3PEUB

S. cerevisiae dbp5 l327v c-terminal domain bound to gle1 h337r and ip6
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
TNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVRQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 108
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3peuB00
3RRNB 3PEUB 3PEVB 3RRMB
chains in the Genus database with same CATH superfamily
2LAIA 3ULEG 3TWVA 4JL0A 4XKCA 4B0ZA 1MHQA 3LPZA 3LY9A 2PQRA 4BESA 3CHRA 5KJKA 3FU6A 2Y4TA 3F6QA 4GTMA 3KEZA 2FO7A 2KBXA 4WNDA 4M3OA 1SVXA 3KSLA 4U7EB 3VLDA 3CQCB 1H19A 1IQRA 4FHKA 3FUHA 3TWXA 3RO2A 5AAOA 2HYZA 2HE0A 5G2NA 1O5MA 3QK0A 4GMRA 4JHJA 5ENRD 1OY3D 4TRQA 1U2VG 2VYIA 3NBNB 4BTBA 5B1BE 4AXHA 3B95A 3HXCA 1MYOA 3LXUX 5EKQD 2XZTG 3ASHA 2WM9A 4BSZB 3HDXA 2IONA 4CYMD 4G8LA 3CSTA 4G23A 2RKKA 3ZHEB 4H7XA 2C0MA 2CG3A 1DC2A 4BT8A 4KZ0A 1E8YA 3CQGB 4DJAA 4UQYA 4HOSA 4U63A 1MX4A 3QWVA 3MEKA 3ZRHA 2M63A 4MRUA 3MKQA 4EZKA 1UOHA 1OWLA 3VTXA 4JHRA 3U66A 5DIZA 2ETCA 3Q75A 4DPRA 4ZHBA 4GTRA 3D9HA 5AIJA 5LCWC 4O60A 2X6FA 4N3AA 2FULA 3APFA 1HU3A 1EF1C 2P58C 2CFUA 5BXOA 3AU4A 4C0MA 5KJNA 1OWPA 1N94A 5ENOD 3L13A 2WQ7A 4R7LA 3PZ2A 3S7BA 2XQ0A 4AM9A 4GTPA 3Q79A 2WXLA 3NOCD 4GA1A 5A7DB 3MYVA 3CVYA 3UTMA 4JVSA 5KNHD 5EYPF 4BX8A 3ZEFA 2XEEA 2VTBA 4LCTA 4LRZA 5G05J 4QQIA 1AWCB 2BKKB 2VSNA 4ACKA 3DRAA 3ZIMA 5BT1A 4APOA 3TWSA 5T8IA 1YCSB 3FDHA 4U8YD 4FA6A 1TJCA 4LG6A 4WWNA 1X81A 2WVIA 4HNAD 3ENEA 2GGFA 1HF8A 4U95D 4OVUA 2WPVA 1XGWA 4WNFA 4TXQA 1JCRA 2V5QC 4U0ZA 4BETA 5J08A 2FI7A 4RG6A 3DPDA 3J5PA 3SZ7A 2YHEA 3ONLA 3DSXA 1FT2A 3RRNB 3LJ3A 3U3WA 5CEAA 4HQDA 4RSYA 4N3BA 3FUJA 3ZUVB 3PZDA 4JW1A 4GPMA 4GZ6A 1EPUA 3TWUA 3CVNA 5T4YA 1BLXB 4XEIG 2DWZA 1OWNA 3SI5A 2WXGA 2XS8A 5FINA 1MX6A 3UM2A 4BFRA 3FEYA 4PS3A 5E76A 3QNKA 3SHFA 5BUZA 3Q7AA 2R05A 3BEEA 2LXLA 3DXMG 5FT9A 3I5PA 4EPZA 4KMOA 1WM5A 3AG3E 2FEZA 2WXOA 3BG0B 3FH8A 2EIME 1E96B 1IKND 3IKOB 3SY2A 4GB9A 3SBSA 5EN5D 3G2TA 3CVQA 5KBAA 4U8VD 3CVPA 1EDUA 3TWWA 3B13A 4HB5A 1ELKA 3Q73A 5AYWD 2AVPA 3FY4A 5A6CA 3SQVA 1UG3A 1N9AA 3MKRA 4AEZC 5LCWJ 3V2OA 5CERB 4C0EA 3FH7A 1UJKA 5AENA 3L6AA 4FP7A 4Q96A 2L6JA 1YA0A 5CEDB 3G2WA 2NC9A 4IYPA 4A1SA 4WWPA 3FTVA 1E7VA 2P2CP 2MHKA 4Y6WA 4PDXA 3JQ1A 3CSFA 3MV2B 3PE3A 4EHMA 4G1TA 4KYOB 2BF0X 4GZDA 4UWGA 4KVMA 4YDOA 2LXMA 3FTSA 5EYLA 3D9MA 5D0OD 4RLYA 4N2SA 1SQMA 2UY1A 3QC1A 3NZUA 3W9GA 1S63A 2YNQA 4MBGA 3D9OA 2AXUA 1H2UA 3SFZA 2GRLA 4I17A 2QZAA 2X38A 1NA3A 5FQ4A 1A5EA 2IY0C 3HXDA 1O1RA 4LSZE 5A23A 3D9NA 2P9UG 4DI4A 1H6KA 2IQCA 4A3VA 3L54A 4G25A 3HXBA 1OCRE 3TAXA 3SBTB 3S7FA 3G2VA 4JA7A 2XGSA 3LVRE 3FWVA 5JHBA 5B1AE 4CEMA 4ABNA 2QC9A 1EYHA 4L2LA 5BV0A 3KAEA 2H6HA 4JZYA 1N0QA 3EU5A 5C2YA 2VSYA 1N4QA 3HYMB 2E2EA 3UQ3A 2PM7A 1SZ9A 2XPZA 4YVQC 2C0LA 3HG0D 3RU0A 3JYSA 1UJJA 1ZU2A 3QWWA 1BI8B 1E8WA 2Y69E 4GMLA 2WQ6A 3ZNGA 2OVFA 4ANXA 4OVVA 4XX5A 1TNYA 2P9SG 3AS8A 3HVEB 2V8SE 3O4ZA 3MJWA 5BW8C 3NAWA 4WNGA 3D9JA 5G04C 2E0IA 2QYUA 3MZLB 3HXEA 5DBKA 2WQHA 3Q4AB 3E34A 5KJMA 1IXVA 4B93B 4BX9A 3CHSA 2VGEA 3PE4A 1H6PA 1TR4A 4GYYA 4Y6CA 4HLEA 4MS6A 3AG2E 5CRUA 3CHQA 2AWIA 3VLEA 2H6FA 4TXPA 5G55A 4U07A 4GA2A 4JXTA 3ASDA 3S2AA 3U9WA 4Q94A 3L17A 3AU5A 4GAAA 3UIOC 3FUEA 4J0UA 2LNIA 3ZHEA 3UX4A 4LUNU 4XKBA 1WG0A 1G3NB 1JWGA 4CDNA 2OVBA 5AQAA 5HRYA 5ENPD 1TN8A 4A55A 3FTYA 3HXFA 3R9MA 2L0TB 4ILHB 4N39A 4X8QA 4DUIA 1TYQG 2WXIA 2DBAA 4HVBA 3T5XA 2IF4A 2PL2A 1QYMA 4BT9A 3DSSA 2IOSA 1KLXA 2WXMA 2XPIA 5AJLA 1U3CA 3C98A 2J4BA 3CK9A 4DX1A 2J49A 1TNUA 4XIFA 4PH4B 3CGHA 1TNZA 3C3QA 3CK8A 4UQZA 3SO8A 2LAHA 1DCEA 1OT8A 3CHPA 3FUNA 4I1OB 4DLQA 1OUVA 1E7UA 3JXJA 2NSZA 5KWDA 2IU1A 1N0RA 1N4PA 3CIAA 3L08A 4PUCA 5BV1A 2BTDA 4GMJA 3Q5MA 3ZPJA 1N54A 5FZSA 2L0IA 3ULYA 1E8ZA 1JPLA 2UY1B 2WXQA 1L5JA 3JUEA 3FUIA 3FTWA 3APCA 1N4RA 3Q9NC 5ANRA 4U0SA 2IFUA 1QBQA 2I9CA 4HRMB 2GRPB 1Z6TA 1Y6IA 1DVPA 1Z3YA 3MKQB 4XI9A 1ELRA 2F0YA 3S7DA 4NURA 4HRNA 3B7SA 3EHMA 1TNOA 1OCOE 4F3VA 1E8XA 4CT0A 2P9IG 4GYOA 3PDNA 3T8KA 4CGWA 2P9NG 3IHYA 4OAVB 4JA9A 3U64A 2V4HC 3DBSA 2EINE 2LSUA 2EIJE 4K5AB 4N5QA 3P2BA 2L6BA 1OCCE 5FWQA 2F37A 5AN8A 5LP0A 2X6IA 4JB8P 4HI9A 3I4RB 4TV3A 5EIDA 2VQ2A 3ZU7B 4ANVA 5M72A 3ABKE 5JA4D 3E32A 3B7BA 2A5UA 3PEVB 4IN3B 3CVWA 4WWOA 4ACLA 4N2QA 4GZCA 5KNGA 1P5QA 5HKPA 2UWJG 1NP7A 1N95A 2JEKA 4EZLA 3ZYQA 4EQFA 3GZ2A 2DVWA 5EX3A 1K3ZD 4KZCA 3CVUA 5ENTD 4I9CA 2KATA 2KM4A 3GYZA 3UT8A 5BPPA 3SFYA 4DX2A 2ETAA 3D9PA 3LY7A 3PH0C 4DI3A 3MA5A 2J9QA 2YHCA 3L16A 2WXHA 3RAUA 2OV8A 2IO2C 3EUVA 2IOLA 4GPKA 4ZFHA 3DSUA 3RSEG 2WMOA 5FQ7A 3AG4E 3UPVA 4PS7A 3B7TA 2KXPC 1V54E 4ANWA 3APDA 2VGXA 2R59A 2AW6A 4G26A 4HI8A 5AQBA 4UI9K 4L1BA 4I2ZA 1TN6A 4DRXE 4GZ3A 2WMNA 4UWHA 1QZ2A 3SFXA 3QDNA 2OOEA 1PC2A 2KCVA 3ESKA 2LSVA 4JHKA 2EILE 2J8SD 4CDRA 5JJ7A 4BWRA 3CHMA 3UM3A 4HBDA 4ANUA 4JPSA 3AS4A 3QWPA 4ILGA 4KVOA 3FEXA 2YQ8A 3OXGA 1MX2A 4AY6A 1ELWA 4J8DA 3PRZA 2Y0BG 3GZSA 4G11A 3AG1E 1HX8A 3KD7A 5ENSD 3UXGA 3BG1B 3IV0A 2XGMA 1KZPA 3CLJA 4O6FA 5G05C 1BU9A 4J7WA 3CK7A 3PEUB 3P1UA 2P9PG 2IO3C 3MV3B 2RG8A 4AV7A 3PZ4A 2H6IA 3FTZA 2R03A 5FJYA 2OCCE 2VSXE 3V2XA 3ASOE 2GRMA 4Z68A 4ILIA 4I43A 3ML8A 3ML9A 3Q47B 4U04A 3ESLA 2F8XK 2AJAA 3RJVA 2XS1A 4WAFA 4FU3A 4DK5A 3UUXA 2XEHA 1LF8A 3QARA 3ZYKA 2FF4A 4NACA 4U96D 1Y8MA 1FVFA 1V55E 2VTBB 2ILRA 4XE0A 1D9SA 4UI9C 3T5VA 4GTVA 5FZRA 4K03A 1H2VC 3FU3A 2WXRA 3UM0A 1INZA 2XPYA 3JXIA 4J6IA 2A5EA 3W9FA 3IBEA 4HOTA 1WAO1 3SNXA 3O48A 1JWFA 1JCSA 1N4SA 2WB2A 4DX5D 4TUUA 3JQ0A 1NFIE 2WXFA 2RD0A 5AQ9A 4U0UA 2PM6A 1NI1A 2J07A 4JEHA 4DLOA 4G24A 2NXPA 3LDZA 4K5BA 4P29A 3RRUA 2H6GA 2XCBA 3J5QB 1NL4A 4NRHB 3R7RA 4B8AA 1XNFA 3TGOA 3EHNA 3C3RA 5B3SE 1PAQA 2PNNA 4OYSA 2QYJA 4AOFA 5ARGA 4FJYA 3N71A 3PZ3A 1TEZA 1K1AA 4I1AA 1VDYA 3DXKG 4E85A 2DZNA 2JLBA 2WXPA 2XRYA 2BUGA 3L22A 5CECB 5CHEE 1N52A 5G04J 2HR2A 2RFAA 2KCKA 4RVBA 5H7PA 4E6HA 2JABA 3FUDA 3T9KA 3FHEA 4KT6B 3ABLE 4L7TA 1FCHA 1N11A 3URZA 3HRAA 3D9KA 4TUMA 4HXIA 4F53A 1TNBA 4HOUA 4BEPA 3U4TA 3KSQA 3IEGA 2RFMA 2Y1LE 2FBNA 5C1DA 5JJTA 2KCLA 1ZB1A 2IEJA 4FC8A 4N5CA 1HO8A 2BEDA 4FHJA 4J8YA 5HS0A 3TXMA 3ISMC 3AS5A 4HORA 3C3OA 3EHRA 3CKCA 4WNEA 2EQXA 3VTYA 2ZU6B 1FPPA 4RG9A 1HG2A 2OEWA 3TG4A 1RZ4A 3LEWA 3PS6A 3RO3A 3D9IA 4APFA 1KT1A 2FO1E 2GROB 3E33A 5BNWA 1S64A 5ARFA 3VLFA 3Q7FA 3EU9A 3UIPC 2YINA 4YVOA 4CCAA 4ATGA 1Z5SC 2DYRE 1E90A 1UN8A 4MKTA 4GCNA 1GW6A 2ETBA 4C48B 4GA0A 3QAQA 5FQ8A 2CG2A 4FADA 4I1MA 2X3MA 1TN7A 5AJDA 2A4ZA 3G2UA 4MLPA 3SF4A 2XZDG 3I4GA 4LNUD 3SD5A 3LY8A 4O1OA 4DX7D 5D66A 3HIZA 3TG5A 5FIOA 2X6KA 3FTUA 3SGHA 4OAUC 5EILA 4UQXA 2DZOA 3G2SA 3UM1A 4D10C 3EIQC 3L82A 4A3TA 3WG7E 2VGYA 4GYWA 3TXNA 4C9BB 2WXNA 3ABME 3MGBA 2ZGDA 3AJIA 5ENNA 2F8YA 3Q49B 2OEVA 2GRRB 1HXIA 3D9LA 2GRQB 5CBNA 4EECA 1ZBPA 3BU8A 4CT4A 1YYHA 3QJZA 3UMVA 1SA5A 4HLLA 4I2WA 4HS2A 2MOWA 1X5BA 4V3IA 2MYOA 4BTAA 3QKYA 2J08A 4G8KA 2DIWA 3FU5A 2XRZA 5HI7A 3ZN3A 5EX0A 4ATZD 1HFAA 4IULA 1D8DA 3FUFA 3S7JA 2DCPA 3Q15A 2AXZA 2CFZA 2XCCA 3LVQE 3TJPA 1UN9A 3NOGD 4K5CA 3OTNA 4L23A 2J09A 2CHZA 2I1JA 4XZ4A 3C5RA 3HHMA 4YDWA 2LO6A 3V31A 1Q2ZA 3ZYLA 3EDTB 3ZKJA 2KZTB 4A63B 4F6RD 2ZXWE 1LD8A 3DEPA 3GZ1A 1IHGA 1O1SA 4CDMA 5E75A 4RQIA 3FUKA 3WXXA 4W9RA 3UKRG 4HFGA 4UWKA 2P9KG 4F7AA 4CZ2D 4B89A 4ME2A 1MJ0A 3PNLB 2V4LA 1W3BA 1SW6A 2Y3AA 4I6JA 5D2MC 5BXUA 2KZTA 2HO1A 1K1BA 3DEOA 4G2VA 1JUQA 5CMYA 3AAAC 3RKVA 4JC8A 3PUKA 4U8HA 1Z3XA 2I6HA 4I6EA 4UUCA 3ZGQA 5LX8A 4GTOA 4CRWA 4J8EA 3UT4A 5FTPA 2NYJA 4BERA 4URKA 2WXKA 3CKBA 4WUYA 5CMWA 4FLHA 4GTSA 4GCOA 3E30A 3UT7A 2VGXB 2I1KA 1O1TA 1HE8A 1BPOA 2L9BA 1H2TC 5KCMA 4L2YA 1WDYA 1OWOA 4KBQA 3ONKA 5J90A 2LUHA 2ZGGA 3PVLA 5FQ6A 1OXJA 4FULA 4EBAG 4N3CA 4HRLA 5FZQA 4A1GA 1YMPA 3UINC 3FU0A 1HH8A 4YDEA 2B6CA 3TWTA 1KT0A 3CR3A 1IQUA 4NQ0A 3RK6A 1AP7A 2QY7A 2VJ8A 3Q78A 3I3NA 3LYAA 4F1SA 4BY6A 1SA4A 3QOUA 3K9IA 3PREA 3CVXA 5JMND 4LEUA 1HZ4A 4AY5A 4EBAA 3KEAA 5EIBE 3T8MA 4UWLA 2XGOA 1B89A 3IXEA 1MQSA 2ZIRA 1FT1A 3IHVA 3C72A 1HG5A 3ZW3A 5CCMA 3TL5A 2R5SA 3EJNA 5CBOA 2J4DA 4I6GA 4GTQA 2GW1A 2Q7FA 4FLBA 4CGVA 4B94A 3B7UX 3R9AB 3FP3A 1RW2A 3CVLA 1NA0A 4YNDA 3FUMA 3LKUA 3ZFWA 3DSTA 2GRNB 3Q9UC 3JCKC 3UI2A 1FVHA 4B8CB 3JUIA 3V30A 3V79K 3NB2A 2XENA 2X6JA 3B7RL 3CHOA 1HS6A 4NIKA 3BUAA 2V5FA 4FJZA 2R02A 5ITZF 3QB2A 5ANLA 5AARA 4GTTA 4J8SA 3R7QA 3RIBA 2XEVA 5ENQD 3ULQA 1K8KG 3NQPA 4O1PA 3DWLG 1BD8A 3ASFA 4F1PA 1SZAA 4AIFA 3TWQA 4H7YA 3PUJA 1QNFA 2C2LA 4KXKB 1QQEA 3ZYMA 3RRMB 4AVXA 4K0RA 4M7CA 3E4BA 3OXFA 1S70B 2EIKE 3PZ1A 1UW4B 5KJLA 1IYGA 3BQOA 3CEQA 5LOZA 1LD7A 2HM8A 4HOQA 3GW4A 4LNBA 1DNPA 5T3RA 3E37A 3UKUG 1S0PA 4AJWA 1MZCA 3LCAA 5JJ6A 4LERA 1H0AA 4QFVA 1BI7B 3TWRA 2I2OA 2CHXA 1WY6A 5EDSA 4JEUA 3NZSA 1NZNA 2BKGA 3X2QE 2XHEA 2AXVA 3ASGA 2PZIA 1IHBA 2KC7A 2V0PA 4BSXA 3ZXPA 5CCLA 1OCZE 2WXJA 3KS2A 2Y4UA 2P9LG 2PQNA 3PNTB 3EIJA 3HVEA 1KPSB 5AQ7A 1U3DA 3MX3A 3OXLA 2R17C 3DSWA 2QFCA 2CHWA 4DX6D 4PS8A 4GU5A 2ONDA 3FTXA 1JCQA 1KZOA 4Q69A 4EZJA 4I9EA 2X6HA 3EHQA 3FH5A 2MRIA 4GZ5A 1OWMA 3ASNE 4IRUA 3LS8A 2B0OE 1LTXA 3ZXSA 2DYSE 5LFAA 4JD2G 3DPYA 3DSVA 2R2LA 3LJNA 5IY5E 1A17A 4YDYA 4XI0A 3MCXA 4TXRA 4UWFA 4L9PA 5JHAA 5D0QD 3FFLA 4J8FA 5CRVA 2VSOE 2ZISA 3D3MA 3FULA 4LNGA 3CVVA 4AP2A 3NF1A 3ZVVA 3OAWA 3L9TA 4UI9J 1D8EA 3CV0A 5HQ8A 2IJGX 1H6OA 1PY1A 1TJFA 1DCQA
chains in the Genus database with same CATH topology
2LAIA 1UJJA 1ZU2A 3GZSA 4G11A 3QWWA 1E8WA 1HX8A 4JL0A 2KZTB 4GMLA 3KD7A 4XKCA 4B0ZA 2WQ6A 1MHQA 2OVFA 3LPZA 3GZ1A 3LY9A 4ANXA 4OVVA 1IHGA 4XX5A 2PQRA 4CDMA 3CHRA 5KJKA 3BG1B 3FU6A 5E75A 3IV0A 2Y4TA 2XGMA 3CLJA 3FUKA 4O6FA 3WXXA 5G05C 3AS8A 3HVEB 4W9RA 2V8SE 3O4ZA 3MJWA 5BW8C 3KEZA 4WNGA 3D9JA 2FO7A 4HFGA 3CK7A 2E0IA 3PEUB 4WNDA 5G04C 3P1UA 4M3OA 3MZLB 5DBKA 2WQHA 3MV3B 4UWKA 3VLDA 3CQCB 3Q4AB 1H19A 5KJMA 4F7AA 2RG8A 4AV7A 1IQRA 4FHKA 4B89A 3FTZA 3FUHA 5FJYA 4ME2A 3PNLB 2V4LA 3RO2A 2VSXE 2HYZA 1W3BA 2GRMA 5G2NA 4BX9A 2Y3AA 4I6JA 3QK0A 3CHSA 4ILIA 4I43A 3PE4A 3ML8A 3ML9A 3Q47B 4JHJA 4U04A 3ESLA 2KZTA 2HO1A 4TRQA 4GYYA 4Y6CA 4G2VA 2VYIA 4WAFA 3RJVA 4FU3A 4MS6A 4DK5A 4HLEA 4BTBA 1JUQA 3UUXA 5CMYA 4AXHA 3RKVA 4JC8A 3CHQA 3LXUX 5EKQD 1LF8A 3QARA 3ASHA 2WM9A 3ZYKA 2FF4A 4NACA 2AWIA 3PUKA 4U8HA 1Y8MA 1FVFA 3VLEA 2VTBB 2ILRA 4XE0A 3HDXA 4UI9C 1Z3XA 4U07A 2IONA 5G55A 3T5VA 4GA2A 4JXTA 2I6HA 3CSTA 3ASDA 3S2AA 4G23A 4I6EA 3U9WA 5FZRA 3ZGQA 4K03A 5LX8A 4Q94A 4CRWA 4J8EA 3L17A 3AU5A 3UT4A 4GAAA 3ZHEB 4H7XA 2C0MA 5FTPA 1H2VC 2CG3A 3FU3A 2WXRA 4BT8A 4KZ0A 1INZA 3FUEA 4J0UA 4URKA 1E8YA 2WXKA 2XPYA 3CQGB 2LNIA 3CKBA 4WUYA 4FLHA 3UX4A 4J6IA 4GCOA 4LUNU 4XKBA 3ZHEA 4UQYA 5CMWA 3UT7A 2VGXB 2I1KA 4HOSA 1HE8A 4U63A 3IBEA 1BPOA 1H2TC 2L9BA 5KCMA 4HOTA 1WAO1 3SNXA 1JWGA 3O48A 3QWVA 2OVBA 3MEKA 4CDNA 1JWFA 3ZRHA 2M63A 4MRUA 3MKQA 4L2YA 4EZKA 2WB2A 1OWOA 4KBQA 4A55A 3ONKA 4TUUA 5J90A 3FTYA 3JQ0A 3PVLA 5FQ6A 2WXFA 4FULA 2L0TB 1OWLA 3VTXA 2RD0A 4JHRA 4ILHB 4EBAG 3U66A 4N3CA 4N39A 5FZQA 4A1GA 4U0UA 2PM6A 2J07A 2WXIA 2DBAA 3FU0A 5DIZA 1HH8A 4HVBA 4JEHA 4DLOA 4G24A 2NXPA 3LDZA 4P29A 3T5XA 2IF4A 2PL2A 1KT0A 4DPRA 3CR3A 3RRUA 4BT9A 2IOSA 2XCBA 1KLXA 2WXMA 5AIJA 1IQUA 4NQ0A 4NRHB 2XPIA 5AJLA 3R7RA 3RK6A 2QY7A 2VJ8A 4B8AA 1U3CA 5LCWC 3C98A 3I3NA 1XNFA 3LYAA 4F1SA 2J4BA 3TGOA 3CK9A 4BY6A 2J49A 3EHNA 2X6FA 4N3AA 2FULA 1PAQA 4XIFA 3APFA 4PH4B 3CGHA 4OYSA 1HU3A 1EF1C 2P58C 4AOFA 2CFUA 3QOUA 3AU4A 3CK8A 3K9IA 3PREA 4C0MA 4UQZA 5KJNA 3CVXA 4LEUA 5ARGA 1OWPA 1HZ4A 2LAHA 4AY5A 4FJYA 3L13A 2WQ7A 4EBAA 3N71A 1TEZA 4R7LA 3S7BA 2XQ0A 4I1AA 4AM9A 1VDYA 3T8MA 3CHPA 3FUNA 2XGOA 4I1OB 4UWLA 2WXLA 4GA1A 4DLQA 1B89A 1OUVA 5A7DB 1MQSA 1E7UA 3MYVA 4E85A 3CVYA 2JLBA 2NSZA 2WXPA 3IHVA 2IU1A 4JVSA 2XRYA 2BUGA 3CIAA 4BX8A 1HG5A 3ZW3A 5CCMA 3ZEFA 3L08A 3L22A 2VTBA 4PUCA 5CHEE 3TL5A 1N52A 4LCTA 4LRZA 5G04J 2HR2A 2R5SA 5BV1A 2KCKA 2BTDA 4GMJA 5G05J 4RVBA 3EJNA 2J4DA 4E6HA 3Q5MA 3FUDA 4I6GA 2VSNA 4ACKA 2GW1A 3ZIMA 5BT1A 3ZPJA 4APOA 2Q7FA 1N54A 3FHEA 4FLBA 3FDHA 5T8IA 4CGVA 4KT6B 4FA6A 5FZSA 1TJCA 2L0IA 4WWNA 4L7TA 4B94A 1E8ZA 3B7UX 1JPLA 2WVIA 3R9AB 1FCHA 2UY1B 3ENEA 2GGFA 1HF8A 2WXQA 1L5JA 3FP3A 3FUIA 3CVLA 1NA0A 4OVUA 3FUMA 4YNDA 3LKUA 3ZFWA 2WPVA 3FTWA 1XGWA 3URZA 4WNFA 3APCA 3D9KA 4HXIA 5ANRA 4U0ZA 4U0SA 4F53A 2IFUA 3JCKC 4HOUA 2I9CA 5J08A 3U4TA 1Z6TA 1Y6IA 2FI7A 1DVPA 1FVHA 1Z3YA 3IEGA 3DPDA 4RG6A 4B8CB 3JUIA 3MKQB 4XI9A 1ELRA 3SZ7A 3S7DA 4NURA 2FBNA 2YHEA 3B7SA 3ONLA 5C1DA 5JJTA 3RRNB 3LJ3A 3U3WA 3EHMA 2KCLA 2X6JA 3B7RL 3CHOA 1HS6A 4FC8A 4RSYA 4F3VA 4N5CA 4N3BA 1HO8A 2V5FA 4FJZA 3FUJA 1E8XA 4CT0A 4FHJA 3PZDA 3QB2A 4JW1A 4GYOA 3PDNA 5ANLA 3TXMA 4HORA 3AS5A 4CGWA 4J8SA 4GZ6A 1EPUA 3R7QA 3IHYA 3RIBA 3CKCA 3CVNA 2XEVA 5T4YA 4JA9A 1OWNA 4WNEA 3SI5A 2WXGA 3ULQA 2EQXA 3VTYA 3U64A 2ZU6B 3NQPA 4BFRA 3FEYA 4PS3A 4RG9A 5E76A 3DBSA 3QNKA 1HG2A 3SHFA 2LSUA 3TG4A 3ASFA 5BUZA 3BEEA 1SZAA 4AIFA 3P2BA 5FT9A 3LEWA 3PS6A 4H7YA 3RO3A 4DJAA 3D9IA 3I5PA 3PUJA 5FWQA 1KT1A 1QNFA 4APFA 4EPZA 4KMOA 2C2LA 2X6IA 5LP0A 4KXKB 5BNWA 1QQEA 1WM5A 5ARFA 3ZYMA 3VLFA 2FEZA 3I4RB 3RRMB 2WXOA 3BG0B 3FH8A 4AVXA 4K0RA 1E96B 4TV3A 2YINA 3E4BA 2VQ2A 3OXFA 3IKOB 4YVOA 4ANVA 4CCAA 4ATGA 5M72A 4GB9A 3SBSA 1UW4B 1E90A 5KJLA 1IYGA 1UN8A 4MKTA 3G2TA 2A5UA 3PEVB 4GCNA 4IN3B 3CEQA 3CVQA 1GW6A 5LOZA 3CVWA 4GA0A 4WWOA 4ACLA 4N2QA 2HM8A 4GZCA 4HOQA 3CVPA 1EDUA 3QAQA 3B13A 1P5QA 3GW4A 5FQ8A 1DNPA 2CG2A 5T3RA 2UWJG 1ELKA 4FADA 4I1MA 1NP7A 5AYWD 2AVPA 3FY4A 5A6CA 2X3MA 2JEKA 4EZLA 1UG3A 1S0PA 4AJWA 5AJDA 3LCAA 2A4ZA 3MKRA 5JJ6A 4LERA 3ZYQA 4AEZC 5LCWJ 3G2UA 4MLPA 1H0AA 3SF4A 4QFVA 3FH7A 4C0EA 3GZ2A 4EQFA 3I4GA 3SD5A 3LY8A 1UJKA 2I2OA 5AENA 3L6AA 4FP7A 4Q96A 2L6JA 5EX3A 4KZCA 3CVUA 3HIZA 2CHXA 1YA0A 4I9CA 1WY6A 5EDSA 3TG5A 2KATA 2KM4A 3GYZA 3UT8A 5BPPA 2X6KA 3FTUA 3G2WA 4JEUA 3NZSA 1NZNA 2NC9A 4IYPA 2XHEA 2AXVA 3SGHA 4UQXA 4A1SA 3D9PA 4WWPA 3FTVA 3G2SA 4D10C 1E7VA 3LY7A 3EIQC 3PH0C 2MHKA 4DI3A 3ASGA 4Y6WA 4A3TA 2PZIA 3MA5A 2KC7A 2VGYA 2J9QA 2V0PA 2YHCA 4PDXA 4BSXA 3JQ1A 3L16A 4GYWA 3TXNA 5CCLA 3CSFA 4C9BB 2WXHA 2WXNA 3MV2B 2WXJA 3MGBA 3KS2A 3PE3A 2Y4UA 2PQNA 3PNTB 4G1TA 2OV8A 4KYOB 3EIJA 5ENNA 2BF0X 3HVEA 4GZDA 3Q49B 4UWGA 4KVMA 1U3DA 2IOLA 3MX3A 4GPKA 1HXIA 3FTSA 3OXLA 3D9LA 3D9MA 5D0OD 2R17C 2WMOA 5FQ7A 4N2SA 1SQMA 4EECA 1ZBPA 2QFCA 2CHWA 2UY1A 3QC1A 4PS8A 4GU5A 2ONDA 3NZUA 2YNQA 4CT4A 3D9OA 3FTXA 2AXUA 1H2UA 3QJZA 3SFZA 3UMVA 2GRLA 3UPVA 4I17A 4Q69A 4PS7A 4EZJA 4I9EA 2X38A 2X6HA 4HS2A 4I2WA 3FH5A 3B7TA 1NA3A 2MRIA 4GZ5A 1OWMA 2MOWA 5FQ4A 1X5BA 4IRUA 4V3IA 4BTAA 3QKYA 2J08A 5A23A 3APDA 2VGXA 3LS8A 2DIWA 3D9NA 4ANWA 2R59A 2AW6A 3FU5A 4G26A 4DI4A 3ZXSA 4UI9K 2XRZA 1H6KA 2IQCA 4L1BA 4A3VA 4I2ZA 5HI7A 3L54A 3ZN3A 4G25A 5LFAA 5EX0A 4GZ3A 2WMNA 4UWHA 1HFAA 4IULA 3SBTB 3TAXA 3FUFA 3S7JA 3S7FA 1QZ2A 3G2VA 4JA7A 3QDNA 2XGSA 2DCPA 2OOEA 1A17A 3LVRE 3Q15A 2AXZA 2CFZA 2XCCA 1PC2A 3LVQE 2KCVA 3FWVA 5JHBA 3ESKA 2LSVA 4JHKA 4XI0A 5JJ7A 4CDRA 3MCXA 4CEMA 3TJPA 4ABNA 4BWRA 1UN9A 3CHMA 4UWFA 4ANUA 3OTNA 1EYHA 5JHAA 4JPSA 3FFLA 4L2LA 4L23A 4J8FA 5D0QD 2VSOE 2J09A 3KAEA 3FULA 3D3MA 3AS4A 3QWPA 5BV0A 4JZYA 2CHZA 2I1JA 3CVVA 4XZ4A 4ILGA 3HHMA 4KVOA 5C2YA 3FEXA 2YQ8A 2VSYA 4AP2A 3HYMB 3NF1A 2E2EA 3UQ3A 3ZVVA 3OAWA 3OXGA 2LO6A 2PM7A 1SZ9A 2XPZA 4AY6A 4UI9J 4YVQC 2C0LA 3ZYLA 1ELWA 4J8DA 3CV0A 5HQ8A 2IJGX 3RU0A 3PRZA 1PY1A 3JYSA 3EDTB 1TJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRN B;  3PEU B;  3PEV B;  3RRM B; 
#chains in the Genus database with same CATH topology
 2LAI A;  3ULE G;  3TWV A;  4JL0 A;  4XKC A;  4B0Z A;  1MHQ A;  3LPZ A;  3LY9 A;  2PQR A;  4BES A;  3CHR A;  5KJK A;  3FU6 A;  2Y4T A;  3F6Q A;  4GTM A;  3KEZ A;  2FO7 A;  2KBX A;  4WND A;  4M3O A;  1SVX A;  3KSL A;  4U7E B;  3VLD A;  3CQC B;  1H19 A;  1IQR A;  4FHK A;  3FUH A;  3TWX A;  3RO2 A;  5AAO A;  2HYZ A;  2HE0 A;  5G2N A;  1O5M A;  3QK0 A;  4GMR A;  4JHJ A;  5ENR D;  1OY3 D;  4TRQ A;  1U2V G;  2VYI A;  3NBN B;  4BTB A;  5B1B E;  4AXH A;  3B95 A;  3HXC A;  1MYO A;  3LXU X;  5EKQ D;  2XZT G;  3ASH A;  2WM9 A;  4BSZ B;  3HDX A;  2ION A;  4CYM D;  4G8L A;  3CST A;  4G23 A;  2RKK A;  3ZHE B;  4H7X A;  2C0M A;  2CG3 A;  1DC2 A;  4BT8 A;  4KZ0 A;  1E8Y A;  3CQG B;  4DJA A;  4UQY A;  4HOS A;  4U63 A;  1MX4 A;  3QWV A;  3MEK A;  3ZRH A;  2M63 A;  4MRU A;  3MKQ A;  4EZK A;  1UOH A;  1OWL A;  3VTX A;  4JHR A;  3U66 A;  5DIZ A;  2ETC A;  3Q75 A;  4DPR A;  4ZHB A;  4GTR A;  3D9H A;  5AIJ A;  5LCW C;  4O60 A;  2X6F A;  4N3A A;  2FUL A;  3APF A;  1HU3 A;  1EF1 C;  2P58 C;  2CFU A;  5BXO A;  3AU4 A;  4C0M A;  5KJN A;  1OWP A;  1N94 A;  5ENO D;  3L13 A;  2WQ7 A;  4R7L A;  3PZ2 A;  3S7B A;  2XQ0 A;  4AM9 A;  4GTP A;  3Q79 A;  2WXL A;  3NOC D;  4GA1 A;  5A7D B;  3MYV A;  3CVY A;  3UTM A;  4JVS A;  5KNH D;  5EYP F;  4BX8 A;  3ZEF A;  2XEE A;  2VTB A;  4LCT A;  4LRZ A;  5G05 J;  4QQI A;  1AWC B;  2BKK B;  2VSN A;  4ACK A;  3DRA A;  3ZIM A;  5BT1 A;  4APO A;  3TWS A;  5T8I A;  1YCS B;  3FDH A;  4U8Y D;  4FA6 A;  1TJC A;  4LG6 A;  4WWN A;  1X81 A;  2WVI A;  4HNA D;  3ENE A;  2GGF A;  1HF8 A;  4U95 D;  4OVU A;  2WPV A;  1XGW A;  4WNF A;  4TXQ A;  1JCR A;  2V5Q C;  4U0Z A;  4BET A;  5J08 A;  2FI7 A;  4RG6 A;  3DPD A;  3J5P A;  3SZ7 A;  2YHE A;  3ONL A;  3DSX A;  1FT2 A;  3RRN B;  3LJ3 A;  3U3W A;  5CEA A;  4HQD A;  4RSY A;  4N3B A;  3FUJ A;  3ZUV B;  3PZD A;  4JW1 A;  4GPM A;  4GZ6 A;  1EPU A;  3TWU A;  3CVN A;  5T4Y A;  1BLX B;  4XEI G;  2DWZ A;  1OWN A;  3SI5 A;  2WXG A;  2XS8 A;  5FIN A;  1MX6 A;  3UM2 A;  4BFR A;  3FEY A;  4PS3 A;  5E76 A;  3QNK A;  3SHF A;  5BUZ A;  3Q7A A;  2R05 A;  3BEE A;  2LXL A;  3DXM G;  5FT9 A;  3I5P A;  4EPZ A;  4KMO A;  1WM5 A;  3AG3 E;  2FEZ A;  2WXO A;  3BG0 B;  3FH8 A;  2EIM E;  1E96 B;  1IKN D;  3IKO B;  3SY2 A;  4GB9 A;  3SBS A;  5EN5 D;  3G2T A;  3CVQ A;  5KBA A;  4U8V D;  3CVP A;  1EDU A;  3TWW A;  3B13 A;  4HB5 A;  1ELK A;  3Q73 A;  5AYW D;  2AVP A;  3FY4 A;  5A6C A;  3SQV A;  1UG3 A;  1N9A A;  3MKR A;  4AEZ C;  5LCW J;  3V2O A;  5CER B;  4C0E A;  3FH7 A;  1UJK A;  5AEN A;  3L6A A;  4FP7 A;  4Q96 A;  2L6J A;  1YA0 A;  5CED B;  3G2W A;  2NC9 A;  4IYP A;  4A1S A;  4WWP A;  3FTV A;  1E7V A;  2P2C P;  2MHK A;  4Y6W A;  4PDX A;  3JQ1 A;  3CSF A;  3MV2 B;  3PE3 A;  4EHM A;  4G1T A;  4KYO B;  2BF0 X;  4GZD A;  4UWG A;  4KVM A;  4YDO A;  2LXM A;  3FTS A;  5EYL A;  3D9M A;  5D0O D;  4RLY A;  4N2S A;  1SQM A;  2UY1 A;  3QC1 A;  3NZU A;  3W9G A;  1S63 A;  2YNQ A;  4MBG A;  3D9O A;  2AXU A;  1H2U A;  3SFZ A;  2GRL A;  4I17 A;  2QZA A;  2X38 A;  1NA3 A;  5FQ4 A;  1A5E A;  2IY0 C;  3HXD A;  1O1R A;  4LSZ E;  5A23 A;  3D9N A;  2P9U G;  4DI4 A;  1H6K A;  2IQC A;  4A3V A;  3L54 A;  4G25 A;  3HXB A;  1OCR E;  3TAX A;  3SBT B;  3S7F A;  3G2V A;  4JA7 A;  2XGS A;  3LVR E;  3FWV A;  5JHB A;  5B1A E;  4CEM A;  4ABN A;  2QC9 A;  1EYH A;  4L2L A;  5BV0 A;  3KAE A;  2H6H A;  4JZY A;  1N0Q A;  3EU5 A;  5C2Y A;  2VSY A;  1N4Q A;  3HYM B;  2E2E A;  3UQ3 A;  2PM7 A;  1SZ9 A;  2XPZ A;  4YVQ C;  2C0L A;  3HG0 D;  3RU0 A;  3JYS A;  1UJJ A;  1ZU2 A;  3QWW A;  1BI8 B;  1E8W A;  2Y69 E;  4GML A;  2WQ6 A;  3ZNG A;  2OVF A;  4ANX A;  4OVV A;  4XX5 A;  1TNY A;  2P9S G;  3AS8 A;  3HVE B;  2V8S E;  3O4Z A;  3MJW A;  5BW8 C;  3NAW A;  4WNG A;  3D9J A;  5G04 C;  2E0I A;  2QYU A;  3MZL B;  3HXE A;  5DBK A;  2WQH A;  3Q4A B;  3E34 A;  5KJM A;  1IXV A;  4B93 B;  4BX9 A;  3CHS A;  2VGE A;  3PE4 A;  1H6P A;  1TR4 A;  4GYY A;  4Y6C A;  4HLE A;  4MS6 A;  3AG2 E;  5CRU A;  3CHQ A;  2AWI A;  3VLE A;  2H6F A;  4TXP A;  5G55 A;  4U07 A;  4GA2 A;  4JXT A;  3ASD A;  3S2A A;  3U9W A;  4Q94 A;  3L17 A;  3AU5 A;  4GAA A;  3UIO C;  3FUE A;  4J0U A;  2LNI A;  3ZHE A;  3UX4 A;  4LUN U;  4XKB A;  1WG0 A;  1G3N B;  1JWG A;  4CDN A;  2OVB A;  5AQA A;  5HRY A;  5ENP D;  1TN8 A;  4A55 A;  3FTY A;  3HXF A;  3R9M A;  2L0T B;  4ILH B;  4N39 A;  4X8Q A;  4DUI A;  1TYQ G;  2WXI A;  2DBA A;  4HVB A;  3T5X A;  2IF4 A;  2PL2 A;  1QYM A;  4BT9 A;  3DSS A;  2IOS A;  1KLX A;  2WXM A;  2XPI A;  5AJL A;  1U3C A;  3C98 A;  2J4B A;  3CK9 A;  4DX1 A;  2J49 A;  1TNU A;  4XIF A;  4PH4 B;  3CGH A;  1TNZ A;  3C3Q A;  3CK8 A;  4UQZ A;  3SO8 A;  2LAH A;  1DCE A;  1OT8 A;  3CHP A;  3FUN A;  4I1O B;  4DLQ A;  1OUV A;  1E7U A;  3JXJ A;  2NSZ A;  5KWD A;  2IU1 A;  1N0R A;  1N4P A;  3CIA A;  3L08 A;  4PUC A;  5BV1 A;  2BTD A;  4GMJ A;  3Q5M A;  3ZPJ A;  1N54 A;  5FZS A;  2L0I A;  3ULY A;  1E8Z A;  1JPL A;  2UY1 B;  2WXQ A;  1L5J A;  3JUE A;  3FUI A;  3FTW A;  3APC A;  1N4R A;  3Q9N C;  5ANR A;  4U0S A;  2IFU A;  1QBQ A;  2I9C A;  4HRM B;  2GRP B;  1Z6T A;  1Y6I A;  1DVP A;  1Z3Y A;  3MKQ B;  4XI9 A;  1ELR A;  2F0Y A;  3S7D A;  4NUR A;  4HRN A;  3B7S A;  3EHM A;  1TNO A;  1OCO E;  4F3V A;  1E8X A;  4CT0 A;  2P9I G;  4GYO A;  3PDN A;  3T8K A;  4CGW A;  2P9N G;  3IHY A;  4OAV B;  4JA9 A;  3U64 A;  2V4H C;  3DBS A;  2EIN E;  2LSU A;  2EIJ E;  4K5A B;  4N5Q A;  3P2B A;  2L6B A;  1OCC E;  5FWQ A;  2F37 A;  5AN8 A;  5LP0 A;  2X6I A;  4JB8 P;  4HI9 A;  3I4R B;  4TV3 A;  5EID A;  2VQ2 A;  3ZU7 B;  4ANV A;  5M72 A;  3ABK E;  5JA4 D;  3E32 A;  3B7B A;  2A5U A;  3PEV B;  4IN3 B;  3CVW A;  4WWO A;  4ACL A;  4N2Q A;  4GZC A;  5KNG A;  1P5Q A;  5HKP A;  2UWJ G;  1NP7 A;  1N95 A;  2JEK A;  4EZL A;  3ZYQ A;  4EQF A;  3GZ2 A;  2DVW A;  5EX3 A;  1K3Z D;  4KZC A;  3CVU A;  5ENT D;  4I9C A;  2KAT A;  2KM4 A;  3GYZ A;  3UT8 A;  5BPP A;  3SFY A;  4DX2 A;  2ETA A;  3D9P A;  3LY7 A;  3PH0 C;  4DI3 A;  3MA5 A;  2J9Q A;  2YHC A;  3L16 A;  2WXH A;  3RAU A;  2OV8 A;  2IO2 C;  3EUV A;  2IOL A;  4GPK A;  4ZFH A;  3DSU A;  3RSE G;  2WMO A;  5FQ7 A;  3AG4 E;  3UPV A;  4PS7 A;  3B7T A;  2KXP C;  1V54 E;  4ANW A;  3APD A;  2VGX A;  2R59 A;  2AW6 A;  4G26 A;  4HI8 A;  5AQB A;  4UI9 K;  4L1B A;  4I2Z A;  1TN6 A;  4DRX E;  4GZ3 A;  2WMN A;  4UWH A;  1QZ2 A;  3SFX A;  3QDN A;  2OOE A;  1PC2 A;  2KCV A;  3ESK A;  2LSV A;  4JHK A;  2EIL E;  2J8S D;  4CDR A;  5JJ7 A;  4BWR A;  3CHM A;  3UM3 A;  4HBD A;  4ANU A;  4JPS A;  3AS4 A;  3QWP A;  4ILG A;  4KVO A;  3FEX A;  2YQ8 A;  3OXG A;  1MX2 A;  4AY6 A;  1ELW A;  4J8D A;  3PRZ A;  2Y0B G;  3GZS A;  4G11 A;  3AG1 E;  1HX8 A;  3KD7 A;  5ENS D;  3UXG A;  3BG1 B;  3IV0 A;  2XGM A;  1KZP A;  3CLJ A;  4O6F A;  5G05 C;  1BU9 A;  4J7W A;  3CK7 A;  3PEU B;  3P1U A;  2P9P G;  2IO3 C;  3MV3 B;  2RG8 A;  4AV7 A;  3PZ4 A;  2H6I A;  3FTZ A;  2R03 A;  5FJY A;  2OCC E;  2VSX E;  3V2X A;  3ASO E;  2GRM A;  4Z68 A;  4ILI A;  4I43 A;  3ML8 A;  3ML9 A;  3Q47 B;  4U04 A;  3ESL A;  2F8X K;  2AJA A;  3RJV A;  2XS1 A;  4WAF A;  4FU3 A;  4DK5 A;  3UUX A;  2XEH A;  1LF8 A;  3QAR A;  3ZYK A;  2FF4 A;  4NAC A;  4U96 D;  1Y8M A;  1FVF A;  1V55 E;  2VTB B;  2ILR A;  4XE0 A;  1D9S A;  4UI9 C;  3T5V A;  4GTV A;  5FZR A;  4K03 A;  1H2V C;  3FU3 A;  2WXR A;  3UM0 A;  1INZ A;  2XPY A;  3JXI A;  4J6I A;  2A5E A;  3W9F A;  3IBE A;  4HOT A;  1WAO 1;  3SNX A;  3O48 A;  1JWF A;  1JCS A;  1N4S A;  2WB2 A;  4DX5 D;  4TUU A;  3JQ0 A;  1NFI E;  2WXF A;  2RD0 A;  5AQ9 A;  4U0U A;  2PM6 A;  1NI1 A;  2J07 A;  4JEH A;  4DLO A;  4G24 A;  2NXP A;  3LDZ A;  4K5B A;  4P29 A;  3RRU A;  2H6G A;  2XCB A;  3J5Q B;  1NL4 A;  4NRH B;  3R7R A;  4B8A A;  1XNF A;  3TGO A;  3EHN A;  3C3R A;  5B3S E;  1PAQ A;  2PNN A;  4OYS A;  2QYJ A;  4AOF A;  5ARG A;  4FJY A;  3N71 A;  3PZ3 A;  1TEZ A;  1K1A A;  4I1A A;  1VDY A;  3DXK G;  4E85 A;  2DZN A;  2JLB A;  2WXP A;  2XRY A;  2BUG A;  3L22 A;  5CEC B;  5CHE E;  1N52 A;  5G04 J;  2HR2 A;  2RFA A;  2KCK A;  4RVB A;  5H7P A;  4E6H A;  2JAB A;  3FUD A;  3T9K A;  3FHE A;  4KT6 B;  3ABL E;  4L7T A;  1FCH A;  1N11 A;  3URZ A;  3HRA A;  3D9K A;  4TUM A;  4HXI A;  4F53 A;  1TNB A;  4HOU A;  4BEP A;  3U4T A;  3KSQ A;  3IEG A;  2RFM A;  2Y1L E;  2FBN A;  5C1D A;  5JJT A;  2KCL A;  1ZB1 A;  2IEJ A;  4FC8 A;  4N5C A;  1HO8 A;  2BED A;  4FHJ A;  4J8Y A;  5HS0 A;  3TXM A;  3ISM C;  3AS5 A;  4HOR A;  3C3O A;  3EHR A;  3CKC A;  4WNE A;  2EQX A;  3VTY A;  2ZU6 B;  1FPP A;  4RG9 A;  1HG2 A;  2OEW A;  3TG4 A;  1RZ4 A;  3LEW A;  3PS6 A;  3RO3 A;  3D9I A;  4APF A;  1KT1 A;  2FO1 E;  2GRO B;  3E33 A;  5BNW A;  1S64 A;  5ARF A;  3VLF A;  3Q7F A;  3EU9 A;  3UIP C;  2YIN A;  4YVO A;  4CCA A;  4ATG A;  1Z5S C;  2DYR E;  1E90 A;  1UN8 A;  4MKT A;  4GCN A;  1GW6 A;  2ETB A;  4C48 B;  4GA0 A;  3QAQ A;  5FQ8 A;  2CG2 A;  4FAD A;  4I1M A;  2X3M A;  1TN7 A;  5AJD A;  2A4Z A;  3G2U A;  4MLP A;  3SF4 A;  2XZD G;  3I4G A;  4LNU D;  3SD5 A;  3LY8 A;  4O1O A;  4DX7 D;  5D66 A;  3HIZ A;  3TG5 A;  5FIO A;  2X6K A;  3FTU A;  3SGH A;  4OAU C;  5EIL A;  4UQX A;  2DZO A;  3G2S A;  3UM1 A;  4D10 C;  3EIQ C;  3L82 A;  4A3T A;  3WG7 E;  2VGY A;  4GYW A;  3TXN A;  4C9B B;  2WXN A;  3ABM E;  3MGB A;  2ZGD A;  3AJI A;  5ENN A;  2F8Y A;  3Q49 B;  2OEV A;  2GRR B;  1HXI A;  3D9L A;  2GRQ B;  5CBN A;  4EEC A;  1ZBP A;  3BU8 A;  4CT4 A;  1YYH A;  3QJZ A;  3UMV A;  1SA5 A;  4HLL A;  4I2W A;  4HS2 A;  2MOW A;  1X5B A;  4V3I A;  2MYO A;  4BTA A;  3QKY A;  2J08 A;  4G8K A;  2DIW A;  3FU5 A;  2XRZ A;  5HI7 A;  3ZN3 A;  5EX0 A;  4ATZ D;  1HFA A;  4IUL A;  1D8D A;  3FUF A;  3S7J A;  2DCP A;  3Q15 A;  2AXZ A;  2CFZ A;  2XCC A;  3LVQ E;  3TJP A;  1UN9 A;  3NOG D;  4K5C A;  3OTN A;  4L23 A;  2J09 A;  2CHZ A;  2I1J A;  4XZ4 A;  3C5R A;  3HHM A;  4YDW A;  2LO6 A;  3V31 A;  1Q2Z A;  3ZYL A;  3EDT B;  3ZKJ A;  2KZT B;  4A63 B;  4F6R D;  2ZXW E;  1LD8 A;  3DEP A;  3GZ1 A;  1IHG A;  1O1S A;  4CDM A;  5E75 A;  4RQI A;  3FUK A;  3WXX A;  4W9R A;  3UKR G;  4HFG A;  4UWK A;  2P9K G;  4F7A A;  4CZ2 D;  4B89 A;  4ME2 A;  1MJ0 A;  3PNL B;  2V4L A;  1W3B A;  1SW6 A;  2Y3A A;  4I6J A;  5D2M C;  5BXU A;  2KZT A;  2HO1 A;  1K1B A;  3DEO A;  4G2V A;  1JUQ A;  5CMY A;  3AAA C;  3RKV A;  4JC8 A;  3PUK A;  4U8H A;  1Z3X A;  2I6H A;  4I6E A;  4UUC A;  3ZGQ A;  5LX8 A;  4GTO A;  4CRW A;  4J8E A;  3UT4 A;  5FTP A;  2NYJ A;  4BER A;  4URK A;  2WXK A;  3CKB A;  4WUY A;  5CMW A;  4FLH A;  4GTS A;  4GCO A;  3E30 A;  3UT7 A;  2VGX B;  2I1K A;  1O1T A;  1HE8 A;  1BPO A;  2L9B A;  1H2T C;  5KCM A;  4L2Y A;  1WDY A;  1OWO A;  4KBQ A;  3ONK A;  5J90 A;  2LUH A;  2ZGG A;  3PVL A;  5FQ6 A;  1OXJ A;  4FUL A;  4EBA G;  4N3C A;  4HRL A;  5FZQ A;  4A1G A;  1YMP A;  3UIN C;  3FU0 A;  1HH8 A;  4YDE A;  2B6C A;  3TWT A;  1KT0 A;  3CR3 A;  1IQU A;  4NQ0 A;  3RK6 A;  1AP7 A;  2QY7 A;  2VJ8 A;  3Q78 A;  3I3N A;  3LYA A;  4F1S A;  4BY6 A;  1SA4 A;  3QOU A;  3K9I A;  3PRE A;  3CVX A;  5JMN D;  4LEU A;  1HZ4 A;  4AY5 A;  4EBA A;  3KEA A;  5EIB E;  3T8M A;  4UWL A;  2XGO A;  1B89 A;  3IXE A;  1MQS A;  2ZIR A;  1FT1 A;  3IHV A;  3C72 A;  1HG5 A;  3ZW3 A;  5CCM A;  3TL5 A;  2R5S A;  3EJN A;  5CBO A;  2J4D A;  4I6G A;  4GTQ A;  2GW1 A;  2Q7F A;  4FLB A;  4CGV A;  4B94 A;  3B7U X;  3R9A B;  3FP3 A;  1RW2 A;  3CVL A;  1NA0 A;  4YND A;  3FUM A;  3LKU A;  3ZFW A;  3DST A;  2GRN B;  3Q9U C;  3JCK C;  3UI2 A;  1FVH A;  4B8C B;  3JUI A;  3V30 A;  3V79 K;  3NB2 A;  2XEN A;  2X6J A;  3B7R L;  3CHO A;  1HS6 A;  4NIK A;  3BUA A;  2V5F A;  4FJZ A;  2R02 A;  5ITZ F;  3QB2 A;  5ANL A;  5AAR A;  4GTT A;  4J8S A;  3R7Q A;  3RIB A;  2XEV A;  5ENQ D;  3ULQ A;  1K8K G;  3NQP A;  4O1P A;  3DWL G;  1BD8 A;  3ASF A;  4F1P A;  1SZA A;  4AIF A;  3TWQ A;  4H7Y A;  3PUJ A;  1QNF A;  2C2L A;  4KXK B;  1QQE A;  3ZYM A;  3RRM B;  4AVX A;  4K0R A;  4M7C A;  3E4B A;  3OXF A;  1S70 B;  2EIK E;  3PZ1 A;  1UW4 B;  5KJL A;  1IYG A;  3BQO A;  3CEQ A;  5LOZ A;  1LD7 A;  2HM8 A;  4HOQ A;  3GW4 A;  4LNB A;  1DNP A;  5T3R A;  3E37 A;  3UKU G;  1S0P A;  4AJW A;  1MZC A;  3LCA A;  5JJ6 A;  4LER A;  1H0A A;  4QFV A;  1BI7 B;  3TWR A;  2I2O A;  2CHX A;  1WY6 A;  5EDS A;  4JEU A;  3NZS A;  1NZN A;  2BKG A;  3X2Q E;  2XHE A;  2AXV A;  3ASG A;  2PZI A;  1IHB A;  2KC7 A;  2V0P A;  4BSX A;  3ZXP A;  5CCL A;  1OCZ E;  2WXJ A;  3KS2 A;  2Y4U A;  2P9L G;  2PQN A;  3PNT B;  3EIJ A;  3HVE A;  1KPS B;  5AQ7 A;  1U3D A;  3MX3 A;  3OXL A;  2R17 C;  3DSW A;  2QFC A;  2CHW A;  4DX6 D;  4PS8 A;  4GU5 A;  2OND A;  3FTX A;  1JCQ A;  1KZO A;  4Q69 A;  4EZJ A;  4I9E A;  2X6H A;  3EHQ A;  3FH5 A;  2MRI A;  4GZ5 A;  1OWM A;  3ASN E;  4IRU A;  3LS8 A;  2B0O E;  1LTX A;  3ZXS A;  2DYS E;  5LFA A;  4JD2 G;  3DPY A;  3DSV A;  2R2L A;  3LJN A;  5IY5 E;  1A17 A;  4YDY A;  4XI0 A;  3MCX A;  4TXR A;  4UWF A;  4L9P A;  5JHA A;  5D0Q D;  3FFL A;  4J8F A;  5CRV A;  2VSO E;  2ZIS A;  3D3M A;  3FUL A;  4LNG A;  3CVV A;  4AP2 A;  3NF1 A;  3ZVV A;  3OAW A;  3L9T A;  4UI9 J;  1D8E A;  3CV0 A;  5HQ8 A;  2IJG X;  1H6O A;  1PY1 A;  1TJF A;  1DCQ A; 
#chains in the Genus database with same CATH homology
 2LAI A;  1UJJ A;  1ZU2 A;  3GZS A;  4G11 A;  3QWW A;  1E8W A;  1HX8 A;  4JL0 A;  2KZT B;  4GML A;  3KD7 A;  4XKC A;  4B0Z A;  2WQ6 A;  1MHQ A;  2OVF A;  3LPZ A;  3GZ1 A;  3LY9 A;  4ANX A;  4OVV A;  1IHG A;  4XX5 A;  2PQR A;  4CDM A;  3CHR A;  5KJK A;  3BG1 B;  3FU6 A;  5E75 A;  3IV0 A;  2Y4T A;  2XGM A;  3CLJ A;  3FUK A;  4O6F A;  3WXX A;  5G05 C;  3AS8 A;  3HVE B;  4W9R A;  2V8S E;  3O4Z A;  3MJW A;  5BW8 C;  3KEZ A;  4WNG A;  3D9J A;  2FO7 A;  4HFG A;  3CK7 A;  2E0I A;  3PEU B;  4WND A;  5G04 C;  3P1U A;  4M3O A;  3MZL B;  5DBK A;  2WQH A;  3MV3 B;  4UWK A;  3VLD A;  3CQC B;  3Q4A B;  1H19 A;  5KJM A;  4F7A A;  2RG8 A;  4AV7 A;  1IQR A;  4FHK A;  4B89 A;  3FTZ A;  3FUH A;  5FJY A;  4ME2 A;  3PNL B;  2V4L A;  3RO2 A;  2VSX E;  2HYZ A;  1W3B A;  2GRM A;  5G2N A;  4BX9 A;  2Y3A A;  4I6J A;  3QK0 A;  3CHS A;  4ILI A;  4I43 A;  3PE4 A;  3ML8 A;  3ML9 A;  3Q47 B;  4JHJ A;  4U04 A;  3ESL A;  2KZT A;  2HO1 A;  4TRQ A;  4GYY A;  4Y6C A;  4G2V A;  2VYI A;  4WAF A;  3RJV A;  4FU3 A;  4MS6 A;  4DK5 A;  4HLE A;  4BTB A;  1JUQ A;  3UUX A;  5CMY A;  4AXH A;  3RKV A;  4JC8 A;  3CHQ A;  3LXU X;  5EKQ D;  1LF8 A;  3QAR A;  3ASH A;  2WM9 A;  3ZYK A;  2FF4 A;  4NAC A;  2AWI A;  3PUK A;  4U8H A;  1Y8M A;  1FVF A;  3VLE A;  2VTB B;  2ILR A;  4XE0 A;  3HDX A;  4UI9 C;  1Z3X A;  4U07 A;  2ION A;  5G55 A;  3T5V A;  4GA2 A;  4JXT A;  2I6H A;  3CST A;  3ASD A;  3S2A A;  4G23 A;  4I6E A;  3U9W A;  5FZR A;  3ZGQ A;  4K03 A;  5LX8 A;  4Q94 A;  4CRW A;  4J8E A;  3L17 A;  3AU5 A;  3UT4 A;  4GAA A;  3ZHE B;  4H7X A;  2C0M A;  5FTP A;  1H2V C;  2CG3 A;  3FU3 A;  2WXR A;  4BT8 A;  4KZ0 A;  1INZ A;  3FUE A;  4J0U A;  4URK A;  1E8Y A;  2WXK A;  2XPY A;  3CQG B;  2LNI A;  3CKB A;  4WUY A;  4FLH A;  3UX4 A;  4J6I A;  4GCO A;  4LUN U;  4XKB A;  3ZHE A;  4UQY A;  5CMW A;  3UT7 A;  2VGX B;  2I1K A;  4HOS A;  1HE8 A;  4U63 A;  3IBE A;  1BPO A;  1H2T C;  2L9B A;  5KCM A;  4HOT A;  1WAO 1;  3SNX A;  1JWG A;  3O48 A;  3QWV A;  2OVB A;  3MEK A;  4CDN A;  1JWF A;  3ZRH A;  2M63 A;  4MRU A;  3MKQ A;  4L2Y A;  4EZK A;  2WB2 A;  1OWO A;  4KBQ A;  4A55 A;  3ONK A;  4TUU A;  5J90 A;  3FTY A;  3JQ0 A;  3PVL A;  5FQ6 A;  2WXF A;  4FUL A;  2L0T B;  1OWL A;  3VTX A;  2RD0 A;  4JHR A;  4ILH B;  4EBA G;  3U66 A;  4N3C A;  4N39 A;  5FZQ A;  4A1G A;  4U0U A;  2PM6 A;  2J07 A;  2WXI A;  2DBA A;  3FU0 A;  5DIZ A;  1HH8 A;  4HVB A;  4JEH A;  4DLO A;  4G24 A;  2NXP A;  3LDZ A;  4P29 A;  3T5X A;  2IF4 A;  2PL2 A;  1KT0 A;  4DPR A;  3CR3 A;  3RRU A;  4BT9 A;  2IOS A;  2XCB A;  1KLX A;  2WXM A;  5AIJ A;  1IQU A;  4NQ0 A;  4NRH B;  2XPI A;  5AJL A;  3R7R A;  3RK6 A;  2QY7 A;  2VJ8 A;  4B8A A;  1U3C A;  5LCW C;  3C98 A;  3I3N A;  1XNF A;  3LYA A;  4F1S A;  2J4B A;  3TGO A;  3CK9 A;  4BY6 A;  2J49 A;  3EHN A;  2X6F A;  4N3A A;  2FUL A;  1PAQ A;  4XIF A;  3APF A;  4PH4 B;  3CGH A;  4OYS A;  1HU3 A;  1EF1 C;  2P58 C;  4AOF A;  2CFU A;  3QOU A;  3AU4 A;  3CK8 A;  3K9I A;  3PRE A;  4C0M A;  4UQZ A;  5KJN A;  3CVX A;  4LEU A;  5ARG A;  1OWP A;  1HZ4 A;  2LAH A;  4AY5 A;  4FJY A;  3L13 A;  2WQ7 A;  4EBA A;  3N71 A;  1TEZ A;  4R7L A;  3S7B A;  2XQ0 A;  4I1A A;  4AM9 A;  1VDY A;  3T8M A;  3CHP A;  3FUN A;  2XGO A;  4I1O B;  4UWL A;  2WXL A;  4GA1 A;  4DLQ A;  1B89 A;  1OUV A;  5A7D B;  1MQS A;  1E7U A;  3MYV A;  4E85 A;  3CVY A;  2JLB A;  2NSZ A;  2WXP A;  3IHV A;  2IU1 A;  4JVS A;  2XRY A;  2BUG A;  3CIA A;  4BX8 A;  1HG5 A;  3ZW3 A;  5CCM A;  3ZEF A;  3L08 A;  3L22 A;  2VTB A;  4PUC A;  5CHE E;  3TL5 A;  1N52 A;  4LCT A;  4LRZ A;  5G04 J;  2HR2 A;  2R5S A;  5BV1 A;  2KCK A;  2BTD A;  4GMJ A;  5G05 J;  4RVB A;  3EJN A;  2J4D A;  4E6H A;  3Q5M A;  3FUD A;  4I6G A;  2VSN A;  4ACK A;  2GW1 A;  3ZIM A;  5BT1 A;  3ZPJ A;  4APO A;  2Q7F A;  1N54 A;  3FHE A;  4FLB A;  3FDH A;  5T8I A;  4CGV A;  4KT6 B;  4FA6 A;  5FZS A;  1TJC A;  2L0I A;  4WWN A;  4L7T A;  4B94 A;  1E8Z A;  3B7U X;  1JPL A;  2WVI A;  3R9A B;  1FCH A;  2UY1 B;  3ENE A;  2GGF A;  1HF8 A;  2WXQ A;  1L5J A;  3FP3 A;  3FUI A;  3CVL A;  1NA0 A;  4OVU A;  3FUM A;  4YND A;  3LKU A;  3ZFW A;  2WPV A;  3FTW A;  1XGW A;  3URZ A;  4WNF A;  3APC A;  3D9K A;  4HXI A;  5ANR A;  4U0Z A;  4U0S A;  4F53 A;  2IFU A;  3JCK C;  4HOU A;  2I9C A;  5J08 A;  3U4T A;  1Z6T A;  1Y6I A;  2FI7 A;  1DVP A;  1FVH A;  1Z3Y A;  3IEG A;  3DPD A;  4RG6 A;  4B8C B;  3JUI A;  3MKQ B;  4XI9 A;  1ELR A;  3SZ7 A;  3S7D A;  4NUR A;  2FBN A;  2YHE A;  3B7S A;  3ONL A;  5C1D A;  5JJT A;  3RRN B;  3LJ3 A;  3U3W A;  3EHM A;  2KCL A;  2X6J A;  3B7R L;  3CHO A;  1HS6 A;  4FC8 A;  4RSY A;  4F3V A;  4N5C A;  4N3B A;  1HO8 A;  2V5F A;  4FJZ A;  3FUJ A;  1E8X A;  4CT0 A;  4FHJ A;  3PZD A;  3QB2 A;  4JW1 A;  4GYO A;  3PDN A;  5ANL A;  3TXM A;  4HOR A;  3AS5 A;  4CGW A;  4J8S A;  4GZ6 A;  1EPU A;  3R7Q A;  3IHY A;  3RIB A;  3CKC A;  3CVN A;  2XEV A;  5T4Y A;  4JA9 A;  1OWN A;  4WNE A;  3SI5 A;  2WXG A;  3ULQ A;  2EQX A;  3VTY A;  3U64 A;  2ZU6 B;  3NQP A;  4BFR A;  3FEY A;  4PS3 A;  4RG9 A;  5E76 A;  3DBS A;  3QNK A;  1HG2 A;  3SHF A;  2LSU A;  3TG4 A;  3ASF A;  5BUZ A;  3BEE A;  1SZA A;  4AIF A;  3P2B A;  5FT9 A;  3LEW A;  3PS6 A;  4H7Y A;  3RO3 A;  4DJA A;  3D9I A;  3I5P A;  3PUJ A;  5FWQ A;  1KT1 A;  1QNF A;  4APF A;  4EPZ A;  4KMO A;  2C2L A;  2X6I A;  5LP0 A;  4KXK B;  5BNW A;  1QQE A;  1WM5 A;  5ARF A;  3ZYM A;  3VLF A;  2FEZ A;  3I4R B;  3RRM B;  2WXO A;  3BG0 B;  3FH8 A;  4AVX A;  4K0R A;  1E96 B;  4TV3 A;  2YIN A;  3E4B A;  2VQ2 A;  3OXF A;  3IKO B;  4YVO A;  4ANV A;  4CCA A;  4ATG A;  5M72 A;  4GB9 A;  3SBS A;  1UW4 B;  1E90 A;  5KJL A;  1IYG A;  1UN8 A;  4MKT A;  3G2T A;  2A5U A;  3PEV B;  4GCN A;  4IN3 B;  3CEQ A;  3CVQ A;  1GW6 A;  5LOZ A;  3CVW A;  4GA0 A;  4WWO A;  4ACL A;  4N2Q A;  2HM8 A;  4GZC A;  4HOQ A;  3CVP A;  1EDU A;  3QAQ A;  3B13 A;  1P5Q A;  3GW4 A;  5FQ8 A;  1DNP A;  2CG2 A;  5T3R A;  2UWJ G;  1ELK A;  4FAD A;  4I1M A;  1NP7 A;  5AYW D;  2AVP A;  3FY4 A;  5A6C A;  2X3M A;  2JEK A;  4EZL A;  1UG3 A;  1S0P A;  4AJW A;  5AJD A;  3LCA A;  2A4Z A;  3MKR A;  5JJ6 A;  4LER A;  3ZYQ A;  4AEZ C;  5LCW J;  3G2U A;  4MLP A;  1H0A A;  3SF4 A;  4QFV A;  3FH7 A;  4C0E A;  3GZ2 A;  4EQF A;  3I4G A;  3SD5 A;  3LY8 A;  1UJK A;  2I2O A;  5AEN A;  3L6A A;  4FP7 A;  4Q96 A;  2L6J A;  5EX3 A;  4KZC A;  3CVU A;  3HIZ A;  2CHX A;  1YA0 A;  4I9C A;  1WY6 A;  5EDS A;  3TG5 A;  2KAT A;  2KM4 A;  3GYZ A;  3UT8 A;  5BPP A;  2X6K A;  3FTU A;  3G2W A;  4JEU A;  3NZS A;  1NZN A;  2NC9 A;  4IYP A;  2XHE A;  2AXV A;  3SGH A;  4UQX A;  4A1S A;  3D9P A;  4WWP A;  3FTV A;  3G2S A;  4D10 C;  1E7V A;  3LY7 A;  3EIQ C;  3PH0 C;  2MHK A;  4DI3 A;  3ASG A;  4Y6W A;  4A3T A;  2PZI A;  3MA5 A;  2KC7 A;  2VGY A;  2J9Q A;  2V0P A;  2YHC A;  4PDX A;  4BSX A;  3JQ1 A;  3L16 A;  4GYW A;  3TXN A;  5CCL A;  3CSF A;  4C9B B;  2WXH A;  2WXN A;  3MV2 B;  2WXJ A;  3MGB A;  3KS2 A;  3PE3 A;  2Y4U A;  2PQN A;  3PNT B;  4G1T A;  2OV8 A;  4KYO B;  3EIJ A;  5ENN A;  2BF0 X;  3HVE A;  4GZD A;  3Q49 B;  4UWG A;  4KVM A;  1U3D A;  2IOL A;  3MX3 A;  4GPK A;  1HXI A;  3FTS A;  3OXL A;  3D9L A;  3D9M A;  5D0O D;  2R17 C;  2WMO A;  5FQ7 A;  4N2S A;  1SQM A;  4EEC A;  1ZBP A;  2QFC A;  2CHW A;  2UY1 A;  3QC1 A;  4PS8 A;  4GU5 A;  2OND A;  3NZU A;  2YNQ A;  4CT4 A;  3D9O A;  3FTX A;  2AXU A;  1H2U A;  3QJZ A;  3SFZ A;  3UMV A;  2GRL A;  3UPV A;  4I17 A;  4Q69 A;  4PS7 A;  4EZJ A;  4I9E A;  2X38 A;  2X6H A;  4HS2 A;  4I2W A;  3FH5 A;  3B7T A;  1NA3 A;  2MRI A;  4GZ5 A;  1OWM A;  2MOW A;  5FQ4 A;  1X5B A;  4IRU A;  4V3I A;  4BTA A;  3QKY A;  2J08 A;  5A23 A;  3APD A;  2VGX A;  3LS8 A;  2DIW A;  3D9N A;  4ANW A;  2R59 A;  2AW6 A;  3FU5 A;  4G26 A;  4DI4 A;  3ZXS A;  4UI9 K;  2XRZ A;  1H6K A;  2IQC A;  4L1B A;  4A3V A;  4I2Z A;  5HI7 A;  3L54 A;  3ZN3 A;  4G25 A;  5LFA A;  5EX0 A;  4GZ3 A;  2WMN A;  4UWH A;  1HFA A;  4IUL A;  3SBT B;  3TAX A;  3FUF A;  3S7J A;  3S7F A;  1QZ2 A;  3G2V A;  4JA7 A;  3QDN A;  2XGS A;  2DCP A;  2OOE A;  1A17 A;  3LVR E;  3Q15 A;  2AXZ A;  2CFZ A;  2XCC A;  1PC2 A;  3LVQ E;  2KCV A;  3FWV A;  5JHB A;  3ESK A;  2LSV A;  4JHK A;  4XI0 A;  5JJ7 A;  4CDR A;  3MCX A;  4CEM A;  3TJP A;  4ABN A;  4BWR A;  1UN9 A;  3CHM A;  4UWF A;  4ANU A;  3OTN A;  1EYH A;  5JHA A;  4JPS A;  3FFL A;  4L2L A;  4L23 A;  4J8F A;  5D0Q D;  2VSO E;  2J09 A;  3KAE A;  3FUL A;  3D3M A;  3AS4 A;  3QWP A;  5BV0 A;  4JZY A;  2CHZ A;  2I1J A;  3CVV A;  4XZ4 A;  4ILG A;  3HHM A;  4KVO A;  5C2Y A;  3FEX A;  2YQ8 A;  2VSY A;  4AP2 A;  3HYM B;  3NF1 A;  2E2E A;  3UQ3 A;  3ZVV A;  3OAW A;  3OXG A;  2LO6 A;  2PM7 A;  1SZ9 A;  2XPZ A;  4AY6 A;  4UI9 J;  4YVQ C;  2C0L A;  3ZYL A;  1ELW A;  4J8D A;  3CV0 A;  5HQ8 A;  2IJG X;  3RU0 A;  3PRZ A;  1PY1 A;  3JYS A;  3EDT B;  1TJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...