3PEJA

Crystal structure of the n-terminal domain of an hsp90 from plasmodium falciparum, pfl1070c in the presence of macbecin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
258
structure length
258
Chain Sequence
b'ESHQYQTEVTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGEEKKLEIRISANKEKNILSITDTGIGMTKVDLINNLGTIAKSGTSNFLEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATNLLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVNDPNYDSVKVEETDDPNKKTRTVEKKVKKWTLMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin homolog
publication title Crystal Structure of the N-terminal domain of an HSP90 from Plasmodium Falciparum, PFL1070c in the presence of Macbecin
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Chaperone
total genus 75
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pejA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3pejA01
2QG0A 1NHIA 1QYEA 4HY1A 4ASAA 4MPNA 3A0ZA 3A0TA 1YETA 4AWQA 1UY6A 3B26A 1AM1A 3D2RA 2VW5A 1TC0A 4URLA 4PU9A 4XKKA 4HXWA 4PL9A 2YKBA 2XD6A 4DUHA 2BYIA 2XX2A 1JM6A 3Q5KA 3H80A 4L91A 2YK2A 2YI6A 1KZNA 4XD8A 4CWNA 4XIQA 5D7RA 4XIPA 3ZKBA 2BU6A 4PRVA 2FYPA 3HZ1A 5FWKA 1US7A 4V25A 2BSMA 5FNFA 5CTXA 3HHUA 4L94A 1THNA 2WI6A 2QFOA 4BIUA 1AH8A 3BM9A 2CG9A 3B25A 3R4NA 3TZ5A 2JKIA 1Z5AA 1TILA 4HYMA 2UWDA 4EGKA 3CRLA 2WI3A 3T1KA 2IWSA 4JAVA 3Q5LA 1KIJA 2YI0A 1U0ZA 4LWEA 2XDLA 2YE2A 3WQ9A 5FNDA 3TTZA 1GJVA 2XK2A 2BU8A 1ID0A 2YE5A 4HXZA 1ZXNA 1UY7A 4JQLA 3RLQA 4EEHA 1S14A 4NH8A 4GT8A 1ZW9A 2YEJA 4NH9A 5D7CA 2WI4A 2YE3A 4XCLA 1Z59A 4L8ZA 1MX0A 3ZXOA 1BXDA 5BOCA 4BQGA 4XCJA 4I5SA 2PNRA 1PVGA 5J6AA 3SL2A 1L0OA 4YKQA 3OMUA 2ZDXA 4HZ5A 5CPHA 5M4NA 4AS9A 2E0AA 2YGEA 4GQTA 2Q8GA 4MP7A 5M4HA 2IWXA 3A0XA 2YEFA 4U7OA 3GIFA 2O1WA 4KSGA 4MPEA 1GKZA 5GGZA 3U2DA 1YT2A 4GFNA 3T10A 3TZ0A 4B7PA 3KE6A 5M4MA 4CE1A 1EA6A 3JZ3A 3C0EA 2K5BA 4ZVIA 4MBCA 1Y4UA 1MU5A 4PRXA 3R4MA 4KQVA 3EKOA 2QG2A 1NHHA 2YEIA 1TIDA 4BAEA 5M4PA 4GGLA 4EGIA 1UYIA 2BREA 3INWA 2O1VA 2Q8HA 4NH7A 3DGEA 4E01A 4CWOA 2XCMA 3LNUA 2WERA 4H7QA 2YKIA 2XJJA 4XTJA 1YC3A 2XDUA 4KFGA 2GFDA 2BRCA 4H85A 1TH8A 3IEDA 3B24A 3EHFA 2Q8FA 5CF0A 4JAUA 4EMVA 3G7EA 4R3MA 2YEDA 3RLRA 2CGFA 3TZ4A 2YJXA 3T0HA 3H4LA 4X9LA 4XKOA 3EKRA 4CWRA 3Q5JA 2EXLA 3R4OA 3O6OA 3G75A 3ZM7A 4EFUA 1I58A 4LWHA 1Y4SA 1I5AA 5F5RA 1UY9A 2JJCA 3EHJA 2YEHA 3A0WA 3K98A 3T2SA 1QY8A 4EGHA 4LWGA 4W7TA 4CWFA 3U2KA 3VHCA 4LWIA 2VCJA 4V26A 1R62A 3HYYA 1UYDA 4MB9A 2HCHA 1YSRA 4R1FA 2YEEA 2YI5A 5FNCA 1B62A 3G7BA 1I59A 2QF6A 5M4EA 1U2OA 4CWQA 3O2FA 4L93A 1TBWA 2CCUA 4KSHA 4LPBA 1YS3A 3R92A 3INXA 3TUHA 4CWPA 1H7UA 1AJ6A 4YKUA 4ASFA 3NMQA 3FT5A 4E02A 4EM7A 2IWUA 4B6CA 5M4KA 4O05A 3A0YA 2H8MA 3GIEA 2YI7A 5CTYA 3VHDA 1ZWHA 2WEQA 2FXSA 1UYCA 5BODA 4WUCA 4BIZA 4AWOA 4YKRA 4XITA 2XDSA 4HY6A 1YESA 2BU5A 2YEGA 3GIGA 4FCRA 4BQJA 4MOTA 2YKEA 4DZYA 5D7DA 5D6PA 1BGQA 3ZXQA 3PEJA 3QDDA 3FT8A 2YE6A 5IDMA 3R4PA 1YERA 3K97A 3EHHA 1UYGA 2XHRA 3BMYA 3D36A 3RKZA 4O07A 4E00A 2ZKJA 1BYQA 2BT0A 3K60A 3FV5A 2ZDYA 4YKXA 3EHGA 3ZKDA 4ZKIA 3GIGB 2IOQA 1AH6A 1UYMA 3VHAA 3OW6A 3D0BA 4XIRA 1UY8A 4P8OA 2XJGA 4YKZA 2YKJA 2WI2A 5L3JA 2XJXA 1I5BA 4MPCA 2YEAA 4KTNA 1GKXA 4HYPA 4CE2A 3C11A 1B3QA 4GCZA 4XDMA 1Y8PA 3CRKA 2WEPA 4XC0A 2VWCA 2FWYA 2CCTA 4CWTA 4QPKA 4L90A 1H7SA 2ZBKB 3MNRP 3WHAA 3K99A 2WI7A 1YT1A 5CTUA 1Y8OA 1UYKA 1UYHA 4LWFA 2ESAA 4CWSA 1A4HA 2BZ5A 4ASBA 1ZXMA 2YK9A 2WI1A 2YE9A 4ASGA 1UYFA 4O04A 2BU2A 4WUDA 1OSFA 4FMTA 1NHJA 2Q8IA 2O1UA 2HG1A 1I5CA 4AWPA 4H81A 1B63A 2WI5A 4WUBA 1BKNA 1UYLA 1S16A 3VADA 3OWBA 2XABA 2YE4A 1Z5CA 1YT0A 2C2AA 2XDKA 4UROA 4U7NA 3QTFA 4K4OA 3R91A 4URNA 2IOPA 2YEBA 2YJWA 4GEEA 3U67A 1Z5BA 2YKCA 2VCIA 4I3HA 4KP4A 3PEHA 2XX4A 4LP0A 2XDXA 2Q2EB 2YGAA 1TC6A 2YECA 5J71A 4P7AA 1QZRA 5F3KA 4FPPA 3CGYA 4QPJA 1EI1A 2FWZA 2H55A 4BXIA 3A0RA 1YSZA 4YKYA 3OPDA 5CTWA 3RLPA 2CCSA 2CH4A 3HYZA 2IORA 1UYEA 2XX5A 3HEKA 3CWVA 3O0IA 4FCQA 4HZ0A 4XKAA 5D6QA 4FCPA 4O0BA 4O09A 5IDJA 5C93A 4CE3A 1YC4A 1YC1A 3LPSA 2BU7A 1I5DA 4XE2A 2BTZA 4EFTA 2HKJA 2YE7A 4YKWA 4URMA 3B27A 2XHXA 2AKPA 4Q20A 5IN9A 2GQPA 3TZ2A 4U93A 3HZ5A 3B28A 4YKTA 2XHTA 1AMWA 4R3AA 2BYHA 2YE8A 4MP2A 2YGFA 3OWDA 1Y8NA 3T0ZA 3CGZA 4JASA
chains in the Genus database with same CATH superfamily
3LAKA 2OPSA 1BMQB 4LJMA 4LRDA 2EFOA 3CD5A 1YRXA 2FTRA 2ZE2B 1RT2B 5KG0A 2BM0A 3M8QA 5T7LB 1D9AA 3H40A 3P96A 1KNZA 1XR5A 3JSRA 3MEKA 2NPFA 2YKBA 2VPXB 1RT5A 1F3VA 1XR7A 2QIFA 4DV2F 1BWEA 3DHWC 3IR7B 3MPUB 4X65F 2EC2A 2WOMB 1HD0A 2DEJA 2BEFA 3HD2A 4K50A 3O8WA 4DG1A 4KRWA 1THNA 3DU6A 5IM0A 3NGUA 3B25A 6FDRA 4DN0A 1MN9A 2WI3A 4ALZA 5J2MB 4B9VA 3Q5LA 1KIJA 3SSQA 4QU7A 5GMDA 3D66A 1ID0A 2YE5A 1VQPS 4JI7J 4P75A 3BREA 4NLSA 1BGXT 3CCUS 3KLHA 1QSYA 5L38A 2UXDF 3W2VB 4OZNA 3CDEA 1Z59A 4C4WA 4DCPB 2PNRA 5J6AA 3C6TA 2Y1IA 2H5IB 1F51A 3V6JA 3GIFA 2AYBA 4J9OA 1GKZA 1X5TA 1YJ7A 2LQ8A 1JLEA 2MSSA 4CE1A 4YOEA 1LWEA 1UVJA 3V81A 1RTIB 2ZH1A 1TV6A 3MM8A 2Y8WA 4I2PB 3G82A 2RE1A 4PXEA 4XTJA 4A47A 3HHNB 3ISZA 3B6BA 3TOQA 5HL7Q 3IBFB 2W1BA 2XCAA 2FDNA 3D0GE 4LF6F 3MCSA 3BJYA 4DV1F 4DX5A 5EHHA 4EFUA 2HWIA 2ZBQA 3OHBA 3M6VA 5KFSA 5F41A 3MCMA 2HQCA 2MLYA 3BZQA 4J5OA 4KAIA 5L39A 1S10A 2FY1A 2Y8YA 3QFHA 3HM9A 5ETNA 4WIQA 2D69A 2BQUA 2CDQA 3A8EA 4Z37A 1KEKA 2CG4A 3G7BA 3WIVA 4H54A 3TZYA 2ALZA 4E02A 4RNOA 2IYIA 4NYZA 3V6HA 3LWLA 2VA3A 3CJQA 3TNVA 4B6CA 1LW2B 3SMZA 3IO1A 3H25A 4P52A 4FBUA 2H8MA 3HFVA 4CLZA 2RHQB 4LSLA 3FUYA 1ZWHA 3M8WA 3PACA 4WUCA 2ROPA 1L3TA 4LF4J 2PMHA 1HBNA 2QC3A 2BU5A 4MOTA 5D7DA 2R8HA 2FJDB 2JSXA 3HJFA 4I0WA 3MD1A 3FT8A 1FRJA 4MJKA 1CQMA 5L8RC 2EW9A 3EUNA 3T19A 4RU2A 3FV5A 4YKXA 1RT4A 2W4DA 4NXMF 4ZKIA 4MKAA 3M2RB 1RE1B 1U2FA 3RBXA 1LWFB 1OSCA 1BQMA 1HBUA 1W25A 2RDJA 2R8KA 1TFYA 4P2SA 4MPCA 2LKZA 5C7PA 1CJTA 1VRUA 1GKXA 1DAXA 1N5TA 1LFPA 4GKJF 4CLUA 3AD8C 2C3YA 2XHCA 1I94F 4NLTA 3IRXA 1LXJA 4ZJOA 3FEZA 4A8WA 4USTA 3DLEB 4DWIA 2ZZNA 3OFHA 2H5JB 1SJQA 3I0RB 4F7VA 1RAHB 4UOCA 3CW2C 1XMBA 4WUDA 1Q81T 3MCNA 4NLWA 2RMLA 5KFWA 1PO6A 4DR7J 2F8MA 2JOQA 2D41A 2CJKA 1RT1B 4C3KA 5DRKA 2BANB 2C3UA 5IC6B 4M95A 1RTJB 3L7OA 2YE4A 2FHJD 1YT0A 2ZH3A 2CJQA 3IBWA 2YJWA 1RKIA 5EN1A 2ZH4A 4FXVA 3PW7A 1HWLA 1OS5A 1NHKL 3WBZA 1UJ6A 2RU9A 3GU0A 3MAQA 3IXQA 1UVIA 1H7WA 2HFZA 4U8VA 4Z2XA 1YSZA 4ZVPB 2MQNA 1RDRA 4TYBA 1PKUA 4V19X 2R7VA 2POKA 1HFEL 5D6GA 1UA0A 3GYXB 3M9OB 4DF8A 3D3BJ 3PFOA 2Z30B 3TA2A 2M52A 1NSAA 3BYRA 4GC6A 3OQ2A 1RT2A 4P2FA 5T7LA 4C8ZA 4O3NA 2JNJA 1RZMA 1UVKA 1T02A 4F3QA 3FEXB 3U7JA 5HROB 1XMQF 4OIXA 3PO5A 1MN7A 2HHSA 1VLYA 4CWBA 1S1VA 3OJUA 2V2ZA 2BJDA 3B26A 4ETZA 1NSQA 2WOMA 1N5VA 4WFXA 2NCKL 3JSYA 5E3QA 1H2UX 4RUBA 1NKEA 1WHXA 2YWGA 1H74A 4KBIA 2MJUA 2DHSA 1RKJA 1JLGB 4LRAA 1KLNA 3DLJA 1T3NA 2MHEA 4C8LA 3PCOB 2FHOB 4QWBA 1SQGA 1U26A 1U02A 3W2VA 2QA4G 4FPRA 2B6AB 4J90A 4IRCA 1F2GA 4C0HA 1A6LA 2GIQA 3RLQA 1S14A 2CQHA 2DXEA 3TW0A 2FQQB 1F2HA 5DDPC 1Z2ZA 2E66A 5ETQA 4LF9F 1PVGA 4AQYF 4I67A 3BR8A 4XTTA 1U1NA 3CDAA 4KE5A 2BYCA 1RTIA 5IV4A 2VV5A 2HNYB 4MPEA 4I2PA 3H5YA 1F0XA 3FMWA 2ASJA 4MKVA 4EI2A 4EFAC 2CPIA 3N01A 1WEYA 3KJVB 3QRRA 1URRA 4CWOA 3IR5B 2R2RA 2DK2A 2LU1A 1SKUB 5LSOA 2HFOA 5DDOC 1HBOB 4HL9A 3FQKA 5LMNF 1SC3B 3G7EA 2DHGA 4J9LA 4DV6F 3N6NA 4YP3A 4UUXA 1U1LA 3DKDA 2X1AA 3CJ8A 1NZ8A 1VLOA 4W4MA 3G8QA 2HHTA 1R31A 2D9OA 4JV0A 3ISND 3V5RA 4LRBA 1YWXA 4O23A 3LGMA 4JUZA 2DISA 1LW2A 1TZ0A 4ZITA 2NXUA 4DMZA 4LQ3A 4F04B 1TKTB 2MLZA 1K0VA 4LSNB 1X31C 2DNOA 4LPBA 1LV5A 1SJFA 4HR2A 1H7UA 5H9EK 2R2SA 4DSIA 1E6YB 4F4WA 1XMOJ 4KTQA 1H3DA 1X4HA 4LMZA 2DR7A 5AXMA 4MIWA 2LMIA 1NH8A 2E1PA 1DURA 1S59A 3HK2A 3CCES 3D54A 4OZ1A 5KG3A 3M2RA 3AHPA 4EWTA 4PXDA 3LP0B 1LWFA 2DNNA 2H4WB 5ETRA 1M1GA 2GCFA 3UDLA 1QAYA 1G7CB 1UEVA 5HSPA 3T1HF 3FBEA 2KG1A 3SCIE 4B08A 2IAJB 3R3TA 2IRYA 1NKBA 3PHEA 2E7WA 4FYDA 1WKLA 2XJXA 2KT3A 3EM1A 3I0RA 4KTNA 3CJ4A 5MLCV 4HI2A 2NPIA 5IOLA 1MROB 4JI4J 5GMKa 1JLBB 1WC0A 1VR6A 4OHXA 1H7SA 3MPDA 2RRBA 4L3NA 4CO4A 3PDNA 5CD4A 3CCMS 1JWWA 1RT1A 4BWJA 2E5GA 2F8EX 2BANA 4LWFA 1N52B 1RTJA 2CA9A 1IR1A 3SDEA 2BU2A 3MR3A 1SJ1A 4OV6A 2A3JA 2UUTA 2YNFB 2VJUA 4DR6F 4UTGA 4JI6F 3W63A 4KKOB 2YTCA 3S8SA 4Y65A 2DO4A 1SL0A 1ZS6A 1EJ7L 3L95X 2YEBA 2DRBA 4R0EA 4Q5VA 1S1TB 2E1RA 4FVMA 4RL1A 4ZLPA 4CI0B 4IRDA 4CNYA 1VQ9S 5IQQA 3G6YA 2XDXA 3KYLA 4PG6A 1K0TA 4USIA 3CGYA 2L41A 2MLXA 5KFEA 4WYWA 3TX0A 4BLGA 1OPIA 1T9XA 3M7VA 2AJFE 1JKHB 2DHHA 4PKDB 3MM9B 3CCTA 3T9NA 2ZHOA 1YC4A 3GG1A 3CE8A 4A8YA 4K4WA 4L74A 3O1LA 3KG0A 1UL3A 1OMSA 5HROA 3HHKA 2GQPA 1HR0J 1RWMB 1N33F 2CAJA 2MPUA 3Q0AA 3NOCA 2JEGA 3GB0A 1SIZA 4CP5A 2OO4A 2HHQA 2NSBA 5AE1A 3UD4P 1Y8NA 4HH0A 1UAWA 3QGGA 3N0VA 1S72S 2KHCA 1UMJA 1H38A 1K73T 1JLGA 4K8RA 4X4OA 3UQSA 2D74B 5D4NA 4FF4A 2O01C 4L73A 4DHVA 2QN6B 3I9ZA 4IO1A 2B6AA 2KU7A 1IKVB 2BU6A 1WC3A 5FWKA 3KUGA 1WDTA 1KTQA 2CG9A 2DY1A 4QIEA 5IQ6A 1AA1B 1N32J 3PJWA 1SUQA 4LWEA 2A2CA 1YZ6A 2DNPA 2UXBJ 3CUNA 5FLXY 3V6DB 3EXCX 2A0FB 2RHSB 2N4DA 2WAQD 4ZVTB 2CJBA 1RWKB 2HNYA 3OHAA 5EWFA 3U1MA 5JVGQ 2VG6B 5BOCA 3CCJS 4OJ3A 3SL2A 1NK6A 2Q79A 2GVZB 2HHUA 2YNGA 2BR0A 3KJVA 1WOSA 1XJWB 4DUYF 5AE3A 2JFDA 3MM7B 4B7PA 3HSDA 3PW0A 3E51A 1HBOA 1E6VB 4KGXB 4ZVIA 2MB0B 1Q8BA 1FNXH 1NHHA 4F25A 3HKWA 2HAFA 1SV5B 3INWA 1JNRB 2LEPA 3QT7A 5A8WB 5KFMA 4RPFA 4X4SA 3PZPA 4C0OC 2E7VA 1YC3A 1YX2A 4CLFA 1DHMA 3NCRA 5I3UA 3M8SA 1TH8A 4M5HA 3NBPB 4ZKAA 3B24A 1WOOA 4JAUA 2MZJA 2HGLA 3RLRA 2OFGX 1YK9A 2R8JA 3TZ4A 3FRYA 2OGUA 3VR1A 4GVBA 4DPOA 3MPWA 3N28A 4PUOB 3H4BA 3PHTA 1U1OA 4LSNA 2AYGA 5HVGA 3Q8PB 4F4XA 1FNMA 5F8JA 1VISA 3H5SA 3K5LA 1Y9OA 4OHWA 1WI8A 3W8GA 2IIHA 5KFFA 4B3SJ 5M4EA 3O2FA 1TMMA 1D8ZA 2F7VA 3C15B 2ASLA 2Z2ZA 5HLFB 1HQ2A 4WFNQ 2IM1A 3NMQA 3OFGA 1F9HA 2IWUA 2KG0A 3W62A 3ITHB 2CPDA 3LP0A 3HMJG 1HNXF 1N8RT 3VHDA 2VONA 2FXSA 5KFCA 1TL7B 3HHDA 4EUVA 1JLAB 4RO0A 1H72C 5LXYA 1KLMB 1N0VC 1YJRA 4JI3F 4DR3J 3L7PA 2IAJA 3FNNA 5B08A 4G6VB 4DR5F 4E0DA 1WORA 3DXBA 4X4PA 1FESA 4E8UA 4PG4A 3R4PA 2VB6A 4J9QA 3W9JA 3MFHA 1A7GE 3K60A 4NRUA 1MROA 4G1IA 4MT1A 2CNOB 3MOZA 4DR4J 4NZ6A 3M8RA 1GFWB 3K17A 3QO9B 1M1HA 1FFWB 3MM5B 3DLKB 4HYPA 1NMEB 1HA1A 5C25B 3DM2B 3NNCA 3ZZUA 4ZLJA 4NEYA 2GFFA 3RU0A 2UUWA 2ZBKB 1I51B 1J5EJ 2YNFA 3PRBA 2UZAA 3VALA 2HG4A 1RAFB 1NB7A 2FJVA 3JXOA 2C2EA 1WELA 3R5AA 2XMVA 3MR7A 4U96A 3MI7X 4HLBA 1KVIA 2V4JB 2WI5A 3HFKA 4X64J 1VBKA 1CULB 1KVJA 4PPDA 4LSZB 4OJHA 2WB4A 3CCWA 3K58A 2XZDB 2DGVA 3DOLB 3NMAA 2CPZA 4RKUC 5L9XA 3NKYA 1RLCL 2RSQA 5KOWA 4I3HA 3EZ5A 1JKHA 4IR1A 1IR2A 4GKKJ 3MM9A 2I8EA 4IUFA 3OUYB 2PA3A 2YNHA 2KM8B 1I3OB 4PCQA 3W66A 1HI1A 2OMLA 3OPDA 4LFBJ 2CCSA 1CS4B 2WSFC 1TAUA 2XX5A 3H90A 4HDGA 3CWVA 1Y3JA 3Q2SC 3QJJA 4ETXA 2WW4A 4Z7YA 1ZAWA 1Q86T 4LF8J 1YC1A 3LPSA 3CMQA 1PIEA 1MMNA 3M30B 3B27A 4ECSA 4Q20A 2ZVIA 2JLFA 1ZTTA 1RCOB 3EGWB 3MMBA 4DCOB 4X4QA 2GA7A 4USVA 1U09A 2YE8A 3BSAA 1MMDA 1VDHA 4JASA 4ECZA 1NK7A 1QYEA 4HY1A 4JYAF 3UNGC 3QGHA 1OIAA 2XMMA 1R6VA 2E44A 2FC8A 2IDLA 1H6KX 3K7RA 2Y0BB 4A8XA 3SBMA 1HARA 4KT0C 3Q86A 3NY0A 2DH9A 2B9EA 5ETPA 4MFBB 1HMVB 4URSA 4NCAA 4OZ3A 1LOUA 3UCGA 3OFFA 2YI6A 4RZRA 3CCZA 4F4ZA 5E0OA 4ZS6A 1Q16B 2KYZA 1Y3KA 4QPXA 5CH7B 1N6QB 4J9VA 4IOAQ 2OD6A 3KHHA 2WI6A 3BM9A 3EXYA 4OI3A 3AB2B 5CA5A 1KSPA 2W2NP 1U0ZA 1GJVA 1GEHA 2OH2A 1R8PA 4AXJA 1VRTB 2GVZA 3OSNA 2HKEA 3AH6A 3MM7A 3S01A 1S12A 5D4LA 4DU7A 2ZOGA 2CQCA 2LDIA 4P7TA 2PC6A 3C6UB 2QGFB 3DGVA 4ZA1A 1SV5A 3KMQA 4LRCA 5A8WA 4NI2B 3U2DA 3QLHB 4YEAA 3NBPA 2HBYB 3UN3A 1TIDA 2AW0A 3KHRA 1RTHA 3DGEA 3NS6A 4Q45A 3DRRB 4J9UE 3KHLA 1P9YA 1GH8A 4PUOA 5EUHA 2GQQA 2B9XA 4M5JA 5AXNA 3M05A 2Q8FA 2VPZB 3KWMA 4YFUA 4HHHA 1QUPA 3HHEA 3J7Z5 2NXNA 5ETMA 4LRFA 3DYAB 2AGQA 2EFVA 3C15A 2GAHC 3U2KA 4F0MA 4C3MA 3Q8UA 1AUSL 3G4SS 5I42B 4YDXA 2HCHA 1B62A 1HPZA 2W2QP 1RT7B 4NRTA 2IA6A 4CWQA 1WEXA 1Q5VA 1TL7A 5DQIA 1SQEA 1R0CB 3SIPB 2QLWA 1U6FA 1PYTA 4DI6A 4NASA 4KV8B 4Q0BB 1APSA 3VGSA 2CRLA 2YVSA 4F0KA 3NOGA 4C8MA 4FCRA 1KC8T 4KFBB 3D6HB 1H73A 1X7VA 1XMQJ 2W01A 3KLFA 8AT1B 2YKNB 2WONB 3CJSA 3K97A 3QO9A 2XHRA 2NXEA 4ANCA 3MM5A 3DLKA 4KJIA 2QYCA 3EZUA 1OWXA 3DM2A 5DM7Q 3FKBA 3MGJA 3RAXA 4IDKB 2HRTA 4BDPA 2N7CA 4J9KA 4C0BA 5B0DA 1PAUB 4U6PA 3OW6A 2CQ1A 2XS5A 5L3JA 5ETLA 3ZZRA 4N8OA 3I32A 1FKOA 1EP4A 4CE2A 1RAOA 3TVYA 4U8YA 1F3FA 5H9EJ 3OJSA 2E7XA 2V4JA 4HDHA 4O3OA 3D67A 1VI7A 2WI7A 5FDLB 3DLBA 1Y8OA 3F44A 1UYHA 4CWSA 4WZQA 2KKHA 4DL0C 5BXIA 3HZEA 1WKKA 2CG8A 2YX4A 2O1UA 3WX4A 3DOLA 3VAKA 1UVNA 4HT7A 2XBPA 4C8YA 1MW7A 2DEIA 2C1EB 4N77A 3LTOA 4NLGA 4QCLA 3OUYA 4DPYA 3ENVA 1R89A 4F2SA 2CQBA 4FNHA 2OKQA 2GNKA 1IKYB 2F63A 3A4TA 3JYTB 4DL3A 1NKCA 4ICLB 3S6EA 2XX4A 1S0VA 5KAKA 4DPTA 3CJ2A 1I6JA 5F3KA 2DRAA 4QPJA 3J81U 1HWKA 3GV7B 4FYWB 4QWCA 3M30A 2XI3A 3KJQB 3UWTA 4CIOA 3IR6B 4BHQA 2X3DA 1UWAA 1T0TV 1FJCA 4HZ0A 5D6QA 5IDJA 1GX6A 3K89A 3RBDA 2ZH2A 1TELA 3MDFA 1V5IB 3K57A 4DV6J 3NRBA 3ILIA 1VIOA 2CDRB 3ET6B 2XC9A 4OQJA 4B9TA 4YR3A 5F0UA 1LK7A 4YKTA 2XHTA 2ZH8A 2QA2A 2C28A 3MURP 4R3AA 1FKPB 4MFBA 1FDDA 1YI2S 1DY3A 1HMVA 3GV8B 2ZH6A 2LA4A 4K5SA 1H98A 2FJXA 3DI6B 4K4XA 4UF4A 1YETA 5DLGA 1TUVA 5D78A 1KFDA 2DNMA 3E8OA 1Q8LA 1N6QA 4URLA 1SXLA 4DUHA 3PIOQ 3QWUA 2KB2A 3BO4A 4J91A 4LBIA 2YK2A 3AXKA 4CWNA 3A3NB 4XIPA 1S1UB 2FIUA 2NQPA 3I5AA 1VRTA 5CTXA 4ECVA 5KG4A 3KK2B 2M8DB 4N7TA 4NLUA 1VJQA 4ZPTR 4DEZA 2XSJB 2IWSA 3OTEA 6AT1B 2YE2A 3AQOA 3SQOP 1MG7A 2BU8A 1D09B 4X2BA 3JTOA 4E98A 1CSJA 1ZW9A 3DRYA 3C6UA 1UVMA 2ZFHA 4CYUB 2XWXA 4NI2A 1JLFA 5C5JA 2UUAJ 1S6QB 5EX3A 3QLHA 2GS8A 4HI1A 2VC0A 4HYKA 4ED2A 1NK9A 3RB4A 1PC4A 4WK3A 5M4HA 1JNZB 2M2BA 3DRRA 1YJVA 3CIZA 1KVKA 1CJUB 1DQAA 4RNHA 3TZ0A 2LXIA 1YJUA 1XQIA 4K2XA 1SC4B 2QG2A 3NGSA 2QT7A 4RBUA 5IZHA 3GV5B 4NLRA 2ZOMA 1SQFA 4FKYA 4K4UA 1RQ0A 3IM8A 1B70B 1GXLA 1HWJA 2AX1A 3VAGA 4DR6J 4B9NA 3DYAA 4JP8A 1TUWA 3MOJB 5I42A 3PJXA 1BQXA 1Y4SA 1RT7A 2JJCA 4O44A 5CCMA 2HAIA 3OV7A 4NL5A 3K98A 1FI4A 3QBCA 5DETA 2RQMA 4QW8A 3CJRA 4L76A 4V26A 2XHWA 3R5DA 4B3OB 1OQ3A 5AJ3F 3PNIA 1OYDA 1I59A 4C11A 1VBYA 4LFAJ 2XTJP 1B64A 1U2OA 2I2YA 3MHYA 5E3RA 1XERA 4DUZJ 4Q0BA 4ES3A 2F4VF 3JQJA 4WTOB 4KIAA 1Q0NA 1VQ4S 2I38A 3GIJA 3EJMA 4F0HA 5C2GA 2ZVSA 2MEWA 1TVRA 1FXDA 1HNVA 5I4MA 4KFBA 2WK4A 2HVDA 3HVWA 3KK1A 1X9WA 3OTCA 2YKNA 3JAMY 3VAFA 1N33J 2J6SA 2JVRA 2DJWA 1XIQA 4JI2J 3HDSA 2AJ2A 5IFMA 4IG0B 4ZPDA 4J9SA 1HBMB 2CVEA 2Z58B 4BQJA 4U7UD 5KFKA 4RW4A 2O66A 1Y7PA 2MQPA 3PEJA 3R2DJ 3SQGA 2D3OR 3TR5A 2GX8A 2XMWA 2VBYA 3FCVA 1WACA 3TRGA 3P6YC 4N56A 2KVIA 2KTQA 4ZCLA 1KOHA 4DQSA 3HXMA 2GIRA 2UVWA 2QLJB 1OYEA 1Q78A 5FDLA 4IOCQ 3Q8YA 4IR9A 3HT0A 4LF4F 2W4CA 5KT2A 4I6AA 1PG5B 4RNNA 3C16B 1IXMA 3EMTA 2VG5B 4IFVB 4PG8A 2E9ZA 4CO1A 1LWXA 3G71S 1A4HA 3AD7C 5HAOA 5CZVA 5CYMB 2HRYA 3QAUA 2HG1A 2DGWA 1IKYA 2N7YA 1RBOB 1U0SA 3BF4A 2ZM6F 2PMWA 4DXLA 1N5YB 3R6GB 2L08A 2FLPA 4TLQA 4GEEA 1WUUA 4DUYJ 1XR6A 5D0GA 5RUBA 4I2QA 1NBEB 2C1GA 4FPPA 1PJ6A 5F8IA 3GONA 2E5HA 5LL6d 3ET6A 1FDAA 1D3WA 3OL7A 4J9RA 3D6TB 3R5BA 3MEEB 1WG1A 1JLQB 4LF7J 1FKPA 2ZH5A 3ENWA 1RYSA 3MMJA 2XHXA 1EZZB 4WBFA 4K59A 2ZBPA 3N6LA 5KFJA 4ID8A 5KFPA 3WX8A 2B8PA 2ATLA 3KK3B 2EBEA 5CYJA 2VASA 2HK3A 2HQ3A 1TL5A 4W98A 3IA0A 1Q53A 2IFXA 3KTQA 1S1UA 2EI5A 5JVHQ 2K1RB 4CLSA 3T5LA 3MPVA 4IO9Q 2RNEA 3KK2A 4ECRA 4PL9A 5G0RB 1IBCB 1TKXB 4EMDA 1X5PA 4KY3A 3X3UA 2DCLA 1RBLA 1RAJA 2AJQA 2QA4S 1VRQC 4FS2A 1HNXJ 5CZXA 1GAOA 1UP1A 4L94A 4H4KA 4BIUA 1QUVA 2W7OA 1IM4A 1NK5A 5M2UA 2ASYA 3T1KA 4JAVA 3HSZA 3VVUA 3B8HA 3I5BA 3BV8A 4DR5J 3KNGA 2PE8A 1Q7YT 1S6QA 4IRKA 4PWWA 1RT3B 1NLKL 1S9GB 3M2UB 4NH9A 2FZCB 3IAM9 1X5OA 4K4VA 2P9CA 2YE3A 4XCLA 1NDCA 2E5JA 3Q23A 4NA3A 1CJUA 4W92B 4BQGA 1FWLA 4XCJA 2A6MA 5K8MA 2DGSA 2DO0A 3W5XA 2E0AA 4GQTA 2A10A 3BH6B 2Q8GA 1BC6A 1WHVA 5ITHA 4U7OA 4DX6A 1FNOA 1RHUB 2QL7B 4LREA 3NWRA 3K8WA 4XAKA 3C0EA 2D3UA 2DNKA 3THPA 1WSRA 1MU5A 1C0UB 3ZZZA 5M4PA 3R7BB 1WF2A 2IC3B 2RRNA 2VH7A 2BREA 4NH7A 3K59A 2K7KA 4E01A 4ED0A 1HYSB 2DR6A 4EZ9A 2BE9B 2VZ9A 2DXDA 3OT9A 2YKAA 2IRUA 2B0GA 1S77D 3HLUA 1KWMA 3IEDA 3CJ0A 4K5RA 5CF0A 1CLFA 4L72B 3GQCA 2EFGA 4X9LA 4B3OA 3DLLQ 2O67A 2CADA 4OX7A 3LAMA 3LP2B 1I58A 5F5RA 3NP5A 4DFJA 5KG6A 2VFVA 5C42B 4OHVA 1B99A 1BLUA 3PW5A 1BUXA 3HHLA 1SC1B 3BSCA 2LQJA 1RHJB 2DNGA 3QRQA 4L93A 2EK6A 2DR8A 1TBWA 2HNDB 4CWPA 2PFDA 4IG0A 1BY9A 1AJ6A 4OFZA 4ASFA 2HHHF 1HBMA 3I4PA 3IS9B 5AXKA 3T6BA 1GMUA 5THWA 1F60B 3PYDA 5HI7A 5KT3A 2HS4A 4A8FA 3M1VA 5DZ6A 4AWOA 5HANA 4YKRA 4R8UA 3NS5A 4NLQA 3EICA 3FCHA 1WF0A 1NHVA 4EYHB 4TXSA 5KFAA 2IJFA 3SFGA 4O0IA 1UYGA 4ZIVA 1QVGR 1M5OC 1AXQA 4JB8B 2BVZA 3C16A 4ZCIA 2VPWB 2JFKA 2VG5A 2UXCF 1RWVB 2MTLA 4IFVA 1XMOF 1ZM9A 3KLIB 5GADI 3VV2B 2FVSA 1SBRA 2R8IA 1U49A 2ADCA 2HHVA 2W8LA 1B3QA 2A1BA 1YBUA 3FK4A 5C24B 3QSYB 3RBZA 1N88A 2DXFA 2WEPA 4XC0A 4FXWA 2VWCA 4IG3B 4DX7A 4ER8A 1EAYC 1Y5IB 3OXGA 3K99A 4M94A 3J80U 3RR7A 3N5FA 1N5YA 4M5NA 4D3HA 2ERRA 4O04A 2VKRA 3G2XA 2Q8IA 1IWGA 2NZCA 3QYYA 5LT5A 1N0UA 1MNEA 4CH0S 3HFZB 2JEFA 2BJ9A 4B9UA 4KGZB 5DGAA 1D8YA 4DSKA 4HACB 1VQMS 2KL8A 4JI4F 1IR0A 4URNA 4AFFA 2MKIA 4YY3F 2IY5B 4NXNJ 2P6SA 3GIMA 2LQ5A 2BKOA 1SKRA 2E5IA 2VC1A 2JDJA 4BC9A 1NK0A 3M8YA 2GMHA 3MEEA 2N4CA 1OY9A 1UPPA 2CPFA 3DDKA 3AODA 1JLQA 2Q6BA 1EI1A 1X0FA 3D2WA 5K9FA 2G2YA 2H9ZA 3ICLA 2CJAA 2JC1A 4FCPA 1WOPA 3IG1A 2KN4A 4CE3A 3KLVA 3HJVA 1I5DA 3ENQA 1V5VA 1IM6A 3W5YA 3KK3A 2DIUA 4URMA 2KM8C 1SJRA 2YX7A 1SI9A 4DL4A 1FK9A 2J8AA 2K1RA 3PRDA 2B4PA 2DGUA 4OZ5A 3W65A 3G9CA 5G0RA 4PABA 1TKXA 4ASAA 1EIYB 2DKOB 3FCWA 1UY6A 5KFRA 5A8RB 1UEUA 3NNAA 1TC0A 3OW2R 2V0NA 1IKXB 1HR0F 3V4IB 2XX2A 2WB1D 4A46A 4K2JA 4UW2A 2V6AA 3BM7A 3FRZA 5KT4A 3IGNA 3MUVP 1RT3A 3HZ1A 1S9GA 3I82A 3M2UA 4RW7B 3EX7B 3GILA 2AJ0A 1PJ7A 1AH8A 3R4NA 4CQ1A 1Z5AA 3IP0A 2M5YA 1REGX 4ZLLA 3UW1A 3JTNA 1NM2A 1N48A 4JQLA 2YEJA 2MZQA 4F2RA 1VQ8S 2GMJA 3MMAB 4A8SA 4RW9A 1JMTA 1YBAA 2BQ3A 2GO8A 1HIYA 3CO0P 3N5BA 3IAS9 2X1FA 2H48B 3K8VA 1C0UA 2JLGA 5CPHA 3I55S 4IQXA 1L5UA 2R3VA 3BDPA 2IC3A 2NSCA 3D6FB 2YEFA 3HO1A 3MEGB 2EKNA 4F67A 1HYSA 1NDKA 1N32F 2GAGC 5A76A 1HNIB 4GFNA 2Y1RI 7AT1B 4PXCA 4LF5F 3K5NA 5KFQA 4GGLA 1ZAVA 1X4GA 5IC4B 3CD6S 4ZPCA 5DDQC 2XWYA 2FJWA 2XDUA 2DHAA 1S76D 3LP2A 2Q3PA 2ZD1B 4DV5J 3W61A 3DRPB 2OEJA 5C42A 2RQKA 1IKWB 4USHA 3K5OA 3EKRA 4CWRA 3QT5A 2CPJA 4DBQA 3C14B 1S9FA 2KI2A 2HLTA 4NA2A 4DL7A 1QY8A 3GLJA 4CM0A 3P45B 3T41A 4CWFA 4AL6A 2HNDA 4OJGA 2CWKA 4LWIA 3LA0A 1PBAA 5HMXA 1FEEA 2RILA 4DV0J 1R62A 2NS1B 1NRKA 3QSIA 4KQZA 3NG8A 2J8SA 4OYPA 2AEJA 3O6QA 2FY8A 3ONQA 2RS8A 2QF6A 3M4XA 3R9LA 4KPYA 1FKAF 1YJTA 3D68A 3K0JA 1KRPA 3AJ1A 5DG7A 3H98A 4CO5A 1FEHA 2Y1JA 4X4UA 2IPOB 3CCQS 4KYZA 2I5JB 5KFLA 1KDNA 1Y4ZB 4HY6A 1SJ3P 3VAHA 4R5PA 3VTIA 2YKEA 4B3SF 2J9EA 3G6XA 2HEKA 3KLIA 2MMYA 4QYZK 1JQGA 3G8SA 2AD9A 3LALA 1YSJA 4H4OA 1RABB 5C24A 4TU8A 1TL1B 2PT0A 4IG3A 1T9TA 1HNZF 4OYZA 4P8OA 2VBZA 1AZSB 3OL9A 1D0EA 3RB3A 3HZGA 3PKYA 2Y9HA 4RW8A 3CRKA 5J2PB 3AA9A 2R7SA 3K5PA 1VQ6S 1LNQA 4B3MJ 1C1BB 4UOFA 1YT1A 2YQ0A 3OPKA 2BZ5A 2CQDA 2YE9A 3H20A 2J9DA 2QRRA 2QL5B 1ICEB 2MDAA 4QWDA 4DR4F 4CDIA 4MAKA 2AHOB 2ROEA 3R1LA 4JOUA 1OPZA 4KHMA 3EYZA 4WUBA 2KDOA 4DFKA 4DL6A 2FJAB 3M2VB 1M1KT 1O5JA 4OMFG 3A1YG 2MKCA 1QJHA 3CJKB 4IQMA 4UROA 3UD5A 4WWSA 3UNYA 3QTFA 4ZK7M 4ID5B 1L3SA 1J5EF 4NZ0A 3PTWA 4AYBD 4FN5A 3ZXWA 2VCIA 2PA8D 2A2DA 5LMUJ 3KKFA 1F5AA 1KP6A 2F3JA 3OXFA 1XNRJ 2R7XA 2YY3A 1HW8A 3BPSP 4X64F 4IKAA 5L1KA 3HEKA 3UDCA 3VF0B 2KZMA 3BGRB 5HN0A 4ZJLA 3GP9A 3CC7S 2BA9A 4DR1F 1FD2A 3CNQP 2XY6A 3DN9A 4NCBA 1YJWS 1SVDA 4X4RA 1Q8IA 3TUZC 2CQGA 5HQLA 1X4DA 2G13A 1MWYA 2VKZG 1Q5YA 4GKKF 3TZZA 1QTNB 2PSZA 2V94A 4NCGB 4GMKA 2LXFA 4FPIA 2X1BA 3ZZ0A 1IJFB 1R8BA 2YGFA 3OWDA 2PDAA 4LFBF 5IS2A 1IKXA 2IBKA 5KT6A 1NXIA 1CJKB 3V4IA 2RU3A 3VQSA 3A0ZA 1R6YA 3MF5A 4LT6A 1VIXA 5AJ3J 1B0VA 4LF8F 1WHYA 2K2PA 4RX6A 3UDVA 4CZCA 2YWFA 1H2TZ 4RW7A 4E2FB 2F4VJ 3FDSA 4XKKA 1SC6A 2Z8QA 3H2LA 4NLDA 3LF0A 3H80A 3QPIA 2ZNZA 2CQIA 3AA8A 3PW2A 2VODA 2WW8A 2VFUA 4I7FA 3VCDA 2FYXA 1OJ4A 4MK7A 1GMVA 2B5JB 2MZRA 4M8LA 1NH7A 1T3OA 1T9YA 1V3ZA 2FC9A 3NAIA 1VQLS 2Y1LB 2WHOA 1B7FA 2MQLA 3OBIA 4FZVA 1B4SA 3TI0A 2VG7B 4UY8T 2IM0A 3PKMA 1YBTA 3MEGA 4B02A 2JEIA 5B09A 2DHXA 1HNIA 4L8ZA 1MU2B 3P5TL 3BBCA 5J2QB 4YB6A 2Z2LA 4YKQA 4URQU 3WHIA 3T9ZA 4C3LA 4ITSA 4TYAA 3BSNA 2MKJA 4P2XA 1FJGJ 2DPJA 4H4KC 4KH1B 1NK4A 2JEJA 1DARA 2AF6A 4WU2A 4MBCA 2ZD1A 2D3O1 4WE1B 1NJIT 3DRPA 2VD3A 1U1QA 3GMGA 2XCPA 2BJ8A 1IKWA 3DCAA 3CC4S 1SKWA 2WCXA 3GFZA 4NLYA 2WERA 2QLFB 3C14A 4BBYA 4XDCA 2C2RA 1CBKA 1CVJA 1M5SA 2DBBA 4PPZA 2ZM6J 1U8WA 3OTOF 3TZWA 3M9MB 1FRIA 2YJXA 2CNKB 5A2QU 3KG4A 2RKIA 2C2ZB 2V68A 5F9LA 3M8PB 3VQTA 1AFIA 2DB1A 1MSWD 3OXLA 1MLAA 1RISA 5HJXA 4DS4A 1MWQA 1CC8A 1NPRA 4XPCA 1YSRA 1NEEA 1DZ5A 3I4HX 3OVSA 2VDHA 2J0QD 3HD1A 1RWNB 2I5JA 2PIIA 4DV4F 1UWBA 1CPZA 3N4WA 5GAHU 2Z4PA 1ZM4A 1S6PB 1RWPB 2FZGB 2G2OA 3UCUP 5IWAF 3AT1B 1Q1KA 2V9KA 5JJBA 2XLIA 2JVOA 1ZA2B 2R2UA 3UN2A 2Y0SD 2HQDA 3NGTA 3M32B 4PQAA 2KXNB 2HIYA 4RUAA 3KLEB 1AZSA 3HHLC 4O4GB 4N5SA 3BMYA 3NGKA 2ZKJA 4G3IA 4C8KA 3AD9C 4KHRA 3SV3A 1WC4A 1VC6A 5J2PA 1TU0B 4YHHF 5ETSA 2ZE2A 1UYMA 2KFYA 2DITA 5H9FK 4EBEA 2V8HA 4V1Ak 4DL2A 4LBPA 3PRVA 2I9SA 4F36A 2K3IA 2M7SA 4QIVA 1UVLA 5E3CA 1ZPWX 3FSYA 1GNKA 3CULA 4WU3A 5CTUA 4OL8A 3M2VA 5JENA 3V4MA 5BYQA 1D9FA 2NUHA 2R2TA 1UYFA 3CJKA 2ZBIA 2DY9A 3OR2B 2W2MP 1ZM3A 3H42A 4M63A 4R0JA 4ID5A 2J9DE 2BOPA 5J2MA 2QV6A 3H59A 2XO7A 2EK1A 1RTZA 4DFPA 2HFSA 3CCSS 2C2AA 3GG0A 1FDBA 4X62J 2DTJA 1EKRA 3QT8A 4K4OA 3OLBA 4K0KJ 2OPPB 2ACYA 4JV1A 3BGRA 2Q2EB 1FO1A 4NLVA 2B8QA 1T7PA 4M5MA 1QDUB 2HZVA 4F4KA 3W5ZA 3TJAA 1FRHA 1PILA 2GZOA 3DRSB 4PXBA 6FD1A 3LQVA 2RRAA 3HX9A 2CWXA 5T14A 4NCGA 3BDEA 1AYEA 1VGYA 1S7HA 4TY9A 3D6MB 3D0HE 5EWGA 3ZNUA 4ZP6A 3LH2S 4F3MA 1W26A 4DZDA 4U93A 3TZ2A 4OYBA 2DD8S 1T94A 2EFQA 3CCVS 3B28A 1EARA 1AMWA 5HQ8A 2XLKA 2ILZA 2AEFA 2BYHA 4MP2A 2LQBA 4M1KA 4MIAA 3CGZA 5AT1B 4B9MA 2GJFA 5HP1B 4MPNA 2CPHA 1HNWF 4AWQA 3CCRS 1RU2A 1QAJA 4ZN1A 4USKA 2RQCA 5EWEA 3BO3A 2GHPA 4USMA 4QR1A 2B5JA 3HF5A 2HHHJ 2MKHA 4XD8A 4ZCKA 3VZHA 3W9HA 3A12A 1VQOS 1I5OB 4C8NA 3QFWA 3QGPA 4GRSA 1VC0A 1KTVA 1F5CA 4EGKA 3PR4A 3W2WB 3R5JB 1MU2A 2GJ2A 5J2QA 2XK2A 4J9NA 1TAQA 3AFGA 2N3OA 1U45A 2AJ1A 2HGMA 4XPEA 3CPWR 2QLXA 2BKPA 4NH8A 3KUEA 1TKZB 3TWZA 3FQLA 3VHQA 4HT5A 5HO4A 2DH7A 3HT3A 3IN5A 3JS9A 2P6TA 1YTYA 4ED3A 2UXCJ 1A9NB 1J2VA 4I5SA 2WVDA 2NYIA 4WE1A 3OMUA 1GXUA 1N56A 4AS9A 2DCUB 3R2CJ 3A0XA 3PIPQ 2FVRA 4KGKA 2V67A 2EG2A 3FSIA 4WFAQ 2W7PA 5CHCB 3RGIA 3J7YU 4KQVA 4WP3A 5J1PA 2YEIA 3PYFA 2V9WA 4DQQA 3R6LB 2VUGA 3M9NB 4B3TJ 2UUAF 2B4OA 3M8PA 3GJTB 3OL8A 3DLEA 4H85A 4P73A 2XO6A 1JX4A 4EMVA 2QL9B 2RF2B 3KDOA 4JI5F 1KFSA 2PEBA 3T0HA 3Q8RB 4PYDA 2OPSB 4RWWA 1GT8A 4ILLA 4L6V3 3NLCA 1HHQA 4YY3J 1UY9A 3OL6A 3T2SA 2C42A 4NMXA 3SEOA 4A48A 2HWTA 2V63A 4Y28C 1KOOA 2YPZA 3W7BA 4OX6A 4FYXB 3IC1A 1G3OA 5M2RA 3J81Y 2MSTA 4KSHA 1S6OA 2BACA 5KFZA 1SPBP 2HFVA 7FD1A 2R8GA 3M32A 4JV5J 2B9YA 3KLEA 1ZBTA 1TK8A 4O4GA 1W2IA 2L3MA 1ZH5A 2XDSA 3UVJB 4XIUA 3KLHB 2J9CA 3B82A 4OYOA 4IFYB 3ILJA 4N47A 5D6PA 1BGQA 4LFAF 2GHWA 1P6TA 2MKYA 4HTIA 4DUZF 3QDDA 4KB7A 3TUIC 4E00A 4QPTA 1HKAA 4NLXA 2I1RA 3RW6A 1U0HB 5HVHA 3CGIA 3NXZA 2VFTA 2NUUG 2XJGA 4JI2F 1QD1A 3RBEA 3TEHB 2XY7A 2BBEA 4C48A 1IQZA 4BS2A 3D0IE 2EG1A 4DV7J 3CJ3A 1S7IA 3X1LB 1W7WA 4L90A 1LFWA 5GAEU 3M6XA 3WHAA 1LQ9A 2GC8A 2KHDA 2CQ4A 1U1RA 2GVDB 1O6XA 3H2VE 2WI1A 1OSFA 1NHJA 5F8LA 2PEHA 1RP5A 2GMLA 2OPPA 1LWCB 2AWZA 1N5QA 1YIJS 2WVBA 4WYLA 2EEYA 2B4VA 4HEA9 4C97A 4QYZJ 2W2PP 2XABA 1ELOA 3POTB 4KR0B 1YDLA 4Y2IA 3GSIA 2FLNA 2N3LA 3C19A 2R7OA 3DRSA 4Q2LA 1Z5BA 1HD1A 4WK1A 2LU2A 1NPPA 3G96A 4LP0A 2WSEC 4X66J 1TC6A 3CC2S 4LF5J 3W3SA 5LM7E 4RUCA 3CMAS 2MGZB 1HHTP 3A0RA 2B4UA 2VIHA 3DRXA 2HFUA 3ETOA 5T41A 1RCXB 2V8VA 4LSLB 1YRTA 1FRLA 1T95A 4Z7CA 4B9SA 1R0AB 1S1XB 4XE2A 2BTZA 4EFTA 3GFHA 5KG5A 3W60A 3PYGA 4K4YA 3MMCB 5HP1A 2YWKA 4NZ7A 1P9QC 5L1LA 3EWGA 1WWHA 4NOHA 3W64A 2VHGA 4PG7A 2JC0A 3T0ZA 2V50A 3BN7A 1NO8A 1RT4B 2ZJRQ 2OPQB 2GHVC 2FJBB 1GQEA 2LFVA 4P7VA 1V3SA 4HHUA 4RWXA 1BQMB 4RJVA 1Y5LB 4ENOA 1JXEA 4LF7F 3CDWA 3E3XA 2R7TA 4HXWA 4CH7A 4X4NA 3B4DA 3Q5KA 3IGVA 3W2WA 2GV1A 2HQIA 2VQEF 2IDEA 1WC6A 1TKTA 4U95A 3OVBA 2BSMA 2HMIB 3Q89A 2QG9B 3I31A 2IMOA 1FCAA 1R8CA 3E2EA 5J1NA 1FDNA 3CSKA 1HQUB 3PFEA 1E6YA 2G9OA 2LCWA 2YI0A 2DNRA 1X4AA 2B56A 2O1PA 2IVMA 4BC7A 2XM3A 2G0CA 2XQCA 2JZ5A 1PAEX 5B0EA 5I3QA 4DPWA 3C8YA 3AOAA 3KOAA 1VHIA 4Y2KA 1AW0A 4DQRA 2BJEA 3CO9A 1NJWA 4OHYA 3F73A 4WFYA 5DQGA 1XC9A 4ZPVR 1HNZJ 1XK8A 1LEOA 4PR6A 4C98A 2KYXA 5A6PA 4ED1A 3HSJA 4DLEA 2X51A 4DF4A 4DR2F 3BQ2A 3A3PB 4HTJA 3TX8A 3Q83A 4W90B 1HW9A 4PRXA 4NA1A 2RS2A 3TYTA 2KVQE 1RWWB 2RF2A 2MQQA 2J76E 1M90T 1O8BA 4R25A 5KFGA 1ULRA 1C4AA 2P8IA 2CKWA 3SI8A 1JLBA 3AJDA 1RHRB 1RYRA 2J7UA 3UI3A 2HPUA 2YH1A 4UZBA 2YKIA 4PG5A 2V34A 5HQMA 4KFGA 3KFWX 2AP6A 3UO0A 2WVCA 4TU7A 4WF9Q 4ECXA 2V5HG 1S99A 2CGFA 2FUG9 3T6JA 2V8PA 2YWWA 2KFNA 1S48A 1QAXA 5KOXA 2C2KB 3NMRA 4J37A 1S1VB 3EHJA 4KKOA 3I5CA 2K3KA 2XYHB 4DSEA 1VQNS 3CDBA 4IOBA 4ELTA 3PV8A 4EBCA 3RRHA 4Y34A 2V8GA 2PO4A 1S1TA 3BO2A 3OR1B 4AD6A 5F8MA 2R7WA 4M5KA 4ERDA 4KGMA 2PD1A 1QLNA 1YS3A 3TUHA 2XULA 4ZJQA 5GAHI 3A8JA 4DR1J 3UVJA 1FT8A 3FT5A 2CYYA 2LQ9A 2OELA 4IFYA 3THTA 1VJWA 2QA1A 1S1WB 2MQ8A 3O5TB 4A8QA 1VQ7S 1AB8A 3DNCA 3RR8A 2WEQA 2J7KA 4TQRA 1EQMA 4I69A 4UQTA 2CJXB 1FRMA 1YESA 2H1YA 5L9NA 1U0HA 1B0PA 2YEGA 1T9VA 1SJ4P 3H4DA 2YXLA 3ZXQA 1CG2A 2IM3A 2BX6A 4TQSA 4MK9A 3DXSX 2Z57B 3QJLA 3TZXA 5BR8F 2OLWA 3H8YA 1JLCB 3P3DA 3SCKE 2MHNA 5F9NA 2OP5A 4RNFA 3D0BA 5DZ7A 1UY8A 2YKJA 2WI2A 1YG0A 2EFNA 3V6KA 1FX2A 2GVDA 2EFPA 2CJYB 4JBCA 1CQNA 4Y6IA 4U7CA 1WKJA 5EX0A 1IWAA 2FWYA 2DGQA 1LWCA 3CB4A 1IKVA 3NGRA 4OLPA 4F8RA 5LJ5Y 1BWVA 3POTA 4I1TA 1S0MA 2PN6A 4A4JA 4AWPA 1UZHA 2OUGA 2W8KA 2FLLA 3OSPA 1DQ9A 4U67Q 3KHGA 2IYGA 5LJ3Y 2YWHA 2RUSA 2BQRA 2M70A 4ED7A 2HBZB 1P27B 3V6DA 4B3RF 1Z5CA 1WEZA 3HVRA 4MYUA 3DOMB 2XDKA 3A3OB 2ZHBA 1VYAA 4UUWA 1SH3A 3S1TA 5ETOA 3R91A 2MGZA 3U67A 3FBCA 2OSQA 2VG6A 4OX9F 1FJ7A 2E5LJ 4YS2A 2UV8G 4Y3CA 5H9FJ 5C2CA 2RT3A 1R0AA 1S1XA 3FZBA 1QE1B 2VQFF 4CT8A 4QIWD 3MMCA 2UUCJ 5IT9U 4CLPA 2LVWA 3L7UA 1E6VA 3R7NB 4O0BA 2K06A 2ZITA 2HBQB 1SCJB 5J2NB 3E01B 4OYIA 4LF2A 3BB5A 1U24A 4I4BA 3OTOJ 2F9JA 2OEMA 3ZTOA 2EBGA 4NXNF 3JQKA 4JI0J 4LUBA 2GIFA 2OPQA 2OAUA 1PJ5A 1D1UA 2ALYB 5DO2A 2CZ9A 2GQ2A 4ZVUB 5L1JA 1NDLA 4IH7A 4K4ZA 4AL5A 4Q43A 3FJ2A 5JUMA 1YRUA 3VGUA 4L75A 2L9NA 2YBVA 1A0OB 4CRJA 1ZM2A 3TA0A 4OYMA 4DDFA 1ZA1B 1OQ6A 2HMIA 3D2RA 4MK8A 2W9CB 1FERA 4DV4J 3G87A 3L3CA 5CXTA 2XD6A 2MJNA 1HQUA 1WI6A 2DR5A 1QVFR 2ZUGA 1RA6A 4FF1A 2MZ1A 2A6OA 5IWAJ 3ULHA 3LO3A 4V25A 1DLOB 2ZEJA 5HLFA 4AT1B 3SDEB 1IBLJ 3PW4A 2FGOA 2XGQA 4WP8A 2XMJA 3EVWA 3ITHA 1OY6A 2ZWOA 3TTZA 1KHVA 3ZO7A 4HXZA 2ABYA 1UY7A 4EEHA 1JLAA 2HHWA 1KLMA 3CMES 4YMEA 1FFGB 4USUA 4YHHJ 2I6WA 1PYSB 4EU0A 3W8PA 1J5OB 3BBBA 4E72A 3PYEA 4LQ9A 4MP7A 2IWXA 1TFWA 1UW9A 3MTKA 3NAHA 1KQKA 1M5PC 3TAPA 2OMOA 4LF1A 1PYOB 3KE6A 5M4MA 3J7YI 4UT4A 4F4YA 5KT5A 2RD5C 1UYIA 5C25A 1RTDB 3I96A 1GMWA 4JI1J 3ZZTA 3QZ8A 4WJBA 3J80Y 1NJYA 2ZNYA 3I0SB 2Y3YA 4XDDA 2R9LA 2WBMA 4R3MA 2YEDA 4A8OA 1RAGB 5KG1A 1FX4A 2K8GA 3BYPA 1IUJA 4OHZA 1QAIA 3Q5JA 3R4OA 2X3GA 3OR1A 2W4PA 4XK8C 2MKSA 2AZ1A 5JMNA 2VL1A 1CULA 4LWGA 4FNIA 2HYIB 2HS3A 2FHKA 1UYDA 3ZFVA 4FS1A 3PVXA 4Q8EA 2YEEA 3R1HA 4DV5F 1S1WA 1AUDA 2CCUA 4DN9A 2MYFA 4LIRA 2B43A 3AQPA 5DM6Q 4DUTA 1BHNA 1HWUA 2AEMA 3BQ1A 3VAJA 1CS4A 2AQ4A 5M4KA 4ZVFA 1SUQB 5KFOA 2HVHA 2UP1A 1TMJA 3MR5A 3GJSB 1UYCA 3GYGA 4DV0F 2V69A 5HMYA 2BE2B 2XGPA 3QZ7A 1JLCA 1R3NA 3MPYA 1KBRA 1HNWJ 2BDPA 5IDMA 3FBFA 3D36A 3RRKA 1BYQA 1GTHA 4CO3A 2YNGB 4MKBA 1S0NA 1RT6B 5F8HA 2R42A 2M88A 2KT2A 2OD4A 1K1QA 4XIRA 4HH1A 1F5BA 2H54B 2KZZA 4EZ6A 4PRFA 2QX0A 5BYSA 4DX8H 3GYNA 4A8MP 2F5GA 1Y8PA 3T5HA 4UZCA 3PO4A 4I56A 2NLWA 5GAEI 4OI2A 1NSKL 4DU8A 4ANDA 4WZMA 3MAHA 5I3UB 3VAIA 1REVB 1UYKA 2ESAA 4ATNA 4CH1A 4Y2MA 1OO0B 1ZOTA 3DOMA 3U1NA 2P9EA 2WVFA 1H0HB 3BKTA 2PI5A 4GVBB 2UVUA 2C2OB 1BKNA 5JXSA 3JB9k 2BW7A 4DFMA 4YUDA 1XNQJ 4LR9A 2QMWA 3MWBA 2XNQA 1NAQA 1QE1A 2J6TA 4B3MF 1V3RA 2G1HA 2Z0GA 2AYMA 2C2DA 5D0HA 2M4MA 3NCQA 1FVQA 3Q2TC 5J2NA 3E01A 3J7ZT 4ZVGA 3LGHA 2DNYA 2H55A 5B0AA 4DS5A 2KH9A 5K20B 5CYQB 1U8SA 2M3DA 4FCQA 1R7IA 3O3LA 1R43A 2BRKA 3AAWB 4JI5J 3HHLD 4YKWA 2BOAA 2CIMA 1RI7A 2KJWA 2ZWPA 2AKPA 1G4CA 3BKFA 5LMUF 2ZC4A 3BEGB 2M0GB 2YKMB 2WRMA 1XNRF 4H4MB 1C2PA 3GCXP 5D4PA 2W9CA 2RDIA 2ZZMA 3PX6A 3Q8VA 1JB0C 4WP9A 5GAGU 4N8NA 2M9KA 3CD0A 3SFUA 4I6WA 8RUCA 4DCJB 1DLOA 3UR3C 2AX0A 1NUEA 1B3TA 1WJ9A 3QATA 2BYIA 5AXLA 4WCEQ 1KZNA 1ZETA 1M0SA 3D5MA 2FPHX 2WZ1A 5MAOA 2ZKUA 3WC2A 5FNFA 5E33A 2V8DA 3HHUA 5B0GA 2UUBJ 2OJ3A 1TILA 2UWDA 2LLZA 4ZN3A 3WQ9A 2AMCB 3KMSA 4KV8A 1J5OA 2B51A 5D7CA 5G4DA 1J27A 1I1GA 1XN9A 1LKZA 4DLGA 2AU0A 2HZCA 3MR6A 3FFIB 5D77A 3RB0A 3DDNA 2WONA 2MQMA 3WDOA 1L0OA 1FE4A 2LEBA 2YNHB 3TUPA 1VK3A 4GVLA 1RTDA 2E9RX 4IDKA 3R5GA 4QQBA 4KSGA 5HBMB 2VJVA 1KR4A 1K44A 1EA6A 2Z2MA 3JZ3A 3I0SA 4ECYA 5CD4H 2K5BA 3SCJE 1Y4UA 4GC7A 4ES1A 4WXWA 4USWA 3TA1A 1RB0A 4G65A 2FHJA 4OZJA 2C1IA 3LW5C 5D0EA 1RAAB 4ZPBA 4RW6B 4F50A 2BRCA 4UQGA 3VGVA 3MMBB 2HW3A 5ETTA 3T1AA 2VBWA 3N79A 4ZVEA 4ZCMA 3CXCR 1FJGF 3H4LA 2VFSA 1C4CA 3RYLA 2HHXA 2HNZB 1C1CB 3O6OA 1WTBA 4LWHA 2IHR1 3SV4A 2GJIA 4TY8B 3US5A 1IBKJ 3A0WA 2KRBA 1XWLA 1BD6A 5SUHA 4KO0B 4CNZA 2VCJA 2Q66A 3OFEA 1TK0A 3TVZA 3JYTA 1RUSA 1T9UA 4PQUB 4ICLA 2EVZA 2HVEA 3LOUA 1EQ0A 3T1YJ 3CJTA 1K8AT 3A8IA 2ZBCA 2W9BB 1TK5A 2BE2A 3DMJB 4O05A 2ROGA 3AOBA 2B7CB 3N6MA 4LR8A 4ECWA 1RHKB 3PM9A 3QJPA 1FRXA 4QJVA 1EHWA 2C22A 5KFUA 4MH8A 3T5KA 2HHIA 1RT6A 3NGDA 5DJBA 5A8KB 5L46A 2BMBA 2JH3A 1YERA 1RADB 1IN0A 2B7BB 4XO0A 3RKZA 4O07A 3QNWB 4Y2AA 2QJ3A 2PFFB 3BGLA 3UE2A 3EHGA 2YNIB 3ZKDA 3GIGB 3DI6A 3WZ0A 2JHEA 1VK8A 2YPYA 1FE0A 3SXLA 4WKYA 2VQEJ 1REVA 3LUYA 1TR0A 2F65A 2YEAA 2IMWP 1G2EA 2QEXS 4LBHA 5J1EB 1RTHB 2G4BA 1UFWA 1YGYA 1KN6A 2CCTA 4CWTA 1F1BB 2Q6CA 2QZ8A 3UR0A 4HVZA 4ED4A 4ASBA 1ZXMA 2YK9A 4UOHA 4ILRA 4TLRA 2EC0A 2QSWA 4NEZA 2XSJA 3QWPA 5HVFA 3ELHA 3MECB 3BR9A 1RWXB 1B63A 1V9OA 3QGIA 2ZJPQ 4ZVHA 4P6QA 1G1XA 2KXFA 2BUNA 3HVTB 3OWBA 3IRWP 1N34F 4DQPA 2AJ4A 4CYUA 2G0JA 9RUBA 3PJ9A 1SIWB 4DR2J 1HPZB 4OI1A 5CYQA 1UZDA 1IVZA 2YKPA 2YGAA 3ZZPA 4CTAB 1ITPA 1CEZA 4BXIA 3CWJA 4N41A 2FGCA 1UFLA 2ZOFA 4PZVA 2CUYA 3RLPA 4UOGA 3TAMB 2IORA 2DNQA 1UYEA 1IBMF 3RUBL 3UCZP 5KFHA 2YKMA 3H2UB 1S4FA 4XKAA 1U7LA 5LOQA 2ZH7A 3D3CJ 2H3EB 4X62F 4H4MA 5D4OA 4C9DA 4K0KF 3GJRB 1VS3A 4Y0FA 2RB7A 3KLFB 4DV2J 1YVFA 4Q2MA 1S9EB 3EGZA 2AGPA 5K5MA 2DYAA 3Q8QB 5A2QY 4X65J 5I3PA 4DSFA 3DC2A 2QG0A 1GXTA 1BXNA 2H4YB 1YQHA 3EDRB 1S49A 1S97A 5CAAA 2I0XA 1Y11A 2FB0A 2RDDA 1RXOB 1X4BA 1FKOB 1EP4B 3UDEA 4OZ0A 1N36F 1DTQB 5FD1A 4HHJA 1SL1A 4CLWA 2OI2A 1WDDA 4JI8F 2UXDJ 4ZHRB 3BGUA 4XIQA 5D7RA 3R27A 3ZKBA 4PRVA 4B17A 4EYIB 2D3ZA 1HWIA 3CF5Q 5IT4A 1FTRA 5FIIA 1SH0A 4LIWA 4CLKA 1CJVB 1UW4A 3FFIA 1ZXNA 5EDWA 1UA1A 1KHWA 2ASDA 1IXKA 2WI4A 1DJ0A 2BZ2A 2LECA 2ZUAA 4TU9A 1YLXA 1XBWA 5HBMA 1MX0A 4ILMA 5BR8J 5B0FA 2XI2A 2LYVA 2XS2A 1RWOB 1QM9A 2YGEA 2IM2A 4LF6J 5E3PA 4DV1J 1YT2A 2U2FA 4RW6A 1U1KA 4Q44A 3I6PA 2VOPA 2BW2A 4M5IA 2OPRB 3NWGA 1TL4A 3R4MA 2N82B 3IWXA 2RH3A 4Q8FA 4EGIA 3ZZOA 1FFSB 2ILYA 2O1VA 1U1PA 4IH5A 2RVJA 1Y10A 1ZYQA 2XNRA 4N76A 2HNZA 1C1CA 4J7CA 4QOTA 3ILOA 5L1IA 3CYGA 1EX8A 2HFNA 4TY8A 1WC1A 2QYGA 5B7WA 4S0MA 3EVOA 2VPYB 4KO0A 4LFCF 4B3RJ 5CYMA 3DDIA 2V4RA 4MIBA 4NLPA 3G75A 4NE9C 2CQ2A 4ZVQB 1RAEB 1KQFB 2HVIA 2F8HA 2VDIA 4PQUA 1I5AA 4OX9J 3TEGA 2MY7A 1HHSA 2W9BA 4DSLA 4B3TF 2DGTA 1ZAXA 3QAEA 3KG1A 4ZOSA 4R1FA 2YI5A 2VQFJ 4YN3B 3DMJA 1RJJA 3P8BB 1UJ5A 3EZOA 4C2MA 1D9DA 2F9DA 2PMZD 1NJXA 4MYTA 3R92A 2DNZA 3INXA 2NYHA 4AE5A 2AYEA 2RAQA 4RR5A 2B3TB 5LSRA 4DL5A 3B54A 1VMBA 4NXMJ 1L3UA 2KJVA 1URNA 5A8KA 5CTYA 1FXLA 4O4RA 5F8NA 2BE7D 4C8OA 5KFXA 1X0PA 4F02A 4XITA 4G1PA 3GCWP 4GKJJ 2YNIA 2AV5A 1NHUA 3GIGA 2D1CA 4DV3F 2DPIA 3VGTA 4DZYA 1I94J 1U4BA 2HGNA 1JLFB 1BQNB 2L9WA 5HMZA 1X9SA 1U6ZA 1OY8A 3LPYA 1QSSA 7FDRA 4TKTA 3RJMB 3TO8A 3KXDA 3F56A 5J1EA 3IWLA 5F8GA 4JV5F 2IOQA 1ACMB 1AH6A 4FKXA 4U7UK 5K8PA 2C2NA 2G0IA 4P72A 2M8HA 2IVFB 4ED5A 1GK8A 2LEAA 2HBRB 2RQ4A 4QWEA 4QPKA 3MECA 2FTKA 3MNRP 1JIHA 4ECTA 2EKYA 3HVTA 1XEZA 5LXRA 2BM1A 4J9PA 3KNAA 3MZIA 2C3OA 4MKYA 2WVEA 3MR2A 3JQMA 5KFYA 1LXNA 4O44B 5CQGA 1HQEB 4CTAA 1S0OA 3GTYX 4DV7F 4OI0A 4U7NA 4ZP8A 3NNHA 4CO2A 1R8HA 2IOPA 1K1SA 2YWEA 3TAMA 4PEOA 4C11B 1K9MT 2KXHA 4ZP7A 3DOKB 2R4FA 2Q1LA 4O3QA 2E1MC 4NX9A 3R97A 2HRUA 4P71A 2NREA 2J6UA 2R7QA 1TVRB 1X4EA 5F0WA 1HNVB 2LXUA 4M5DB 3GIIA 3R5CA 3KK1B 2AZ3A 2XY5A 1R8AA 4KC5A 3TUJC 3O0IA 1S9EA 3GWCA 3QIPB 4FYVB 4CT9A 1Y5NB 1TL3B 4DPUA 4P2MA 4RU9A 3FSXA 4KGVB 1PC5A 5BYRA 5IN9A 4RW4B 1Q7LB 2Q43A 2FVPA 3HI9A 4X66F 1XTZA 1U25A 3SQGB 1JJHA 5GADU 3HKZD 4GO5X 2CPEA 2YKQA 1DTQA 1VQ5S 2JRSA 2DGOA 5GAGI 2E29A 1JJ4A 1YJ9S 1ROFA 4ZHRA 2VU5A 3DGPB 4FDFA 4EGLA 4RUHA 1UTAA 3M6UA 3AB4B 4K7QA 2W24A 2PI4A 4AL7A 2DVIA 1N54B 3PR5B 3ZNJ1 1KD1T 3D1HA 1JM6A 1PCAA 4L91A 3EGNA 1CJVA 4LVNP 4FF2A 4LF9J 2IBOA 4AQYJ 1L3KA 3GR0A 5DDRC 3IS9A 3TZ5A 1UKUA 1S4EA 2JKIA 4PWUA 2UU9F 2FJEB 2XDLA 1ZTWA 1T03B 5FNDA 2V2KA 2ZJQQ 3DHXA 2ZBRA 3KLGB 1WNEA 3FVYA 4GT8A 1NNDA 1P8GA 3DLGB 1M5HA 3H7HB 2HVZA 1EB0A 3M8ZA 3ZXOA 5KFTA 2G2ZA 2LP4A 3C2PA 1ZZFA 4I2QB 2OPRA 4TNOA 4YQWA 2ZDXA 1U2CA 3TJ8A 1R0BG 5LMNJ 3ZZYA 4EBDA 1VHFA 5GGZA 2W9AA 1UJ4A 1VBZA 2QE5A 5EGYA 5DLFA 2QO3A 4BAEA 5ETKA 5DS7A 2HS0A 4DJBA 5KG7A 4ZPAA 4H7QA 2XJJA 3LWMA 4QW9A 4KHPF 3MFIA 3EHFA 4P74A 1EETB 2VBXA 2BJ3A 4L3KA 3ILLA 1U48A 5FJ4A 3SCLE 1RGVA 3RW7A 3MUTP 2EXLA 3R7SB 3GJQB 4F3OA 1DBDA 2NR0A 4EK2A 2JLEA 3TARA 5KFVA 3LMMA 1NSPA 4OI4A 2HK2A 2IA0A 4HACA 1S79A 1X4FA 3PX4A 2HQFA 3DFEA 1X4CA 4QBUA 1RK8A 1HI8A 3VVTA 4URGA 2P9GA 2HWHA 3P4UB 4HKQA 3U1LA 2QMXA 1RAIB 3T1HJ 3AOCA 1GTEA 1BQNA 3HP6A 4ZIWA 2QFJA 3LP1B 4QWAA 5BODA 3SSRA 3W9IA 5FLXU 3GE9A 1RU1A 1FJEB 4CCHA 2E1AA 3C3LA 2IVYA 4ANEA 1X60A 1VQYA 1PGZA 5B0CA 3WC0A 4JI7F 1RHQB 1BE4A 1B7YB 4ES2A 2BT0A 2ATCB 3EGVA 4NYOA 1DRZA 1FVSA 3A8KA 3U27A 3W1YC 2V2QA 3EPIA 5A8RA 2C2MB 3MTJA 4JI6J 2JWNA 2J0WA 2J5AA 4PWDB 1C0TB 1S57A 3T3FA 1QTMA 2OSRA 3TQEA 3CT9A 3SSSA 2C3MA 1VC5A 3G6ES 4USJC 2CNNB 1HQEA 3KJNB 1Z2LA 1TQLA 2RUGA 3EDQB 3S5TA 1DFDA 2MQOA 2O3DA 4H81A 2LDYA 1P1LA 3M6WA 2NXCA 1R27B 2J0XA 4CLYA 2FVCA 4NLOA 2FLOA 3DOKA 4F4AA 5GMEA 1TKDA 1FWKA 3AY0A 3MMAA 3EPGA 1NDPA 3Q24A 4OX8A 3HHLB 2YKCA 3I9V9 4M5DA 5DG9A 3MM6B 5H1SV 1UFKA 3UN5A 2GGPB 2FVQA 1WTFA 5GVQA 1UEKA 2YQ3A 3QIPA 2VOOA 1TL3A 2YECA 1L3VA 3PY8A 2FWZA 4O3RA 2XG8A 4IH6A 3JSMB 2OTJS 1VOMA 1LK5A 4O09A 2XEXA 4YB5A 2CQ0A 3M1VB 2ZKTA 4R8UB 5LSLA 2DRDA 4QYRA 2KFZA 2E5LF 4RBTA 3IFEA 3DGPA 2CZ4A 3BSOA 5K8NA 4WFZA 3QRPA 3CVKA 2O5DA 3GPAA 3UFCX 3D4JA 2UUCF 1ZPVA 1NHIA 1T05B 3CD7A 3HCXA 4OZ2A 4OYXA 5D8HB 5HATA 3RAQA 1RWUA 4FVCA 4FP9A 2E9TA 5HK4A 3H5UA 3G86A 2VW5A 4JI0F 1NPKA 4ED8A 4MTPA 1H2VZ 2DIVA 1JXLA 3BS9A 1SKSA 2X7IA 4CM2A 5K14B 3CTRA 1WD6A 2L9DA 5KFIA 1T03A 2V2VA 3ISNC 1VFJA 2C3PA 3KLGA 2BKNA 2FYPA 2L48A 3BGFA 1VQSA 1YHQS 1Z4UA 2UVRA 3DLGA 5A0YB 2Z56B 2W7AA 1NU4A 3CRLA 3L4BC 4YB1P 4OI6A 2QFIA 1F9FA 1YZ7A 5B0BA 3ENAA 4ZVRB 2WTFA 2GQCA 1N5SA 3PXGa 4J9MA 3EE3A 1FRKA 5KFDA 3LANA 5M2PA 4KSEB 4DR7F 1G6BA 5E7OB 1PBUA 1WHWA 3DLHA 2CXEA 4P9SA 3CIMA 4C6AA 5M4NA 4O3SA 1IBLF 1JJ2R 4X4VA 2O1WA 4K4TA 1TL1A 3FZ2A 1X9MA 3T10A 2OEKA 4ZVOB 5ETVA 4Q7AA 3JSBA 1KKHA 1TTHB 3BPDA 1T11A 1M5VC 2DGXA 3TJ9A 3GFXA 2J0SD 3MEDB 1EETA 2EPIA 3IWNC 3WIUA 3IG1B 2XYGB 1JXVA 4QU6A 2XMAA 1MMLA 2Q8HA 1FF2A 2QTWA 2ACMA 1AT1B 2XCMA 3LNUA 4D3GA 3HVAA 3U02A 1VQKS 2K7JA 2P5VA 1C1BA 1IJEB 3UPFA 1FK9B 2DR9A 3HPOA 5E41A 1DTTB 3I56S 5D15A 3BGOP 1N34J 2RJZA 1WF1A 3ZM7A 2YH0A 3PX0A 3VWSA 3JTPA 3O2IA 3G8TA 2EXUA 3SYZA 2YEHA 1YKWA 2HHPA 3GR1A 3QQCD 4EGHA 1LW0B 1V6HA 3OVAA 4W7TA 4JI1F 4EO6A 3RZAA 2SXLA 2VFRA 3KUHA 4JV2A 4JI3J 5E5NA 2JX2A 1QSLA 4DSJA 4QIFA 2W25A 1IBMJ 3BBFA 2BABA 1ZZNA 3BN4A 3LP1A 2XZWA 5CCLA 2IJNA 4ZP9A 4EM7A 2AKWB 4Y00A 2CFXA 5KG2A 5IT9Y 1FA0A 1JK9B 2BJ7A 2U1AA 2R7UA 3OLAA 3L9ZA 3SZ2A 2CZVC 4BIZA 3H0PA 4LR7A 3R8YA 4RW9B 5HMWA 4I6YA 4CLTA 1KQSR 1RBAA 4M5GA 3FGVA 2ZDYA 1U2RA 1N36J 4ED6A 2WSCC 4PWDA 1C0TA 1CJKA 1W2BR 4JI8J 1Z1ZA 2D7SA 3F41A 5KFBA 4WTYA 4YKZA 4OYAA 3I87A 4YB7A 1I5BA 3GIKA 1FWPA 1NB2A 2ADBA 1Q8KA 5IT0A 1F9EB 4V19J 1M5KC 3UD3P 4BWMA 1U47A 2KRRA 4KH0B 1U6BA 1WSVA 3GIRA 3A13A 5DG8A 1T9WA 4ASGA 4ELUA 3KJFB 4M5LA 4FMTA 1I5CA 4AXIA 2NZ4A 1UPMB 3MM6A 1UYLA 2GGPA 1S16A 1UCNA 2F1FA 4YR2A 2VG7A 1DQ8A 2MXYA 1WG4A 3P5BP 4YR0A 4AUKA 3NS7B 3CEDA 3TVKA 4OYWA 4DZ6A 3JSMA 4I68A 1NCLA 3QIDA 4KP4A 5DQHA 3OTBA 1SB6A 1Q79A 3RAMA 1NJZA 3MAAB 5D3GB 1F6TA 5J71A 4PAAA 4P7AA 1QZRA 1X8DA 4F26A 3K5MA 2E1CA 2IRXA 1KS2A 1RACB 4CO0A 2D9PA 4YKYA 4G1QB 3Q22A 2CJ9A 2JL9A 2PGCA 2DH8A 4PYAA 4JYAJ 2W2OP 4ZMMA 2BV3A 4IYQA 2AIRB 2R7RA 4FXDA 2XLJA 1XNQF 2F40A 2V4QA 5C93A 3QMQA 3OD2A 2F4FA 1WC5A 2B9WA 5F3TA 4LFCJ 4CLLA 3BQ0A 1T05A 2G1DA 4R5PB 1CC7A 1SH2A 1WG5A 3HZ5A 3D28A 4X84A 2HSEB 3D1OA 5ADZA 4H4OB 3DU5A 1KQGB 2QLBB 1HL6A 2APOA 2BRLA 3Q8SB 5K8OA 2ZHAA 5K14A 4ZVSB 1O51A 3A0TA 3C66A 1S6UA 4RNMA 1AM1A 3MUMP 4PU9A 2H65B 5A0YA 2UV8A 2HURA 1Q4RA 1NZAA 2DT9A 3FEYB 4Y2CA 2DNLA 2GW8A 4RW8B 3BH7B 2CPYA 1SL2A 3RB6A 3L09A 2CPXA 3M8QB 2OIHA 2YQ1A 1US7A 2Z2YB 1FD8A 3GSDA 8ATCB 1AFJA 2COLA 2QFOA 2AT1B 3WQPA 1RT5B 3IM9A 4HYMA 3D9BA 3F0NA 2IJRA 4KPCA 1QY7A 4FYYB 1N4LA 1AROP 1S6PA 4DV3J 2MZTA 3CDUA 1Q95G 4TVAB 4I64A 5AE2A 2VICA 2RIJA 5KTQA 3LPEA 3FC9A 5IV3A 4B9LA 4DG1B 3HSGA 5IM0B 5KFNA 4NYPA 4X4TA 1FTCA 4K4SA 1P1TA 3THVA 1HI0P 1BXDA 4DPXA 2ZC3A 5E2QA 3RTVA 1MWZA 2P2CB 2FD2A 3MCOA 3MEDA 4HZ5A 2UUBF 5U47A 4ZPWR 1K47A 1Y0HA 3ZTSA 2BXJA 3C46A 3C6TB 3ADAC 4A8KA 1DTTA 1Y00A 4O0NA 4QIGA 3EKOA 2ZZTA 3ZTRA 1Q82T 1B0TA 3NCPA 3NL0A 1JLEB 2GFDA 3T5JA 2H51B 1LW0A 1LWEB 3V81B 2OFHX 4OV1A 5A6WA 2FZKB 3OR2A 4FF3A 2XB2D 1TV6B 2MY8A 3MM8B 4XKOA 3G82B 1KONA 3PG9A 4GO7X 3TAQA 4OZLA 4ELVA 4EO8A 4QZVB 3D7SB 3BKUA 4EEYA 3QT6A 2CQ3A 3VHCA 4QR2A 2H5EA 3HYYA 4MB9A 2A18A 2LA6A 1IQTA 3ZC4A 4NPOA 5FNCA 1TUGB 2BJ1A 4I7FB 2MKKA 1PSDA 1UETA 4WPAA 2ZDPA 4YKUA 1X5SA 5IXUA 3J7AN 1JJCB 2QSFA 2DNHA 1IBKF 3A0YA 3GIEA 3J7A1 1H7XA 2YI7A 4DQIA 3J81j 3GZ7A 2VA2A 3LGNA 2WBRA 3OTDA 1EKSA 2FHMA 5DGBA 4WXOA 3EVMA 2CQPA 3N9UC 5F3ZA 2X1GA 4YDDB 3T1YF 2UXBF 4ZDNA 2YE6A 3EHHA 2UVVA 3CCLS 3IBCB 5E3AA 1GX5A 1HBNB 2KT5A 2HQGA 3O44A 3MD3A 4ZLNA 1U1MA 4MMOA 1O0PA 2HLUA 2XYPB 3AJ2A 3VHAA 4LVOP 5BJRA 2YKOA 4C7QA 1RLDA 2ZH9A 3C11A 3HULA 1YJNS 4GCZA 3KDNA 4XDMA 3IMQJ 5KT7A 1VBXA 3G6VA 3TP2A 3B4MA 2MZSA 1RA7A 4UY85 2EWHA 2UU9J 1HBUB 4DOZA 3VZIA 4ECUA 1HLWA 3TANA 2XMTA 4NMLA 1CJTB 1VRUB 3FBBA 4RLEA 3AXMA 3ZTPA 2HZAA 1T8EA 2VF3A 3NEKA 2RKIB 3IRXB 3CJ5A 3GFYA 1RHMB 1TP7A 5D0RA 3MXHP 4WFBQ 4TN2A 3VADA 4O3PA 3S7RA 1GMWD 3MAAA 5D3GA 1TKZA 2XSFA 2KO1A 1YITS 2AGOA 4G1QA 2CNLB 2OHDA 2OTLS 2J7WA 3ZTQA 5CABA 5HJYA 3D1QA 3P49B 1FHTA 3V2UC 3B78A 3PEHA 2NXJA 3ETMA 9ATCB 2ZDOA 4OLOA 2JJ4D 2XS7A 1UWBB 4P10A 3RRGA 2CVIA 2QMUB 2XMKA 4QR0A 4U9RA 5CTWA 2CH4A 3HYZA 5SZTA 3VAMA 4OJ1A 2YX1A 2HIQA 2XMUA 1NK8A 4WIIA 3RG6A 4KHPJ 1OSDA 3JAMU 4FBTA 3H5XA 1S5ZA 4BCAA 1RSCA 1VCTA 2BU7A 4RBVA 2GO9A 2HKJA 2YE7A 4WKRA 3FMBA 4ECQA 1FXRA 3K2YA 4NWBA 4DR3F 3TQ1A 2XZTB
chains in the Genus database with same CATH topology
2QG0A 3GV8B 3LAKA 2OPSA 2ZH6A 4B9MA 2LA4A 4K5SA 1H98A 4LJMA 2FJXA 5HP1B 3DI6B 1GXTA 4MPNA 2CPHA 4K4XA 1YQHA 2EFOA 3CD5A 1YRXA 2FTRA 2ZE2B 1HNWF 1RT2B 5KG0A 1YETA 1S49A 2BM0A 5DLGA 1S97A 4AWQA 2I0XA 1TUVA 3CCRS 3M8QA 5T7LB 1QAJA 5D78A 1D9AA 1KFDA 2FB0A 2DNMA 3E8OA 2RQCA 3P96A 3H40A 1KNZA 1Q8LA 5EWEA 1N6QA 1XR5A 1X4BA 3BO3A 1FKOB 1EP4B 3JSRA 4OZ0A 2GHPA 1N36F 4URLA 1DTQB 4QR1A 3MEKA 2B5JA 2NPFA 2YKBA 5FD1A 1SXLA 2VPXB 4DUHA 3HF5A 1RT5A 4HHJA 3PIOQ 1SL1A 1XR7A 3QWUA 2KB2A 2QIFA 4JI8F 4DV2F 2MKHA 3BO4A 4ZHRB 1BWEA 2YK2A 4XD8A 3BGUA 3DHWC 4CWNA 4XIQA 5D7RA 3IR7B 3R27A 4XIPA 3ZKBA 4PRVA 1S1UB 4X65F 2WOMB 4ZCKA 4B17A 1HD0A 3VZHA 2FIUA 2NQPA 1VQOS 3I5AA 4EYIB 2D3ZA 1VRTA 4K50A 3O8WA 4DG1A 5KG4A 4C8NA 4ECVA 3KK2B 5CTXA 3QGPA 4KRWA 1THNA 1VC0A 2M8DB 1HWIA 3DU6A 5IM0A 5IT4A 3CF5Q 6FDRA 1KTVA 3B25A 1FTRA 4DN0A 4NLUA 1F5CA 4EGKA 4ZPTR 4DEZA 2WI3A 5FIIA 3PR4A 2XSJB 4ALZA 5J2MB 3OTEA 3W2WB 4B9VA 2IWSA 3Q5LA 1KIJA 1MU2A 1SH0A 4LIWA 3SSQA 4QU7A 2GJ2A 2YE2A 3AQOA 1UW4A 5J2QA 3FFIA 2XK2A 4J9NA 2BU8A 1TAQA 1ID0A 2YE5A 4X2BA 3JTOA 2N3OA 1ZXNA 1U45A 2AJ1A 2HGMA 5EDWA 4XPEA 3CPWR 1VQPS 2QLXA 4E98A 1CSJA 1UA1A 4NH8A 3BREA 1ZW9A 3DRYA 4NLSA 1BGXT 1KHWA 3C6UA 2ASDA 1IXKA 1TKZB 3CCUS 1UVMA 3FQLA 2ZFHA 3KLHA 1QSYA 2WI4A 1DJ0A 5L38A 2UXDF 4HT5A 2BZ2A 3W2VB 2DH7A 5HO4A 4OZNA 4TU9A 3HT3A 3IN5A 2LECA 2P6TA 2XWXA 3CDEA 5HBMA 1XBWA 1YTYA 1Z59A 4ED3A 4C4WA 1MX0A 4ILMA 1A9NB 1JLFA 1J2VA 5B0FA 5C5JA 2XI2A 4I5SA 1S6QB 2LYVA 2PNRA 5EX3A 5J6AA 3C6TA 3QLHA 2Y1IA 2NYIA 2XS2A 4HI1A 4WE1A 1QM9A 3OMUA 2VC0A 4HYKA 4ED2A 1GXUA 1N56A 1NK9A 3RB4A 2YGEA 4AS9A 2DCUB 1PC4A 4WK3A 5M4HA 1JNZB 3A0XA 2M2BA 3PIPQ 3V6JA 3GIFA 2IM2A 2FVRA 3DRRA 4KGKA 4J9OA 2AYBA 1YJVA 3CIZA 1X5TA 1GKZA 5E3PA 2EG2A 1YT2A 2U2FA 3FSIA 1DQAA 4RNHA 4WFAQ 3TZ0A 4RW6A 1JLEA 1U1KA 4Q44A 2W7PA 2MSSA 2LXIA 4CE1A 3I6PA 2VOPA 2BW2A 1YJUA 5CHCB 2OPRB 3NWGA 3J7YU 1TL4A 4K2XA 4YOEA 3R4MA 4KQVA 5J1PA 2QG2A 2YEIA 2N82B 1LWEA 1UVJA 3IWXA 2RH3A 4Q8FA 3V81A 2QT7A 4RBUA 2V9WA 4EGIA 4DQQA 1RTIB 3ZZOA 5IZHA