 5A0YB 1MN9A 4KE5A 2RS8A 1XMQJ 3DC2A 1RUSA 4KH0B 5DETA 1QY8A 2XLJA 1EZZB 4FS2A 3OXGA 4IOCQ 4DV4J 2DY9A 1NH8A 2HYIB 3G7BA 1U2RA 2GJ2A 4MYUA 2OMLA 2LXIA 3KG4A 1RT5B 2E7XA 1H7WA 3CYGA 2VODA 3QIPA 4QR2A 3OL8A 4X65J 2PIIA 1S0NA 1BYQA 3GFYA 2V4RA 2Q6BA 3KLEA 1VISA 3N6MA 5EHHA 3BGOP 4A8FA 3OWDA 1WC1A 5EX0A 4JQLA 2ZC4A 3SDEB 5DLGA 1TU0B 3DLLQ 4LRCA 5I3UB 4AFFA 4RNMA 3R97A 1Q53A 4LUBA 2EXUA 3ZZTA 4Y6IA 1EP4B 1Z5CA 5LXRA 1QD1A 4DLEA 1RWPB 2DNOA 5IS2A 2IMWP 1WDTA 1RP5A 4OHXA 4IG0A 3M30A 2CUYA 3K17A 5IZHA 1I5OB 4WE1A 5D6GA 2OD6A 1I5DA 4HXZA 1SC3B 2A18A 3HSGA 4A8XA 4WFXA 3UD4P 3G82B 2KHDA 3FZBA 4ELVA 2ZH4A 4PXDA 3TX0A 4B9TA 1QVGR 2EVZA 4Q8FA 1P8GA 4RW9B 1YI2S 1YT1A 4FDFA 3IRXB 4OV6A 4K5SA 3OXFA 4ZP6A 2ZJRQ 4I69A 4DSKA 2HNYA 1N56A 5A8KB 1FWLA 1RWXB 1EA6A 2EFVA 1YGYA 2MQQA 2FWYA 2HFOA 4YY3J 3MOZA 1JLGA 2XDSA 1T9YA 3K0JA 3A0RA 2AEJA 2P6SA 4ZVHA 4ZVOB 4TN2A 5ETRA 3SCIE 3DMJA 1SL2A 4ED0A 4Y00A 2H9ZA 1RTDA 4R5PA 2FJAB 2VZ9A 2CG4A 2CQIA 1U1LA 1NKCA 1ZS6A 2FHJA 4DMZA 3FCVA 3D9BA 3M8PA 3MUTP 1QM9A 3TZ5A 3HJFA 4AWQA 1G1XA 1V9OA 2HHUA 1V3ZA 3K60A 2CZ9A 3K58A 3D6FB 3DRYA 1ITPA 1D9FA 4V26A 4B02A 3R5DA 2Y8WA 1N0UA 2MZQA 1S1XB 1UL3A 5F8JA 2QA4G 3TYTA 4D3GA 4K2JA 3C14B 2GQ2A 3D68A 3N4WA 1KOHA 3OTEA 4WYWA 4X65F 2FY1A 1CG2A 3CJSA 3MMBB 3HVWA 2Y1LB 1TL3A 2H48B 2PT0A 1O51A 4FBUA 3LP1A 4DX7A 3HD1A 5IFMA 4OZ3A 1W2IA 2X1BA 3AXKA 5LL6d 4YUDA 3G6XA 3CB4A 1EJ7L 3LP0A 5KFAA 2LU1A 4YKTA 2Z2MA 1X5TA 4ZVTB 1HL6A 4ELTA 2WOMB 1RTIA 2GMLA 4O0IA 3M8QA 4NRTA 3Q8PB 1VC0A 3FBEA 2W25A 4DQIA 2YECA 2ZBQA 2YKBA 4CWFA 3HMJG 1DFDA 3A13A 4M94A 2W4DA 4RUBA 3S1TA 2G2OA 3PDNA 3EUNA 1RCOB 2PI4A 2MQNA 1ZTTA 5DRKA 3KUEA 4DCOB 1S1VB 4E2FB 1JLCB 5E5NA 2ZVIA 2XMVA 2LDIA 1S6UA 1XMOF 1QJHA 2YE3A 3DLGA 3MEDB 2GS8A 2VL1A 3I0SB 1Y5LB 1AA1B 3SCKE 4B9MA 3KK1A 2UVUA 2BKNA 2MMYA 3L7PA 4FPRA 4KFBA 2XLKA 1C0UB 2HVZA 4WUDA 4PU9A 2XWXA 4DL3A 3CULA 2DIUA 1FRIA 2DO4A 2OH2A 4LSLB 2V69A 1VBZA 4KPYA 4O09A 3BF4A 1T9TA 4GVLA 1WC0A 2QSWA 2K3IA 1X4EA 2QSFA 4XDDA 3PHEA 1YJ7A 2AJ0A 1TH8A 1RT5A 4B6CA 4XDCA 4M5IA 4QIWD 4K2XA 1CULB 1SB6A 3IBFB 2UXBF 1XIQA 4PG7A 2LMIA 4ZKAA 3BN7A 2CH4A 1U1RA 1FESA 2RDDA 2BRLA 5H9FK 3KFWX 5THWA 3D28A 1Y0HA 1X9WA 1Q78A 3CJ5A 3VV2B 4DR6J 4L75A 1RCXB 4LSZB 3ILOA 4LIRA 3CPWR 3HFZB 3WHAA 5GMEA 1U47A 3CCES 3SFUA 1VMBA 2MY8A 1NNDA 2XS5A 3FEXB 4F3MA 1LWFB 2CQGA 2UUAF 3TA1A 1QE1A 3WC0A 3VQSA 4ZVSB 4K4XA 2G4BA 1NJZA 3CJRA 2W7PA 4EGKA 1YJVA 4IRCA 2OPQB 3I5BA 3ETOA 2J6UA 1WHWA 1UTAA 4CM2A 4F4KA 3TZXA 5I4MA 2MQ8A 1NK8A 1RT1B 2E1RA 2YQ3A 3FCWA 2VPWB 3VHDA 3FBFA 5A6WA 4URQU 3RJMB 2RDJA 3VVUA 2QEXS 3R3TA 3NGDA 2IDEA 2CVEA 1BGQA 3BS9A 2HNYB 2ZBCA 1S5ZA 3JSRA 2GC8A 3R4PA 2VDIA 5A8KA 2QG0A 2VJUA 1VQPS 1UYEA 2VA2A 3VGVA 1C0TB 4WP8A 2CFXA 1B4SA 2XWYA 3DOKA 1R6VA 2KJVA 3JZ3A 3M6VA 4PCQA 3A0WA 2FHMA 3VHCA 3PO4A 3RW6A 5F3ZA 4KHMA 2QN6B 2YKMA 4KC5A 2B5JB 3SYZA 2ZH3A 4CTAB 2RB7A 3BREA 3D2RA 2EC0A 1QUPA 4I6WA 4N56A 1XMBA 2GFFA 2NLWA 2ZDPA 2ZOMA 4KGZB 2WSFC 2J7WA 4USVA 4QQBA 4QWDA 2W1BA 1KVIA 2CJKA 3CWJA 3O6QA 3OJUA 2AX1A 3V4IB 5B09A 5KG5A 5A6PA 4IQXA 4GRSA 2W2NP 2BM0A 2DHHA 2BTZA 2HGLA 4DSFA 4ANDA 1QY7A 4USHA 3TA2A 1VQYA 3AJDA 3MR7A 4CO2A 5M4NA 2Z2LA 4P7TA 4IH5A 2HNZA 1PCAA 2DGVA 2HQFA 3QWUA 4WXWA 4ZA1A 3CT9A 4OLOA 1XMOJ 2Z58B 1IKYB 3KLGA 2GNKA 2HRTA 3JB9k 2V9WA 1TVRB 2ZKJA 3TWZA 3LA0A 2QG9B 1C0TA 4C8ZA 3HT0A 1FJGF 2EK1A 1EIYB 2GO8A 1DJ0A 2LEAA 2EFGA 2QT7A 1T11A 2XK2A 3VAFA 1HFEL 1OYDA 1JKHA 2YI7A 3H5UA 2XDUA 3GIJA 3N79A 2R7QA 4R3MA 5D4NA 5EGYA 2XGQA 1KQGB 2BQRA 2O67A 3HKZD 1NJWA 1H74A 2DGQA 3GG1A 3U7JA 4ILMA 3C6TA 2WERA 1SJ1A 2AGOA 1YSZA 2WRMA 2RF2B 2WW4A 3D1QA 1AT1B 3ITHA 4Q0BA 5M4EA 1FHTA 4FKYA 3OL7A 4O04A 2VH7A 5KFDA 2DISA 3AH6A 2QMWA 4P7AA 2GJIA 4BCAA 2JKIA 1D3WA 3V6KA 3UD5A 4NCGA 4GQTA 2PSZA 4ZVEA 3I0SA 3QSYB 1UYDA 2KXHA 4A48A 4USMA 1HWKA 3R92A 4RWXA 3KLGB 3AQOA 2HVIA 2ZHBA 4HEA9 2LA4A 4X4PA 1F9HA 3PW4A 4CLSA 2B6AB 3PM9A 1UZHA 5HN0A 2YY3A 1P1TA 1WACA 1KP6A 3EMTA 2M70A 1R8CA 3NAHA 4W4MA 2RAQA 3M8WA 5EN1A 5LMUJ 2F9DA 3C6TB 3VGSA 3BV8A 1DQ9A 1G2EA 2AJFE 2P6TA 4OJ3A 4K59A 4DV4F 1DQ8A 3MM5A 4KGVB 1QAJA 2M8DB 4ECRA 1A6LA 4Y28C 2WVEA 1ZXMA 4N7TA 1N6QB 3QGIA 5KT4A 2ASYA 4AL6A 5I42B 1X5SA 2BQUA 3RGIA 3W5YA 1BC6A 2AMCB 1I1GA 1PGZA 2WHOA 2ATLA 2XZWA 4EEHA 1VQOS 3HFKA 4U6PA 2MTLA 4B17A 1F2HA 1RWOB 4IOAQ 2XMMA 3FVYA 3WX8A 3NWGA 3K5LA 2VQEJ 1N5QA 3QT8A 3OTOF 2B8QA 4OHVA 3B78A 5KOWA 4ASFA 4JI4F 3Q83A 1HWLA 5IXUA 2QYGA 5E3PA 3A0XA 1FJGJ 1ID0A 5C24A 3BDEA 1UMJA 1RADB 2UP1A 2WONB 4LRAA 4RW8A 4FZVA 3HHLA 3GV8B 2MLZA 3BBBA 1VRQC 3DM2B 3DGVA 3FT5A 4F67A 4EI2A 1JKHB 3LMMA 1ICEB 4QJVA 1F9EB 5K14A 3TARA 1V3SA 3S5TA 2M88A 2F9JA 3PJXA 1Y3JA 2XI3A 4OYIA 4LWFA 1FERA 1CJKB 1JJHA 2E29A 2E9ZA 4X62F 5KG7A 1F60B 2ZVSA 4X2BA 3B8HA 2MLYA 1S49A 1F51A 3Q8VA 5J2NB 1Q4RA 2XCMA 2NPIA 3QSIA 2CPEA 2V2VA 5KFMA 3KK3A 4HZ5A 1KLMB 2VQFJ 4UY8T 1KFDA 3QO9A 3GB0A 2BDPA 2YKMB 4UOHA 1RTHB 1YHQS 1HMVA 3BM9A 1E6VB 2ZKTA 2UZAA 1SIWB 2P9EA 4R0JA 4KSGA 2OTLS 1HWUA 5ADZA 4EFAC 3TAPA 2V94A 2Z8QA 4DX6A 1TL7A 1YKWA 1U1NA 3TNVA 2GMHA 4RUHA 2MGZA 1S6QA 3QDDA 5KFGA 2VG5B 4ZVFA 2YEEA 1I5AA 1QDUB 1VRTB 3G8TA 3RLQA 4M5GA 1Z5BA 3PY8A 3SFGA 3MMJA 4ETXA 4FVMA 4QYZJ 1S1WB 3OVAA 1TFWA 4DL6A 2RKIB 1B0TA 1HI0P 3ENVA 3CO0P 4N41A 3THVA 4XC0A 5J6AA 1QUVA 2JLFA 4PKDB 2OPRB 2QMUB 1TIDA 1TC0A 1FKOB 4NLUA 2XSFA 1JLBA 3DLHA 2VF3A 2KO1A 4RBTA 3CCSS 4QZVB 3K57A 4XIPA 1RE1B 1NK9A 2OAUA 3TX8A 1RT7B 5M2PA 1S1UA 2QL7B 4B9LA 2C1GA 4EO8A 2WVFA 2KVIA 2AEMA 3SV3A 2U1AA 3KHLA 1RHKB 2ALYB 5KG2A 3RUBL 2X7IA 2F3JA 3KHHA 4HACB 3VALA 1SH3A 3MECA 4OHYA 2RMLA 3MCNA 4JI2F 1OY9A 4A8SA 2AX0A 2MPUA 7AT1B 4P2MA 2GA7A 2YVSA 3L3CA 3A1YG 1R8AA 4L3KA 4ZOSA 1U48A 1RJJA 4ZVIA 3EGNA 3UCZP 4DQSA 5ETOA 2NXUA 2HS4A 5E2QA 4USJC 3CD6S 1TAUA 3BO4A 1U6BA 3DNCA 1FTCA 1UVJA 1G7CB 2XSJB 5CHCB 4QW9A 1MU2B 5CTWA 5HL7Q 3NBPA 3P4UB 2MKIA 2B6AA 2ROEA 2ROGA 1WI6A 4J9KA 4CH0S 1JK9B 4BC7A 4DFJA 3RRHA 4F3QA 2KZZA 2HHVA 3T10A 4Z37A 1RT7A 1J5OB 2VUGA 1JLAB 4YFUA 3H20A 1X0PA 3P8BB 2UU9F 2FZKB 4N47A 2HK2A 3CWVA 4ZPVR 1WEXA 2B56A 1NU4A 4PAAA 3IG1B 3FKBA 2N4DA 4DL7A 2F63A 1RWUA 2ABYA 1EETB 3K2YA 3TUHA 3R7SB 4RR5A 3T5HA 3FMWA 2XHWA 4R0EA 2VHGA 4OZLA 3MM5B 2PMZD 3KHGA 1OSDA 3I0RA 5KFHA 2YKOA 5LJ3Y 1TILA 3VHQA 5CF0A 5T7LB 3PTWA 1KOOA 1LFPA 2K7KA 3W61A 1JLQB 3EX7B 3ITHB 7FDRA 2GFDA 2ZNZA 3Q24A 2BJ3A 1ZH5A 2DGWA 2C28A 2BEFA 1RACB 1ZTWA 5HLFB 1RWVB 4RW4B 4BWJA 2LQJA 2VQFF 4W90B 1HW9A 2B3TB 3TP2A 4RZRA 2AKPA 5E7OB 1VRUB 5D3GB 1UPMB 3CDWA 5F3TA 5LXYA 2UUAJ 2HKEA 2Q1LA 4WPAA 2XX5A 4WIQA 3L9ZA 3JQKA 1RA7A 3KUHA 3KWMA 1VQ8S 5HO4A 2IAJB 1HBMA 2W2PP 3DU6A 2XMKA 3O0IA 2FJEB 1VJQA 3IM9A 2M4MA 1HW8A 3R1HA 3WDOA 3QRQA 1S57A 3VVTA 4F4AA 4RW7A 1U45A 3CNQP 4I7FB 3BN4A 3U2KA 4O3RA 4XK8C 3CE8A 4F2RA 4PRFA 1HI1A 2BYCA 2YKEA 1O8BA 1X4DA 1ZZNA 2CNOB 1NSKL 1X8DA 4FPIA 1CLFA 3A0YA 2YNGA 3FMBA 2YBVA 4CT9A 4K4TA 5IT4A 3DLKB 4F04B 2KJWA 4C0OC 1C1BB 4GMKA 3DDKA 4KFGA 3HHKA 3GIIA 4KSHA 3H4BA 1GX5A 3BEGB 3RRKA 2Z0GA 3O6OA 5HP1A 2EBGA 3WX4A 1S6QB 2ZJPQ 2XMTA 2E9RX 2VB6A 4C0BA 4JI2J 3RB6A 1SL0A 3TOQA 4H81A 2X1FA 1O6XA 4J9NA 3DU5A 1GK8A 1VS3A 1ZETA 3BGLA 2J0WA 1TBWA 3HEKA 2B4PA 2HLTA 2XX2A 4DU7A 1QAIA 3DYAB 2RKIA 3RLPA 3EXCX 2YWHA 2R7RA 1T9WA 2JVOA 2V8VA 2BOAA 2E66A 3BGFA 1X31C 4ID8A 4JV5J 4ICLB 3DOMB 4I68A 3K98A 4U8YA 2DNPA 2Z2YB 3NXZA 1LEOA 4MFBB 3PO5A 2BJEA 4DOZA 1MMNA 1AFIA 1YRUA 2NQPA 2B7BB 4C8NA 2EKNA 4LFCJ 2CQ3A 2YNFA 4O3SA 1KBRA 3TZZA 4MT1A 4NYPA 1IKWB 2QA2A 1UYLA 2CPFA 3HYYA 2YE6A 1JLQA 4G1IA 4YP3A 1Y8PA 4MAKA 4JBCA 2I5JB 4GC6A 1T3OA 3ELHA 1Q5YA 4DQPA 3BKUA 1LFWA 1NZ8A 4E8UA 4ASGA 3FRYA 4UZBA 3KMQA 4OJHA 3RYLA 4DSLA 5BYQA 3HXMA 1HWIA 8ATCB 2IC3A 2AV5A 4NLVA 3K8VA 3H7HB 1MN7A 3WQ9A 4EZ9A 1IKXA 2XHTA 4EMDA 2VG6B 3PIOQ 2AZ1A 3D7SB 2HMIA 1AYEA 4FXWA 1NSPA 3HJVA 2BXJA 4ICLA 4B3RF 3P5BP 1UY6A 1LWCB 3G4SS 3GTYX 2RRAA 4ZPCA 5AE1A 5HMWA 3LNUA 3PX4A 5D6PA 2RSQA 2VC0A 3CVKA 1UFKA 2YKCA 3R6LB 3TANA 3QYYA 2DR6A 3TA0A 1WG1A 4KPCA 1H38A 1RT4A 4PWDB 2IA0A 3R27A 3M32A 1NXIA 2GIQA 4CE3A 4DN9A 4ZPAA 4FYWB 3ZZYA 3WBZA 1X4FA 4ECWA 3P49B 1VQ6S 4Y2AA 3AT1B 3A3OB 4U95A 1QLNA 2VBZA 2O1UA 4ASAA 2DXDA 2C2RA 3OFGA 4DPUA 2HGMA 4I2QB 1RU1A 3T5LA 5HP1B 4X4UA 3D67A 5C24B 3HFVA 1RBOB 3UDVA 2ATCB 1HBOA 2AGPA 4IOBA 2B51A 3BPSP 4E02A 2C2NA 3G9CA 3CDUA 4QPKA 1BQNB 1UYCA 3OTBA 3DOMA 3D66A 3ZZRA 4CRJA 4MPEA 2LEPA 4ZPDA 1CJKA 4PUOA 1YBTA 4F4ZA 2BOPA 2RHQB 1SC4B 3RBDA 4LFCF 1Y4UA 1PKUA 2BW7A 3P3DA 4RKUC 4B3OA 3DRRB 5A8RB 4A8MP 4FKXA 1XC9A 2DY1A 2YH0A 2HFVA 3TUPA 3ET6A 2VCJA 1AUSL 1Y10A 1YJUA 4UOCA 1E6VA 1T3NA 2CYYA 3D5MA 2JC1A 3MURP 4URSA 2JEJA 4H4OB 1NJXA 4FP9A 3FQKA 3UO0A 5CCMA 2YEFA 3EICA 4RW6B 3ZTRA 2B9XA 3LGNA 2JEGA 2MZ1A 3ILJA 3AODA 3LQVA 4M5HA 2Y1JA 4JYAJ 1FNMA 2NR0A 4ZJQA 3BYPA 3QRPA 1UVKA 1K8AT 2FHOB 4W92B 4CLTA 4CI0B 3SV4A 1JXEA 2XY7A 5JENA 2GVZA 3KDNA 2UXBJ 2COLA 2LVWA 1LXNA 5ETQA 3JSMB 4MKYA 2BJ7A 4DJBA 2LCWA 2B0GA 5FLXU 3FGVA 2OPSB 3NGKA 1N52B 4MK8A 3EM1A 1LKZA 6AT1B 2FB0A 4HH1A 2G1HA 1VLYA 4IG0B 1VQ7S 4LMZA 1Z2ZA 1BHNA 5IWAF 1CQNA 1H2VZ 2XB2D 2F8HA 5FDLA 2HVHA 3HZGA 3M1VA 1LQ9A 2QC3A 2DR9A 4TYAA 2FC9A 4HACA 3SIPB 3N28A 4XD8A 2H4YB 3GIMA 2G1DA 2MKYA 3D3BJ 4LVOP 4KB7A 2R8JA 1RYRA 4LVNP 3CDBA 5D6QA 1OJ4A 3B24A 1FT8A 1RT2B 3UN3A 1WF2A 4XITA 1JM6A 3CJ0A 2BR0A 4V25A 1VCTA 3ZFVA 3DOLB 2BQ3A 2ADCA 5LSOA 4EEYA 1RTJA 1RLDA 5C5JA 1HD0A 2ZFHA 2DTJA 1M5OC 2HKJA 2UVWA 3ISZA 1UVMA 1OMSA 4CLWA 2C42A 2WZ1A 1AZSB 2XJGA 1HQEA 1VIXA 3SQGB 1UYKA 1WWHA 3PW2A 1FEEA 2Y1IA 4A8WA 1UFLA 3RBXA 2BRCA 4P7VA 3PKMA 2MXYA 5T14A 5HMZA 2BE9B 1RBAA 3WC2A 4FXVA 2RVJA 1HBNB 5L38A 2JRSA 4NLOA 3EYZA 2VKZG 3MEEA 1RAIB 1HIYA 4M5LA 4XDMA 5DLFA 4MPNA 5M4HA 2R7XA 4DN0A 2V8GA 3BR8A 3ZTPA 1RAJA 3IAM9 5J1EB 4MYTA 1D09B 3PRDA 2JH3A 3EZUA 2OO4A 1DURA 3DCAA 4NI2B 4XKOA 1VYAA 3EKRA 2MKHA 3PR4A 1NMEB 1MLAA 3A12A 3IEDA 4EFUA 4DFMA 1XNQJ 2C3MA 2R7UA 3NCPA 4B08A 3DOLA 4DS5A 1CC7A 1PSDA 1AROP 2CZ4A 4DS4A 2DBBA 1RHQB 2BUNA 3L95X 4B3SF 6FDRA 1GX6A 5H9FJ 2HHHJ 2H1YA 1WHVA 4MH8A 3O5TB 4NCAA 1UA0A 5AJ3J 4YKUA 2ACYA 1NJYA 2HEKA 4WP3A 5J1PA 2BYHA 1HD1A 2K5BA 4YB6A 4DBQA 2KH9A 2ZDOA 2CADA 2UUCJ 4LQ9A 1OPZA 1CPZA 2K1RA 5AE3A 2HHQA 1CVJA 5E3AA 2OPSA 3JSYA 4JYAF 1F1BB 3OD2A 2DITA 4J37A 1Y4SA 3MM7B 4N76A 3ZXWA 2QL9B 5L9XA 2B4VA 5I3UA 2L9WA 1EHWA 4I7FA 2MQPA 2MHEA 3R2CJ 4Y34A 1FVSA 1GJVA 4U7NA 2AJQA 3DLGB 1C4CA 3CSKA 2CPHA 1GNKA 3PYFA 4X4NA 1YX2A 1Q81T 3NGRA 2XMJA 1MMLA 2CG9A 3HT3A 1M1HA 2D7SA 4F8RA 2KKHA 4K4UA 5K8MA 5HROA 1CQMA 3LF0A 1YERA 1ZM9A 2KT2A 2XO7A 2DRAA 1P6TA 2L48A 1CJVA 4PXEA 1V5IB 4C97A 1HKAA 1MMDA 3FSXA 3T1KA 1UYGA 1DTTB 1W7WA 1WKLA 3E01A 4LIWA 4HHHA 3O8WA 2H5EA 1NB2A 3C8YA 4ECYA 3MPYA 5D7CA 3MPUB 3LGHA 2VFTA 4E98A 3BO3A 3C16A 1KQSR 1NK7A 5LMUF 4O3QA 1HPZB 2GVZB 4M5KA 1I5CA 1BD6A 1CJUB 3TO8A 3MMAA 1UW4A 1D8ZA 2WI7A 4NH8A 1HNVB 4J9RA 1REVA 5HVHA 3FFIA 4L6V3 2C3YA 4ES1A 2BU6A 2QLJB 1S77D 2BZ5A 5DZ6A 1RHRB 4ZLPA 2U2FA 1T02A 2R7WA 4WUCA 2WSCC 1GXTA 3GCXP 4OX8A 5JMNA 3V6JA 5HQ8A 2YI0A 2VJVA 2HHHF 1VQ4S 5IM0A 1CJVB 4ASBA 4MIWA 2PFFB 2HHTA 4ZS6A 3K5NA 1VOMA 1U8WA 3DXSX 4LBHA 1JIHA 1T9XA 3DKDA 4JI4J 1NK0A 3M2VB 3NWRA 2CWKA 4USWA 3PFEA 5GAHI 2NXEA 4EGHA 4ILLA 3ENWA 1MWYA 4JP8A 2E9TA 5KFUA 3QJJA 2BX6A 3GFHA 4K0KF 3C11A 1SIZA 4YDXA 3OSNA 5IC4B 3CC7S 2DK2A 4KV8A 4GEEA 4QPXA 2HHPA 2HFNA 2HWTA 1WOPA 3PEHA 4B3SJ 1EQ0A 3THPA 4CLPA 2LECA 3M2UB 1S0MA 4F25A 1FKPB 3QPIA 2CQ1A 1N36J 2R2UA 3NMAA 1PYTA 5F8GA 3WHIA 3TVKA 2OP5A 4ED7A 2CJ9A 2CQCA 1U1OA 4I3HA 2J8SA 3LANA 4F3OA 4KKOB 3RB4A 1F3VA 1FRMA 4ZK7M 1RZMA 3RBEA 2YKNB 2FLNA 4A8QA 3UDEA 4K4ZA 2W7OA 2AIRB 2J9DE 2RQKA 3CXCR 2C2ZB 1JLEB 3MM8B 2M52A 4ZN3A 3W2VA 4YR0A 1BXDA 1S6PA 3RZAA 4F4WA 1T8EA 1FVQA 4W7TA 1IJEB 1WF0A 5HVGA 2VCIA 2HQGA 3BBFA 1J27A 3AQPA 3K99A 3QQCD 2CPZA 4XCJA 4WK1A 5GADU 2YK9A 3HO1A 1LW0B 4NLXA 2F8EX 3KUGA 4EK2A 1KC8T 3G71S 2CJAA 4GC7A 2QL5B 4ZHRA 2WW8A 3I87A 5KAKA 3SQGA 3FNNA 3VWSA 1WC3A 2R8KA 4LSNA 4NEZA 4B3OB 3TAQA 2MB0B 4UY85 2YEBA 3O3LA 1K44A 1R0CB 1YTYA 3HF5A 1S76D 1GKZA 2RS2A 2ZD1B 2ZHAA 2QA4S 2ZBPA 1VK8A 5GGZA 3UN2A 5KTQA 5B7WA 4EGIA 3H90A 3I31A 3HULA 5DDRC 2VBXA 2BKPA 3IMQJ 5CZVA 2BKOA 3UR0A 2DKOB 1Y4ZB 3PG9A 2QG2A 4X9LA 1JNZB 3MAHA 4DUZF 3THTA 1TV6B 4Y0FA 2A1BA 3G96A 2QLFB 1NPPA 4DV2F 1O0PA 3N0VA 1RT1A 4NH9A 2KTQA 4BBYA 3M6XA 2MZTA 2MKKA 2LFVA 4I6AA 1YZ7A 1RI7A 1UVLA 4B9VA 4YKYA 2IM2A 2E1CA 2I0XA 4G65A 4MMOA 4KGXB 2R2SA 2UU9J 5AXNA 2OEMA 2A3JA 2C3UA 3MZIA 3C16B 5A2QU 2KU7A 4ED4A 3CF5Q 3G8SA 3NRBA 3M2RB 3OTCA 2OLWA 2W7AA 3C2PA 4K4SA 1CJUA 2OFHX 4K0KJ 4TU8A 4IDKA 4DV1F 4QWAA 3PKYA 3PACA 4EBCA 1VC6A 3FZ2A 2B5JA 4FNIA 1VJWA 4BDPA 5IDJA 1HHQA 2ZDYA 4DL2A 1SV5B 5JJBA 2J0SD 1N36F 4FXDA 2DT9A 1S6PB 1ZW9A 4WWSA 5K8NA 1REGX 4CH1A 1XR6A 3G82A 5IC6B 2XS2A 3HPOA 2AYMA 4Y2MA 1L3TA 1SKRA 1XK8A 1U2OA 2J7UA 1TMJA 3BGUA 4C3KA 1WKJA 4J9LA 2AJ4A 3IRXA 2IYGA 2GZOA 5HSPA 1G3OA 2DCUB 3GYNA 2H5JB 2MDAA 4M5MA 1NCLA 2I9SA 2EFPA 3EVWA 4OI3A 2NXJA 1FXRA 4DX8H 3DI6B 4G1QA 2HIYA 5D0GA 1A7GE 7FD1A 2F65A 4LREA 3DMJB 2R7VA 4ATNA 3ILIA 4ZLLA 1VQLS 5K5MA 3W7BA 1Y5IB 4ANEA 3Q8UA 2YEGA 1I59A 2KFYA 2XYHB 3J81j 3JTNA 3RBZA 4OI0A 1FRHA 3MEDA 2MQMA 1IWGA 1BQMB 4O4GB 4ZITA 1TMMA 4NYOA 3Q2TC 1HYSA 2KHCA 3QAEA 5B0AA 3CO9A 1M5KC 3H80A 3GJQB 1THNA 4DUZJ 1LWEA 4X4TA 5GAHU 2MYFA 4F26A 3QAUA 2O5DA 1AH6A 2RU3A 3BB5A 4IYQA 2E5IA 1LW2A 3HDSA 5FIIA 4Y3CA 3HVTB 3EHJA 4NASA 1EB0A 1OSCA 2V2KA 4WP9A 1UVNA 3CMES 4H85A 5KFRA 3TW0A 1X0FA 5G4DA 4JV5F 2AYGA 2IVMA 4NH7A 3IBWA 4G1PA 2W2OP 3AD9C 1JLGB 4A8OA 2HFZA 4DV1J 2YE8A 1KDNA 2LP4A 2C3PA 2WEQA 3BGRB 2KM8B 3AD8C 3K7RA 4C11B 5A76A 2HQCA 1N0VC 5F9NA 1FKPA 2OI2A 4ZDNA 2GHVC 2CQHA 1Q82T 3EZ5A 5B0GA 1KR4A 3PCOB 4RNOA 1RBLA 2MY7A 3DXBA 1Q86T 4UUXA 1S1VA 3H5XA 5E41A 3HHEA 1K47A 1LW2B 5BR8F 4RWWA 4HHJA 1M90T 2QO3A 4DG1B 1JJ2R 4HXWA 2HBQB 4UF4A 5E3CA 3TUIC 1GFWB 2ZH7A 1AB8A 1JLEA 3FK4A 4FF3A 1KHVA 3W2VB 4LT6A 2Y0SD 2K2PA 1I6JA 3NNCA 4EMVA 5GAGI 3MTJA 2XCAA 4I4BA 1Y11A 3NEKA 4N8OA 3HVRA 3KLHA 4OIXA 2C2EA 3D4JA 4YKQA 2PD1A 1TKTA 4B3RJ 2EXLA 3GJTB 2GQCA 4AUKA 2WONA 1IKVB 4URGA 4OZ1A 1DQAA 2YNHA 1JLCA 4AE5A 4JV2A 2KFZA 2MZRA 3M8YA 2V4JA 2ZH8A 1EETA 3QT7A 2LQBA 4X4RA 1CS4A 3Q5KA 2L08A 1AFJA 1ZPWX 2YNIA 2Q43A 5KFIA 2XNRA 2ZBRA 2Q79A 5M4KA 4U9RA 2H55A 1UYIA 2QFJA 3R6GB 3W64A 3Q2SC 1U1MA 3UCUP 4XE2A 3OFFA 1YT2A 4RW9A 1FD2A 3NY0A 1H7SA 4L93A 2W4PA 4O3PA 4N8NA 4J90A 4ECZA 2ZZNA 2DH9A 3CJTA 1RHJB 5FD1A 4TY9A 2LXUA 3QIPB 1WOSA 1B0VA 1OY6A 2KZMA 2BW2A 1TV6A 1S1WA 1NDPA 1UWAA 2E44A 2D69A 3NCRA 3QGHA 1SC6A 4DUYJ 2RU9A 3MPDA 2V8HA 1KQKA 5C42A 3QT6A 2FJDB 2IRXA 3HHUA 4U7UD 4H7QA 4R5PB 5B0BA 3M9NB 3PJWA 1UJ5A 2DPIA 5GADI 4ZPWR 2V68A 2A0FB 1U24A 2ZITA 4GGLA 2BABA 3DLBA 3NOCA 1KSPA 2ZWPA 5BYSA 3I4HX 1C1CA 1Q5VA 3ZTOA 2FVQA 1DLOA 3C66A 2F40A 2VFVA 3UE2A 2XY5A 2N3LA 2W9CA 4KTNA 4O3OA 4QIFA 1LOUA 3NKYA 4TU7A 3TEGA 4JV1A 1MG7A 3J80U 3INWA 1YC1A 3RR8A 3KJNB 4ZCLA 4YKXA 2XC9A 2RHSB 3D2WA 1S9GB 1LWCA 2LU2A 2K06A 1NM2A 2WI3A 4ILRA 2VKRA 3QZ7A 1EKSA 1KHWA 4UQTA 3T6BA 4AL7A 4X4SA 2XABA 1WD6A 2J9DA 1S6OA 1HI8A 3T3FA 2IYIA 5IWAJ 1RT4B 2MKJA 1FFWB 1RWKB 3W63A 3T1YJ 3B25A 4ECQA 5J2NA 3UN5A 2DH7A 2HBRB 3KK3B 4KBIA 3TJ9A 3DI6A 1FA0A 3C15A 3CGYA 2DR7A 4CO1A 1N6QA 4ZP9A 3QZ8A 2XDLA 3FT8A 3IP0A 4DL4A 4OJ1A 1PVGA 4HI2A 5KFQA 1BLUA 1WHXA 5KFZA 2MGZB 4KFBB 4JI5F 3PVXA 1QAYA 3DRXA 3KJVB 1LWXA 5D15A 3EVMA 2L9NA 1UKUA 3OHBA 4C8LA 3MI7X 2XO6A 3LPSA 3LP2A 2IMOA 2VIHA 4LWEA 1YJ9S 1SL1A 1G6BA 4DFKA 2HRYA 2HK3A 4U93A 1XEZA 3GCWP 4U96A 1RAGB 4Y2CA 1UFWA 3OR2B 4QOTA 3KJFB 1N5YA 5D4PA 4F7VA 4NLTA 4EM7A 4NZ0A 2WI2A 3U1MA 1RTIB 1TL1A 1YJTA 2CDRB 1H7UA 5MLCV 3OVBA 1FK9A 1VHFA 4K50A 3HYZA 1QTNB 4J9OA 1Y3KA 3FUYA 4H4OA 4NA1A 5CYQB 3K97A 2W01A 1XNQF 3D0IE 4J9SA 4AWOA 4K4WA 2Q8GA 3MD1A 2H8MA 2QF6A 4DV2J 1K73T 3FEYB 1ULRA 3OBIA 2HHXA 3BGRA 2CCUA 1Q8LA 1N88A 1T94A 4C11A 1ZAVA 2M3DA 3J80Y 5HAOA 2PN6A 1FJ7A 2XM3A 4Q45A 2RIJA 2BU5A 3LGMA 5AJ3F 5T41A 4HTIA 4DUTA 3AB2B 5CTYA 2FY8A 3EPIA 4OQJA 2KRRA 2HHIA 2ZZMA 2VW5A 3C0EA 4IFVA 1HBOB 3AD7C 4Q2LA 1WTBA 1WEYA 2UUCF 2C2AA 3CCJS 3I5AA 4C3LA 4DF4A 4BC9A 4ZPBA 1NK6A 4PQUA 3NMQA 1S7HA 3JAMY 1P27B 2OPRA 1J5OA 4KO0B 2R7TA 1U6ZA 3NL0A 1SQGA 3OW2R 3OPKA 3N6LA 4ER8A 4CLUA 3RTVA 3W8PA 3MTKA 2XTJP 4PPDA 2HURA 1YWXA 2GGPA 4JB8B 1UEUA 3Q8RB 2NYIA 4CWRA 3EXYA 3C15B 4F50A 2R3VA 4OJGA 4YR3A 2YX4A 1FF2A 4KJIA 2BJ9A 5J1NA 1SQFA 1N5SA 3TZ4A 2IHR1 2YI6A 2YWFA 4KH1B 2X1AA 4CWOA 1VLOA 4JAVA 5K9FA 1GT8A 3MAAB 2PMHA 3B26A 3W9IA 1B7FA 4L74A 2G13A 4MIBA 5JVHQ 3QNWB 3NGSA 3G75A 4LQ3A 3TR5A 1VGYA 1XTZA 1HMVB 1HQEB 2VA3A 2CPIA 3A8JA 2FDNA 3SL2A 4ZVPB 4DR1J 2HFUA 1M1GA 1XN9A 5KFSA 2JHEA 4RNFA 4DR2F 3R8YA 2CPJA 3HKWA 4MKAA 3SEOA 5HQMA 2LQ5A 4YDDB 4YB5A 3IS9A 3Q89A 5F0UA 1SXLA 4OX7A 1D0EA 3GZ7A 4HLBA 2PDAA 1SJ3P 1IBMF 4JI5J 4MKBA 3R7BB 1SI9A 3SMZA 1VBXA 5F9LA 2F4VJ 2NUUG 4WJBA 3A3PB 4F0HA 3PYDA 1P1LA 3A0TA 1PBUA 1US7A 5CPHA 4WIIA 3MNRP 2X3DA 5FLXY 5AXMA 2YPZA 5CABA 3EZOA 2VG7A 3Q22A 5CD4A 4J9MA 4M8LA 2MQOA 3OMUA 2EKYA 1YRTA 5LT5A 4CWQA 3KLFB 4CZCA 2BZ2A 1YJRA 1OYEA 1BXNA 4CDIA 1X4HA 2EFOA 3VTIA 1F5BA 1OY8A 1SJQA 2NPFA 2AU0A 3DRPA 1N8RT 5ETNA 2N7CA 3HZEA 1PG5B 1UYMA 2BU2A 4XKKA 4OMFG 5HJXA 1E6YB 1OO0B 4G6VB 1T95A 4P2FA 2HQIA 3OL9A 3GIFA 3CCLS 3QGGA 1UY7A 2IY5B 3AA8A 4KHPJ 4CWSA 3KHRA 4HZ0A 3F44A 2JFDA 2ZOFA 1FCAA 1L0OA 2AEFA 3RB0A 1R31A 2GGPB 3VAKA 5ETPA 5K20B 1RB0A 3B28A 3HSJA 4HH0A 4OYMA 3C6UA 5J2PB 4OV1A 1S72S 1Y7PA 4UT4A 4CH7A 4IG3A 3M8PB 3CJKA 4FVCA 3FSIA 3J81U 2WTFA 5A8RA 1NHJA 4OX9F 1U0ZA 3BQ1A 1RHUB 1S1UB 4BS2A 2R7SA 2QV6A 3M9MB 4JASA 1WC6A 2I5JA 2W2QP 3IR5B 1N34J 4Y2IA 1U0HB 3E01B 4IO1A 4ID5A 3MECB 3EVOA 1C1BA 1UETA 2PI5A 2IWXA 1LXJA 2JC0A 1L3SA 2EK6A 2R42A 3K59A 3GIGA 4CP5A 1PO6A 3AOBA 3GP9A 4DEZA 2QLXA 1OSFA 3IS9B 3PX0A 5LOQA 4AQYF 2PA3A 1RXOB 3IFEA 2UXDJ 2UVRA 2XZTB 4ALZA 1TQLA 2CQ4A 4RUCA 5K8PA 4DV5J 2VV5A 4DQQA 1NRKA 4LR7A 3T1AA 3KNAA 4ZCMA 2FHKA 4NLQA 1RT3A 3OTDA 1M5SA 4RJVA 3EPGA 4DR1F 1HBMB 1UPPA 3W8GA 4WKRA 1TTHB 5T7LA 2IOPA 2VG7B 4R25A 2D3O1 4DL0C 2KXNB 2UWDA 4ECSA 3KTQA 2OPPA 3GV7B 4B3TF 2PA8D 1IBMJ 1KTQA 2MJUA 1H73A 3GPAA 3MFHA 2F8MA 1KNZA 1S48A 1KLNA 4IR1A 3JYTB 2F4VF 3I4PA 2QA1A 2B7CB 2DRBA 2AGQA 4KGKA 4NZ7A 1T7PA 5IV3A 4DUYF 5GAEI 5DG9A 1R0AA 1TR0A 4C0HA 3QLHA 1KTVA 4IFYB 2AHOB 3DLKA 2K8GA 5CYJA 3GMGA 2V8DA 2E7VA 1PAEX 2OFGX 4OL8A 3P6YC 4KHPF 4LWHA 5DM6Q 4P2XA 1VQ5S 3SI8A 4F0KA 4ED3A 1CJTA 2BACA 1X9SA 2OUGA 4S0MA 1YZ6A 2BU7A 1YJNS 2QIFA 4C8YA 1WDDA 4C8KA 4PUOB 2DB1A 1FE0A 4TQSA 4L76A 3ZTSA 3W9HA 5F5RA 1S9EA 1TK5A 2DNNA 3ZC4A 3DGEA 4M5DB 3G8QA 3MCMA 4UQGA 4BHQA 4E72A 3V5RA 2D1CA 2MZJA 3M32B 2QTWA 2RE1A 3V6DA 1N34F 1U7LA 4D3HA 1KLMA 4OLPA 2H54B 1TC6A 2KVQE 4FF4A 1NDCA 2HG4A 3LOUA 2ZBKB 5HATA 3F0NA 3GJRB 1FNXH 3UI3A 2CNNB 2DEIA 3LO3A 1YC4A 4C7QA 1ZZFA 2XHXA 4J9VA 1OIAA 3G2XA 2DXEA 4LF1A 2YK2A 4NMXA 2OJ3A 4KV8B 1ZYQA 3T1YF 1NSQA 3ZXOA 4OX9J 2HAFA 1U02A 3FDSA 3IRWP 3UQSA 3SBMA 2WI4A 4RPFA 4OZ2A 5A8WB 2N7YA 2Q8IA 1X5PA 3KDOA 2C2OB 2UXCF 2BA9A 1H0HB 2NZ4A 2EG1A 1S10A 4LSNB 1L5UA 3F73A 1TKXB 2B9WA 3DRSA 1X4BA 2PEBA 4NLSA 3SSSA 4EYHB 2VDHA 1KONA 2R8IA 1NUEA 3K5MA 2ILYA 2V2QA 2NS1B 1XR5A 2BANB 3MM6B 2ZBIA 2NXNA 4TQRA 4M5NA 3T1HJ 3BMYA 2E5LJ 3R5CA 2ASDA 1RKIA 3HCXA 1B63A 4NPOA 2UUTA 2QFIA 3BSAA 1UP1A 2DH8A 4PEOA 5HK4A 2QLBB 3OUYB 2H5IB 4DWIA 4HDGA 3UCGA 4QPJA 3ENQA 2HZAA 1BUXA 1W26A 3UNGC 3CD7A 2IA6A 4ZVUB 4R1FA 4DCPB 2I6WA 1EI1A 4X64F 1IM4A 2FGCA 1LV5A 4L91A 2WVDA 5L9NA 5KFCA 3QRRA 4R8UB 2JVRA 1HNZF 5H1SV 1DARA 2Y1RI 2JFKA 4FMTA 5FNCA 4WZMA 3ZXQA 3KK2B 3BM7A 3N5BA 2J7KA 2OEKA 2UVVA 3GIGB 2O01C 5CYMB 2FWZA 2FGOA 1SH2A 2FPHX 4ZVQB 4O3NA 3KLIB 4BQGA 1GKXA 2EG2A 4HKQA 2MZSA 1Q0NA 3B6BA 4IDKB 4QU7A 5RUBA 1UJ6A 5U47A 2JX2A 3R5BA 5ETVA 5J1EA 4CLLA 4H4MA 5KFPA 3KG0A 3KYLA 4JI1J 3MM9A 1FWKA 3VZHA 1OPIA 3POTA 4N5SA 2J9CA 2BRKA 4DPWA 5ETKA 2E1AA 3HSZA 4PABA 3V6HA 4ZIWA 3Q8SB 2CCTA 1RABB 5KT6A 2JEFA 5BJRA 1B64A 3OUYA 2DGOA 3IWLA 4RL1A 5BR8J 3ZKBA 3EWGA 1LK7A 3OSPA 1RSCA 4WFZA 5J2PA 4J5OA 2LQ9A 1L3KA 2CIMA 2E1PA 4LRDA 1ZM2A 4OHZA 3LAMA 3FJ2A 4FCQA 4OYAA 5CD4H 2CQBA 4ZP7A 4I1TA 4ITSA 3DGPB 4QCLA 5IT9Y 4PRVA 1DBDA 2VD3A 3RW7A 4RW4A 1BQNA 3DLEA 2VPXB 5CYMA 4YB7A 1TL5A 3QFHA 1GEHA 3MAQA 5LMNJ 3JXOA 1WORA 1VQ9S 5C7PA 4QU6A 4LBIA 2CQDA 1HQUB 4ETZA 5F0WA 3HD2A 3Q8YA 4DPXA 5IQ6A 2CCSA 4DFPA 2AWZA 2MQLA 3CC4S 3JQJA 3OWBA 4KGMA 3R5JB 2IAJA 2E0AA 1LWFA 5D4OA 3V81A 1IBLF 3GFXA 4TLQA 1UAWA 3X1LB 2AQ4A 4BWMA 5KFNA 3ZO7A 3T1HF 4LF6J 3GE9A 1S9EB 3NS5A 1GH8A 2HQ3A 4C2MA 2WAQD 4CLZA 4FF2A 4M5DA 1WC5A 3KE6A 3GYXB 3AJ2A 2OPQA 3GIEA 2CQ0A 2XCPA 3LPEA 3KNGA 4C8MA 1URNA 4DR2J 2CJBA 3JS9A 4L72B 4LBPA 2IFXA 3INXA 3V6DB 1VK3A 3HZ5A 4ZPTR 3T19A 1B3QA 4X64J 1UEVA 2MSTA 3ET6B 4I64A 4DSEA 3BSNA 2IVFB 4FYXB 1BGXT 1RGVA 2PO4A 2WB1D 5CTUA 3G86A 3B4MA 1D8YA 5EWEA 3AFGA 3M7VA 3EGWB 1RTJB 2IC3B 2DNLA 1U25A 3IR7B 2CQPA 2CNKB 3M05A 1KQFB 4BIZA 3K89A 3AJ1A 4LJMA 2HMIB 3VAJA 2A2CA 3AB4B 3PXGa 2L3MA 4PXCA 4IRKA 2HLUA 1URRA 1NJIT 5GMKa 4KAIA 5KG1A 2QFOA 2QX0A 4LFAJ 1SH0A 3NGTA 1X4GA 1JJCB 1K9MT 1RAOA 1MROA 5E3RA 2FVRA 4IUFA 2JLEA 3PYEA 2VOPA 2Q2EB 2HNDB 3TTZA 1LWEB 3PIPQ 4RU9A 2DR8A 4Q5VA 4CLFA 4NLDA 1NSAA 1PYOB 2DJWA 2HSEB 1Q7YT 3Q0AA 1GMVA 4U67Q 3BYRA 5FDLB 1NK4A 5KFLA 4HDHA 3HLUA
chains in the Genus database with same CATH topology
4Z2XA 4YMEA 3H4DA 5J71A 3HVTA 1FXLA 4J9LA 2AJ4A 3IRXA 5EN1A 2IYGA 1F5CA 4AWOA 2F9DA 3CEDA 1G3OA 2DCUB 3C6TB 3GYNA 5F3KA 3HVAA 4X4QA 2MKSA 3MUMP 1HNXF 1DQ9A 1G2EA 1NHHA 1S99A 4XIQA 2AJFE 2XNQA 1ZPVA 2MDAA 2P6TA 4OJ3A 2I9SA 4K59A 4CIOA 1L3UA 3H5YA 2EFPA 5SZTA 3BQ2A 4OI3A 2FD2A 4DV4F 2WI1A 3CCUS 2GIRA 1DQ8A 3MM5A 4Q0BB 1QAJA 1TAQA 3MMCA 4O44B 2M8DB 4CTAA 1FXRA 1A6LA 4ECRA 4DX8H 4PG6A 4Y28C 2JDJA 3DI6B 2BU8A 4G1QA 4R3AA 4ECXA 1ZXMA 3O1LA 1VRTA 3TVYA 1N6QB 3QGIA 5KT4A 2ASYA 4I6YA 5GAEU 4AL6A 1A7GE 1X5SA 5I42B 2CDQA 2GX8A 3I55S 1P9QC 2BQUA 7FD1A 4DLGA 2UUWA 2V9KA 5CZXA 1NO8A 1BC6A 3D0GE 1I1GA 1PGZA 2WHOA 2ATLA 1KIJA 4V19J 4PG8A 2XZWA 4EEHA 1VQOS 3DMJB 2R7VA 3DHXA 2HIQA 4ATNA 3JTPA 3HFKA 4U6PA 1SUQA 1VQLS 1QAXA 5K5MA 1ZM4A 3W7BA 1Y5IB 4B17A 4IOAQ 3SDEA 2XMMA 3SSQA 1K0TA 3FVYA 2YGAA 4I2PA 2JZ5A 1NB7A 2YEGA 1I59A 2KFYA 4NA3A 3NWGA 3U67A 3K5LA 4E01A 1MROB 3G6YA 3GFZA 3JTNA 1N5QA 2D3OR 1U4BA 1M1KT 3M6WA 3ONQA 4OI0A 3OTOF 2ESAA 1FRHA 3MEDA 4I5SA 4BIUA 2MQMA 4OHVA 1M5HA 4O4GB 1BQMB 3B78A 5KOWA 1UA1A 2EFQA 4ASFA 3H5SA 4NYOA 3Q2TC 1HYSA 4JI4F 2GQPA 2KHCA 2ZH2A 4UROA 3QAEA 5B0AA 1ELOA 3CO9A 3C46A 1M5KC 1HWLA 3P96A 3SSRA 5IXUA 4USIA 3H80A 3VHAA 1THNA 1LWEA 5E3PA 4QWCA 2AD9A 4X4TA 3A0XA 2DGTA 1M5PC 5GAHU 1ID0A 2MYFA 4FYDA 1Z5AA 1HA1A 5LMNF 2R4FA 4HVZA 5C24A 4F26A 3BDEA 3QAUA 2DNMA 1DTQA 1CC8A 1UMJA 4NA2A 3CC2S 2UP1A 2WONB 4NZ6A 4RW8A 2O5DA 3MEEB 4FZVA 4DL5A 1AH6A 3NP5A 5KFXA 4G3IA 3HHLA 2RU3A 3O44A 3BB5A 3GV8B 4IYQA 2E5IA 3DM2B 1LW2A 3HDSA 4FBTA 4CE2A 1S1XA 5E33A 5FIIA 1ZBTA 4Y3CA 1IXKA 1FXDA 4DR6F 3HVTB 3PW7A 3EHJA 3IXQA 4ZCIA 3FT5A 4F67A 5KT3A 4B9NA 3UPFA 1JKHB 4HYPA 2ZOGA 1OSCA 2V2KA 4GO5X 4XCJA 4QJVA 4L94A 5M4PA 3GG0A 3TUJC 5K14A 3TARA 3T5KA 4B9SA 4RW6A 1UVNA 1V3SA 4XAKA 4XKAA 3CMES 4H85A 2M88A 2F9JA 3PJXA 1Y3JA 2XI3A 3SCLE 1NEEA 5KFRA 3UDLA 5FJ4A 1MU5A 4LWFA 1JWWA 3TW0A 4YOEA 1FERA 2UXDF 4LF5F 2N82B 3LP1B 5HROB 2FUG9 2XG8A 5G0RA 1JJHA 4WKYA 3KLFA 2E29A 2E9ZA 1X0FA 1XNRF 5G4DA 5KG7A 1F60B 2ZVSA 4X62F 3G6ES 4RX6A 1FTRA 4X2BA