3PEUB

S. cerevisiae dbp5 l327v c-terminal domain bound to gle1 h337r and ip6
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
TNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVRQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 108
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3peuB00
3RRMB 3PEUB 3PEVB 3RRNB
chains in the Genus database with same CATH superfamily
5JJTA 4QQIA 1N54A 3OXLA 3UTMA 3JUEA 4NIKA 2P58C 3WG7E 4X8QA 3ESKA 4UWLA 5BUZA 2ILRA 4AXHA 4XI0A 4U8YD 4CEMA 2IQCA 1N4QA 1Z3XA 4H7XA 1A5EA 5T3RA 1HZ4A 3NAWA 4UUCA 2RD0A 2P9UG 3ZYQA 2FULA 4HS2A 5BV0A 3EHNA 3HG0D 3CVPA 3IXEA 1YMPA 4HB5A 4BEPA 4K5CA 2A4ZA 3ZYMA 5ENPD 4G23A 4HI8A 2GRPB 3G2SA 4JHKA 1PY1A 3L22A 4GA0A 3TWVA 4XE0A 3O4ZA 4PS7A 4B94A 4TRQA 4B89A 5KNGA 5FQ7A 3PEVB 2V4LA 3SQVA 3ZUVB 1K1BA 2V5FA 3R7RA 2XENA 5G04J 4QFVA 3PS6A 4OVUA 4EHMA 5LX8A 4U0ZA 5LCWC 2VTBA 1B89A 1OWLA 4ILIA 5ENNA 1P5QA 2XPYA 1BPOA 4HXIA 1YYHA 2FEZA 2WB2A 5DBKA 1O1TA 4WNFA 3AG2E 3SHFA 3I3NA 4F6RD 3RO2A 1KT0A 2YINA 3CKBA 4NURA 3L13A 4GTQA 1N9AA 3C72A 2MHKA 3CHMA 4JXTA 2UWJG 4I6JA 4N2QA 3DSTA 2WXQA 5J90A 3DWLG 4JEHA 3LVQE 4PH4B 3ASNE 3MKRA 3GZ1A 4N2SA 2E0IA 3SBSA 2HYZA 3KS2A 5G55A 1E8YA 1OCRE 4CCAA 3G2WA 4LUNU 2R5SA 4I1AA 3TG5A 4P29A 3ZYKA 3UM3A 5FIOA 4FHKA 3EHQA 5HKPA 2XZTG 1IHGA 3TXMA 3FY4A 3TAXA 3FUJA 2WXOA 2VSYA 4XKBA 1DC2A 5D66A 3FFLA 4YDOA 2VSNA 3UKRG 2ONDA 1OY3D 2XEVA 4WWOA 4DX2A 2E2EA 3FP3A 3V2OA 1INZA 4YVOA 4UWHA 3D3MA 4WNGA 4B8AA 4ATZD 1N4PA 5FZQA 4JA7A 4JEUA 4GMJA 3UM1A 2KCVA 2L6JA 4U7EB 2PNNA 4JPSA 5EYPF 3PDNA 5C1DA 2KM4A 1K3ZD 3QNKA 3URZA 1SVXA 4BT9A 4U96D 4EZLA 3CVQA 1H2TC 1YA0A 3CVNA 4NACA 5CCMA 5IY5E 3ZNGA 1Y6IA 4W9RA 3AJIA 3QARA 2WXKA 4HOTA 3OXGA 1H19A 3FULA 4N3CA 2WMOA 3RO3A 1OWMA 4XI9A 3KEAA 3L9TA 2GRLA 3PE4A 4TV3A 1N95A 4DX7D 2QFCA 3D9JA 3T9KA 3ABLE 1HF8A 4AOFA 3S7BA 3SFXA 3RU0A 3Q73A 2OV8A 3AG1E 4A3VA 1HG5A 2V4HC 3ISMC 3Q79A 3PNLB 3FTWA 4BSXA 3Q47B 3CQGB 5CECB 1PAQA 3TWWA 3UM0A 2KCLA 3FH5A 4NQ0A 2GGFA 2R05A 4B93B 1HO8A 3ASGA 2I9CA 4ACLA 1NA0A 3B13A 2VSXE 3NBNB 3LY9A 4OAVB 2IOLA 5CMWA 3Q9UC 4E85A 4WNDA 5G05J 3PZ2A 3EIQC 3ZEFA 2JEKA 4YVQC 3ASFA 5BT1A 5ENTD 4EPZA 2CG2A 2Y4TA 3AG3E 1D8DA 4Z68A 3BU8A 2IOSA 2XCBA 5EX0A 5FZSA 1NFIE 1N4RA 1G3NB 3UKUG 5CRUA 2I6HA 4APOA 2PQNA 4KMOA 2LXLA 4I6EA 3G2UA 2WQ6A 3CSTA 2XPZA 3EU9A 3L82A 1Z6TA 1UN8A 4K03A 3CHSA 2WXRA 2P9SG 3DPYA 3OXFA 3UXGA 3BQOA 2H6HA 1OWOA 1UG3A 4F1PA 2OCCE 1KPSB 5EIDA 1UW4B 3DSUA 2IF4A 2IFUA 4HRNA 1E96B 1E7VA 3ASOE 3E34A 2IO3C 3UT8A 4U04A 3UIOC 1JPLA 2J9QA 3QDNA 3RRMB 5CRVA 3N71A 2LUHA 2PL2A 5B1BE 5E75A 1N94A 3TXNA 2XS1A 3OAWA 1MHQA 3DSXA 5FZRA 3RAUA 5BXUA 2Y69E 2KC7A 3GYZA 5M72A 4LCTA 4L23A 3FU6A 4KBQA 1NI1A 4G24A 3VLFA 4IULA 3GZSA 5CEDB 2F0YA 3D9KA 1QZ2A 2A5UA 4O6FA 4L2LA 2OEVA 4AY6A 1OUVA 4YDYA 1HX8A 3HRAA 4OVVA 2VGYA 4L9PA 3CQCB 4OAUC 2DZOA 1E8XA 1E7UA 4UI9J 2X6JA 4IRUA 4L2YA 2CHZA 5A6CA 2F37A 3VTYA 2Y1LE 4HQDA 4B8CB 2VGEA 2BF0X 4J8FA 3FTVA 3ZIMA 3EHMA 3P2BA 2WPVA 4XIFA 4BETA 1D9SA 3FUDA 3FUIA 2IONA 5AQ7A 1L5JA 5CHEE 2NXPA 3UPVA 4GPKA 1EPUA 2WXNA 3B7RL 2YNQA 3Q75A 4G1TA 4HFGA 2EIJE 4A3TA 3Q78A 3VTXA 3J5PA 4FJYA 3UQ3A 4KZCA 3LJNA 3GW4A 4MS6A 3C3QA 1O5MA 2WXIA 1TN6A 3NQPA 5KBAA 3IV0A 4FP7A 4EZJA 5ARFA 2YHEA 3WXXA 3E37A 3MZLB 5CEAA 1U3CA 2DIWA 3CVXA 1HS6A 3TJPA 4GPMA 5AQBA 1XGWA 4BTBA 4LNGA 1UJJA 5G2NA 2OEWA 4O60A 3UT7A 3TWUA 3AS8A 1EYHA 5JMND 1TR4A 2LNIA 4WNEA 3I4RB 3DEOA 4AM9A 4UQZA 3NF1A 4RQIA 4J8EA 2P9PG 1O1RA 2BUGA 4HOSA 3V79K 5ANRA 1D8EA 3T5VA 3FU3A 5LFAA 4ME2A 2XRZA 4KVMA 2DVWA 4U0UA 5KJMA 3AS5A 2KXPC 2C2LA 4ILHB 3BEEA 1BI8B 2OVBA 3NZUA 4TUMA 2ZIRA 4AP2A 5EILA 2EIKE 2VGXA 4I2WA 4KVOA 5C2YA 4GAAA 2H6FA 4ILGA 4FU3A 4URKA 3CVWA 3IEGA 4GZ3A 1WY6A 4GZ5A 3AU4A 4HOQA 3C3OA 5JHAA 3TG4A 1ZBPA 3SFYA 2X6IA 4YDEA 3APDA 3RKVA 1TYQG 3B7BA 4LERA 3LKUA 1MX2A 2PM6A 2LXMA 2XGOA 2WXGA 2R17C 2AWIA 3DPDA 3TGOA 2UY1A 3DSWA 4LRZA 2CFZA 3MV3B 1FVHA 1Q2ZA 3AAAC 4GTSA 5CBOA 4A63B 3MEKA 3ZN3A 1QBQA 3PUKA 1DCQA 2BEDA 3EDTB 3T8KA 2ZISA 5H7PA 4JHRA 2ZGGA 2H6GA 3FTSA 2Q7FA 2XS8A 5FQ6A 1V54E 1MZCA 5KNHD 2L9BA 4U95D 4UI9C 2GRRB 5AENA 3ZW3A 3FWVA 3TWSA 4GU5A 4DPRA 2GRNB 4BESA 5FQ4A 2I1JA 4XKCA 4EQFA 3FTUA 3RSEG 3SY2A 1KT1A 1DNPA 4BX9A 4HBDA 4GTRA 3UI2A 2HO1A 2VJ8A 1V55E 2P9KG 3CEQA 3QOUA 3E33A 3B7UX 1FT1A 2VQ2A 3LY7A 4ZHBA 1QYMA 4PDXA 1BU9A 2AXVA 4ANVA 1TJFA 4A55A 2LAIA 4K0RA 2AXZA 4AVXA 3RJVA 4F3VA 1FCHA 4DX6D 4JHJA 4RLYA 4I43A 2ZXWE 3FEXA 5E76A 4G8KA 2QYUA 1S70B 3DRAA 3R7QA 4ABNA 4U07A 2CHXA 4CT4A 3ZU7B 3FUMA 5LCWJ 5AYWD 4J8DA 4FADA 4GB9A 4GMLA 5ENOD 2GRMA 5G04C 1ELRA 3FU0A 1TNUA 3BUAA 1SZ9A 2WXPA 3U3WA 4CRWA 2QC9A 5ENQD 3S7DA 3ZKJA 3QKYA 1JCRA 1ELKA 5BV1A 1O1SA 5EN5D 5FTPA 3T5XA 3PZ3A 4LNBA 4TUUA 1VDYA 3GZ2A 2OOEA 4AEZC 3IHYA 4F1SA 5BW8C 4NRHB 1OWPA 5CCLA 1IKND 3PUJA 2I2OA 4AJWA 4DX1A 1MQSA 4IYPA 3UM2A 3SFZA 2XEEA 3Q7AA 1AP7A 3ZHEB 2J08A 1Z3YA 4EBAG 3ABME 2DZNA 5D0OD 2WXMA 1NA3A 4G26A 1NP7A 4MKTA 3R9AB 3PZ1A 3L54A 1RZ4A 2KZTA 4GZDA 1H2VC 5AJLA 4CT0A 3CVVA 5D2MC 2ZGDA 1GW6A 4G25A 5BPPA 3MA5A 5B1AE 3FTZA 5AQ9A 1QNFA 3X2QE 4HOUA 3Q5MA 4UQYA 4FC8A 2B0OE 3ZHEA 2Y3AA 2PM7A 4OYSA 4HVBA 1FVFA 3CK7A 3FUKA 4AIFA 2EIME 2I1KA 4GA2A 5CMYA 4G2VA 4DLOA 3ASDA 4JB8P 1BLXB 5AAOA 4GZCA 4TXPA 5ARGA 2KZTB 1OCOE 1DVPA 1KZOA 3LJ3A 3LDZA 3CK8A 5HQ8A 2WVIA 3CGHA 4L7TA 2UY1B 4WAFA 3FU5A 3QWVA 3SZ7A 4I2ZA 3ZRHA 5HI7A 3RIBA 3EJNA 4K5BA 3EIJA 2WM9A 5AN8A 3JXIA 4JVSA 2J49A 2HM8A 4Y6CA 4XX5A 3HDXA 4G8LA 3HXEA 1H6PA 1JCQA 4UI9K 5JJ7A 4F53A 1X5BA 1TNYA 3SI5A 2FF4A 1Y8MA 4BT8A 3ABKE 3SF4A 3TWTA 4GZ6A 5T4YA 4Q94A 2XPIA 3JUIA 3FEYA 4I9CA 2J4DA 4M7CA 3HIZA 4H7YA 4RG9A 3TWRA 3G2VA 2Y4UA 1H6OA 1LD7A 3ASHA 4IN3B 4CGVA 1FT2A 4DRXE 3FUFA 5FWQA 2FI7A 2R59A 3MV2B 1KLXA 1DCEA 2JABA 3UUXA 4I6GA 4J6IA 4RVBA 3L16A 2XCCA 2R02A 3VLEA 4HI9A 4GCNA 2MRIA 3ENEA 3PH0C 3C5RA 2X6KA 3PZDA 4CZ2D 3KEZA 2AXUA 3BG1B 1N4SA 3DXKG 4BFRA 3E4BA 2B6CA 3JCKC 3LCAA 3ESLA 1H2UA 4EZKA 3MKQA 3G2TA 5EX3A 2L0IA 3PNTB 2L0TB 4LSZE 4HLEA 1WDYA 5BXOA 1RW2A 4CDRA 5LP0A 2LAHA 1TN8A 2M63A 5EIBE 3UINC 4O1PA 3HVEA 3QJZA 2ZU6B 3FTXA 2FO1E 3W9GA 3D9NA 2J07A 3ULEG 5ANLA 2LSVA 3MJWA 1SA4A 3U9WA 2C0MA 1QQEA 2DCPA 1K1AA 5CERB 3MGBA 2GW1A 2WQHA 1HH8A 2BKKB 2DWZA 2XRYA 4ACKA 1Z5SC 4GYOA 3ULYA 4KT6B 3UIPC 1NZNA 1EDUA 4K5AB 3RRNB 3C98A 3V30A 2XZDG 2IU1A 4GCOA 3SGHA 4E6HA 3DEPA 3CKCA 1SA5A 2IY0C 3L17A 2FBNA 3B7TA 1KZPA 4UQXA 2QZAA 4DJAA 3ZPJA 2WQ7A 3CR3A 4BERA 2GROB 2WMNA 1PC2A 2VGXB 1H6KA 2A5EA 5EDSA 1N11A 4U63A 2P9IG 1HU3A 2LO6A 2IEJA 4GTVA 1HXIA 4MBGA 5G05C 2BKGA 3F6QA 3KSQA 1MX6A 4TXQA 3LVRE 1OT8A 4C0MA 3PVLA 2AVPA 2EQXA 2VYIA 1N52A 3SNXA 2QY7A 2F8YA 4G11A 4HORA 3HHMA 3CHOA 1UOHA 4LG6A 2V8SE 3R9MA 4F7AA 3D9MA 4ANUA 4CYMD 1S0PA 5CBNA 3Q15A 4YNDA 1UJKA 3HXBA 1U2VG 4GTOA 2QYJA 3PEUB 4FULA 3LYAA 3VLDA 5D0QD 3EUVA 2XEHA 5AARA 3AG4E 1OCZE 2AJAA 3E32A 3FDHA 3PRZA 2VTBB 1MX4A 4FA6A 5AIJA 5T8IA 2DYSE 4B0ZA 3CIAA 2MYOA 3RRUA 4N39A 3ZVVA 2JLBA 3ONKA 3HXFA 4ZFHA 3APCA 3LS8A 3J5QB 5AJDA 3HXCA 3U64A 3CHPA 3JQ1A 4L1BA 1TNBA 3KAEA 4I1OB 3ZYLA 4GYWA 1LF8A 4GTTA 2FO7A 4EECA 3ZGQA 4RSYA 1IXVA 1JWFA 1OCCE 3HXDA 4Q96A 3I4GA 4MRUA 4U8HA 5FINA 4C9BB 2GRQB 4U8VD 3OTNA 4LEUA 4JD2G 3EU5A 3FUHA 4DUIA 1OWNA 1IQUA 4TXRA 3QC1A 3FH7A 3L6AA 2C0LA 3HYMB 3V2XA 1EF1C 4APFA 5JA4D 4JA9A 1JWGA 3IKOB 3IHVA 3UX4A 3LY8A 2VSOE 1N0QA 2XHEA 2WXFA 4UWFA 4FLBA 4FJZA 3W9FA 2Y0BG 4WWPA 3PREA 1MYOA 2XQ0A 2ETCA 2X3MA 4BWRA 4BSZB 4O1OA 3DBSA 3FHEA 1TEZA 2IO2C 2WXJA 1ZB1A 1N0RA 2P2CP 1XNFA 5FT9A 4I9EA 1A17A 3Q49B 3B7SA 4DI3A 3S7FA 1TNZA 2NC9A 5ENSD 2R03A 3DSVA 5HS0A 4FLHA 3NOGD 3Q4AB 5A7DB 4BTAA 5KWDA 3ML9A 2PQRA 2X6HA 2NYJA 1HFAA 3MYVA 4BY6A 5KJKA 3UMVA 3CV0A 3CVUA 2LSUA 3TWXA 2J8SD 3O48A 4CGWA 1U3DA 4Q69A 3E30A 3ZXPA 4N5CA 3Q9NC 1K8KG 4HRLA 2RG8A 1S64A 4UWGA 3ZFWA 3TWQA 4CDMA 4JL0A 4M3OA 1SZAA 3ZXSA 1UN9A 4HLLA 5HRYA 3S7JA 2J09A 3RK6A 3EHRA 3IBEA 1OXJA 3CLJA 1E8WA 3DXMG 3S2AA 1SW6A 3KSLA 3D9IA 2BTDA 1HG2A 4N5QA 3CVYA 4A1SA 2NSZA 3NB2A 3QWWA 1TN7A 4D10C 3C3RA 4JC8A 1BI7B 1IHBA 1TJCA 3AU5A 3D9OA 1E90A 4DK5A 4ANXA 4YDWA 3U66A 3SO8A 4PUCA 4GYYA 3LEWA 2X6FA 5J08A 3TL5A 4EBAA 2P9LG 3MKQB 5ITZF 1HE8A 2L6BA 4J7WA 4C48B 3QB2A 3L08A 3B95A 3AS4A 2J4BA 2EINE 4PS8A 2PZIA 3Q7FA 2HR2A 2ETAA 2OVFA 3PZ4A 4JZYA 4UWKA 3KD7A 3FUEA 3UT4A 4HNAD 4XEIG 4WWNA 2DYRE 1S63A 4WUYA 1IQRA 5DIZA 2WXHA 1YCSB 2V0PA 3SBTB 4XZ4A 5B3SE 3HVEB 5KJNA 3BG0B 3PE3A 2MOWA 3FTYA 2CFUA 1NL4A 1JCSA 4LNUD 4BX8A 1SQMA 3ULQA 2DBAA 4FHJA 2F8XK 3NZSA 2EILE 3SD5A 4HRMB 2YHCA 1H0AA 3CHQA 3ML8A 2ETBA 5FJYA 1ELWA 4R7LA 3QAQA 1BD8A 2WXLA 4KYOB 5BNWA 4GA1A 5KJLA 4GTPA 1LTXA 1LD8A 3K9IA 4ANWA 3DSSA 3LPZA 3NOCD 4I1MA 1TNOA 2X38A 3CHRA 2CG3A 5KCMA 3D9HA 5ENRD 4AY5A 1E8ZA 3V31A 3QK0A 5A23A 5EKQD 5EYLA 4U0SA 4CDNA 4GTMA 2P9NG 4C0EA 2XGMA 2KATA 4GMRA 4A1GA 1AWCB 4DLQA 3CSFA 3T8MA 1ZU2A 2AW6A 2KBXA 2YQ8A 3D9LA 1WAO1 3JYSA 4N3BA 4J0UA 2RKKA 5JHBA 3FUNA 3MX3A 1X81A 3CK9A 2KCKA 4MLPA 5JJ6A 3CVLA 3U4TA 4J8YA 1IYGA 2CHWA 4DI4A 3JXJA 2IJGX 3MCXA 3D9PA 4RG6A 3JQ0A 3I5PA 1WG0A 4KXKB 4KZ0A 3APFA 4ATGA 1W3BA 4N3AA 3ONLA 2R2LA 4I17A 4JW1A 2V5QC 3LXUX 1FPPA 4Y6WA 2H6IA 5LOZA 4J8SA 4V3IA 2RFAA 2RFMA 4AV7A 5AQAA 3P1UA 2HE0A 3QWPA 3FH8A 1JUQA 4DX5D 1MJ0A 2XGSA 1WM5A 5FQ8A 4PS3A
chains in the Genus database with same CATH topology
2PL2A 3CHPA 4AJWA 5E75A 3JQ1A 4L1BA 5JJTA 1N54A 3OXLA 1MQSA 4IYPA 3TXNA 3SFZA 3KAEA 3OAWA 1MHQA 4I1OB 5FZRA 3ZYLA 4GYWA 1LF8A 2KC7A 2P58C 3ZHEB 3GYZA 2FO7A 2J08A 4EECA 5M72A 3ZGQA 4RSYA 1Z3YA 4LCTA 4L23A 3ESKA 1JWFA 3FU6A 4EBAG 4KBQA 4UWLA 5BUZA 2ILRA 4Q96A 3I4GA 4MRUA 4U8HA 4AXHA 4XI0A 4G24A 5D0OD 3VLFA 4C9BB 3OTNA 4CEMA 2WXMA 4IULA 1NA3A 2IQCA 3GZSA 4G26A 1Z3XA 4H7XA 4LEUA 3D9KA 5T3RA 1NP7A 4MKTA 3R9AB 1QZ2A 3L54A 2A5UA 1HZ4A 4O6FA 2KZTA 2RD0A 4GZDA 4L2LA 3ZYQA 2FULA 3FUHA 1H2VC 4HS2A 1OWNA 5AJLA 4CT0A 3EHNA 1IQUA 5BV0A 3CVVA 4AY6A 3QC1A 1OUVA 3FH7A 1HX8A 3CVPA 3L6AA 4OVVA 2C0LA 1GW6A 4G25A 2VGYA 5BPPA 3HYMB 3CQCB 3MA5A 1EF1C 3FTZA 1E8XA 1QNFA 1E7UA 4UI9J 4APFA 2X6JA 4IRUA 4HOUA 3Q5MA 2A4ZA 4JA9A 4L2YA 1JWGA 4UQYA 2CHZA 3ZYMA 4FC8A 4G23A 5A6CA 3IKOB 3IHVA 3UX4A 3VTYA 3LY8A 2VSOE 3G2SA 3ZHEA 4JHKA 2Y3AA 2PM7A 4OYSA 4B8CB 1FVFA 1PY1A 3L22A 4GA0A 3CK7A 2BF0X 3FUKA 4HVBA 4AIFA 4J8FA 4XE0A 2I1KA 3FTVA 4GA2A 5CMYA 3O4ZA 3ZIMA 4PS7A 2XHEA 4G2VA 3EHMA 4DLOA 4B94A 4TRQA 4B89A 3P2BA 2WXFA 2WPVA 3ASDA 3PEVB 4XIFA 5FQ7A 2V4LA 4UWFA 3FUDA 3FUIA 2IONA 4FLBA 4FJZA 2V5FA 1L5JA 3R7RA 5G04J 4QFVA 5CHEE 3PS6A 2NXPA 4GZCA 3UPVA 4GPKA 4OVUA 4WWPA 5ARGA 2KZTB 3PREA 2XQ0A 5LX8A 4U0ZA 5LCWC 2VTBA 2X3MA 1DVPA 1B89A 1EPUA 3LJ3A 4BWRA 2WXNA 3DBSA 3FHEA 1TEZA 3B7RL 1OWLA 2WXJA 2YNQA 3LDZA 4ILIA 5ENNA 1P5QA 2XPYA 3CK8A 5HQ8A 2WVIA 3CGHA 4G1TA 4HFGA 1BPOA 4L7TA 1XNFA 2UY1B 4HXIA 4WAFA 3FU5A 4A3TA 3VTXA 5FT9A 3QWVA 4FJYA 4I9EA 3SZ7A 2FEZA 4I2ZA 2WB2A 3ZRHA 5DBKA 1A17A 5HI7A 3RIBA 3Q49B 3UQ3A 3B7SA 4KZCA 3EJNA 3EIJA 2WM9A 3GW4A 4DI3A 4MS6A 3S7FA 4WNFA 2WXIA 3SHFA 3I3NA 2NC9A 4JVSA 2J49A 3NQPA 2HM8A 4Y6CA 3RO2A 3IV0A 4FP7A 4FLHA 4EZJA 4XX5A 1KT0A 3HDXA 3Q4AB 5A7DB 4BTAA 5ARFA 2YINA 3ML9A 2PQRA 2YHEA 3CKBA 2X6HA 3WXXA 4NURA 3L13A 1HFAA 3MYVA 4UI9K 4BY6A 5JJ7A 5KJKA 4F53A 3UMVA 3MZLB 3CV0A 2MHKA 3CVUA 1X5BA 2LSUA 3CHMA 4JXTA 1U3CA 2DIWA 3CVXA 1HS6A 3TJPA 2UWJG 4I6JA 4N2QA 1XGWA 3SI5A 2FF4A 2WXQA 4BTBA 3O48A 5J90A 1Y8MA 4BT8A 4CGWA 4JEHA 3LVQE 1U3DA 1UJJA 4Q69A 5G2NA 5FQ8A 3UT7A 3SF4A 4PH4B 3MKRA 4GZ6A 3GZ1A 4N5CA 5T4YA 4Q94A 2E0IA 2XPIA 4N2SA 3AS8A 1EYHA 2HYZA 3SBSA 2LNIA 4WNEA 3KS2A 3I4RB 2RG8A 1E8YA 5G55A 3JUIA 4AM9A 4CCAA 3G2WA 4UQZA 4LUNU 3FEYA 3NF1A 2R5SA 4I9CA 4I1AA 2J4DA 4UWGA 3TG5A 3ZFWA 4P29A 3ZYKA 4J8EA 3HIZA 4H7YA 4CDMA 4JL0A 4M3OA 4FHKA 1SZAA 4RG9A 3ZXSA 2BUGA 1UN9A 4HOSA 3G2VA 2Y4UA 1IHGA 3S7JA 3TXMA 5ANRA 2J09A 3ASHA 4IN3B 3RK6A 4CGVA 3T5VA 3FU3A 3FY4A 5LFAA 3IBEA 3CLJA 3FUFA 1E8WA 5FWQA 2FI7A 2R59A 4ME2A 2XRZA 3TAXA 3FUJA 3S2AA 2WXOA 2VSYA 3MV2B 1KLXA 3D9IA 4I6GA 2BTDA 4J6IA 4RVBA 4XKBA 3L16A 2XCCA 4KVMA 1HG2A 4U0UA 3UUXA 5KJMA 3AS5A 3VLEA 2C2LA 4A1SA 2NSZA 4ILHB 3CVYA 3QWWA 4GCNA 2MRIA 3ENEA 4D10C 3BEEA 4JC8A 3FFLA 2VSNA 1TJCA 3AU5A 3D9OA 1E90A 2ONDA 3PH0C 2XEVA 2X6KA 2OVBA 3PZDA 4DK5A 3NZUA 4ANXA 3KEZA 2AXUA 3BG1B 4WWOA 3U66A 2E2EA 4AP2A 3FP3A 4PUCA 4BFRA 3E4BA 3JCKC 3LCAA 4GYYA 3ESLA 1H2UA 1INZA 4YVOA 4UWHA 3D3MA 3LEWA 4WNGA 2X6FA 4B8AA 4EZKA 2VGXA 4I2WA 3TL5A 5J08A 4KVOA 5C2YA 3MKQA 4GAAA 4EBAA 4ILGA 4FU3A 5FZQA 3G2TA 4JA7A 2L0IA 5EX3A 4URKA 3CVWA 3MKQB 3PNTB 2L0TB 4JEUA 4HLEA 1HE8A 3IEGA 4GZ3A 4GMJA 3QB2A 1WY6A 4GZ5A 3AU4A 3L08A 4CDRA 4HOQA 5LP0A 2LAHA 3AS4A 2KCVA 2L6JA 2J4BA 5JHAA 2M63A 4PS8A 3TG4A 1ZBPA 4JPSA 3PDNA 3HVEA 3QJZA 2PZIA 5C1DA 2ZU6B 2X6IA 3FTXA 3APDA 2KM4A 3RKVA 4LERA 3D9NA 3LKUA 2HR2A 2J07A 2OVFA 4JZYA 4UWKA 3QNKA 3KD7A 3FUEA 2PM6A 3UT4A 5ANLA 2LSVA 2XGOA 3URZA 3MJWA 4WWNA 3U9WA 4BT9A 2C0MA 1QQEA 2DCPA 2WXGA 4WUYA 1IQRA 5DIZA 4EZLA 2R17C 2WXHA 2V0PA 3SBTB 3CVQA 1H2TC 2AWIA 3DPDA 3TGOA 3MGBA 1YA0A 3CVNA 4NACA 5CCMA 2GW1A 2UY1A 2WQHA 4XZ4A 1HH8A 2XRYA 3HVEB 4LRZA 2CFZA 5KJNA 3MV3B 3BG0B 1FVHA 1Y6IA 4W9RA 3PE3A 4ACKA 2MOWA 3MEKA 3QARA 2WXKA 3ZN3A 3OXGA 4HOTA 4GYOA 4KT6B 3PUKA 1H19A 3FTYA 3FULA 1NZNA 4N3CA 3EDTB 2CFUA 1EDUA 2WMOA 3RO3A 1OWMA 3RRNB 4XI9A 3C98A 4JHRA 4BX8A 1SQMA 3ULQA 2DBAA 2IU1A 3FTSA 2GRLA 3PE4A 4GCOA 4TV3A 3SGHA 4FHJA 2QFCA 4E6HA 2Q7FA 3CKCA 3NZSA 3D9JA 3L17A 5FQ6A 3SD5A 2YHCA 1H0AA 1HF8A 4AOFA 2FBNA 3S7BA 3B7TA 2L9BA 3CHQA 3ML8A 3RU0A 4UQXA 4DJAA 3ZPJA 2WQ7A 2OV8A 3CR3A 5FJYA 4UI9C 1ELWA 4R7LA 4A3VA 5AENA 3ZW3A 1HG5A 3QAQA 3FWVA 2WMNA 1PC2A 2VGXB 3PNLB 4GU5A 3FTWA 4DPRA 4BSXA 1H6KA 2WXLA 3Q47B 4KYOB 5BNWA 3CQGB 5FQ4A 5EDSA 2I1JA 1PAQA 4XKCA 3FTUA 4EQFA 2KCLA 3FH5A 4NQ0A 2GGFA 1KT1A 4GA1A 4U63A 5KJLA 1DNPA 1HU3A 2LO6A 4BX9A 1HO8A 3ASGA 2HO1A 2I9CA 2VJ8A 4ACLA 3CEQA 3QOUA 3K9IA 3B7UX 1NA0A 4ANWA 3B13A 1HXIA 2VQ2A 2VSXE 3LY7A 3LPZA 4I1MA 2X38A 3CHRA 3LY9A 5G05C 2CG3A 5KCMA 4PDXA 2IOLA 5CMWA 4AY5A 1E8ZA 3LVRE 3QK0A 4E85A 5A23A 2AXVA 4WNDA 5EKQD 5G05J 4ANVA 4U0SA 4CDNA 4C0MA 1TJFA 3EIQC 4A55A 3PVLA 3ZEFA 2AVPA 2LAIA 4K0RA 4C0EA 2AXZA 2XGMA 2EQXA 2VYIA 2KATA 1N52A 4AVXA 2JEKA 2QY7A 3ASFA 4YVQC 3CSFA 3RJVA 3SNXA 4A1GA 4DLQA 1FCHA 3T8MA 4F3VA 5BT1A 4G11A 4HORA 4EPZA 4JHJA 1ZU2A 2AW6A 2YQ8A 3HHMA 3CHOA 3D9LA 1WAO1 2V8SE 3JYSA 4N3BA 4I43A 4F7AA 2CG2A 3FEXA 2Y4TA 4J0UA 5JHBA 3FUNA 3D9MA 4ANUA 5E76A 2IOSA 1S0PA 3MX3A 3CK9A 2KCKA 4MLPA 2XCBA 5EX0A 3CVLA 5JJ6A 3U4TA 3Q15A 4YNDA 5FZSA 1IYGA 1UJKA 3R7QA 4ABNA 4U07A 2CHXA 4CT4A 2CHWA 4DI4A 3PEUB 4FULA 3FUMA 5LCWJ 2IJGX 2I6HA 3MCXA 3LYAA 5AYWD 3VLDA 3D9PA 4APOA 2PQNA 3JQ0A 4J8DA 4RG6A 5D0QD 3I5PA 4KMOA 4GB9A 4I6EA 4GMLA 3G2UA 4FADA 4KXKB 2GRMA 4KZ0A 2WQ6A 5G04C 1ELRA 3CSTA 2XPZA 3FU0A 3APFA 4ATGA 1W3BA 3PUJA 1SZ9A 4N3AA 3FDHA 3PRZA 2VTBB 1Z6TA 2WXPA 3ONLA 1UN8A 4I17A 3U3WA 4K03A 3CHSA 4CRWA 2WXRA 4JW1A 3LXUX 4FA6A 3S7DA 5AIJA 3OXFA 5T8IA 4Y6WA 3QKYA 5LOZA 4J8SA 4V3IA 1ELKA 5BV1A 1OWOA 1UG3A 5FTPA 4B0ZA 3CIAA 3T5XA 1UW4B 4TUUA 3RRUA 2IF4A 4AV7A 2IFUA 1VDYA 3P1UA 4N39A 3ZVVA 1E96B 1E7VA 2JLBA 3GZ2A 2OOEA 3ONKA 3QWPA 4AEZC 3UT8A 3IHYA 3FH8A 1JUQA 4U04A 5BW8C 4F1SA 4NRHB 1OWPA 3APCA 3LS8A 1JPLA 2J9QA 2XGSA 3QDNA 5AJDA 1WM5A 3RRMB 5CCLA 3N71A 3U64A 2I2OA 4PS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRM B;  3PEU B;  3PEV B;  3RRN B; 
#chains in the Genus database with same CATH topology
 5JJT A;  4QQI A;  1N54 A;  3OXL A;  3UTM A;  3JUE A;  4NIK A;  2P58 C;  3WG7 E;  4X8Q A;  3ESK A;  4UWL A;  5BUZ A;  2ILR A;  4AXH A;  4XI0 A;  4U8Y D;  4CEM A;  2IQC A;  1N4Q A;  1Z3X A;  4H7X A;  1A5E A;  5T3R A;  1HZ4 A;  3NAW A;  4UUC A;  2RD0 A;  2P9U G;  3ZYQ A;  2FUL A;  4HS2 A;  5BV0 A;  3EHN A;  3HG0 D;  3CVP A;  3IXE A;  1YMP A;  4HB5 A;  4BEP A;  4K5C A;  2A4Z A;  3ZYM A;  5ENP D;  4G23 A;  4HI8 A;  2GRP B;  3G2S A;  4JHK A;  1PY1 A;  3L22 A;  4GA0 A;  3TWV A;  4XE0 A;  3O4Z A;  4PS7 A;  4B94 A;  4TRQ A;  4B89 A;  5KNG A;  5FQ7 A;  3PEV B;  2V4L A;  3SQV A;  3ZUV B;  1K1B A;  2V5F A;  3R7R A;  2XEN A;  5G04 J;  4QFV A;  3PS6 A;  4OVU A;  4EHM A;  5LX8 A;  4U0Z A;  5LCW C;  2VTB A;  1B89 A;  1OWL A;  4ILI A;  5ENN A;  1P5Q A;  2XPY A;  1BPO A;  4HXI A;  1YYH A;  2FEZ A;  2WB2 A;  5DBK A;  1O1T A;  4WNF A;  3AG2 E;  3SHF A;  3I3N A;  4F6R D;  3RO2 A;  1KT0 A;  2YIN A;  3CKB A;  4NUR A;  3L13 A;  4GTQ A;  1N9A A;  3C72 A;  2MHK A;  3CHM A;  4JXT A;  2UWJ G;  4I6J A;  4N2Q A;  3DST A;  2WXQ A;  5J90 A;  3DWL G;  4JEH A;  3LVQ E;  4PH4 B;  3ASN E;  3MKR A;  3GZ1 A;  4N2S A;  2E0I A;  3SBS A;  2HYZ A;  3KS2 A;  5G55 A;  1E8Y A;  1OCR E;  4CCA A;  3G2W A;  4LUN U;  2R5S A;  4I1A A;  3TG5 A;  4P29 A;  3ZYK A;  3UM3 A;  5FIO A;  4FHK A;  3EHQ A;  5HKP A;  2XZT G;  1IHG A;  3TXM A;  3FY4 A;  3TAX A;  3FUJ A;  2WXO A;  2VSY A;  4XKB A;  1DC2 A;  5D66 A;  3FFL A;  4YDO A;  2VSN A;  3UKR G;  2OND A;  1OY3 D;  2XEV A;  4WWO A;  4DX2 A;  2E2E A;  3FP3 A;  3V2O A;  1INZ A;  4YVO A;  4UWH A;  3D3M A;  4WNG A;  4B8A A;  4ATZ D;  1N4P A;  5FZQ A;  4JA7 A;  4JEU A;  4GMJ A;  3UM1 A;  2KCV A;  2L6J A;  4U7E B;  2PNN A;  4JPS A;  5EYP F;  3PDN A;  5C1D A;  2KM4 A;  1K3Z D;  3QNK A;  3URZ A;  1SVX A;  4BT9 A;  4U96 D;  4EZL A;  3CVQ A;  1H2T C;  1YA0 A;  3CVN A;  4NAC A;  5CCM A;  5IY5 E;  3ZNG A;  1Y6I A;  4W9R A;  3AJI A;  3QAR A;  2WXK A;  4HOT A;  3OXG A;  1H19 A;  3FUL A;  4N3C A;  2WMO A;  3RO3 A;  1OWM A;  4XI9 A;  3KEA A;  3L9T A;  2GRL A;  3PE4 A;  4TV3 A;  1N95 A;  4DX7 D;  2QFC A;  3D9J A;  3T9K A;  3ABL E;  1HF8 A;  4AOF A;  3S7B A;  3SFX A;  3RU0 A;  3Q73 A;  2OV8 A;  3AG1 E;  4A3V A;  1HG5 A;  2V4H C;  3ISM C;  3Q79 A;  3PNL B;  3FTW A;  4BSX A;  3Q47 B;  3CQG B;  5CEC B;  1PAQ A;  3TWW A;  3UM0 A;  2KCL A;  3FH5 A;  4NQ0 A;  2GGF A;  2R05 A;  4B93 B;  1HO8 A;  3ASG A;  2I9C A;  4ACL A;  1NA0 A;  3B13 A;  2VSX E;  3NBN B;  3LY9 A;  4OAV B;  2IOL A;  5CMW A;  3Q9U C;  4E85 A;  4WND A;  5G05 J;  3PZ2 A;  3EIQ C;  3ZEF A;  2JEK A;  4YVQ C;  3ASF A;  5BT1 A;  5ENT D;  4EPZ A;  2CG2 A;  2Y4T A;  3AG3 E;  1D8D A;  4Z68 A;  3BU8 A;  2IOS A;  2XCB A;  5EX0 A;  5FZS A;  1NFI E;  1N4R A;  1G3N B;  3UKU G;  5CRU A;  2I6H A;  4APO A;  2PQN A;  4KMO A;  2LXL A;  4I6E A;  3G2U A;  2WQ6 A;  3CST A;  2XPZ A;  3EU9 A;  3L82 A;  1Z6T A;  1UN8 A;  4K03 A;  3CHS A;  2WXR A;  2P9S G;  3DPY A;  3OXF A;  3UXG A;  3BQO A;  2H6H A;  1OWO A;  1UG3 A;  4F1P A;  2OCC E;  1KPS B;  5EID A;  1UW4 B;  3DSU A;  2IF4 A;  2IFU A;  4HRN A;  1E96 B;  1E7V A;  3ASO E;  3E34 A;  2IO3 C;  3UT8 A;  4U04 A;  3UIO C;  1JPL A;  2J9Q A;  3QDN A;  3RRM B;  5CRV A;  3N71 A;  2LUH A;  2PL2 A;  5B1B E;  5E75 A;  1N94 A;  3TXN A;  2XS1 A;  3OAW A;  1MHQ A;  3DSX A;  5FZR A;  3RAU A;  5BXU A;  2Y69 E;  2KC7 A;  3GYZ A;  5M72 A;  4LCT A;  4L23 A;  3FU6 A;  4KBQ A;  1NI1 A;  4G24 A;  3VLF A;  4IUL A;  3GZS A;  5CED B;  2F0Y A;  3D9K A;  1QZ2 A;  2A5U A;  4O6F A;  4L2L A;  2OEV A;  4AY6 A;  1OUV A;  4YDY A;  1HX8 A;  3HRA A;  4OVV A;  2VGY A;  4L9P A;  3CQC B;  4OAU C;  2DZO A;  1E8X A;  1E7U A;  4UI9 J;  2X6J A;  4IRU A;  4L2Y A;  2CHZ A;  5A6C A;  2F37 A;  3VTY A;  2Y1L E;  4HQD A;  4B8C B;  2VGE A;  2BF0 X;  4J8F A;  3FTV A;  3ZIM A;  3EHM A;  3P2B A;  2WPV A;  4XIF A;  4BET A;  1D9S A;  3FUD A;  3FUI A;  2ION A;  5AQ7 A;  1L5J A;  5CHE E;  2NXP A;  3UPV A;  4GPK A;  1EPU A;  2WXN A;  3B7R L;  2YNQ A;  3Q75 A;  4G1T A;  4HFG A;  2EIJ E;  4A3T A;  3Q78 A;  3VTX A;  3J5P A;  4FJY A;  3UQ3 A;  4KZC A;  3LJN A;  3GW4 A;  4MS6 A;  3C3Q A;  1O5M A;  2WXI A;  1TN6 A;  3NQP A;  5KBA A;  3IV0 A;  4FP7 A;  4EZJ A;  5ARF A;  2YHE A;  3WXX A;  3E37 A;  3MZL B;  5CEA A;  1U3C A;  2DIW A;  3CVX A;  1HS6 A;  3TJP A;  4GPM A;  5AQB A;  1XGW A;  4BTB A;  4LNG A;  1UJJ A;  5G2N A;  2OEW A;  4O60 A;  3UT7 A;  3TWU A;  3AS8 A;  1EYH A;  5JMN D;  1TR4 A;  2LNI A;  4WNE A;  3I4R B;  3DEO A;  4AM9 A;  4UQZ A;  3NF1 A;  4RQI A;  4J8E A;  2P9P G;  1O1R A;  2BUG A;  4HOS A;  3V79 K;  5ANR A;  1D8E A;  3T5V A;  3FU3 A;  5LFA A;  4ME2 A;  2XRZ A;  4KVM A;  2DVW A;  4U0U A;  5KJM A;  3AS5 A;  2KXP C;  2C2L A;  4ILH B;  3BEE A;  1BI8 B;  2OVB A;  3NZU A;  4TUM A;  2ZIR A;  4AP2 A;  5EIL A;  2EIK E;  2VGX A;  4I2W A;  4KVO A;  5C2Y A;  4GAA A;  2H6F A;  4ILG A;  4FU3 A;  4URK A;  3CVW A;  3IEG A;  4GZ3 A;  1WY6 A;  4GZ5 A;  3AU4 A;  4HOQ A;  3C3O A;  5JHA A;  3TG4 A;  1ZBP A;  3SFY A;  2X6I A;  4YDE A;  3APD A;  3RKV A;  1TYQ G;  3B7B A;  4LER A;  3LKU A;  1MX2 A;  2PM6 A;  2LXM A;  2XGO A;  2WXG A;  2R17 C;  2AWI A;  3DPD A;  3TGO A;  2UY1 A;  3DSW A;  4LRZ A;  2CFZ A;  3MV3 B;  1FVH A;  1Q2Z A;  3AAA C;  4GTS A;  5CBO A;  4A63 B;  3MEK A;  3ZN3 A;  1QBQ A;  3PUK A;  1DCQ A;  2BED A;  3EDT B;  3T8K A;  2ZIS A;  5H7P A;  4JHR A;  2ZGG A;  2H6G A;  3FTS A;  2Q7F A;  2XS8 A;  5FQ6 A;  1V54 E;  1MZC A;  5KNH D;  2L9B A;  4U95 D;  4UI9 C;  2GRR B;  5AEN A;  3ZW3 A;  3FWV A;  3TWS A;  4GU5 A;  4DPR A;  2GRN B;  4BES A;  5FQ4 A;  2I1J A;  4XKC A;  4EQF A;  3FTU A;  3RSE G;  3SY2 A;  1KT1 A;  1DNP A;  4BX9 A;  4HBD A;  4GTR A;  3UI2 A;  2HO1 A;  2VJ8 A;  1V55 E;  2P9K G;  3CEQ A;  3QOU A;  3E33 A;  3B7U X;  1FT1 A;  2VQ2 A;  3LY7 A;  4ZHB A;  1QYM A;  4PDX A;  1BU9 A;  2AXV A;  4ANV A;  1TJF A;  4A55 A;  2LAI A;  4K0R A;  2AXZ A;  4AVX A;  3RJV A;  4F3V A;  1FCH A;  4DX6 D;  4JHJ A;  4RLY A;  4I43 A;  2ZXW E;  3FEX A;  5E76 A;  4G8K A;  2QYU A;  1S70 B;  3DRA A;  3R7Q A;  4ABN A;  4U07 A;  2CHX A;  4CT4 A;  3ZU7 B;  3FUM A;  5LCW J;  5AYW D;  4J8D A;  4FAD A;  4GB9 A;  4GML A;  5ENO D;  2GRM A;  5G04 C;  1ELR A;  3FU0 A;  1TNU A;  3BUA A;  1SZ9 A;  2WXP A;  3U3W A;  4CRW A;  2QC9 A;  5ENQ D;  3S7D A;  3ZKJ A;  3QKY A;  1JCR A;  1ELK A;  5BV1 A;  1O1S A;  5EN5 D;  5FTP A;  3T5X A;  3PZ3 A;  4LNB A;  4TUU A;  1VDY A;  3GZ2 A;  2OOE A;  4AEZ C;  3IHY A;  4F1S A;  5BW8 C;  4NRH B;  1OWP A;  5CCL A;  1IKN D;  3PUJ A;  2I2O A;  4AJW A;  4DX1 A;  1MQS A;  4IYP A;  3UM2 A;  3SFZ A;  2XEE A;  3Q7A A;  1AP7 A;  3ZHE B;  2J08 A;  1Z3Y A;  4EBA G;  3ABM E;  2DZN A;  5D0O D;  2WXM A;  1NA3 A;  4G26 A;  1NP7 A;  4MKT A;  3R9A B;  3PZ1 A;  3L54 A;  1RZ4 A;  2KZT A;  4GZD A;  1H2V C;  5AJL A;  4CT0 A;  3CVV A;  5D2M C;  2ZGD A;  1GW6 A;  4G25 A;  5BPP A;  3MA5 A;  5B1A E;  3FTZ A;  5AQ9 A;  1QNF A;  3X2Q E;  4HOU A;  3Q5M A;  4UQY A;  4FC8 A;  2B0O E;  3ZHE A;  2Y3A A;  2PM7 A;  4OYS A;  4HVB A;  1FVF A;  3CK7 A;  3FUK A;  4AIF A;  2EIM E;  2I1K A;  4GA2 A;  5CMY A;  4G2V A;  4DLO A;  3ASD A;  4JB8 P;  1BLX B;  5AAO A;  4GZC A;  4TXP A;  5ARG A;  2KZT B;  1OCO E;  1DVP A;  1KZO A;  3LJ3 A;  3LDZ A;  3CK8 A;  5HQ8 A;  2WVI A;  3CGH A;  4L7T A;  2UY1 B;  4WAF A;  3FU5 A;  3QWV A;  3SZ7 A;  4I2Z A;  3ZRH A;  5HI7 A;  3RIB A;  3EJN A;  4K5B A;  3EIJ A;  2WM9 A;  5AN8 A;  3JXI A;  4JVS A;  2J49 A;  2HM8 A;  4Y6C A;  4XX5 A;  3HDX A;  4G8L A;  3HXE A;  1H6P A;  1JCQ A;  4UI9 K;  5JJ7 A;  4F53 A;  1X5B A;  1TNY A;  3SI5 A;  2FF4 A;  1Y8M A;  4BT8 A;  3ABK E;  3SF4 A;  3TWT A;  4GZ6 A;  5T4Y A;  4Q94 A;  2XPI A;  3JUI A;  3FEY A;  4I9C A;  2J4D A;  4M7C A;  3HIZ A;  4H7Y A;  4RG9 A;  3TWR A;  3G2V A;  2Y4U A;  1H6O A;  1LD7 A;  3ASH A;  4IN3 B;  4CGV A;  1FT2 A;  4DRX E;  3FUF A;  5FWQ A;  2FI7 A;  2R59 A;  3MV2 B;  1KLX A;  1DCE A;  2JAB A;  3UUX A;  4I6G A;  4J6I A;  4RVB A;  3L16 A;  2XCC A;  2R02 A;  3VLE A;  4HI9 A;  4GCN A;  2MRI A;  3ENE A;  3PH0 C;  3C5R A;  2X6K A;  3PZD A;  4CZ2 D;  3KEZ A;  2AXU A;  3BG1 B;  1N4S A;  3DXK G;  4BFR A;  3E4B A;  2B6C A;  3JCK C;  3LCA A;  3ESL A;  1H2U A;  4EZK A;  3MKQ A;  3G2T A;  5EX3 A;  2L0I A;  3PNT B;  2L0T B;  4LSZ E;  4HLE A;  1WDY A;  5BXO A;  1RW2 A;  4CDR A;  5LP0 A;  2LAH A;  1TN8 A;  2M63 A;  5EIB E;  3UIN C;  4O1P A;  3HVE A;  3QJZ A;  2ZU6 B;  3FTX A;  2FO1 E;  3W9G A;  3D9N A;  2J07 A;  3ULE G;  5ANL A;  2LSV A;  3MJW A;  1SA4 A;  3U9W A;  2C0M A;  1QQE A;  2DCP A;  1K1A A;  5CER B;  3MGB A;  2GW1 A;  2WQH A;  1HH8 A;  2BKK B;  2DWZ A;  2XRY A;  4ACK A;  1Z5S C;  4GYO A;  3ULY A;  4KT6 B;  3UIP C;  1NZN A;  1EDU A;  4K5A B;  3RRN B;  3C98 A;  3V30 A;  2XZD G;  2IU1 A;  4GCO A;  3SGH A;  4E6H A;  3DEP A;  3CKC A;  1SA5 A;  2IY0 C;  3L17 A;  2FBN A;  3B7T A;  1KZP A;  4UQX A;  2QZA A;  4DJA A;  3ZPJ A;  2WQ7 A;  3CR3 A;  4BER A;  2GRO B;  2WMN A;  1PC2 A;  2VGX B;  1H6K A;  2A5E A;  5EDS A;  1N11 A;  4U63 A;  2P9I G;  1HU3 A;  2LO6 A;  2IEJ A;  4GTV A;  1HXI A;  4MBG A;  5G05 C;  2BKG A;  3F6Q A;  3KSQ A;  1MX6 A;  4TXQ A;  3LVR E;  1OT8 A;  4C0M A;  3PVL A;  2AVP A;  2EQX A;  2VYI A;  1N52 A;  3SNX A;  2QY7 A;  2F8Y A;  4G11 A;  4HOR A;  3HHM A;  3CHO A;  1UOH A;  4LG6 A;  2V8S E;  3R9M A;  4F7A A;  3D9M A;  4ANU A;  4CYM D;  1S0P A;  5CBN A;  3Q15 A;  4YND A;  1UJK A;  3HXB A;  1U2V G;  4GTO A;  2QYJ A;  3PEU B;  4FUL A;  3LYA A;  3VLD A;  5D0Q D;  3EUV A;  2XEH A;  5AAR A;  3AG4 E;  1OCZ E;  2AJA A;  3E32 A;  3FDH A;  3PRZ A;  2VTB B;  1MX4 A;  4FA6 A;  5AIJ A;  5T8I A;  2DYS E;  4B0Z A;  3CIA A;  2MYO A;  3RRU A;  4N39 A;  3ZVV A;  2JLB A;  3ONK A;  3HXF A;  4ZFH A;  3APC A;  3LS8 A;  3J5Q B;  5AJD A;  3HXC A;  3U64 A;  3CHP A;  3JQ1 A;  4L1B A;  1TNB A;  3KAE A;  4I1O B;  3ZYL A;  4GYW A;  1LF8 A;  4GTT A;  2FO7 A;  4EEC A;  3ZGQ A;  4RSY A;  1IXV A;  1JWF A;  1OCC E;  3HXD A;  4Q96 A;  3I4G A;  4MRU A;  4U8H A;  5FIN A;  4C9B B;  2GRQ B;  4U8V D;  3OTN A;  4LEU A;  4JD2 G;  3EU5 A;  3FUH A;  4DUI A;  1OWN A;  1IQU A;  4TXR A;  3QC1 A;  3FH7 A;  3L6A A;  2C0L A;  3HYM B;  3V2X A;  1EF1 C;  4APF A;  5JA4 D;  4JA9 A;  1JWG A;  3IKO B;  3IHV A;  3UX4 A;  3LY8 A;  2VSO E;  1N0Q A;  2XHE A;  2WXF A;  4UWF A;  4FLB A;  4FJZ A;  3W9F A;  2Y0B G;  4WWP A;  3PRE A;  1MYO A;  2XQ0 A;  2ETC A;  2X3M A;  4BWR A;  4BSZ B;  4O1O A;  3DBS A;  3FHE A;  1TEZ A;  2IO2 C;  2WXJ A;  1ZB1 A;  1N0R A;  2P2C P;  1XNF A;  5FT9 A;  4I9E A;  1A17 A;  3Q49 B;  3B7S A;  4DI3 A;  3S7F A;  1TNZ A;  2NC9 A;  5ENS D;  2R03 A;  3DSV A;  5HS0 A;  4FLH A;  3NOG D;  3Q4A B;  5A7D B;  4BTA A;  5KWD A;  3ML9 A;  2PQR A;  2X6H A;  2NYJ A;  1HFA A;  3MYV A;  4BY6 A;  5KJK A;  3UMV A;  3CV0 A;  3CVU A;  2LSU A;  3TWX A;  2J8S D;  3O48 A;  4CGW A;  1U3D A;  4Q69 A;  3E30 A;  3ZXP A;  4N5C A;  3Q9N C;  1K8K G;  4HRL A;  2RG8 A;  1S64 A;  4UWG A;  3ZFW A;  3TWQ A;  4CDM A;  4JL0 A;  4M3O A;  1SZA A;  3ZXS A;  1UN9 A;  4HLL A;  5HRY A;  3S7J A;  2J09 A;  3RK6 A;  3EHR A;  3IBE A;  1OXJ A;  3CLJ A;  1E8W A;  3DXM G;  3S2A A;  1SW6 A;  3KSL A;  3D9I A;  2BTD A;  1HG2 A;  4N5Q A;  3CVY A;  4A1S A;  2NSZ A;  3NB2 A;  3QWW A;  1TN7 A;  4D10 C;  3C3R A;  4JC8 A;  1BI7 B;  1IHB A;  1TJC A;  3AU5 A;  3D9O A;  1E90 A;  4DK5 A;  4ANX A;  4YDW A;  3U66 A;  3SO8 A;  4PUC A;  4GYY A;  3LEW A;  2X6F A;  5J08 A;  3TL5 A;  4EBA A;  2P9L G;  3MKQ B;  5ITZ F;  1HE8 A;  2L6B A;  4J7W A;  4C48 B;  3QB2 A;  3L08 A;  3B95 A;  3AS4 A;  2J4B A;  2EIN E;  4PS8 A;  2PZI A;  3Q7F A;  2HR2 A;  2ETA A;  2OVF A;  3PZ4 A;  4JZY A;  4UWK A;  3KD7 A;  3FUE A;  3UT4 A;  4HNA D;  4XEI G;  4WWN A;  2DYR E;  1S63 A;  4WUY A;  1IQR A;  5DIZ A;  2WXH A;  1YCS B;  2V0P A;  3SBT B;  4XZ4 A;  5B3S E;  3HVE B;  5KJN A;  3BG0 B;  3PE3 A;  2MOW A;  3FTY A;  2CFU A;  1NL4 A;  1JCS A;  4LNU D;  4BX8 A;  1SQM A;  3ULQ A;  2DBA A;  4FHJ A;  2F8X K;  3NZS A;  2EIL E;  3SD5 A;  4HRM B;  2YHC A;  1H0A A;  3CHQ A;  3ML8 A;  2ETB A;  5FJY A;  1ELW A;  4R7L A;  3QAQ A;  1BD8 A;  2WXL A;  4KYO B;  5BNW A;  4GA1 A;  5KJL A;  4GTP A;  1LTX A;  1LD8 A;  3K9I A;  4ANW A;  3DSS A;  3LPZ A;  3NOC D;  4I1M A;  1TNO A;  2X38 A;  3CHR A;  2CG3 A;  5KCM A;  3D9H A;  5ENR D;  4AY5 A;  1E8Z A;  3V31 A;  3QK0 A;  5A23 A;  5EKQ D;  5EYL A;  4U0S A;  4CDN A;  4GTM A;  2P9N G;  4C0E A;  2XGM A;  2KAT A;  4GMR A;  4A1G A;  1AWC B;  4DLQ A;  3CSF A;  3T8M A;  1ZU2 A;  2AW6 A;  2KBX A;  2YQ8 A;  3D9L A;  1WAO 1;  3JYS A;  4N3B A;  4J0U A;  2RKK A;  5JHB A;  3FUN A;  3MX3 A;  1X81 A;  3CK9 A;  2KCK A;  4MLP A;  5JJ6 A;  3CVL A;  3U4T A;  4J8Y A;  1IYG A;  2CHW A;  4DI4 A;  3JXJ A;  2IJG X;  3MCX A;  3D9P A;  4RG6 A;  3JQ0 A;  3I5P A;  1WG0 A;  4KXK B;  4KZ0 A;  3APF A;  4ATG A;  1W3B A;  4N3A A;  3ONL A;  2R2L A;  4I17 A;  4JW1 A;  2V5Q C;  3LXU X;  1FPP A;  4Y6W A;  2H6I A;  5LOZ A;  4J8S A;  4V3I A;  2RFA A;  2RFM A;  4AV7 A;  5AQA A;  3P1U A;  2HE0 A;  3QWP A;  3FH8 A;  1JUQ A;  4DX5 D;  1MJ0 A;  2XGS A;  1WM5 A;  5FQ8 A;  4PS3 A; 
#chains in the Genus database with same CATH homology
 2PL2 A;  3CHP A;  4AJW A;  5E75 A;  3JQ1 A;  4L1B A;  5JJT A;  1N54 A;  3OXL A;  1MQS A;  4IYP A;  3TXN A;  3SFZ A;  3KAE A;  3OAW A;  1MHQ A;  4I1O B;  5FZR A;  3ZYL A;  4GYW A;  1LF8 A;  2KC7 A;  2P58 C;  3ZHE B;  3GYZ A;  2FO7 A;  2J08 A;  4EEC A;  5M72 A;  3ZGQ A;  4RSY A;  1Z3Y A;  4LCT A;  4L23 A;  3ESK A;  1JWF A;  3FU6 A;  4EBA G;  4KBQ A;  4UWL A;  5BUZ A;  2ILR A;  4Q96 A;  3I4G A;  4MRU A;  4U8H A;  4AXH A;  4XI0 A;  4G24 A;  5D0O D;  3VLF A;  4C9B B;  3OTN A;  4CEM A;  2WXM A;  4IUL A;  1NA3 A;  2IQC A;  3GZS A;  4G26 A;  1Z3X A;  4H7X A;  4LEU A;  3D9K A;  5T3R A;  1NP7 A;  4MKT A;  3R9A B;  1QZ2 A;  3L54 A;  2A5U A;  1HZ4 A;  4O6F A;  2KZT A;  2RD0 A;  4GZD A;  4L2L A;  3ZYQ A;  2FUL A;  3FUH A;  1H2V C;  4HS2 A;  1OWN A;  5AJL A;  4CT0 A;  3EHN A;  1IQU A;  5BV0 A;  3CVV A;  4AY6 A;  3QC1 A;  1OUV A;  3FH7 A;  1HX8 A;  3CVP A;  3L6A A;  4OVV A;  2C0L A;  1GW6 A;  4G25 A;  2VGY A;  5BPP A;  3HYM B;  3CQC B;  3MA5 A;  1EF1 C;  3FTZ A;  1E8X A;  1QNF A;  1E7U A;  4UI9 J;  4APF A;  2X6J A;  4IRU A;  4HOU A;  3Q5M A;  2A4Z A;  4JA9 A;  4L2Y A;  1JWG A;  4UQY A;  2CHZ A;  3ZYM A;  4FC8 A;  4G23 A;  5A6C A;  3IKO B;  3IHV A;  3UX4 A;  3VTY A;  3LY8 A;  2VSO E;  3G2S A;  3ZHE A;  4JHK A;  2Y3A A;  2PM7 A;  4OYS A;  4B8C B;  1FVF A;  1PY1 A;  3L22 A;  4GA0 A;  3CK7 A;  2BF0 X;  3FUK A;  4HVB A;  4AIF A;  4J8F A;  4XE0 A;  2I1K A;  3FTV A;  4GA2 A;  5CMY A;  3O4Z A;  3ZIM A;  4PS7 A;  2XHE A;  4G2V A;  3EHM A;  4DLO A;  4B94 A;  4TRQ A;  4B89 A;  3P2B A;  2WXF A;  2WPV A;  3ASD A;  3PEV B;  4XIF A;  5FQ7 A;  2V4L A;  4UWF A;  3FUD A;  3FUI A;  2ION A;  4FLB A;  4FJZ A;  2V5F A;  1L5J A;  3R7R A;  5G04 J;  4QFV A;  5CHE E;  3PS6 A;  2NXP A;  4GZC A;  3UPV A;  4GPK A;  4OVU A;  4WWP A;  5ARG A;  2KZT B;  3PRE A;  2XQ0 A;  5LX8 A;  4U0Z A;  5LCW C;  2VTB A;  2X3M A;  1DVP A;  1B89 A;  1EPU A;  3LJ3 A;  4BWR A;  2WXN A;  3DBS A;  3FHE A;  1TEZ A;  3B7R L;  1OWL A;  2WXJ A;  2YNQ A;  3LDZ A;  4ILI A;  5ENN A;  1P5Q A;  2XPY A;  3CK8 A;  5HQ8 A;  2WVI A;  3CGH A;  4G1T A;  4HFG A;  1BPO A;  4L7T A;  1XNF A;  2UY1 B;  4HXI A;  4WAF A;  3FU5 A;  4A3T A;  3VTX A;  5FT9 A;  3QWV A;  4FJY A;  4I9E A;  3SZ7 A;  2FEZ A;  4I2Z A;  2WB2 A;  3ZRH A;  5DBK A;  1A17 A;  5HI7 A;  3RIB A;  3Q49 B;  3UQ3 A;  3B7S A;  4KZC A;  3EJN A;  3EIJ A;  2WM9 A;  3GW4 A;  4DI3 A;  4MS6 A;  3S7F A;  4WNF A;  2WXI A;  3SHF A;  3I3N A;  2NC9 A;  4JVS A;  2J49 A;  3NQP A;  2HM8 A;  4Y6C A;  3RO2 A;  3IV0 A;  4FP7 A;  4FLH A;  4EZJ A;  4XX5 A;  1KT0 A;  3HDX A;  3Q4A B;  5A7D B;  4BTA A;  5ARF A;  2YIN A;  3ML9 A;  2PQR A;  2YHE A;  3CKB A;  2X6H A;  3WXX A;  4NUR A;  3L13 A;  1HFA A;  3MYV A;  4UI9 K;  4BY6 A;  5JJ7 A;  5KJK A;  4F53 A;  3UMV A;  3MZL B;  3CV0 A;  2MHK A;  3CVU A;  1X5B A;  2LSU A;  3CHM A;  4JXT A;  1U3C A;  2DIW A;  3CVX A;  1HS6 A;  3TJP A;  2UWJ G;  4I6J A;  4N2Q A;  1XGW A;  3SI5 A;  2FF4 A;  2WXQ A;  4BTB A;  3O48 A;  5J90 A;  1Y8M A;  4BT8 A;  4CGW A;  4JEH A;  3LVQ E;  1U3D A;  1UJJ A;  4Q69 A;  5G2N A;  5FQ8 A;  3UT7 A;  3SF4 A;  4PH4 B;  3MKR A;  4GZ6 A;  3GZ1 A;  4N5C A;  5T4Y A;  4Q94 A;  2E0I A;  2XPI A;  4N2S A;  3AS8 A;  1EYH A;  2HYZ A;  3SBS A;  2LNI A;  4WNE A;  3KS2 A;  3I4R B;  2RG8 A;  1E8Y A;  5G55 A;  3JUI A;  4AM9 A;  4CCA A;  3G2W A;  4UQZ A;  4LUN U;  3FEY A;  3NF1 A;  2R5S A;  4I9C A;  4I1A A;  2J4D A;  4UWG A;  3TG5 A;  3ZFW A;  4P29 A;  3ZYK A;  4J8E A;  3HIZ A;  4H7Y A;  4CDM A;  4JL0 A;  4M3O A;  4FHK A;  1SZA A;  4RG9 A;  3ZXS A;  2BUG A;  1UN9 A;  4HOS A;  3G2V A;  2Y4U A;  1IHG A;  3S7J A;  3TXM A;  5ANR A;  2J09 A;  3ASH A;  4IN3 B;  3RK6 A;  4CGV A;  3T5V A;  3FU3 A;  3FY4 A;  5LFA A;  3IBE A;  3CLJ A;  3FUF A;  1E8W A;  5FWQ A;  2FI7 A;  2R59 A;  4ME2 A;  2XRZ A;  3TAX A;  3FUJ A;  3S2A A;  2WXO A;  2VSY A;  3MV2 B;  1KLX A;  3D9I A;  4I6G A;  2BTD A;  4J6I A;  4RVB A;  4XKB A;  3L16 A;  2XCC A;  4KVM A;  1HG2 A;  4U0U A;  3UUX A;  5KJM A;  3AS5 A;  3VLE A;  2C2L A;  4A1S A;  2NSZ A;  4ILH B;  3CVY A;  3QWW A;  4GCN A;  2MRI A;  3ENE A;  4D10 C;  3BEE A;  4JC8 A;  3FFL A;  2VSN A;  1TJC A;  3AU5 A;  3D9O A;  1E90 A;  2OND A;  3PH0 C;  2XEV A;  2X6K A;  2OVB A;  3PZD A;  4DK5 A;  3NZU A;  4ANX A;  3KEZ A;  2AXU A;  3BG1 B;  4WWO A;  3U66 A;  2E2E A;  4AP2 A;  3FP3 A;  4PUC A;  4BFR A;  3E4B A;  3JCK C;  3LCA A;  4GYY A;  3ESL A;  1H2U A;  1INZ A;  4YVO A;  4UWH A;  3D3M A;  3LEW A;  4WNG A;  2X6F A;  4B8A A;  4EZK A;  2VGX A;  4I2W A;  3TL5 A;  5J08 A;  4KVO A;  5C2Y A;  3MKQ A;  4GAA A;  4EBA A;  4ILG A;  4FU3 A;  5FZQ A;  3G2T A;  4JA7 A;  2L0I A;  5EX3 A;  4URK A;  3CVW A;  3MKQ B;  3PNT B;  2L0T B;  4JEU A;  4HLE A;  1HE8 A;  3IEG A;  4GZ3 A;  4GMJ A;  3QB2 A;  1WY6 A;  4GZ5 A;  3AU4 A;  3L08 A;  4CDR A;  4HOQ A;  5LP0 A;  2LAH A;  3AS4 A;  2KCV A;  2L6J A;  2J4B A;  5JHA A;  2M63 A;  4PS8 A;  3TG4 A;  1ZBP A;  4JPS A;  3PDN A;  3HVE A;  3QJZ A;  2PZI A;  5C1D A;  2ZU6 B;  2X6I A;  3FTX A;  3APD A;  2KM4 A;  3RKV A;  4LER A;  3D9N A;  3LKU A;  2HR2 A;  2J07 A;  2OVF A;  4JZY A;  4UWK A;  3QNK A;  3KD7 A;  3FUE A;  2PM6 A;  3UT4 A;  5ANL A;  2LSV A;  2XGO A;  3URZ A;  3MJW A;  4WWN A;  3U9W A;  4BT9 A;  2C0M A;  1QQE A;  2DCP A;  2WXG A;  4WUY A;  1IQR A;  5DIZ A;  4EZL A;  2R17 C;  2WXH A;  2V0P A;  3SBT B;  3CVQ A;  1H2T C;  2AWI A;  3DPD A;  3TGO A;  3MGB A;  1YA0 A;  3CVN A;  4NAC A;  5CCM A;  2GW1 A;  2UY1 A;  2WQH A;  4XZ4 A;  1HH8 A;  2XRY A;  3HVE B;  4LRZ A;  2CFZ A;  5KJN A;  3MV3 B;  3BG0 B;  1FVH A;  1Y6I A;  4W9R A;  3PE3 A;  4ACK A;  2MOW A;  3MEK A;  3QAR A;  2WXK A;  3ZN3 A;  3OXG A;  4HOT A;  4GYO A;  4KT6 B;  3PUK A;  1H19 A;  3FTY A;  3FUL A;  1NZN A;  4N3C A;  3EDT B;  2CFU A;  1EDU A;  2WMO A;  3RO3 A;  1OWM A;  3RRN B;  4XI9 A;  3C98 A;  4JHR A;  4BX8 A;  1SQM A;  3ULQ A;  2DBA A;  2IU1 A;  3FTS A;  2GRL A;  3PE4 A;  4GCO A;  4TV3 A;  3SGH A;  4FHJ A;  2QFC A;  4E6H A;  2Q7F A;  3CKC A;  3NZS A;  3D9J A;  3L17 A;  5FQ6 A;  3SD5 A;  2YHC A;  1H0A A;  1HF8 A;  4AOF A;  2FBN A;  3S7B A;  3B7T A;  2L9B A;  3CHQ A;  3ML8 A;  3RU0 A;  4UQX A;  4DJA A;  3ZPJ A;  2WQ7 A;  2OV8 A;  3CR3 A;  5FJY A;  4UI9 C;  1ELW A;  4R7L A;  4A3V A;  5AEN A;  3ZW3 A;  1HG5 A;  3QAQ A;  3FWV A;  2WMN A;  1PC2 A;  2VGX B;  3PNL B;  4GU5 A;  3FTW A;  4DPR A;  4BSX A;  1H6K A;  2WXL A;  3Q47 B;  4KYO B;  5BNW A;  3CQG B;  5FQ4 A;  5EDS A;  2I1J A;  1PAQ A;  4XKC A;  3FTU A;  4EQF A;  2KCL A;  3FH5 A;  4NQ0 A;  2GGF A;  1KT1 A;  4GA1 A;  4U63 A;  5KJL A;  1DNP A;  1HU3 A;  2LO6 A;  4BX9 A;  1HO8 A;  3ASG A;  2HO1 A;  2I9C A;  2VJ8 A;  4ACL A;  3CEQ A;  3QOU A;  3K9I A;  3B7U X;  1NA0 A;  4ANW A;  3B13 A;  1HXI A;  2VQ2 A;  2VSX E;  3LY7 A;  3LPZ A;  4I1M A;  2X38 A;  3CHR A;  3LY9 A;  5G05 C;  2CG3 A;  5KCM A;  4PDX A;  2IOL A;  5CMW A;  4AY5 A;  1E8Z A;  3LVR E;  3QK0 A;  4E85 A;  5A23 A;  2AXV A;  4WND A;  5EKQ D;  5G05 J;  4ANV A;  4U0S A;  4CDN A;  4C0M A;  1TJF A;  3EIQ C;  4A55 A;  3PVL A;  3ZEF A;  2AVP A;  2LAI A;  4K0R A;  4C0E A;  2AXZ A;  2XGM A;  2EQX A;  2VYI A;  2KAT A;  1N52 A;  4AVX A;  2JEK A;  2QY7 A;  3ASF A;  4YVQ C;  3CSF A;  3RJV A;  3SNX A;  4A1G A;  4DLQ A;  1FCH A;  3T8M A;  4F3V A;  5BT1 A;  4G11 A;  4HOR A;  4EPZ A;  4JHJ A;  1ZU2 A;  2AW6 A;  2YQ8 A;  3HHM A;  3CHO A;  3D9L A;  1WAO 1;  2V8S E;  3JYS A;  4N3B A;  4I43 A;  4F7A A;  2CG2 A;  3FEX A;  2Y4T A;  4J0U A;  5JHB A;  3FUN A;  3D9M A;  4ANU A;  5E76 A;  2IOS A;  1S0P A;  3MX3 A;  3CK9 A;  2KCK A;  4MLP A;  2XCB A;  5EX0 A;  3CVL A;  5JJ6 A;  3U4T A;  3Q15 A;  4YND A;  5FZS A;  1IYG A;  1UJK A;  3R7Q A;  4ABN A;  4U07 A;  2CHX A;  4CT4 A;  2CHW A;  4DI4 A;  3PEU B;  4FUL A;  3FUM A;  5LCW J;  2IJG X;  2I6H A;  3MCX A;  3LYA A;  5AYW D;  3VLD A;  3D9P A;  4APO A;  2PQN A;  3JQ0 A;  4J8D A;  4RG6 A;  5D0Q D;  3I5P A;  4KMO A;  4GB9 A;  4I6E A;  4GML A;  3G2U A;  4FAD A;  4KXK B;  2GRM A;  4KZ0 A;  2WQ6 A;  5G04 C;  1ELR A;  3CST A;  2XPZ A;  3FU0 A;  3APF A;  4ATG A;  1W3B A;  3PUJ A;  1SZ9 A;  4N3A A;  3FDH A;  3PRZ A;  2VTB B;  1Z6T A;  2WXP A;  3ONL A;  1UN8 A;  4I17 A;  3U3W A;  4K03 A;  3CHS A;  4CRW A;  2WXR A;  4JW1 A;  3LXU X;  4FA6 A;  3S7D A;  5AIJ A;  3OXF A;  5T8I A;  4Y6W A;  3QKY A;  5LOZ A;  4J8S A;  4V3I A;  1ELK A;  5BV1 A;  1OWO A;  1UG3 A;  5FTP A;  4B0Z A;  3CIA A;  3T5X A;  1UW4 B;  4TUU A;  3RRU A;  2IF4 A;  4AV7 A;  2IFU A;  1VDY A;  3P1U A;  4N39 A;  3ZVV A;  1E96 B;  1E7V A;  2JLB A;  3GZ2 A;  2OOE A;  3ONK A;  3QWP A;  4AEZ C;  3UT8 A;  3IHY A;  3FH8 A;  1JUQ A;  4U04 A;  5BW8 C;  4F1S A;  4NRH B;  1OWP A;  3APC A;  3LS8 A;  1JPL A;  2J9Q A;  2XGS A;  3QDN A;  5AJD A;  1WM5 A;  3RRM B;  5CCL A;  3N71 A;  3U64 A;  2I2O A;  4PS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...