3PEJA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of macbecin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
258
structure length
258
Chain Sequence
ESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of Macbecin
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Chaperone
molecule keywords Endoplasmin homolog
total genus 75
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pejA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pejA01
3GIGB 3LPSA 4U7NA 4LP0A 1TIDA 2E0AA 3H4LA 2XD6A 2WI7A 4EFTA 4EGHA 3WQ9A 1U2OA 4GCZA 2YGFA 1S14A 1Y4SA 4GQTA 3R4PA 5CTYA 4R3AA 4O04A 4R1FA 2YKCA 3VHAA 1UYEA 4CWSA 2VCIA 2CCUA 2YEJA 4U7OA 2YE5A 4NH9A 2BU5A 4LWHA 3DGEA 2YGEA 3O6OA 3LNUA 2YEIA 2ZDXA 5BODA 3A0XA 4BQGA 2WEPA 3MNRP 3K60A 2HCHA 4B7PA 1BYQA 3A0TA 2CG9A 4FPPA 2XDSA 5J71A 2Q8FA 1QY8A 4U93A 5FWKA 2WI3A 3EHFA 2BYHA 3EHJA 2YE4A 2QG2A 1BGQA 2ESAA 3HZ1A 3KE6A 4XKOA 2EXLA 1AH6A 4LWIA 3QTFA 4EM7A 4PU9A 4XE2A 1B62A 3HYYA 2YECA 1ID0A 4MPEA 1TILA 3FT5A 4PRXA 1NHHA 4MP7A 5C93A 4L91A 1A4HA 3A0WA 1YC1A 5D7RA 4CWQA 3B25A 4XDMA 4AWPA 2YKJA 2XX2A 2CGFA 3ZXQA 3FT8A 3T10A 2GQPA 3TZ0A 2Q8GA 4BIUA 4V25A 4EGIA 1UY7A 5CTXA 1YT0A 4BXIA 1TC6A 3EHHA 2QFOA 2O1VA 2YE8A 4HXWA 2WERA 1Z5CA 3O0IA 4QPKA 2HKJA 3B27A 3D0BA 2H8MA 4WUCA 5M4NA 4WUDA 4LWGA 4YKUA 5FNFA 4ZVIA 2XCMA 3OPDA 1ZWHA 2XDUA 4KFGA 1GKXA 4GGLA 4H85A 4XKKA 1UYIA 2Q8HA 2ZDYA 1YESA 1GJVA 3Q5JA 3Q5LA 2XX5A 4JAUA 1TBWA 4HYMA 2VWCA 4O0BA 2ZBKB 2XJJA 3CGYA 1YSZA 4E01A 5M4KA 2XHTA 4LPBA 1YETA 1QYEA 2WI4A 2CH4A 3EHGA 4LWEA 1Y4UA 3T0HA 2FYPA 5M4MA 4KQVA 1Y8PA 4P7AA 1KIJA 4KP4A 2HG1A 4YKTA 1Y8OA 1UY9A 2BYIA 2YE3A 3ZXOA 5D7CA 3G7EA 2QG0A 2XABA 5F3KA 2WEQA 4WUBA 2BREA 4XIQA 2BRCA 2IWXA 1UYLA 4KSHA 2CCTA 3D36A 4XCLA 5CF0A 4XCJA 4FCRA 4MPNA 2BSMA 3T2SA 4CWRA 3RLRA 1KZNA 5IN9A 5GGZA 3GIGA 3OWBA 3B28A 2Q2EB 2YEGA 3QDDA 4QPJA 2BZ5A 3R4OA 1UYGA 2Q8IA 4HXZA 2YEEA 4I5SA 4L8ZA 2ZKJA 1B63A 3NMQA 4W7TA 3INXA 3G7BA 3IEDA 1EA6A 2XHRA 4CE1A 2QF6A 2BT0A 4FMTA 2WI5A 2YKIA 4H81A 4GT8A 3CGZA 4V26A 4K4OA 1R62A 3A0RA 4YKWA 2YE7A 5FNCA 1GKZA 4FCPA 1PVGA 3JZ3A 4P8OA 2JKIA 1U0ZA 3R91A 2UWDA 4H7QA 3B24A 3GIEA 4CWTA 1YT1A 5D6PA 3PEHA 2YEHA 2YE9A 1NHJA 4B6CA 1H7SA 5IDJA 4DUHA 4LWFA 5BOCA 4ASAA 4DZYA 4BIZA 1TC0A 2YI7A 4CWOA 2IOQA 1Z59A 3WHAA 4ASBA 3C11A 1UYMA 3T0ZA 4I3HA 4JASA 3HHUA 4FCQA 3GIFA 4XC0A 4R3MA 3PEJA 5M4PA 3HZ5A 1I5CA 3O2FA 2YKEA 5CPHA 4CWFA 3VADA 3VHCA 3CRLA 3K98A 1I59A 1US7A 3G75A 2O1UA 2K5BA 4HY1A 2CCSA 4MBCA 2FXSA 4MOTA 1I5DA 5CTWA 4KSGA 3TZ4A 2VCJA 2XDXA 1BKNA 3OMUA 4AS9A 1THNA 1I5AA 4L90A 2XDKA 5IDMA 1JM6A 1YC4A 4URNA 2YI6A 2GFDA 5FNDA 3RLPA 1I5BA 1Z5BA 4X9LA 1YT2A 3OW6A 2YEAA 4PRVA 4ASFA 4CWPA 3RKZA 4AWOA 2IOPA 5D7DA 4URMA 2YI0A 2XJGA 5L3JA 1TH8A 4PL9A 1Y8NA 1Z5AA 1S16A 4XIRA 3FV5A 3H80A 4BQJA 2VW5A 4KTNA 4ASGA 3TZ5A 4O09A 4URLA 2FWYA 3HYZA 3A0ZA 2WI2A 3D2RA 4E02A 4XIPA 1MU5A 2YE6A 3R4MA 4NH8A 4CWNA 4EMVA 2YEFA 1UYCA 1UYFA 2IORA 3K97A 3SL2A 5F5RA 2BU7A 4HY6A 2FWZA 2H55A 1UY6A 3EKOA 5M4EA 3RLQA 4YKRA 4HZ0A 2BU2A 2WI6A 3ZM7A 2XK2A 3TZ2A 1UY8A 1B3QA 4JQLA 3A0YA 4E00A 1UYHA 4XD8A 1ZXNA 1YERA 2WI1A 4GEEA 4YKQA 1UYKA 2YJWA 5J6AA 4HYPA 5M4HA 4YKXA 2YJXA 2BU8A 3C0EA 3INWA 4NH7A 4XKAA 3TTZA 4XTJA 2YGAA 1YSRA 1YS3A 2IWSA 5D6QA 2AKPA 2O1WA 4O05A 4EGKA 4Q20A 3BMYA 3BM9A 2C2AA 4MB9A 3U67A 2YK9A 2YI5A 2YK2A 3EKRA 4L94A 2XJXA 1L0OA 4JAVA 3TUHA 2BU6A 3Q5KA 5CTUA 3R4NA 4MP2A 2XHXA 3U2DA 1I58A 3OWDA 1AH8A 4UROA 4O07A 3T1KA 4CE3A 3U2KA 4BAEA 1YC3A 4YKYA 3ZKDA 1ZXMA 4MPCA 3CWVA 2IWUA 4HZ5A 2PNRA 1BXDA 1EI1A 4XITA 1ZW9A 1QZRA 2YEBA 4ZKIA 2JJCA 3CRKA 3ZKBA 2YE2A 3K99A 1MX0A 3B26A 2XDLA 2YKBA 4CE2A 2BTZA 1NHIA 2YEDA 4L93A 4GFNA 1OSFA 1AMWA 3VHDA 3R92A 4EFUA 1AM1A 4YKZA 3HEKA 4EEHA 4AWQA 1H7UA 1AJ6A 2XX4A 1UYDA
chains in the Genus database with same CATH superfamily
3MD1A 1N48A 4ES2A 4B3OB 2GNKA 2JLEA 2AQ4A 3WQ9A 2OPRB 4HI2A 3CJSA 4RU2A 2PGCA 1T9XA 2OAUA 2CNKB 1OO0B 5KFGA 1EZZB 4F02A 2DCUB 2FJBB 1HMVA 4OYMA 4R8UA 3HKWA 3HFVA 5I42A 3IBFB 2YKNB 1KOHA 3HHLB 1BYQA 1YJUA 3BREA 2W2QP 4QIEA 2XLJA 1LKZA 2XCAA 5DS7A 2CQ3A 1FF2A 3KG1A 3CT9A 4OZ1A 1GXLA 2HLUA 2QG2A 3WIUA 2ESAA 4UW2A 3KE6A 2FC9A 3T9ZA 1DAXA 2EXLA 2VU5A 1F9FA 3OTCA 2HQ3A 1RCXB 1H2TZ 1DJ0A 3BJYA 2QLFB 3D7SB 4M5NA 1NUEA 5E5NA 1UW4A 3MR7A 1I51B 4Z37A 2GVDA 3T10A 4RL1A 2YBVA 3X1LB 3FDSA 3B82A 3TAQA 5CTXA 4BXIA 1UVIA 2E29A 1RI7A 3CJTA 4ZA1A 4CLSA 3O44A 5E0OA 4RWXA 1VQPS 4HKQA 4WTOB 1REVB 4PWWA 1U26A 2B4UA 4DR1J 2DNHA 3AA9A 1DURA 3RW6A 4JAUA 1T02A 2DIUA 4C8NA 1NK0A 1Y4UA 3MWBA 3D3CJ 1TAQA 3VAIA 1C4CA 5IC4B 3FEYB 4NYPA 2BE2A 4XIQA 5GAEU 4R0EA 2RUSA 2VHGA 3VHQA 4EWTA 1JLAB 4C0OC 2LXIA 4I4BA 4IG0A 4FCRA 4KQZA 3QGGA 2MZTA 3AA8A 4WE1B 5C25B 2BANB 3T1YF 2J9EA 4DG1B 2Q79A 1MMDA 1UYGA 2HURA 3MR2A 1OIAA 2CG8A 2W9CA 3A3PB 2ASDA 1H6KX 5LMNJ 3LAMA 3DMJA 3NGDA 1FO1A 5CCLA 4K4VA 4DPWA 1KTQA 1VQ6S 2ACMA 4RW7B 4B9SA 1UWBB 3G9CA 1FEEA 3OFHA 1DQ8A 4WYLA 4RUHA 2Y3YA 3IXQA 1YLXA 1GKZA 5DQIA 3MMCA 5DG9A 4F04B 3R8YA 5HO4A 3SFGA 3CD0A 5KTQA 4JV0A 2DNRA 3TO8A 1UEKA 3PEHA 4OYOA 3RRKA 3DDKA 2H5EA 3E01A 2DO0A 1R27B 4HHUA 3IR5B 3MEEA 1TP7A 5KFBA 2CPYA 3CCZA 3CXCR 1HHTP 4IUFA 2OPQB 1IKXA 3PEJA 1I6JA 2YKEA 4P7TA 1S6PB 3GSDA 4DL7A 3KLHB 1BLUA 4DPTA 1BY9A 4EEYA 2M9KA 3OTBA 1B99A 3HHDA 4L75A 1YK9A 4ANEA 2C2KB 2KXFA 1K9MT 4E8UA 5IS2A 2DGOA 2GVZB 3QFWA 1HBOA 1S6PA 2QE5A 4CWBA 2GGPA 4R5PA 2MEWA 4UF4A 1I1GA 3MMAA 4WP9A 4XDDA 4ZLNA 5BYRA 3IGNA 2M8HA 3GTYX 3HHNB 1RA7A 5F0UA 4A8MP 2E1PA 1FX2A 3M8RA 3I0SB 3GB0A 3NGKA 3HYZA 2Y8WA 2O3DA 2QSWA 3IGVA 1AT1B 1UJ4A 3EGVA 1PBAA 2X3DA 3PVXA 4PQUB 4Y2IA 3OTEA 1FDBA 3ZM7A 2XK2A 4X4VA 1HNVB 2JEGA 3DRXA 2A2DA 2HAFA 2MKSA 4CLFA 2M2BA 3M6UA 4IG3A 2F7VA 5J6AA 4FPRA 3BBBA 3FC9A 5F0WA 2R7XA 1O6XA 2D1CA 2IC3B 1NJYA 2IWSA 1BQMA 3C19A 4FYYB 2ADCA 1U7LA 2V2KA 3U67A 3PR5B 4LF9J 3UD5A 4OMFG 3VGUA 3KK2A 3R4NA 4LREA 1A0OB 4IDKB 2VG6B 3BQ0A 3D6FB 3RAXA 2F4VJ 2PC6A 5CAAA 4CLWA 1X0FA 1V6HA 4FBUA 2JJCA 3Q8SB 1UFKA 1S7IA 1RBLA 2V0NA 2AYGA 4EYIB 2CQ2A 1NBEB 4NASA 1NEEA 3MM6A 1NB7A 3N5BA 2ZBPA 1BWVA 1NKBA 2QMXA 2MY7A 3DNCA 1HYSB 2XD6A 2NXCA 4DF8A 2LA6A 1FCAA 4KPCA 3HVAA 1FHTA 4PPDA 4PKDB 1VHFA 2OH2A 2O5DA 1EIYB 1FJGJ 3SFUA 3HVRA 2ZOMA 1QSSA 2R3VA 3ICLA 1ZAVA 4G3IA 2ZD1A 8RUCA 2VF3A 2HGLA 2GA7A 3FNNA 4O44B 3CO9A 1HR0J 3Q8QB 4K0KF 2ZH3A 1NK4A 3HYYA 2ZBRA 3QRPA 1JLCB 4IRDA 1NHHA 5C93A 2BJ3A 2RILA 4K5SA 3A0WA 5CZXA 3IRXA 2P9GA 3BBCA 3MAHA 2HYIB 3ADAC 4FF2A 4MFBB 8ATCB 1YT0A 2JLFA 3IWNC 1RAAB 2IM3A 3BSCA 4PCQA 2BOAA 3CJ5A 1U2FA 1WOPA 2Z58B 1HHSA 5KFZA 1OSCA 4IFYA 4ZCIA 3HSJA 4RNMA 2QLBB 1D9AA 3MCMA 4DUYJ 4M5KA 2ZH5A 2J6TA 1T3NA 4JI2J 4R0JA 3WDOA 4H85A 2E9TA 3DLGB 4GKKF 1XR5A 2BM1A 1YKWA 3VAGA 2MKIA 5F41A 1XIQA 2ILZA 1UKUA 2D41A 3KLGB 4LT6A 1KS2A 3NMAA 4DZ6A 3BSAA 3EVMA 1G6BA 2B9XA 3CJKB 1UY9A 1MN9A 1V3SA 2NYIA 2VQFJ 2QL5B 4HDHA 1B7FA 3D36A 3OLBA 3V6HA 1H2VZ 3KLGA 2NZCA 5IC6B 4CWRA 1HBUB 3VR1A 3J81j 4LQ9A 2YEGA 1HARA 2IMOA 3SQOP 4O4RA 4L8ZA 1SH3A 1NJWA 1JXEA 1B70B 3INXA 3QT6A 3R5GA 1ZTTA 3VCDA 1RA6A 3FRYA 4RZRA 1B0VA 5EUHA 2N7CA 4FXWA 3BKTA 4LQ3A 1RWPB 3NGTA 2E9ZA 2XZTB 4LBPA 1EKRA 4H7QA 3B24A 3GIEA 4C8MA 1JKHB 4WP8A 4Y00A 3SQGB 2RQ4A 2F1FA 2MHEA 1TC0A 4KYZA 4XTTA 2FYXA 2P9EA 3A3NB 4MAKA 4I2QB 4KE5A 4V19J 3T0ZA 4NXNF 2EKNA 1EKSA 2DD8S 2IM2A 2R7SA 5DRKA 3S1TA 3BO2A 1GMUA 2BQ3A 2CPIA 3HO1A 3PO5A 2A6MA 2DK2A 2K5BA 2GC8A 2J7KA 4I2QA 3QIPB 3KLFA 1S9GA 2ASJA 1IBKF 2ZOFA 1BKNA 1XWLA 5KOXA 1J5OA 4F4KA 1T95A 2C3OA 1APSA 5GADI 3MR5A 1Q0NA 3FBCA 2PFDA 2CNNB 2AT1B 4CYUB 1UVLA 4JI6F 1S9GB 2FB0A 3AFGA 2D9PA 1Y8NA 3GU0A 3N79A 3M9OB 3QO9A 3T1HF 4O09A 3D5MA 3V81A 2DRAA 2B5JB 3A0ZA 3D2RA 1MU5A 2ZH7A 2HEKA 4WU3A 4DL0C 2LU2A 1MW7A 3EPGA 3D28A 2HFUA 3JTOA 2IORA 1VRTB 1RTIA 4IQMA 4Q8EA 1FEHA 4J5OA 5DQGA 3SIPB 3NNCA 2IRXA 4DR3J 5KOWA 1SJFA 2VA2A 4DR2J 2LFVA 4XIUA 1Q79A 1KKHA 3NAIA 3NG8A 3L3CA 1VISA 4C3KA 4DU8A 3IG1B 4CLKA 3FCHA 4J9PA 3F41A 1W25A 3IM8A 4Q20A 5GAHI 2RT3A 3D6TB 1UPMB 3NL0A 3LP2B 4DN9A 4TU8A 3KXDA 2I6WA 3Q5KA 2B8PA 4QIVA 1M5PC 2XHXA 4ECYA 2W2OP 1FWPA 3HX9A 2FZCB 3ZKDA 5KFRA 3ULHA 3AOAA 4GKKJ 4NRUA 2HNYB 3QBCA 2CZ4A 3A8IA 4GO7X 2C2ZB 1EQMA 3NCRA 1Y00A 3I5BA 1WC1A 1FTRA 5CCMA 5KFCA 4CO4A 2AYBA 3L7UA 3IC1A 1U1NA 1WG1A 2EFOA 4U9RA 3M9NB 3P4UB 1TKTA 2PMHA 2OEJA 2FY8A 1O8BA 2U2FA 4KFBA 2KG0A 4XK8C 3P6YC 2BJDA 1XR7A 2FJDB 3K8WA 5FWKA 4PG6A 1C0TA 3EHFA 1FWLA 2VV5A 2O66A 4IG0B 4YHHF 2V4JA 1C1BA 1BQXA 3ET6A 3QGHA 3G8TA 4MPEA 3BGFA 5B7WA 3FEZA 2HWTA 2DXFA 4CWQA 2E1RA 1GMWA 2XX2A 2BEFA 1FRIA 5K8PA 5HBMB 3FT8A 1MLAA 4GC6A 4AFFA 1PJ5A 3PJWA 2CNLB 3KFWX 3HM9A 5DDQC 2CPJA 3FZBA 1Z5CA 4C48A 3HVTA 3SCLE 2KN4A 1RK8A 2BBEA 5E33A 5M4NA 1T03B 4WF9Q 5SUHA 2PO4A 3NBPA 2MQ8A 3E3XA 1WDDA 4DLEA 1M1HA 3N0VA 2Y0BB 4OZ5A 1PG5B 2IAJA 4YB1P 3QSIA 3MMAB 2IRUA 1EAYC 3UQSA 1VBZA 5IOLA 2DPJA 1GQEA 4H4OA 5AE3A 3ZXOA 1S6QB 2VL1A 3LH2S 2NQPA 4Y6IA 1X9SA 2YTCA 1TK0A 4OYXA 2XYHB 3OT9A 1IKWA 2NCKL 4HHHA 3BGLA 4XPEA 3ENWA 1PILA 5IN9A 1SC3B 3DOMA 1SJRA 4ED5A 2NZ4A 5H9EJ 3GV7B 3SCKE 4HXZA 4KSEB 3EJMA 3CSKA 2DKOB 1KRPA 1S1UB 2WTFA 3LO3A 1QTMA 1JNRB 2I2YA 5T7LB 4O4GB 3B78A 1TL5A 3UNGC 3E8OA 2QL9B 2LQ8A 1C1CA 4TY8B 4DV5F 2G0JA 2NS1B 2ERRA 2MKKA 3DRSA 3NY0A 4CNYA 2J8SA 3QO9B 3DRPB 4DFMA 2DO4A 1HNVA 3Q8VA 2Z8QA 2VG6A 4BC9A 3HI9A 1KHWA 1UYMA 4I3HA 4ES1A 2ZKUA 1OSDA 1U45A 3A8JA 3NKYA 3OQ2A 4FCQA 4R3MA 1WORA 2R7RA 5L1IA 3LTOA 2HBYB 3G82B 5HQMA 2ZBIA 3GIRA 3QLHB 1LW2B 5D0HA 3BPDA 4X64J 4EO6A 3NNHA 3M1VB 1O51A 1ACMB 4IRKA 4F26A 2W1BA 4HACA 3HSGA 5CXTA 3EDQB 3EUNA 5IV3A 1MN7A 1C2PA 1NK9A 1SQFA 1GH8A 5KFYA 2FGCA 2L9WA 2UUBF 4PL9A 1RWNB 2HHTA 2J9DE 1EETB 4S0MA 1D09B 3FKBA 2BABA 4J37A 3RR8A 1RT3B 4NH8A 4F2RA 2OLWA 1WELA 3SDEA 2OMLA 2AJ4A 1H0HB 4M5IA 4B3MF 1VDHA 4HH0A 1L5UA 1B7YB 3SL2A 3UDLA 2VFSA 2ROEA 4U7UK 1Q8KA 2PT0A 2PEBA 2WVFA 2BANA 1TELA 3IS9B 2XCPA 2VASA 4HZ0A 2ACYA 1YRTA 2DHXA 2A1BA 4FF4A 2YKMA 3RB0A 3LP1B 2WI1A 3A13A 2GJIA 4N56A 1P27B 3KDOA 4RLEA 4ENOA 2YJXA 2M7SA 2YNIB 3CNQP 1PSDA 3ZTQA 4KO0B 3TYTA 3BM9A 3W66A 2OPSB 1S10A 4MB9A 1NSPA 3LP2A 4ED7A 1JLGA 4YMEA 2XJXA 2QLXA 5L8RC 5HP1B 3M32B 5HANA 4GVBA 2ZJRQ 3JXOA 2AYMA 4PXEA 2RSQA 5AJ3J 2G0IA 1L3TA 4KGVB 2IWUA 1C0TB 1PJ7A 4XITA 4NZ6A 4YN3B 4AYBD 4URQU 2DH8A 3T9NA 4X4SA 3D3BJ 5A76A 2RQMA 2BMBA 2QTWA 2HQIA 3ET6B 2E66A 1OSFA 3QGIA 3VHDA 4Q2MA 4G65A 2XX4A 4RW4A 4RUCA 2C2OB 2CQHA 4U7NA 2QX0A 1WOSA 3O3LA 1DZ5A 3R4PA 1LXJA 1C0UA 3PIOQ 1RYSA 2VG5A 3TX0A 4U7OA 2NXEA 4U8VA 4LWHA 3DGEA 1CJTA 3CJKA 4ECQA 1KVIA 1WC0A 2YX1A 1IKYB 2WVBA 5F8IA 4NLXA 4WFBQ 3NEKA 3FEXB 3MURP 4PEOA 1F9EB 2F8HA 4ZP8A 5F8HA 3ZZYA 2EBGA 2IM0A 4EM7A 2MKYA 4KV8B 4CO5A 1TILA 1ZH5A 3EWGA 1T05B 3G6YA 2V9KA 3AAWB 1M5HA 1A4HA 4ED3A 3B25A 1T9UA 4AWPA 4YR3A 3AT1B 4KGZB 1IKWB 1LOUA 2DGQA 3ZZUA 3KUHA 4QPTA 3EHHA 3FJ2A 3QT7A 1BWEA 4LFCF 1NPRA 5LT5A 3CE8A 5JVGQ 1FVSA 4GRSA 2LEPA 4WUDA 1RT6A 2G13A 3B4DA 1K8AT 3W63A 4ZHRB 1PAUB 4F2SA 2ZC4A 5AXKA 2RB7A 4YB5A 2D3UA 2ZNYA 2VONA 3KK2B 3Q5LA 4K4WA 5CQGA 5CZVA 2V8PA 3LAKA 1P1LA 3GJQB 2K2PA 3GQCA 4ILMA 2FHKA 2HMIA 1H74A 2JOQA 4PR6A 4C97A 1LK7A 1ITPA 2CNOB 3W9HA 4ECTA 2MKCA 4DL2A 2JFKA 4IH5A 1S0OA 1N32F 4KSHA 1JX4A 3DM2A 1R8CA 2C1EB 4ECVA 1FK9B 5F8GA 4P6QA 3D4JA 1HWUA 1M1GA 5GMDA 1KHVA 1XJWB 3MUMP 4JV2A 4F7VA 1GT8A 1S79A 3MM9A 3UCGA 2DGVA 1S1UA 2GAGC 4IO1A 4WFAQ 3C6UB 4JI1J 4H81A 3BR9A 4DV0J 3A0RA 3I82A 3PCOB 4QIFA 2HHPA 3CDUA 1WC5A 1DTQB 3NGUA 3OHBA 4ECSA 2CWKA 2QC3A 3I0RB 2DY9A 4B17A 3M2VA 1IQZA 2AJ2A 2FVSA 1WF2A 3DRPA 4PUOB 1ELOA 2MJUA 4PXDA 4HTIA 4YHHJ 4IOCQ 4QYZJ 4HT7A 2UV8A 5GADU 4DR6F 2VPXB 1QUVA 5HQ8A 3K58A 3RB6A 3OV7A 5IQ6A 2ZZTA 3CC2S 3GIFA 2VFTA 2JWNA 4UUXA 4J7CA 1F2HA 3NS5A 3TP2A 3D6MB 1VI7A 5FD1A 1U6FA 4HEA9 4HR2A 4QR0A 2HQGA 5HATA 1NRKA 1GX6A 1Y7PA 2Z56B 2GVDB 2R42A 3EGWB 3NGRA 2CG4A 3I5CA 1BC6A 3N6NA 2YNIA 2YI6A 2DNMA 4FXVA 4JV5F 2MGZA 1Z5BA 1YT2A 3OW6A 2YEAA 4L3KA 1R31A 3BGOP 4ZN3A 4JI1F 4ZDNA 3EGNA 2KYZA 1KC8T 2WI2A 2VG7B 2KJVA 4KFBB 4OX7A 1HL6A 1NAQA 2MGZB 1WUUA 1F3FA 1GTHA 2BU7A 1JK9B 3S01A 4H4KC 3MAAB 3CIZA 4I1TA 2F5GA 1NB2A 1CS4A 5IT9U 1F6TA 2F9DA 2V4RA 3GV8B 1ZXNA 4FYVB 3M4XA 4OFZA 2F4FA 4YEAA 2CUYA 3UE2A 3CDWA 2VBWA 5KT7A 2DHAA 3INWA 1X4BA 3WBZA 2OKQA 2RQCA 1OPZA 4NA1A 4NRTA 3R9LA 2OPSA 4DFKA 2CZVC 3L7PA 1VQ7S 3BH7B 2XM3A 5RUBA 3HHLA 3ILOA 3BSOA 1KTVA 4Z2XA 3ITHB 1PYTA 4EYHB 3UN5A 3CWVA 1JLEA 1MG7A 1IBLF 3H7HB 2UUTA 3MCOA 3W65A 3KMSA 4E0DA 4TLRA 2JNJA 2R8JA 5G0RB 4OJ1A 1OYDA 3D67A 1T05A 5DDOC 5K8MA 3HD2A 4L72B 4EFUA 3DGVA 3OUYA 1GXTA 3NS6A 3PY8A 1HBMB 1C4AA 1IJEB 4GCZA 2WONA 4K4YA 4Q0BA 1DRZA 2ATLA 3TW0A 5DZ6A 1UYEA 4X84A 2BJ1A 3HHEA 2XMAA 4WWSA 1F5CA 4WIQA 1TUGB 3LWMA 4ZLJA 3V81B 2DPIA 3KLIA 3OTDA 5EX0A 1IKVB 2GHWA 1KLMB 3I9ZA 1C1CB 4TY8A 4YB7A 2DBBA 1TFWA 4ZVOB 1CJUB 3HKZD 3HD1A 1ID0A 3LQVA 1QLNA 1JLQA 3TX8A 2FVPA 4O3SA 1N52B 3K89A 2B4VA 3I55S 2MZ1A 3N6MA 2HIYA 3MZIA 2Q8GA 3KUGA 3VVTA 4NCBA 2C3YA 4RUAA 2RH3A 4B3OA 4HXWA 2XTJP 2MLXA 2ZH8A 3CCLS 1YHQS 1V5IB 4RNHA 4XAKA 3CWJA 2R9LA 4LSZB 2WRMA 3W8PA 1N33J 3H2LA 2AJFE 2CPZA 4J9SA 2K1RB 3KLVA 4HYMA 1FI4A 4DSKA 1RT1B 3MECB 4LSLB 4JV1A 4KQVA 1NMEB 2V6AA 4F3QA 3JSBA 1RAJA 4Y28C 3RU0A 1BQNA 5H1SV 4ID5B 3PYEA 4AQYJ 3KMQA 2FIUA 3DOKB 2B9YA 1CVJA 2PSZA 2IBOA 5B08A 5J1PA 2LLZA 3NRBA 5KT3A 4XCJA 4MPNA 3KLHA 3R7NB 1MSWD 3G6XA 2XY7A 3GIGA 4LRDA 3OWBA 4WK1A 2Q2EB 3P3DA 2V8VA 3W5XA 3O1LA 1ZA1B 3R4OA 1VQ4S 1Q8BA 1JLBA 3OL9A 4P74A 1N6QA 2KKHA 4FMTA 4DR5F 2JC1A 4NEYA 4U7UD 3QWUA 2YE7A 2ZH6A 3RJMB 5KFWA 3TR5A 1QDUB 4A8YA 3GG1A 4C8OA 4M8LA 1VRUB 3MI7X 4M5DB 2W8KA 1YTYA 5FJ4A 3BKUA 3IO1A 5IT0A 2E1AA 1RT2A 1LWCA 4ER8A 5J2QB 3BPSP 3AXKA 4A4JA 1URRA 2CQ1A 1CQMA 4AL7A 1SQEA 4KC5A 3C3LA 2XY5A 3MAAA 3FMWA 4PYDA 3G75A 1JLCA 2VB6A 2OJ3A 3PW5A 3W1YC 1KQGB 2ZDPA 1U0SA 2XDXA 1HQUA 4G1PA 4IQXA 4WTYA 3KJNB 2OTLS 1SL0A 4RBVA 1NZAA 3IAM9 3MTJA 2OMOA 3GFYA 4ZVQB 3TRGA 2GFDA 1URNA 5AE2A 3RLPA 4UUWA 4NMXA 1VMBA 4N77A 4O3OA 2JSXA 3WZ0A 2VQFF 5HVFA 2BOPA 1IWGA 5KFFA 4G1QB 2BQUA 3PW2A 4ASGA 2H9ZA 4B08A 2LP4A 2FLPA 3ITHA 5B0FA 1RU2A 4USMA 3OXFA 3CEDA 2HW3A 2MDAA 4YOEA 4DR1F 4ANDA 4JI7J 1VBKA 1HIYA 5G0RA 3MM6B 1JXLA 1KD1T 5BJRA 3MM8A 3HXMA 2RQKA 3A0YA 2MLZA 1FJCA 4P2SA 4RW6B 4GEEA 2H48B 3FBBA 3VAMA 3SSQA 2DR8A 4RBTA 1CJTB 4LF8F 2EFNA 2E5HA 2L48A 1CQNA 1HWKA 3BMYA 4I2PA 1SH2A 4LBIA 4DV0F 1OQ3A 2EPIA 3K5PA 2ZH9A 1VC6A 3TA0A 4DQRA 2E1MC 1X5OA 3TOQA 1RAHB 5A8RB 2Z2LA 3ZZZA 3NWGA 1Z2LA 1ZAXA 4O07A 3LANA 3IMQJ 1N4LA 3MOZA 3GIJA 1ZTWA 4O3RA 3TZYA 2YH1A 1ZXMA 4AD6A 3PHEA 1NU4A 4C11B 4X4NA 2A0FB 2YEBA 2N3OA 2BRKA 3B26A 2YKBA 3KTQA 2AWZA 2R8HA 4DUZJ 4OX6A 5L39A 3MPDA 3NMRA 2J0WA 4Y3CA 1WHWA 2ZDOA 5BR8J 5CHCB 3HF5A 1N54B 5D4PA 3M9MB 1LXNA 4DUYF 3MPWA 1AJ6A 2KT5A 4USKA 2Y8YA 1UYDA 3AHPA 2GS8A 4OHWA 1HNXJ 2WB1D 4M5LA 1HBMA 5L9XA 2YGFA 2F40A 4A8QA 2BE9B 3W9IA 3LOUA 4OX8A 4RPFA 4ZJLA 3D1HA 4R3AA 5DQHA 2BA9A 4CWSA 3GP9A 1RHJB 1U47A 3D68A 5KFOA 5D78A 4OI4A 3SMZA 5LMNF 1QSLA 4ELVA 1NPPA 5J71A 4QOTA 3QJPA 2FJAB 1KLMA 1VJWA 3DFEA 5KFQA 1EQ0A 1G2EA 3MEDB 4DR3F 5J1EA 1S99A 4QU7A 1TFYA 3KWMA 3J7AN 3R2DJ 4PU9A 5LM7E 3ZZPA 6AT1B 2KFZA 3T5HA 4LF5F 3H4DA 4JI5F 3MPUB 2MMYA 1KQSR 1LEOA 2CZ9A 4P73A 3M2UA 3AOBA 1XMQJ 5KFKA 4DV3F 4V25A 3LP1A 5J1NA 3HDSA 1FRLA 1QE1B 3RRGA 3BDEA 2YE8A 1VJQA 1K1SA 2CVEA 3MTKA 2UU9J 4UOHA 2CIMA 1TMMA 4OYZA 2V50A 2GZOA 4GGLA 1NH8A 2EFPA 2Q8HA 1N36J 3S7RA 1FE0A 1YJNS 3R3TA 2UUBJ 1RGVA 3Q89A 2XJJA 1H38A 1S1TA 2HIQA 4OQJA 3O2IA 1S1WB 2HK3A 2ZHOA 5DDRC 3CF5Q 3T0HA 1WEYA 2DNNA 2MPUA 2V63A 3OSNA 1WG5A 1VLYA 4B3MJ 2Z30B 3KJVA 3K7RA 2BM0A 1NXIA 2XNRA 2XSJA 4LRCA 5CF0A 3TARA 2C1GA 3POTA 4A8FA 3QPIA 3TUZC 1WC4A 3G8QA 3PFOA 2P5VA 3V4IB 3CC4S 5K14A 2C22A 3NOGA 1UVNA 2UUAF 2LQ9A 4CO3A 4TU9A 1MU2B 2DNQA 4RW9A 3TJ8A 2Q8IA 3M30B 3RGIA 4DZDA 1C0UB 1OMSA 3PZPA 4DR4J 1HWIA 1KVJA 2VDIA 4OI0A 5MLCV 3QMQA 3V4IA 4MT1A 2WI5A 2FDNA 4ZIVA 5L1KA 5L1JA 1S9FA 1LFPA 4DFPA 2XMVA 3KK3A 4CO1A 2DHSA 2N82B 4LF8J 3FFIB 3EDRB 2JKIA 3H5XA 2HG4A 3EYZA 4CWTA 1HW9A 1H7XA 2DY1A 4B6CA 1TKTB 4F8RA 2KI2A 5BOCA 1SIZA 4CWOA 2HWHA 3DLJA 4F3MA 2I9SA 1NK6A 1DTTB 1RCOB 2AJ1A 1X4CA 2VFRA 3H42A 3C11A 1YRXA 4FYXB 1CS4B 1WTFA 1RTIB 3FVYA 3HHUA 4A8SA 2KO1A 4X4OA 4U96A 4C7QA 3AODA 2R7WA 3CRLA 3EXCX 4FDFA 3KHGA 1CBKA 1VS3A 2CCSA 4NLUA 1XMOF 5ETKA 3ZTRA 1RT4A 1HQUB 1JQGA 3HMJG 1K0VA 2DH7A 3DKDA 4WK3A 4O3PA 1MMNA 2BZ2A 3PRVA 4QWDA 2XGPA 2A18A 4RBUA 3RYLA 3UR3C 1N0VC 1HNXF 2H5JB 5KFUA 2EWHA 1CLFA 3EM1A 1TL1B 5KFAA 5GAGI 1TK8A 4DV3J 3DRRA 2XJGA 3L7OA 1T03A 4FXDA 3DOLB 2APOA 2VW5A 2MHNA 5HL7Q 4L73A 5CD4H 1UCNA 1VK8A 2W4PA 4XIPA 3R4MA 3MM5A 1UL3A 3TWZA 3G96A 2ZH2A 1U1OA 3OUYB 1NPKA 4CLUA 3UCZP 1U49A 2FWZA 3IR6B 1RLDA 4CO0A 5HROA 1NO8A 1U8WA 2RUGA 4Q2LA 4NZ0A 3T1AA 2XYGB 3RBEA 2ZNZA 4PG5A 1BGXT 1UYHA 2DYAA 4B9UA 1G4CA 1YERA 4ZPWR 5B0CA 4YKQA 1L3UA 2NXNA 2HVIA 1T9WA 3JSRA 2F9JA 2OFHX 1UFLA 4XKAA 2D7SA 3ENAA 3M8YA 3ZTOA 3R5AA 2QL7B 5D6QA 3DDIA 1REVA 4DWIA 1CC8A 3T6JA 2MQMA 1I94F 4CYUA 2P8IA 2R8IA 4TY9A 5DDPC 3K8VA 4O4GA 4D3HA 1PC5A 1Q82T 4ICLA 3ZTPA 4UOCA 1ZW9A 3K99A 3ILLA 2E44A 1GNKA 4PYAA 3UVJA 4OV1A 4LFBF 1TL4A 4QBUA 3VGVA 1NHIA 4A8OA 1Y0HA 3J7A1 4EO8A 1ZPVA 5HBMA 2NUHA 2AU0A 3K5LA 5CD4A 3DLKB 3VQTA 1TIDA 2E0AA 2RAQA 4DV4F 4OLPA 4WBFA 4DX5A 3CJRA 3JSMA 2YXLA 2ZHAA 1YBUA 4ZCMA 4EK2A 2A10A 2X1AA 2WSEC 2YKCA 3J7Z5 3VHAA 3PKYA 1L3VA 4ZPCA 2YEJA 2L9NA 3MECA 2RDJA 5DG8A 3O6OA 3S8SA 4Q8FA 2M52A 3BEGB 2B0GA 4RW8B 2DEIA 4X62F 1XMBA 2IAJB 1BUXA 4CI0B 2JC0A 1QY8A 2KRBA 1WACA 2CQBA 4OJGA 1TU0B 2BW2A 1AZSB 2BYHA 3CCES 1SI9A 4ZVSB 3HZEA 1AH6A 1RZMA 3PNIA 1ZYQA 2OEKA 2YECA 2CJQA 3D9BA 1IXKA 2BRLA 3PDNA 2GIFA 4MP7A 4USWA 3CVKA 3R1HA 2AYEA 2CYYA 2DGTA 4A46A 3UPFA 4JI6J 4UQGA 4NXNJ 2N7YA 1P6TA 4ZVTB 1FJ7A 2WBMA 3FCVA 3M30A 2KVQE 2KYXA 4KGXB 2PN6A 2YWHA 2HBRB 3V6DA 2HHQA 1HBOB 2A6OA 2ROGA 3GSIA 2DGXA 4NYZA 1TBWA 2AEFA 5GAHU 4O0BA 4E01A 2CH4A 2EG2A 5T41A 4X65F 5A8WA 2V2QA 4LF4J 2RDIA 3R6LB 5DGBA 2LKZA 3DCAA 1KVKA 2GJ2A 4J9MA 3CGIA 3MD3A 3MMJA 2G2YA 1R0AB 3BR8A 4Z7CA 3C2PA 2D3O1 3DLLQ 1DARA 5D8HB 1EARA 1B0PA 5E2QA 4ED1A 2WB4A 5AXMA 5CA5A 2XMUA 3PX6A 1RAOA 5AJ3F 4WZQA 3MM8B 1R8BA 5IFMA 4FKXA 1TL3A 4MTPA 1VC5A 4EMDA 1Q5YA 1UWAA 1H73A 5BYSA 3ZZOA 2V2ZA 3LWLA 2FGOA 4GT8A 2V67A 2ZUAA 3TNVA 4K50A 2AZ3A 1T7PA 4W92B 1N0UA 4KHRA 3F0NA 2H65B 4Q5VA 4OZJA 5CYMB 3R91A 5IM0A 2UXCF 1Y3KA 1NKCA 2LQ5A 4B02A 1CJKA 2XI2A 3I6PA 4QZVB 5KFVA 2J7UA 1Z59A 2JLGA 4X4UA 4OLOA 1VOMA 3KOAA 1VIXA 3RAMA 3RG6A 5D4LA 3BZQA 5HROB 3VHCA 5C42A 4F0MA 4Y2AA 1XERA 1RWVB 5D3GB 2VQEF 1AYEA 3QT5A 1WG4A 5T7LA 2MKJA 1HA1A 2VFVA 2OSRA 1SBRA 2FVCA 4CWPA 1M0SA 1FFWB 3RUBL 2MLYA 2RHQB 1RBAA 1U2CA 2CXEA 2BW7A 1ZOTA 3TZXA 3TVYA 2E5IA 1SKUB 1Q7LB 4ICLB 1WWHA 3DU5A 3V6JA 2OPPB 3ZFVA 3K97A 2DNYA 6FDRA 1SUQA 5F3TA 3CUNA 2BU2A 4KKOB 4RO0A 1VHIA 4TVAB 1UPPA 5KFPA 4MKYA 2UUAJ 4RNFA 5A0YA 4J9KA 2RD5C 3LA0A 4YKXA 2M3DA 3GE9A 3JSMB 1IR2A 4OZ2A 4UT4A 3HFZB 1RKJA 2J76E 1KFSA 3WQPA 4O05A 4Y2CA 5LSLA 5ETSA 4DL5A 1R6YA 2OO4A 4NLYA 4N8OA 5J2PB 4WFZA 4NLVA 1TL7A 4CE3A 4R5PB 3ZZRA 4YKYA 2RMLA 1U1QA 1WSVA 5FDLB 1BXDA 2JX2A 5M2RA 5DGAA 1S6OA 3HLUA 3GJTB 1SJ1A 5L1LA 4N7TA 2C42A 5M2UA 3H59A 4WJBA 1O0PA 5IQQA 4K7QA 5IV4A 5ETRA 3AD8C 2I8EA 4AL5A 1JJ4A 3QRRA 4DF4A 1LK5A 2JZ5A 2DEJA 4LF6J 1QSYA 3POTB 1EP4A 1TKZA 1T9YA 5ETTA 1VQMS 5CH7B 4JV5J 4EFTA 1Z4UA 1VYAA 3PIPQ 4UY8T 2LDIA 2L41A 1T9VA 5T14A 2VUGA 3PW4A 2YE5A 1HMVB 4U7CA 3OR2A 3I56S 2Q6CA 2J6SA 4CTAB 1UVKA 1XC9A 1HHQA 3I9V9 2WI3A 2XSJB 5HI7A 2ZWPA 4YS2A 3EHJA 2YE4A 2FJEB 2D69A 4U67Q 5LXRA 4CT8A 3OR2B 2DNLA 2ZITA 4F50A 3QTFA 4C2MA 3H2UB 1J27A 3QATA 2RE1A 4PRXA 4ZP6A 4O0NA 2VG7A 4HACB 1WNEA 2GW8A 3ENVA 2WVDA 1U02A 1UZDA 4PG8A 4ECRA 1UY7A 3HFKA 2N4DA 3H5SA 3TI0A 1FRHA 2G2OA 2NSCA 2IM1A 3AQOA 2WERA 2VBYA 1W2IA 2QA1A 3AJDA 3DYAB 4NZ7A 2FVRA 1ZM2A 2RS2A 4LWGA 1XK8A 2UUCF 1Y4ZB 3V6DB 4ZVIA 4R8UB 2YNGB 4J9VA 3THTA 1NJXA 4G6VB 1VQYA 1NKEA 1YJVA 5HJXA 1NK5A 2W8LA 2ZDYA 1ZZFA 3IA0A 1NDKA 1FA0A 2LEAA 3CCTA 2HHWA 2ZBKB 4ILRA 1XEZA 3QZ7A 4KJIA 1S97A 4LWEA 3M2VB 4A8XA 3ZZTA 4J90A 5IM0B 4I67A 2YNGA 5CYJA 1KIJA 3D6HB 1J5EF 2BYIA 2J0SD 5ETOA 3W64A 4ZLLA 4KRWA 2JHEA 2BRCA 2IWXA 4PQAA 3UWTA 2HS0A 4E2FB 5KT6A 5KFHA 2KZZA 2LYVA 2EI5A 4BCAA 2DNPA 1I3OB 2RRAA 4FS1A 1R43A 3TZWA 1Q7YT 3AH6A 2KT2A 4M5MA 3R1LA 3G7BA 2YNHB 2V5HG 3QJLA 3SCJE 3DOLA 5BYQA 4OHYA 3BO4A 2CRLA 3HP6A 4WFXA 2M4MA 2XLKA 1I5OB 1X31C 3I96A 1KLNA 3MMCB 1KQFB 4P72A 3W2WA 1YG0A 4NYOA 3UO0A 3JB9k 4ASAA 4FPIA 4IR1A 5CYQB 1PJ6A 2IOQA 5AXNA 4LR9A 3WHAA 5D15A 3DN9A 2CQIA 3C8YA 1K44A 3D66A 3Q2SC 1NM2A 4JASA 5IT9Y 3R97A 1T8EA 4P9SA 1SUQB 3W8GA 2BV3A 1FFGB 4DCOB 2RU9A 3SV3A 3JAMY 1N32J 4HH1A 4DFJA 4JYAJ 2AEMA 1SVDA 4BS2A 3QZ8A 2HVEA 1RACB 3VTIA 4B3RF 1Q95G 2M8DB 3C14A 1G1XA 2KRRA 3KNAA 5D0GA 2GGPB 4DCPB 4URNA 4X4QA 4ZVRB 3IBWA 1UJ6A 1VQSA 2MZJA 2HHXA 2XBPA 3RKZA 4URMA 3FUYA 2FTRA 3SBMA 4P52A 4QR1A 1ZZNA 4FF1A 2JEIA 2BVZA 3PYFA 2E5GA 1ULRA 3GPAA 1V9OA 4MKBA 1JLEB 1Q1KA 2KL8A 2QN6B 3NAHA 2BJEA 4CWNA 4OJHA 1D0EA 2ASYA 1WC6A 1AZSA 1XNQF 2FD2A 1RKIA 5A6WA 1U24A 3MPYA 2IVFB 1GMVA 4ZIWA 1TUVA 4K5RA 1PAEX 2AX1A 5D0RA 4LF7F 2KT3A 2MZSA 3M8QA 4LBHA 1AB8A 4FYDA 3Q2TC 3QFHA 4CO2A 1X0PA 1HNZJ 4H4MA 2XLIA 1EX8A 3HCXA 5KFTA 5GMKa 5FLXY 3G6VA 1N8RT 4K8RA 4ZKAA 1XNRJ 4JAVA 3TUHA 1TQLA 4DV6F 1LNQA 4MP2A 4HDGA 2CQ0A 1TL7B 2BR0A 1PKUA 2XHWA 2R2UA 5KFJA 3U2KA 2O1PA 3JAMU 1AUDA 1XBWA 5KFEA 2J9DA 2LXUA 4FYWB 5F8LA 3M2RA 2XWYA 3CCJS 4LFAF 2YKAA 1D3WA 5DO2A 4TNOA 1ZA2B 1R8AA 4NXMF 3J7YU 4DL3A 2CJ9A 4DSEA 1AMWA 3C6TA 2OFGX 2AZ1A 4LMZA 5J2QA 4ZVHA 4B9NA 3ISND 3H4LA 2AP6A 2K3IA 3H0PA 1LQ9A 3LGNA 2ZE2B 1MWZA 2JDJA 2VJVA 1PO6A 1F3VA 2DR6A 3Q22A 1IBMF 1NHUA 5EN1A 2G4BA 2AIRB 2L3MA 2HBQB 1EJ7L 4UQTA 4PUOA 2K1RA 3OR1B 5KT5A 2QLJB 4BHQA 1YWXA 4CTAA 2CG9A 4FPPA 2ZEJA 2AMCB 2X7IA 3DGPA 2CJBA 5K8OA 2M0GB 5DETA 3F44A 3HSDA 3MM5B 3CDAA 5CYMA 3T1YJ 4DI6A 4BBYA 2HFZA 3KNGA 3NXZA 2CJYB 3DOKA 2R2TA 2AF6A 2FHMA 2W25A 2B9WA 1JMTA 1HWJA 5KT4A 5B0GA 2QIFA 4DDFA 4HHJA 3PHTA 1WI8A 3CD6S 1IM6A 3V5RA 2AJQA 1YDLA 3WHIA 1SV5A 3FBFA 4DLGA 3UN2A 3DU6A 1R0CB 3CDBA 4UOGA 2YNHA 4RW6A 4JI7F 4XKKA 3JTPA 4OI6A 1PGZA 2QLWA 3Q5JA 2LDYA 4MK9A 1PBUA 2YKOA 4Z7YA 2PD1A 3VALA 1F5AA 1SIWB 2AD9A 1YSZA 4DX7A 1K47A 1QYEA 2J5AA 1FNOA 2HNYA 1MROA 5BR8F 4WE1A 1RBOB 3F73A 2HG1A 4USJC 1SCJB 2HZCA 4YKTA 1CJUA 1T11A 1AW0A 4F4XA 1JLQB 3GIIA 3MEGB 2HQFA 1FXLA 1SXLA 2P6SA 2GQ2A 2KDOA 3LW5C 4KT0C 4EZ9A 3G71S 4PABA 5HN0A 2H5IB 1FTCA 4LJMA 1S57A 3V6KA 2CQ4A 3ETOA 3QQCD 4W7TA 2LQJA 1RYRA 5JENA 2XHRA 2UVWA 1WEZA 2W24A 2QF6A 3IAS9 2MY8A 2EKYA 4DPUA 3PACA 2J8AA 3TANA 3ELHA 4K4OA 2H1YA 1R62A 2N4CA 4CM0A 1UTAA 1ZM3A 2CDQA 3GYXB 3ETMA 5IT4A 3QRQA 2CJAA 5HP1A 1NHJA 4DEZA 2YWEA 4LWFA 4H4KA 4BIZA 4Y34A 4J9LA 2WW4A 4QCLA 3W62A 1QAJA 1A9NB 2R7TA 2XI3A 5ADZA 2YPZA 2V9WA 2KVIA 1X4HA 3VZHA 1YBAA 4J9OA 4MIBA 2DGUA 2B56A 4KGMA 4M5JA 5KG4A 1IBLJ 3VADA 4NA3A 2UU9F 1KOOA 2B7BB 2Q3PA 2HBZB 1VR6A 3QIPA 3KLFB 5CTWA 2NR0A 1RWXB 4OI2A 3R2CJ 4AS9A 4FBTA 2IHR1 3ZXWA 1EP4B 1TKZB 2KJWA 4RNNA 2FJWA 3CJQA 4ASFA 1RHUB 2KG1A 4I64A 2KU7A 2QO3A 3M8WA 1Z5AA 3X3UA 1IBMJ 4URLA 4M5DA 2FWYA 2W7OA 3FBEA 2H54B 4QIGA 2F63A 4ZITA 2YE6A 2W2PP 2HNDA 3PR4A 1J5EJ 1HD0A 4A47A 3K5OA 4P2FA 1YSJA 2H55A 2LCWA 3MM7B 5IZHA 5KFXA 1IR1A 2Q1LA 2V8DA 4YKRA 1TVRA 1YJ7A 2ALZA 1FNMA 4IFVA 4DV2J 1VK3A 4JI4F 4USIA 2H4YB 4PG7A 1VLOA 5GAEI 7FD1A 3M8QB 1IUJA 3QWPA 2YWKA 4QIWD 1YSRA 4EBCA 1RT1A 4OJ3A 2NSBA 3FK4A 4EGKA 1K1QA 3SSRA 1U1MA 5EX3A 2R7UA 4ZN1A 1RJJA 5CTUA 5DG7A 4LF5J 1AH8A 4P2MA 1CG2A 1YJTA 3SZ2A 4DS4A 1YGYA 5HMZA 2R7OA 2UXBF 3W5YA 2C2MB 4CNZA 4F36A 4ZKIA 3GJSB 2R2SA 3ZNJ1 5AXLA 3MCNA 2F65A 1AFJA 2BTZA 4LRFA 1JLFB 4GFNA 1ZAWA 2RVJA 3M1VA 2C3UA 1DTTA 4RUBA 3IR7B 4ILLA 3BGRB 3VWSA 3AB2B 4AQYF 3NCQA 4PG4A 3VZIA 3UFCX 2F8EX 5CTYA 4DV2F 3WX8A 4DU7A 2GJFA 1WHVA 2VCIA 1P9QC 5SZTA 2PIIA 2EEYA 2VOOA 3FCWA 2KFNA 2ZDXA 4EFAC 1L3SA 4NOHA 1RT4B 4BQGA 5BODA 2HFOA 3U27A 3U02A 3ZZ0A 4NWBA 3DXBA 2XO6A 3CO0P 3SCIE 4V19X 4DQPA 3EVWA 2RIJA 3OJUA 3N6LA 3KK1A 3K5MA 4YR0A 2A2CA 5K5MA 2O01C 4LWIA 1AUSL 2ZWOA 4QWAA 3DLEB 4P75A 4NLPA 2OP5A 3J81Y 3EGZA 2F4VF 1Q53A 1OY6A 4OYWA 3ZNUA 2VH7A 2YKJA 1NDCA 1WDTA 2CQGA 3TA2A 3RAQA 3P45B 2HVHA 4C0HA 6FD1A 2QJ3A 3DLEA 3GJRB 2IJNA 1MU2A 4MKVA 3O0IA 3G8SA 1X60A 5A6PA 4RNOA 2W4DA 2E7WA 2MQOA 1HFEL 4G1QA 2VKZG 3BH6B 4P10A 4YKUA 5FNFA 2MSSA 3B8HA 1KDNA 4A8WA 3MUTP 1RWKB 3VAKA 1GKXA 1UWBA 3N4WA 3BO3A 1KWMA 1S5ZA 2GMJA 2CPXA 3MGJA 2EC0A 1YETA 1T3OA 1PYSB 1ZBTA 3BQ1A 2H51B 4M1KA 4TXSA 2O67A 1WI6A 4TN2A 4KBIA 4KP4A 5KFIA 2XC9A 1U6ZA 3T5KA 2ZBQA 1Q81T 1R8PA 3LPEA 4B3SJ 5LOQA 4K4XA 3M6VA 4KB7A 3K59A 1VFJA 1FT8A 2EBEA 1P8GA 2AX0A 2DHHA 4MKAA 2WVCA 1YI2S 1KEKA 3GFZA 4JI5J 3ONQA 2ZKJA 1FRJA 5KG3A 1OY9A 1RTZA 3NMQA 4DMZA 3DMJB 4WCEQ 1TAUA 1JKHA 1EA6A 4BWJA 3PYDA 3CCQS 1KR4A 1WF1A 1FD2A 1RP5A 5LMUJ 5B09A 4OYPA 4ED6A 5D6PA 2M70A 2CADA 2QEXS 4MYUA 3OVAA 2WHOA 2D74B 4DSIA 1FDDA 3A1YG 1J2VA 1N5YB 4CLTA 1ROFA 4DV1J 4K4UA 5HSPA 1SQGA 4ZVGA 1CULB 3IFEA 4JOUA 3LUYA 1A7GE 1I59A 4IFVB 2CQPA 1RT6B 2DCLA 4MBCA 2DB1A 4RW9B 1JXVA 4ZHRA 1SPBP 4CM2A 4KY3A 1JJ2R 3ISNC 1M5SA 2XB2D 1JM6A 4LR8A 1N33F 1UZHA 1HI1A 1R0BG 2OPRA 3ILJA 4NCAA 4QU6A 3DDNA 4X9LA 4J9NA 2G1HA 5HLFA 3PRBA 1A6LA 4P7VA 1S16A 1E6YB 4KTNA 3R27A 3ZO7A 3B4MA 1HI0P 2VPWB 4JBCA 1YX2A 2EFQA 2RF2A 3DM2B 2KFYA 3CJ8A 3R5BA 4QJVA 3OD2A 1UYCA 5AT1B 3I0RA 4HY6A 3JTNA 3NCPA 3G82A 1E6YA 1FX4A 2FJXA 4LF1A 2ZE2A 1W26A 4O3NA 2ROPA 3SV4A 2GAHC 2NYHA 4E00A 2UXDF 3OL7A 4DV1F 3JQJA 2H3EB 4URGA 1P9YA 3BGRA 4TU7A 5KG1A 1H72C 4M94A 5J2NB 2CPEA 2UUCJ 3H98A 3NWRA 3QYYA 3FZ2A 4KTQA 1YS3A 1S1WA 4ZMMA 5EGYA 3AXMA 1QUPA 4KPYA 1XMOJ 5E41A 1SC4B 2PMWA 2VOPA 2CVIA 2BU6A 2VZ9A 3DC2A 5U47A 1I58A 3IG1A 1QAXA 2ADBA 1D8YA 1D1UA 4OYIA 2XMMA 4KGKA 4XPCA 3IN5A 3ILIA 3CRKA 1MX0A 2PEHA 3IS9A 4CE2A 4ID5A 2RNEA 3MPVA 2YEDA 1TKDA 4C98A 1AA1B 7AT1B 4YKZA 1V5VA 1RT5A 4OYBA 2YX7A 3GIGB 3TVZA 3KJFB 2HS4A 4F67A 3RZAA 5F8MA 3FFIA 3GR1A 5C2CA 4KO0A 3CJ2A 2X1FA 4O04A 1CPZA 1E6VA 3JSYA 2BU5A 1SB6A 3LNUA 1RWOB 4LF4F 2YH0A 1XTZA 2ZD1B 2XDSA 1Y3JA 3DLGA 2V69A 4O3QA 2IJFA 3U1MA 4HI1A 4U93A 2ZBCA 3MEGA 4O44A 3IBCB 1KN6A 3VAFA 1BGQA 3H5YA 3H4BA 3SYZA 1ZPWX 1R3NA 2BJ9A 3CD7A 4DR6J 1T9TA 5I4MA 1W2BR 4MK8A 2LU1A 1ZM4A 3DHWC 1YJRA 3IRXB 4Q7AA 1FRMA 3OL8A 3R6GB 1RWUA 5EWFA 2EK6A 2XQCA 1C1BB 3TAPA 1RUSA 5A8KA 4L3NA 1M5KC 5KFMA 1LWXA 4DSFA 3AY0A 1TL1A 4K2XA 2KH9A 2AKWB 2XS5A 4WUCA 2KZMA 1Z1ZA 3CTRA 2UXCJ 2G9OA 1SH0A 1UYIA 1FKPA 4WU2A 2PDAA 2UVUA 3Q8PB 4H54A 1GJVA 4J91A 1IKYA 4ZPBA 2X1BA 3CGYA 4NLGA 2XHTA 1NSQA 4LPBA 1XR6A 1WD6A 3OFGA 3OVBA 4XO0A 2VIHA 1Y8PA 3MR3A 3TEHB 2IMWP 2XABA 3CPWR 5H9FK 2DNGA 2IA6A 4D3GA 1NH7A 1CJVA 2B6AA 4DPOA 2IVYA 3QIDA 2VKRA 3MHYA 4YY3F 2BSMA 2GVZA 1CULA 4H4OB 1BD6A 3T41A 3PO4A 1K73T 4ELUA 3UR0A 3QDDA 2R4FA 2RHSB 2Y1RI 5B0BA 1B64A 1NK8A 1N5QA 1YJ9S 4FNIA 2QGFB 5F9NA 2XSFA 5B0EA 1VC0A 1J5OB 3IRWP 5I42B 3HULA 2YKNA 2B43A 5FNCA 2FQQB 2IC3A 3JQMA 4I2PB 4LF2A 3BKFA 4URSA 3K2YA 2KXNB 1BQMB 2BQRA 1U1LA 1D9FA 2CA9A 5A8RA 2YE9A 4YP3A 4DUHA 4DZYA 2HPUA 3HHLC 5KG0A 4CZCA 1YITS 3TVKA 3MUVP 4ASBA 1S0VA 3N9UC 2QMWA 4W98A 2R2RA 1KBRA 4ALZA 4J9RA 1FK9A 1VRTA 2GQCA 5EHHA 1IJFB 3Q8RB 2HRYA 3PYGA 3M8PB 3C66A 1US7A 1FDNA 2VA3A 2O1UA 1UA1A 3H25A 2JFDA 4LRBA 2I5JA 5D4NA 4JI3J 4YY3J 1QTNB 4YB6A 4ATNA 4R25A 4GO5X 3LP0A 2JJ4D 4RWWA 1HBNB 3R5DA 2ZFHA 1NK7A 1HWLA 1H98A 1D8ZA 4Y2KA 4ECZA 4AWOA 5HLFB 5D7DA 2G2ZA 1HQ2A 2W2MP 4RJVA 4WKYA 3H80A 3L95X 2YQ0A 3TZ5A 5E3AA 3HK2A 1D9DA 4ED8A 3A3OB 4YQWA 3CYGA 3EE3A 2V8HA 4DCJB 1WF0A 1S77D 4USVA 5DJBA 2IDLA 3O5TB 1TKXB 3EICA 1QY7A 5A2QY 1X9WA 2WI6A 1SL2A 3M2UB 2W2NP 1X5TA 1EHWA 4GKJJ 3SDEB 4F4ZA 4ETZA 1LW0A 2CDRB 5ETNA 4I56A 4HYPA 3AB4B 1FKAF 3F56A 2BU8A 3C0EA 1SJ4P 5E3RA 4ZLPA 3O6QA 4ZPAA 1Y9OA 1L0OA 3IWLA 2CQDA 4JI8J 4AE5A 1UP1A 3DXSX 1WKJA 4QPXA 4PWDA 2FTKA 3CJ0A 4OZNA 1RAEB 2OD4A 1JWWA 3OTOJ 4B3TJ 1WKLA 3PXGa 1FRKA 3FRZA 4ED4A 4I0WA 1JLGB 2XDLA 1N5SA 4DBQA 1HNWF 1DLOB 2Z0GA 2IY5B 1UMJA 3D0IE 4EBEA 4CCHA 2P2CB 4IKAA 4KKOA 1TL3B 4EI2A 1FESA 2ZZNA 1S59A 1ZM9A 4MYTA 1SL1A 1DBDA 4OIXA 4XDCA 4GQTA 4NLOA 5HMWA 2KHDA 4NH9A 2KHCA 2E9RX 2AHOB 2WEPA 1FKPB 3K60A 1YQHA 1RAFB 1SC1B 4RX6A 1RHKB 1MWYA 1ICEB 3OXGA 3MFHA 2PI4A 2LA4A 2G1DA 4QW8A 3OSPA 1RHRB 1B62A 3QJJA 1FE4A 3D0HE 4BDPA 3P5TL 3CIMA 5D7RA 4QR2A 1NJIT 1SKRA 1F51A 4DV7F 3TZ0A 4NCGB 5LXYA 4JP8A 2XWXA 2OIHA 2J0QD 2BKOA 4ED0A 1R8HA 2HZAA 1FERA 1Q4RA 5D4OA 1M90T 1B0TA 2FVQA 2Y1JA 2NXJA 4FZVA 2GQQA 2FZGB 4HL9A 4X64F 3RBDA 3PJ9A 2XX5A 3CDEA 4OX9F 4Y0FA 3KLIB 4GKJF 2HKEA 2EW9A 4I69A 3EHGA 2WVEA 3UN3A 1VQ9S 2DGWA 2E7VA 2FYPA 5CYQA 2JH3A 2LEBA 4UTGA 1Y8OA 3J7ZT 1S6QA 1S49A 5J2MB 4WUBA 4KHPJ 3RB3A 2EK1A 2B5JA 4EUVA 2HHHJ 3HJVA 1U48A 1YJWS 1V3ZA 4N5SA 2OGUA 2XMKA 3MCSA 4ECXA 1YZ6A 3VV2B 4DV6J 2XMJA 5GMEA 1IM4A 3CD5A 3B28A 3BYPA 3TUIC 1IVZA 3VVUA 2BZ5A 3W9JA 2YEEA 3DLBA 4I5SA 2CJXB 4YDDB 2V34A 3AQPA 2BXJA 3CCWA 1IBCB 4CE1A 1R6VA 3C14B 2JVOA 3BM7A 5ETMA 2Q6BA 3CGZA 3NNAA 4IOBA 3T5LA 5J2NA 4FCPA 2HHSA 3JZ3A 2UWDA 1GFWB 3GG0A 2UZAA 1GX5A 2YEHA 3A8KA 1NHKL 3H90A 1L3KA 2GO8A 5LSOA 2UXBJ 3OR1A 3FSXA 2Z57B 5LSRA 2MYFA 2UVVA 2VICA 4N8NA 1DTQA 1VQOS 2YNFA 3M8SA 4LF7J 2BX6A 4UZCA 4JI0F 3S5TA 2XS2A 2ZC3A 1WOOA 2DT9A 2W9BA 1F1BB 5F8JA 2CFXA 3B6BA 1JJCB 1HI8A 4NLQA 3QLHA 3N5FA 4TQSA 4B9TA 3RW7A 4KHPF 4HVZA 2QMUB 3L09A 1JLBB 2ALYB 1UJ5A 4LIRA 4WFYA 3PV8A 1RABB 1KSPA 1SJQA 1XNRF 2VC1A 1THNA 1RAGB 2NXUA 4EBDA 1F2GA 4U8YA 2XDKA 4LVOP 2C2EA 4IH7A 1X4AA 2C2RA 1HNIB 2WCXA 2W01A 5ETVA 4PRVA 1E6VB 1WKKA 3OXLA 4QW9A 4TYBA 2PFFB 1S7HA 2HK2A 1M5OC 3R5JB 2BKPA 3M2RB 2KM8B 1WSRA 4QYZK 4OI3A 5KFLA 1XN9A 4CH7A 3OJSA 1DQAA 2HNZA 1UY6A 2W9AA 2XULA 2ILYA 4RU9A 4TQRA 2IBKA 2NREA 5KFDA 3CJ3A 1Q8IA 1GTEA 1U8SA 1Y11A 2M88A 2N3LA 4DN0A 3K0JA 3JQKA 2YQ3A 2DNKA 4XTJA 4ZVPB 4DS5A 4F3OA 2R7VA 1IWAA 2AKPA 2QZ8A 2YWFA 9RUBA 1TV6A 3KJQB 2YK2A 1RT7B 2W7PA 2UVRA 2YKPA 1YVFA 5H9EK 4LSNA 5JVHQ 4GVBB 1RB0A 1UW9A 1M1KT 4ES3A 4I6AA 4IR9A 4E72A 1QAIA 1S1XA 3BN4A 3TJ9A 4OHXA 1T94A 2RS8A 2BJ7A 2HGMA 2AGQA 4ZVUB 1VBXA 4USUA 3UDEA 2E1CA 3CCUS 3R92A 5K20B 5LJ5Y 1AM1A 4EEHA 3HEKA 5IWAJ 3MEEB 1XQIA 2V4QA 2HHVA 4W4MA 4NCGA 2AGOA 3LPSA 5KAKA 1NSKL 2DHGA 4EGHA 2WK4A 1RISA 1ZETA 3L9ZA 4DR4F 1S14A 1QVGR 1Y4SA 4CRJA 4YDXA 4AXIA 2VG5B 1HPZB 4H4MB 1FRXA 3G87A 3WC2A 4DR7F 2D3OR 2PMZD 1JB0C 2YEIA 1NSAA 1K0TA 4F0KA 3TA1A 2DRBA 2CKWA 2DRDA 3G6ES 2Q8FA 3V2UC 3QGPA 1H2UX 2WSFC 1WHYA 4KH0B 2XS7A 1AFIA 3LALA 3QT8A 3AOCA 3MEDA 4XE2A 1EB0A 2C1IA 3BB5A 3DOMB 2DNZA 4ZP7A 4K2JA 4C0BA 3TQ1A 2JRSA 1BHNA 1TZ0A 2FLNA 2GFFA 4WPAA 1Y5LB 1S1VA 5BXIA 2Y9HA 1LWEA 4F25A 2FUG9 3MEKA 3N01A 4CT9A 3GIMA 3Q0AA 4B9LA 3IM9A 4CIOA 4NEZA 3NLCA 1RTHA 2WBRA 4NXMJ 3CW2C 1TVRB 2HKJA 5C42B 2HFVA 3TEGA 1OQ6A 4JUZA 2H8MA 1QVFR 1QJHA 2C3MA 3MM9B 4GVLA 5F9LA 2QYGA 2DVIA 3M6XA 1SC6A 2YX4A 2RU3A 2AJ0A 1T0TV 2I38A 2DXDA 2FHJD 3GCXP 3NGSA 4JB8B 3MAQA 4IH6A 3T1HJ 3HPOA 1B4SA 7FDRA 4RW8A 1SKSA 5D7CA 3G7EA 5F3KA 4IRCA 2MQNA 5F8NA 1CEZA 1UYLA 3CMAS 2GMHA 3UD3P 3S6EA 3EMTA 2EG1A 4LF9F 4C8LA 1N6QB 3W7BA 1SJ3P 3UDVA 5KG6A 1KZNA 2W9BB 3J80U 2HHUA 2ZUGA 2ZVIA 2GHPA 3TZZA 4CLPA 1XNQJ 2HRUA 1TK5A 2MTLA 1NHVA 3IEDA 1HW8A 1RTJB 2BT0A 5EWGA 3RRHA 2F8MA 3C6UA 2LECA 4AL6A 3I4HX 4ZJQA 1S1TB 1PVGA 3BDPA 2B51A 4P8OA 1U6BA 4ZOSA 4ZCLA 3I32A 3P96A 4MH8A 2CWXA 2HFSA 1MROB 4N47A 2BDPA 1IXMA 1F0XA 5IDJA 3Q83A 3H20A 1XMQF 4LFBJ 3R7SB 1JJHA 2YKMB 4MIAA 3KG0A 9ATCB 2QA4G 1RLCL 3MM7A 2Q66A 1NJZA 1FWKA 2B7CB 1GEHA 2OELA 5JXSA 4DX8H 1X9MA 1LWCB 1Q8LA 3PKMA 4K4TA 2DISA 4IG3B 2W4CA 1LFWA 4K0KJ 2K06A 2R8KA 4M5HA 2XO7A 3W5ZA 3H5UA 5IDMA 4DJBA 2FHJA 4A48A 1YC4A 2E5JA 4AXJA 1U1KA 2FPHX 1FXRA 2CQCA 3GONA 2IA0A 1HNIA 1I5BA 2RJZA 4X4TA 1RXOB 3W2VA 4YUDA 1DLOA 2YWGA 3VQSA 1BXNA 2VJUA 1OYEA 2J7WA 1LWFB 3BQ2A 3E01B 1RTDA 3I31A 3HT3A 4EMVA 5ETQA 4RW4B 1V3RA 4IYQA 3CMES 4JI2F 4NLDA 3EZUA 3OHAA 2J6UA 3FQLA 3EKOA 5KT2A 5M4EA 1S1XB 1WHXA 2KXHA 1YRUA 4V1Ak 1VIOA 4LUBA 3OBIA 1VQKS 1Y5NB 2OEMA 1FJGF 3DI6A 1UAWA 3H2VE 5A2QU 3RR7A 1X5PA 2E5LF 4P2XA 3GZ7A 2DR9A 4NI2A 2ZM6F 2YI5A 5I3UB 1RHQB 4PAAA 4KV8A 3U2DA 3CULA 2JVRA 5HVHA 3MXHP 4U95A 4X65J 4C6AA 3C15A 5B0AA 3TQEA 3SEOA 2MKHA 4B9VA 4HZ5A 2R7QA 2Z2YB 3HVWA 4DUTA 1F9HA 2XZDB 1JNZB 1JIHA 5I3QA 3PTWA 4JI0J 3C15B 5LMUF 3RTVA 4DQQA 5JJBA 1RQ0A 3KHHA 3D2WA 1VGYA 3GYGA 3PW0A 2K7JA 3GWCA 4IFYB 2HRTA 2OHDA 3SXLA 1IN0A 4CLYA 3T6BA 4X4PA 2IIHA 3N28A 4B3RJ 2PA8D 2CPFA 1HPZA 2IPOB 1VBYA 3CJ4A 3PFEA 4C8ZA 2YGEA 1S4FA 3SI8A 3K17A 2PE8A 3W2WB 3QAUA 4CH0S 4DR5J 4FS2A 2DXEA 3KKFA 1RT3A 2ZM6J 2XMWA 1IBKJ 4FN5A 2XGQA 2QFJA 4I6WA 2ZJPQ 3LGHA 2XMTA 3ZC4A 4LR7A 2UXDJ 4ECWA 3RBZA 4WFNQ 2KTQA 2HQCA 3FT5A 2GCFA 2FJVA 1HD1A 2MQQA 3LMMA 4P71A 4Q44A 1S1VB 3ENQA 4X2BA 1VRQC 5CABA 3ZXQA 3HSZA 1DQ9A 3OL6A 1HBUA 4OL8A 2YNFB 4BIUA 2DJWA 2PA3A 2GIQA 5M2PA 3VF0B 1Q78A 2HGNA 2QFOA 5HQLA 1N5VA 3KHLA 2GIRA 3HJFA 3W61A 2AW0A 5LJ3Y 3LF0A 2K7KA 1PCAA 3OPDA 1ZWHA 1IR0A 2VD3A 3AD7C 4DXLA 1RE1B 4KAIA 3B54A 3IP0A 2B4PA 1YESA 3GCWP 3KJVB 1RAIB 2VWCA 2GX8A 3J81U 3PRDA 2XYPB 2WI4A 3PW7A 5A8WB 4LSLA 4KIAA 5M4MA 3RB4A 1BMQB 3KK1B 1NDLA 5K14B 2U1AA 2YE3A 2QG0A 5B0DA 4F4YA 2WEQA 2DR7A 3Q86A 4AT1B 3CCMS 2BREA 5THWA 3MR6A 4LRAA 4PRFA 2CCTA 2Y1LB 3C46A 5HMXA 2K8GA 2ZOGA 3RLRA 2E7XA 2D3ZA 4QWEA 5ETPA 2HNZB 3KLEB 3PG9A 3W3SA 4QPJA 1KFDA 5FLXU 4X62J 4I7FB 1AXQA 2PI5A 2Q43A 1BE4A 3I87A 1F5BA 3OFFA 3HHLD 2GV1A 4QWCA 1UA0A 2MJNA 5LL6d 1U4BA 4NE9C 4L76A 4V26A 4BLGA 5I3PA 2DGSA 2VC0A 1FXDA 4FNHA 5DM7Q 4JI8F 2E5LJ 3DYAA 1DY3A 4DHVA 2AEJA 3ZTSA 3E2EA 1S72S 1YT1A 2YQ1A 1RT7A 3UDCA 2RF2B 3CB4A 2C2NA 1LWFA 4FKYA 3MOJB 1RTDB 1R0AA 2FHOB 4NLTA 1HYSA 4XC0A 5C5JA 4CLLA 4CLZA 2WZ1A 2VPZB 2RKIA 4TKTA 4CWFA 2EFGA 5KG2A 2ZZMA 4M63A 2V2VA 1OY8A 2BACA 2POKA 4WKRA 4DUZF 2HS3A 1OJ4A 4KSGA 3TUJC 2DR5A 2C3PA 2JEFA 1I5AA 5H9FJ 4G1IA 1UETA 2HAIA 2WONB 3HVTB 3W2VB 4X66J 1KQKA 1TH8A 2J0XA 4XIRA 4O0IA 4AUKA 3DGPB 3G2XA 5KG7A 2CPHA 2YWWA 4A8KA 4USHA 4Y2MA 5J2MA 2HHIA 3UI3A 4MFBA 1MNEA 2HZVA 1N5YA 4ECUA 4KH1B 3M8ZA 3RLQA 4MK7A 1QAYA 1WEXA 3G86A 4FVCA 2XZWA 3G4SS 3V4MA 2LVWA 1RT5B 1VQ5S 1X8DA 3U1LA 1WC3A 2B6AB 5E7OB 1UEVA 3PJXA 2HVDA 4F4AA 1VQ8S 3TAMB 4FVMA 2YKQA 1U0HB 2VFUA 2VBZA 1IKVA 5E3PA 1OS5A 2YK9A 3CC7S 3EKRA 3UVJB 4L94A 1RADB 4F4WA 4WXWA 3TAMA 2B4OA 1X4FA 3M7VA 4UROA 1U0HA 2EVZA 1YC3A 2CAJA 2NPIA 4OHVA 4HT5A 2M5YA 3QNWB 3ZKBA 4OZ3A 4X66F 5D0EA 2DNOA 4BC7A 3THVA 2LMIA 2HHHF 2QYCA 3PM9A 4L93A 5DM6Q 4JI3F 1BQNB 1JLAA 2IYGA 4DV5J 2Z2MA 4YFUA 5DLGA 4WIIA 4J9UE 2AV5A 3UD4P 3BS9A 1U09A 1TTHB 4FP9A 3U1NA 8AT1B 3NBPB 3US5A 4DQSA 2MXYA 2IVMA 1VQNS 3DRYA 4N76A 3A0XA 2NLWA 2NUUG 3DHXA 5J2PA 1GAOA 3CMQA 3FQKA 2HVZA 3LP0B 4OYAA 4L74A 1HBNA 3D0GE 3MF5A 4OV6A 1QD1A 2WOMA 1Y10A 1I94J 2GO9A 2NPFA 5J1EB 3HZ1A 3JYTA 3OLAA 1GK8A 3UW1A 2P6TA 5C7PA 4ID8A 1PIEA 2IDEA 4F0HA 4X4RA 4C8YA 4XDMA 2ATCB 2UUWA 4MJKA 2DITA 4C3LA 3OPKA 4EGIA 4JI4J 1TC6A 2BKNA 3KUEA 1RHMB 1REGX 1RSCA 3B27A 3D0BA 3GR0A 1FD8A 4ZPTR 1WJ9A 3EZOA 2OD6A 1VRUA 1QM9A 5C2GA 2XCMA 3IWXA 3TJAA 5F3ZA 2XNQA 4KFGA 1TMJA 3DLHA 4ZVFA 1LW0B 1S48A 1RT2B 2XG8A 1S4EA 4ELTA 5M4KA 4DR2F 2GHVC 4ZPVR 4Q45A 4EZ6A 3I0SA 4P7AA 3PX4A 2Z2ZA 3EX7B 2V4JB 1S9EA 4NLSA 1H3DA 2YY3A 4IOAQ 3OFEA 3M32A 4M95A 4DSLA 3P8BB 1VQLS 2UV8G 2J9CA 1LV5A 2MB0B 2ASLA 1AROP 2XEXA 4PQUA 5HMYA 5K8NA 5GGZA 2ZKTA 2BUNA 3UNYA 3FSIA 3KLEA 3KDNA 3LGMA 2I5JB 5MAOA 1DFDA 1B63A 4K4ZA 4Q0BB 4B9MA 1S0NA 3L4BC 2CJKA 2VPYB 5E3CA 4OI1A 3LPYA 1HNWJ 1CJKB 4BWMA 1G3OA 3BYRA 4YKWA 2QFIA 5FIIA 2C2DA 2L9DA 2FLOA 5I3UA 3CCSS 2OTJS 1N88A 2IRYA 4DV4J 2YI7A 2C28A 3MDFA 2WSCC 1PC4A 2L08A 4ZK7M 2G0CA 5EWEA 5DLFA 4LFAJ 1CJVB 3DI6B 4LFCJ 5M4PA 5E3QA 1I5CA 3GLJA 3O2FA 5HK4A 5CPHA 1PYOB 3FGVA 4TLQA 5IWAF 3EZ5A 3WX4A 3A4TA 3OVSA 1Q16B 1YBTA 2HQDA 1IQTA 1X4EA 2FXSA 4MOTA 3TZ4A 2VCJA 2ZH4A 2UP1A 2X1GA 1KONA 1N34F 4L90A 5D77A 4DR7J 1X5SA 3BGUA 5FNDA 2HWIA 1N36F 4C11A 4KHMA 3HZGA 3J7YI 3DRRB 2IOPA 4DV7J 3A12A 3DRSB 4BQJA 3FV5A 1Q86T 3W60A 1NNDA 3T3FA 3VAHA 2LXFA 4E02A 2EFVA 3AJ1A 5C25A 4WXOA 5JMNA 1MMLA 2YEFA 4TYAA 4N41A 5F5RA 2RRBA 2CPDA 4HYKA 4DG1A 3CCRS 1UFWA 3P5BP 2H4WB 3TZ2A 4K4SA 4MIWA 1B3QA 3M8PA 2DTJA 3R7BB 5HVGA 1NZ8A 4C4WA 4UY85 1IKXB 1UYKA 3TTZA 2QA4S 3AD9C 1S0MA 1GMWD 2HSEB 4C8KA 2O1WA 3H40A 4WZMA 1HQEA 4PXCA 1U25A 1Y5IB 1NLKL 2I1RA 2VQEJ 4LIWA 4NLWA 2IJRA 4O23A 1UVJA 1R89A 1VCTA 4WP3A 4ZJOA 3OWDA 4QWBA 1UEUA 5EDWA 4HTJA 5AE1A 5L38A 2B9EA 3HT0A 4BAEA 1EETA 2YVSA 2JL9A 2KM8C 3BV8A 1W7WA 1QZRA 2FLLA 4ZS6A 4DSJA 3JYTB 3GILA 2BYCA 3Q8YA 3J80Y 4ED2A 4OHZA 5C24A 2ZHBA 2F3JA 2HLTA 3C6TB 5FDLA 4AWQA 1H7UA 1RWMB 4NL5A 3FMBA 4LP0A 1U2RA 2WI7A 2X3GA 1N56A 4DL4A 1TR0A 2Y0SD 2HFNA 1U2OA 4UOFA 5C24B 2QV6A 3NOCA 4OX9J 5KG5A 1X7VA 4GC7A 2WAQD 3Q24A 4R1FA 1F60B 3UCUP 2CCUA 3Q23A 4EU0A 3MMBB 1GXUA 3KG4A 1Z2ZA 1O5JA 3MNRP 4ZVEA 2HCHA 4B7PA 3A0TA 3BBFA 2WOMB 5L46A 5KFSA 4PWDB 3SQGA 2JEJA 3Q8UA 1WTBA 3MMBA 4XKOA 4NMLA 3FSYA 1OWXA 1S12A 5IXUA 4IDKA 2P9CA 4DQIA 4DPYA 1LW2A 3C16B 3GFHA 4HLBA 4L91A 1YC1A 3OTOF 3D54A 4B3TF 4PXBA 1FKOB 2QT7A 3BF4A 3BN7A 2DH9A 2CGFA 3GMGA 2GQPA 3D1QA 4OZLA 3KYLA 2OSQA 3WIVA 1S76D 3PX0A 3EPIA 4ZCKA 2O1VA 2ZVSA 4MMOA 2EXUA 4QPKA 1CC7A 4GMKA 2R8GA 1SV5B 1KNZA 4L6V3 4NI2B 4USTA 4C9DA 5ETLA 4LF6F 2XDUA 4NX9A 3R5CA 2MZQA 4PZVA 1CSJA 4EGLA 1RDRA 2YPYA 1N34J 3GIKA 4DX6A 2RRNA 4IO9Q 4ZP9A 1TKXA 3T5JA 1TV6B 4RKUC 2VBXA 1FDAA 1KP6A 5HAOA 1FFSB 2MQLA 2BE2B 1RWWB 4DL6A 1B3TA 1HNZF 3QAEA 2MQPA 4XCLA 4JYAF 3MFIA 4ZPDA 3OW2R 1X4DA 4I6YA 3T2SA 4PPZA 4W90B 3TUPA 1Q5VA 2FY1A 3T19A 4PWUA 2W9CB 2QSFA 2ZH1A 4QQBA 2ZJQQ 3I5AA 5D3GA 1TUWA 5ITHA 4CDIA 3E51A 3EXYA 3NP5A 2SXLA 4RW7A 5HJYA 1G7CB 4CQ1A 2YKIA 3O8WA 2KB2A 4ERDA 1U0ZA 2A3JA 5K9FA 2XHCA 1M5VC 3CCVS 5GAGU 1H7SA 1HLWA 1OPIA 4NA2A 1U1RA 3RBXA 2D9OA 4NPOA 3P49B 2MSTA 1ZS6A 2OPQA 3HZ5A 3U7JA 3M6WA 3BSNA 4DOZA 3A8EA 3K98A 1H7WA 1YZ7A 3VGSA 5L9NA 1QE1A 4FF3A 4HY1A 4CP5A 2OUGA 1I5DA 4KR0B 5JUMA 5A0YB 3OMUA 3D1OA 3GYNA 3M05A 2BE7D 3K5NA 2FC8A 1FVQA 4C3MA 1FNXH 1RTHB 4QYRA 4Y65A 2VDHA 1HQEB 5DZ7A 4LVNP 2DIVA 2ABYA 2RDDA 4DPXA 2YI0A 2COLA 5L3JA 3I4PA 4LSNB 4J9QA 1NCLA 2V94A 2BJ8A 4E98A 1HR0F 2K3KA 3ISZA 2Y1IA 4OZ0A 3EVOA 4ITSA 2HNDB 2MZRA 5G4DA 3DLKA 1UYFA 2IFXA 2OPPA 4M5GA 2OI2A 5D6GA 4Q43A 4UZBA 2IYIA 3GV5B 1NDPA 2EC2A 4WYWA 3K57A 1UY8A 4JQLA 3HHKA 2V68A 4XD8A 2QG9B 1MWQA 4I7FA 2FZKB 1YIJS 3WC0A 2YJWA 1HKAA 5A8KB 2LQBA 4NLRA 2Z4PA 3THPA 3AJ2A 5M4HA 4NH7A 2W7AA 2YGAA 3KHRA 3GFXA 2HMIB 2B8QA 2XY6A 4ETXA 2C2AA 2WW8A 1U1PA 3KK3B 3QSYB 3SSSA 3VGTA 1S6UA 2QA2A 3VAJA 1X4GA 1RU1A 1P1TA 2VODA 2I0XA 2B3TB 1RTJA 1UVMA 5GVQA 3T1KA 4CH1A 4MPCA 1DHMA 2PNRA 1EI1A 2V8GA 2YE2A 1N5TA 2X51A 4B3SF 1SKWA 3H8YA 3JS9A 4ANCA 2RKIB 2AGPA 4RR5A 4YR2A 4U6PA 3C16A 1JLFA 3NS7B 5KFNA 1LWEB 1S9EB 2GMLA 1FJEB 2QRRA 1FKOA 1R7IA 4K59A 4I68A
chains in the Genus database with same CATH topology
4ZVHA 1GXTA 4NCGA 4B9NA 3NS6A 3ISND 3MD1A 2AGOA 5KAKA 3LPSA 1N48A 1NJXA 3PY8A 3H4LA 4ES2A 4B3OB 2GNKA 2JLEA 2DHGA 2AQ4A 2AP6A 3WQ9A 2K3IA 4EGHA 2WK4A 2OPRB 1HBMB 1RISA 1LQ9A 1C4AA 1IJEB 4HI2A 1ZETA 4GCZA 4DR4F 3LGNA 1S14A 2WONA 1QVGR 2ZE2B 1Y4SA 1MWZA 2JDJA 4K4YA 1PO6A 4Q0BA 4YDXA 4AXIA 4RU2A 2PGCA 1DRZA 2ATLA 2OAUA 2VG5B 3TW0A 1HPZB 1OO0B 5KFGA 3Q22A 1UYEA 1IBMF 1NHUA 1FRXA 4H4MB 4F02A 3WC2A 5EN1A 2DCUB 2FJBB 4DR7F 4X84A 2D3OR 2G4BA 1HMVA 2PMZD 4R8UA 2L3MA 1JB0C 4UQTA 3HKWA 2YEIA 3HHEA 4PUOA 5I42A 2K1RA 1K0TA 3OR1B 2YKNB 1F5CA 5KT5A 3TA1A 2DRBA 2CKWA 1KOHA 3HHLB 4BHQA 1BYQA 1YJUA 3BREA 1YWXA 4CTAA 2CG9A 4FPPA 3G6ES 4QIEA 2XLJA 3LWMA 2Q8FA 3DGPA 1LKZA 2CJBA 5K8OA 2M0GB 3V2UC 3QGPA 3V81B 1H2UX 2WSFC 5DETA 1WHYA 3KLIA 3OTDA 5EX0A 2XCAA 5DS7A 2DPIA 1IKVB 2GHWA 1KLMB 2CQ3A 3I9ZA 3F44A 2XS7A 1AFIA 1FF2A 3KG1A 3CT9A 4OZ1A 3MM5B 1GXLA 3LALA 2HLUA 1C1CB 4TY8A 3CDAA 4YB7A 2DBBA 2QG2A 1TFWA 3MEDA 2ESAA 4UW2A 3KE6A 2FC9A 3T9ZA 1DAXA 5CYMA 2EXLA 3HKZD 4XE2A 3BB5A 4BBYA 1ID0A 1F9FA 2DNZA 3OTCA 4ZP7A 3LQVA 1QLNA 1JLQA 3TX8A 2HQ3A 4C0BA 3TQ1A 1H2TZ 1DJ0A 2JRSA 3BJYA 2HFZA 3KNGA 2FVPA 5E5NA 1TZ0A 1UW4A 2GFFA 3DOKA 2FLNA 4O3SA 2R2TA 1Y5LB 1N52B 4Z37A 2B4VA 2AF6A 1S1VA 2FHMA 2MZ1A 3I55S 1LWEA 2W25A 2B9WA 3N6MA 1JMTA 3MZIA 2FUG9 3MEKA 1HWJA 4F25A 3N01A 4CT9A 5KT4A 3GIMA 3T10A 5B0GA 3Q0AA 2QIFA 4B9LA 4DDFA 2Q8GA 4HHJA 3X1LB 3FDSA 3B82A 1WI8A 3TAQA 3CD6S 5CTXA 4CIOA 4BXIA 3V5RA 4NCBA 2C3YA 4RUAA 3NLCA 2RH3A 1RTHA 2E29A 1RI7A 1UVIA 4B3OA 4HXWA 4ZA1A 2WBRA 2ZH8A 1TVRB 3CCLS 2AJQA 2HKJA 3O44A 5E0OA 5C42B 4RWXA 1YHQS 1VQPS 1OQ6A 1SV5A 4JUZA 1QVFR 1QJHA 2H8MA 4DLGA 4HKQA 4RNHA 4XAKA 1REVB 2C3MA 3DU6A 3MM9B 3CWJA 2R9LA 3CDBA 2WRMA 1N6QB 1U26A 2B4UA 2YNHA 2AJFE 2CPZA 3H2LA 5F9LA 4J9SA 2DNHA 4RW6A 4JI7F 4XKKA 3AA9A 3JTPA 2DVIA 1DURA 2K1RB 4OI6A 1PGZA 3RW6A 2QLWA 3Q5JA 2LDYA 3M6XA 1SC6A 2YX4A 4MK9A 2RU3A 2AJ0A 3KLVA 4JAUA 1T02A 2YKOA 4HYMA 2I38A 2PD1A 3VALA 1F5AA 1SIWB 2AD9A 2FHJD 1YSZA 2DIUA 4DSKA 1QYEA 1RT1B 4IH6A 4C8NA 3MAQA 3HPOA 1NK0A