3PEVA

S. cerevisiae dbp5 l327v c-terminal domain bound to gle1 and ip6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
178
Chain Sequence
b'AIKQLYMDCKNEADKFDVLTELYGVMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase DBP5
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
total genus 60
structure length 178
sequence length 180
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pevA00
1GNRA 1GNPA 1AKYA 1TF7A 2HUPA 2N1BA 4BFSA 1IN6A 2HT1A 5EP3A 4M9QA 4FCTA 3I72A 3LNCA 2ZAOA 4DDWA 4B48A 1J70A 4O3MA 1B23P 2AWNA 2QQ0A 1DAGA 2QSYA 4TSFA 4MA4A 5AWFC 3OFNA 4A2PA 1OHHA 2IYXA 4OK6A 3VR2A 2Q3FA 1E3MA 1W49A 3ZIAD 2WJVA 1H65A 3VR5A 2WOJA 1CJKC 4JLPA 3K70C 1JXOA 1N6KA 1IXRC 4GOJA 2QY9A 3AKCA 3BGWA 2HLDD 2IBMA 3AQ4A 3RWOA 4B3XA 3DMNA 4UXJA 1IAQA 5IK2D 2OHFA 1W0JA 3IO3A 4C0HA 1W36B 4MYTA 3QF4B 3DPUA 1KIMA 3GEHA 1QHYA 1TF2A 3W5JA 1E9FA 2ZRFA 4A6PA 1ZCAA 4C3ZA 2HDNB 4GL2A 1GKYA 1ZIOA 4MUBA 1XD2B 3X1XA 1NLFA 3EZ6A 5AK0A 3DZ8A 1T9HA 4LI0A 4X8OA 4Q03A 1DAHA 2ANCA 5HKKA 3O8DA 4F4CA 3ZVNA 1RE0A 2QRNA 4NH0A 4ZCIA 1M7GA 3QY0A 1ZUHA 3KFVA 1DO0A 3H4MA 3W3AA 4P4SB 1D6JA 5L3QB 4NL4H 2XTNA 1T0JB 2ANBA 1G3UA 4TQ9A 4A2WA 2ZRGA 1BH2A 2X77A 3T1TA 4E22A 4UNNA 2C9YA 2ZJZA 3AKYA 4BASA 4R98A 1SKQA 1SVOA 1W5TA 4TQAA 2ZS8A 3KKOA 2G9NA 2JLXA 3B1WA 5FPYA 4R71A 1S8FA 4PC7A 2WWXA 2CLSA 3N5CA 2PL3A 3B82A 1FX0B 1COWD 3NBXX 1W36D 3P4YA 4YMSA 5HCNA 3QUSA 3A4NA 2PLRA 1HY3A 2QROA 4PR0A 5HTKA 4Q9LA 3M0EA 3WY9A 1KI7A 1G5TA 2CHVA 2WWHA 2ZE8A 4ZDIA 4GDFA 3NC1C 3TW4A 1E2LA 4NYMR 1JAIA 4Q1AA 1EWRA 2ZI3A 3LX5A 1KO8A 3AP1A 2GXQA 3DM9B 1S1MA 3S1AA 3TK1A 2HCJB 3ZVLA 2PMDA 1NN3A 4DJTA 3GJ3A 3OIUA 4LBVA 4DBLC 3GLIA 3KQLA 1Z83A 1IY2A 4C7OB 2RB4A 1N6LA 4M21A 4H1VA 2DBYA 4V02A 4QGFA 2OSBA 2QPOA 4ZIRB 2J9RA 1NF3A 3V00A 3L0PA 1BO6A 1UF9A 2ORIA 3NBFA 3NEJA 3K70D 1QVAA 2GXSA 4PXAA 3ECCA 3GLFB 4NONA 4LZZA 2RGDA 1R4AA 2KE5A 4WVFA 1HQYE 5JHGB 3ZVMA 1MRSA 3CKLA 3BRWD 4M1TA 1FL9A 4DLVA 2WWGA 2QU8A 4GOXA 4XWAA 3U44A 4P0TA 3F3YA 2O0KA 3L0OA 4ZI2A 4XWOA 1YZNA 3ADKA 5FPTA 4DLYA 1FFHA 2Z6VA 4JYBA 3MWKA 1GKIA 2CL7X 1YU9A 2W58A 3I4LA 3WRYC 2MMCA 3ZZ0A 4BFUA 3QXCA 3QXJA 4Z8YA 1SXJA 5AJYA 1MOZA 3VR1A 3VHXA 2X8AA 2CDNA 3U3OA 1TEVA 3UXMA 2J0SA 4LCBA 4MITA 2O8FA 1KJZA 4X8LA 4DIEA 4KVAA 3LV8A 1GDDA 4PQRA 1CXZA 4HZIA 4G5QA 2PJZA 1NP6A 4NCNA 2HYIC 3RWMB 1N6HA 3TH5A 4B6FA 4TL6A 1XMSA 2RCNA 4JT2A 4NYJQ 4HI0E 3GLFE 1NBME 4BLOA 2VTKA 3PUWA 4ARZA 4HAUA 4LJAA 2ZR0A 1KKLA 1D2NA 1ZNXA 4P4UA 1I4LD 1E6CA 2IF2A 3TW8B 1XNJA 1TEXA 4G01B 4OI4A 3GJ0A 2JJ2A 1U90A 1E96A 1GRNA 3CBQA 2FSGA 2I4IA 4IHQA 2K5UA 4IOJA 2ZRPA 2CHGA 1A2KC 1IOZA 2V54A 4JLAA 1Z29A 3AF0A 4RJLA 1W0KD 3T1QA 2IYYA 2CCGA 4DC9A 2AK2A 1TU3A 3ZS8A 3DEFA 3DHWC 4LYFA 2HXSA 4O25A 1A7JA 1X1SA 3Q7PA 2GJAA 4AYTA 4HLUA 4LJ8A 3L82B 1X8JA 1G4UR 4I4LA 4B75A 3CZQA 1AJEA 3KTAB 2JLZA 1NKSA 821PA 2ZM5A 2P6RA 1CRPA 2ZE6A 4BFVA 4E03A 1TAGA 3AVOA 1N6OA 3PR1A 2O8BB 2J0QA 4MRPA 2ZJ2A 2F7SA 1KNQA 3WBKA 1KAGA 2NZJA 1QHGA 3R20A 1NLZA 4MRVA 1W46A 4LRWA 5FL7A 4C0QC 1KSGA 4CEIA 3GEIA 3RAPR 3AM1A 1Q3HA 5FPKA 3UMSA 2OE2A 4RZ2A 5BN5A 1V43A 4TYNA 2F9LA 5FOVA 1KSFX 4QBFA 4IFEA 5FTLA 1DG3A 1N0UA 4JLOA 5DHFA 4KYIB 3T12A 2FFAA 2R65A 3KJEA 4JLMA 2WV9A 4M53A 3EZ2A 4OK3A 4JBXA 2BEKA 2VHUA 4B71A 621PA 2C8VA 2QZ4A 2QORA 2F1HA 3R7WB 2RMKA 3U5ZB 4GSYA 1PUIA 5DIFA 5FR2A 2ZU6A 2WJJA 4JLKA 4P3YA 3W6OA 4UNRA 1KHTA 1VPLA 4TYYA 2ONJA 1YR7A 5DNYB 3EA0A 4QBIA 1BOFA 5BWMA 3EIEA 1CJUC 1R0XA 1NY6A 5JRJA 1U8YA 3M4YA 1H8ED 2BBTA 2A5DA 1N6IA 4C30A 4HUQA 4MDFA 4ZDWA 5K8LA 4BQSA 4F92B 4MUAA 3A6PC 4N1AA 1BMFA 1DAFA 3BB1A 1VMAA 2PMKA 3ZLJA 3QXXA 1F6BA 2FJUA 2VSFA 3TNFA 4M1MA 3CUEF 3U2QA 1OFIA 2RAPA 4IDNA 2BC9A 3RABA 2QMHA 3PENA 2G3YA 4JLNA 4WZBE 5LB2A 3SI7A 3K0SA 1E2JA 1DVRA 1IJEA 3GFOA 5DYIA 3TR0A 1HT2E 1P72A 1GKUB 1XEFA 3NVAA 5DYGA 2OXCA 3FPAA 2IS6A 3SEAA 4DZZA 1FZQA 4EFNA 1M7HA 1YE8A 4UJ3A 1TQDA 3GQBA 2GILA 3SU8A 2YZ2A 2ZYTX 2FFHA 4XTRA 4A0HA 3W34A 1ETUA 2AFIE 1OXSC 1D5CA 1BKDR 1Q21A 2G0NA 2ERXA 2GXUA 1J90A 4E5UA 3WHKA 1S4QA 2BM0A 1CBUA 4PAQA 4DLSA 5IRCD 1YR9A 1N0WA 3C41J 4KLZA 3F8TA 3BH0A 3KKQA 1GVNB 1KI8A 3WMEA 3O8CA 5BQ5A 1XEWX 3IO5A 3THWA 5H8WA 2A7QA 4QFMA 1RKBA 1UM8A 1P9WA 1T8TA 3T35A 2IF0A 1YRAA 5HZHA 1K5GA 1XU4A 3EZFA 4LWZA 1E69A 2GRJA 2BM1A 3QE0A 4CW7A 2A30A 4X8HA 2IYLD 5CM8B 3P20A 1OKKD 3PUZA 5AJXA 2BV3A 1I4DD 3KB1A 1WF3A 3VKGA 2R6GA 2D7CA 8OHMA 3I5XA 3WBJA 1R8SA 2ORVA 4I1VA 3CH4B 2V8OA 3AVXA 5EE1A 3QNUA 2FEMA 3UMFA 5EXPA 1T3HA 1SVIA 1GIAA 2JDID 5LPNA 4YXWA 3BB4A 3OIWA 1Z63A 2CEAA 4JS0A 3VHLB 3MCAA 2J7PA 2FF7A 2XEXA 4HAXA 2ZJBA 3C4JA 4PC3A 1E9AA 2VP2A 3QKSA 4Q4LA 1KMHA 4MGZR 2WBLC 3LBNA 3PUYA 3TIFA 4MGKR 1M74A 3DKVA 5CDFA 5C46F 4UXHA 2RGNA 3I1FA 3W3ZB 1ZM9A 3B1YA 1G3RA 2B92A 1TF5A 4QM7A 1P2VA 1E1RA 5JRZA 3TUZC 5GJWC 3GJ4A 4OJQA 4O2LA 1WQ1R 3FMIA 1XMIA 2UZIR 2GVZC 4C0BA 4Q00A 521PA 1PJRA 4A0GA 1OHHD 3OZXA 1KI6B 4LV8B 4XD7D 3ZS9A 4HZUB 1UPTA 4ZO4A 2ZAMA 1RYHA 1G18A 1QG4A 3PV0A 5FTKA 1HE1C 4EKDA 1JQLB 1CIPA 3T5GA 1Q3TA 4AWXA 4IXMA 3BWDD 3UG7A 1OXTA 4Z8XA 2ZXUA 3TAHA 4BLTA 5CDFE 1G8GA 4PO9A 4A6XA 1XTKA 4Q66C 3KQNA 4CRWB 1Z8FA 5IHPA 1OH6A 3NDBB 1WCV1 3D31A 2BIFA 4RZ3A 1D8TA 4GP6A 2Q3HA 4KAXA 1DELA 3VU9B 4B73A 4DSUA 3U3KA 1L4YA 5JSZB 4OJKA 1Z06A 3FE2A 1YR6A 3SFVA 3U7FB 1ESNA 3OAAA 1UKYA 2QBYA 4DUGD 4WOPA 1GUAA 2CJWB 4Q7JB 2ZR7A 4BLRA 1NN1A 4US1R 5A5GA 2IX3A 4F38A 4D6PA 1VYUA 3ZIAA 2IEYA 5SZKB 3SYNA 4URXR 1UKVY 1MO6A 3LVRE 1SHKA 1CJMA 4WAUA 1YZQA 4N0EA 3VKHA 4M22A 3WXMA 5JS7A 4OI1A 1QBKC 2DY1A 4DCTA 2O5VA 3TUIC 3UG6A 4W9MC 4GFDA 2O8CB 5EXSA 2Y8EA 4P32A 5TARA 3CO5A 2VA8A 4IDPA 3DOEA 1ZW6A 1EFHA 4RCZA 5GVRA 3U4QA 3ZQ6A 1Y3AA 3ZJYA 3F5FA 4HATA 2XB2A 4TL8A 4E09A 1U2RA 3CF0A 1JEDA 2O0JA 2V7QA 3C5HA 5FUVA 2VIIA 4UNQA 2GCOB 4MRRA 1AS0A 3MGCA 2WKRA 2IYVA 4KSCA 2GTPA 1H8HA 3TSWA 2IUSA 1MH1A 2P65A 1N3BA 3U60B 1D2EA 3TAUA 2DFTA 1QF9A 1G6OA 4M1OA 4TMZA 3HR8A 4B43A 2DR3A 5L3SB 1AN0A 2QPAA 1PUJA 2WSSD 3W90A 1R10A 2XNSA 4OQLA 2I1VB 3R8CA 4NPHA 5CYOA 3THXB 4JVNA 3C8UA 5DN6A 1NJGA 3FVQA 5LDDC 1DTSA 1G17A 1JEEA 5JI3E 2GNOA 2QN6A 2YINC 1E1RD 5C2JB 1XZPA 1X86B 1M34E 2V6IA 1Z0IA 4K46A 4AURA 5JFGA 3IEUA 5LBIA 2IS2A 2ZVQX 1G8HA 3ZGXA 2Q6TA 2ZJ8A 2A2ZA 3UMRA 4LYAA 4JSYA 2GZAA 1S3SA 4S2EA 4Q21A 3LLUA 4RKEA 3NHBA 1SHZA 5KSOA 1A82A 1XCGB 2J0UA 5F9HA 4JL6A 1JXMA 4Q4AB 3CPHA 2QUZA 3B9QA 3K0FA 4NP6A 3KB2A 2HT6A 1XCPA 3SYLA 4PSKA 4QJ4A 421PA 3EX7C 4X8MA 2VO1A 2FFBA 4XOIA 3SJBA 2P67A 4W5HA 3K8YA 2PCLA 4JL8A 2A5GA 4MGIR 1UADA 1P75A 2JLRA 2IUTA 4YMWA 1LFDB 4TLAA 1G8PA 3Q8XB 1K8RA 2OXRA 4LC1A 3CIOA 2RGGA 2DB3A 1U9IC 1KJWA 4URYR 3SN6A 4O2RA 4IKEA 2DFNA 4Q1CA 2QEQA 2GETA 1W7AA 2SHKA 4B35A 2IT1A 5EE9A 2WVJA 4KXFB 4PZYA 3SYKA 1J8YF 3OHMA 4NU0A 4IJMA 2OM2A 2W0MA 4Q4JA 4ABYA 4ESHA 1EX6A 1HV8A 3K0CA 3KXLA 1FQJA 1NMXA 1US8B 4OHXA 4DT1A 2W2XA 4AKHA 3AF3A 4XWKA 2Q9BA 5J47A 1TTTA 2QMOA 4TLCA 3BERA 4WXPA 1G1MA 4GBMA 3ZVRA 1SVWA 4OHWA 1O3YA 3P26A 1ZU5A 3K0CC 1UKEA 4MYCA 2O8EA 4YDSA 4Q19A 3RC3A 5BYKA 4KU4A 3OIVA 4FMBB 2YHSA 4OHZA 2FMXA 1Z0FA 3PQCA 3GJ7A 4A0RA 3R8FA 4BEJA 3NTUA 2AXNA 4HEJA 2GEUA 1G7CA 4Q9JA 3VKWA 3ETLA 4Q7LA 2ZSAA 4NCJA 5HCIA 2PX3A 2ZR9A 4TL9A 2JJ2D 1MR3F 1KNXA 2V6JA 1OH5A 2ZIAA 2QQEA 4NYMQ 5FL7D 4JJKA 1U98A 1E2GA 1ZVQA 4MGYR 4B3CA 2QAGA 3FWYA 4BFZA 1JNYA 1OYYA 2GAAA 3KKNA 2GK7A 1ODFA 1L4UA 2JASA 4I1OA 2ZYVX 1Q1EA 4ZCLA 4F4JA 3KKPA 1KI9A 1OV4A 1UKZA 2GK6A 4AY2A 2ZANA 1HA3A 2BBOA 4II7A 5BN3A 3QENA 1Q44A 3TJZA 1ZM2A 4H1UA 5F9FA 3GLHB 2GDJA 5E95A 3W5IA 1XPRA 1BS1A 2VBCA 1T3LA 4BLPA 3CRQA 3LA6A 2ZU0C 2V1XA 1E4YA 2CNWA 1OIXA 4JYCA 3UATA 2YWEA 1SXJD 2W2TA 3QF4A 5AJZA 121PA 2QTFA 4CZ2A 1W0KA 2R6AA 3MSXA 1AM4D 1XD2A 3ND9A 1SVMA 3P1JA 3U7GA 1P2UA 1M2OB 3A4MA 3TKLA 2KBFA 4A8JA 3A1UA 1GL9B 4KSBA 1Z6XA 3KJGA 3B78A 4D2IA 3LAWA 1GAJA 3N70A 4C0LA 4DEXA 1OPXA 3TVTA 5C4MA 5F98A 4M4SA 1CR4A 4V0LA 4KV9A 5BYJA 5L3QA 4TSFD 2FPMA 3HU3A 1ANKA 4DCNA 3QPVA 4Z1MD 3FMPB 2CL6X 1KY2A 1XZQA 2YNMA 1DEKA 3EWAA 1FNMA 2ATVA 4QRHA 2Q0HA 4DVGA 1KZ7B 1VCNA 2W2VA 2RKOA 2XITA 4F91B 1QRAA 2OAQ1 3QEOA 1JAHA 2JAQA 1U0JA 1KDRA 4IDOA 3LWNA 1FX0A 1XRJA 1W0JD 2W6JD 1LF5A 1VG8A 2FNAA 1AA9A 4LPSA 3Q3JB 1ZUNB 4LDJA 1ZIPA 4WXRA 1YR8A 1SGWA 2ORWA 1MRNA 2ZSDA 3K9LA 5FUYA 3IEVA 3FHTA 3ZZTA 4HB4A 4Q1BA 3SDZA 5AUPB 4C0AC 1NMZA 1Q12A 2WJIA 4ZPXA 3K09A 4R2IA 3WNDA 1FMLA 1VDZA 1E4VA 4UQOA 5DN6D 3TVDA 1FUUA 1T4GA 4ZI3A 3TRFA 2GAOA 2IYRA 4TTRA 4B33A 2ZI6A 1Z0AA 5JCZA 4DDVA 3S1AB 2ZSBA 4HB3A 1HYQA 2QT1A 5G3ZA 1NVXQ 1E2QA 2GEDA 5E7IA 4QOSA 2D2EA 3GLIB 1ZM7A 1OT3A 1NSTA 1Q57A 2RHDA 3LQQA 5KDDA 4C7OA 1XWIA 2QM7A 4FCWA 1CKEA 3TMKA 2R8RA 3PEWA 1E2IA 3X1WA 4ZIRA 3I5YA 1VCOA 5HPYB 2CBZA 1KKMA 5FBWB 1LY1A 3T5DA 1WP9A 4BZQA 2IS1A 4WBSA 2ZREA 4TN1A 5CM9C 4RD3A 2H17A 2XXAB 1HE8B 3ZQJA 3IDQA 2EVWX 3PUXA 3NHAA 3LLMA 4LOAA 3CPEA 2IL1A 5KU1A 4EFLA 4LV5B 1TUIA 2F43B 5JJIA 1P61B 3PCRB 4UNSA 4XVQA 3DO6A 3QKTA 1F2UB 3KUDA 1SVSA 1XEWY 2QGNA 1XXHE 2XB4A 4NDZA 1V5WA 1DPFA 1E0JA 2OFXA 2QSZA 4TQUS 3T1OA 3U6BA 4QBGB 4TLDA 1KY3A 3U6KA 4D0GA 2ZROA 4BUJA 4AC9A 3IQXA 4MRNA 1E79D 1ZU4A 1W47A 1S9DA 5B64A 4AD8A 3RS3A 2BVNA 1CP2A 3NC0C 4QGHA 1UFQA 2I1QA 1NNEA 2VHJA 2ZRCA 2AHOA 3CWQA 2AL7A 3GLHE 5FI0B 2XAUA 4M2LA 4EIWA 2V9PA 3NKVA 2KI5A 3I32A 4Q47A 3BORA 4XSHA 1KSJA 3SHFA 2FZ4A 3ICEA 1N5KA 2IYZA 2KBEA 5J4HA 1NIPA 2RHMA 1KK2A 2QG6A 5AUOB 2JCSA 1MKYA 2OAP1 1W2GA 4GZMA 2VP4A 4B3FX 2WWYA 2PH1A 4ARZB 4IOLA 4PC6A 3SC3A 1XBTA 1HQCA 2YJTD 4N0DA 4Q7KA 4TLBA 1TPZA 1IY1A 1DOAA 1GP2A 1IN5A 5DO9A 5JBQA 2ZTSA 4KHZA 4PANA 4DB4A 2WPDA 4DXAA 3U7HB 3KQKA 2X2FA 1TMKA 2H7VA 4MRSA 5FBLB 2C04A 1XDBA 2HJGA 2VYFA 1AGRA 4PPGA 4Q7MB 2XOKA 1IN8A 4URZR 2ZI4A 4LHZA 4OBEA 4RVCA 1X8KA 2OV2A 3UK6A 1RPZA 1N2CE 3I92A 4ON9A 2WMNB 4RCYA 3WNBA 4DDTA 3ICQB 2XX3A 1OYWA 2C96A 1PLJA 5FPHA 1ZJ6A 3CX8A 4C4PA 1ZRHA 2H57A 1II0A 4TYQA 3KTAA 1OFTA 3SOPA 4LHXA 2CCJA 5AJVB 2Z0MA 5FTMA 2H16A 2Q3MA 3QKUA 1E2FA 3WYAA 2AK3A 3ASYA 4QL3A 5JWOA 4BRUA 2NO7A 4RD0A 5FOWA 1SVLA 5L8VA 2W0SA 2ZJOA 4LJ7A 1AIPA 5LB4A 2JLUA 2YWGA 5TDHA 1ZC3A 3KQUA 1WBBA 2A5FA 3GPLA 3WHLA 3KZ1E 1W4CA 3GEEA 2ZRLA 4DLUA 3NBYC 3QVVA 1CJTC 3G82C 5JS8A 1KI2A 5KHOC 1LTQA 3AGQA 3LD9A 1P2TA 4RFSA 3BFKA 2OCYC 2OLJA 3CR8A 3SBEA 1P9NA 5GVSA 4A36A 2RGNC 2IYUA 2EYUA 2ZS9A 4GPTA 2QP4A 2FFQA 3AVPA 1DS6A 3MFYA 5CK5A 3RS5A 2OZEA 2J87A 4AYXA 1OJLA 4BLQA 5CIWA 1E0KA 4HUTA 4Q1DA 1G5RA 3CZPA 4AKIA 2QNRA 2WWWA 2XZPA 2B7CA 1YHNA 4LJ6A 3QKRB 4GI7A 4GT1A 4QNRA 1XPUA 2GWHA 4CEJB 2X19A 4LJ4A 2IS4A 2BJWA 4C2UA 1KK3A 1SVKA 4OQXA 3E1SA 2GEVA 3GLGB 2CE2X 5DISB 2YOHA 4HAZA 3MWJA 4BZPA 1G5PA 1JR3E 1HT1E 2A9KA 2FN4A 4IDHA 1RRCA 1YJ5A 4JVMA 2EYQA 3VMFA 3GJXC 1VHTA 2J45A 2GA8A 4JLDA 1ZYUA 3H86A 5FTNA 2QP3A 4URWR 1FTSA 2R62A 1SXJE 5IDVA 1Z08A 3HR7A 5EUMA 3AVTA 5J4KA 4LX0A 3EC2A 3UIEA 3EIHA 3ADBA 2VH5R 1QHNA 1XJCA 5DI3A 2OT3B 1P3JA 2E87A 3C7KA 2I3BA 1NI3A 3Q9LA 1NVVQ 1Q1BA 1XCMA 4ZKEA 2Z43A 3RYTC 3NDPA 3K70B 3FMFA 3IUYA 2OCBA 2ZI7A 1UBEA 4FMDB 5FOSA 2VP6A 4IEEA 5C4GB 1GSIA 2XZLA 3BAFA 4WW0A 3AKDA 4GP7A 2ZJYA 4GZLA 5C1BA 3P32A 2OILA 4LK2A 4RZXA 2D4HA 4CT4B 3FOZA 3HDTA 1Z3IX 2ZJAA 2C95A 1CEEA 5K8UA 1HH4A 3LRPA 3QPUA 4DB2A 4IEIA 2X1VA 3HYRA 4PPFA 4C0SA 2DWQA 4AKGA 1NSFA 2JLYA 1EXMA 2KJQA 2ZRBA 4US2R 2QRZA 3RRZA 2AD1A 1EGAA 3T1VA 3EPHA 2CL0X 3DMDA 5FI1B 1WB9A 4QNMA 3Q5DA 4LHWA 1X1RA 2EQBA 1HEIA 3THWB 1UDWA 3P27A 4B44A 5AUNB 2P6UA 1RRGA 1UBCA 4M1KA 3CLVA 4QC2A 3RRYA 2OEPA 2WWFA 5TB5A 5A0FA 1WBDA 2GCPA 2RGAA 2J7PD 3K09C 3CNOA 3OEHA 4KLNA 4C0JA 1MO4A 3RNLA 2MSEB 3GJ6A 3JZAA 4R2HA 4D82A 1ZM3A 2N42A 1JPNA 1U81A 4B74A 3ZD7A 4L8GA 4EPVA 2JGNA 1OXVA 2FZLA 4HSEA 3TQCA 1ZMXA 4TMTA 4BFXA 3BXZA 4RD1A 1N6PA 3GD7A 3HYTA 5EZ6B 1XX6A 3OE7D 4Q02A 5FBVB 1EFRD 1IXSB 3CRW1 2NPFA 1J2JA 2P0EA 1E9CA 2IK8A 3B8HA 4V0OA 1Z6AA 2C2HA 1G8FA 2IA5A 3I3SR 4L4UA 4PTLA 4U5XA 1C9KA 1W5SA 4NCHA 4B2PA 4LC0A 2ECKA 3QKSB 5JZVA 2J59A 2YV5A 1KMHB 4MKFA 1SZPA 4D4MA 1KDPA 4FWTA 1Q22A 1Z6TA 3AF2A 3T61A 2F1RA 1QHIA 1CTQA 3BB3A 3IGFA 4EJSC 4UXIA 5LD2B 4WA7A 4NYIQ 1ZUIA 4DDUA 4ERNA 1P9RA 3CW2A 1AGPA 2R6FA 1G16A 4OQMA 4DSOA 3SQWA 1RJ9B 1LNZA 1QHXA 1DE0A 1L7VC 2ZYUX 1FTNA 3LBIA 1YQTA 2FWRA 2LKCA 2RGBA 1G6HA 2C78A 1XXHB 2P5TB 2ZUBA 4W5JA 4J0QA 4Q18A 5FOTA 5KTYA 4TZ6A 4L9SA 1KO4A 2CHQA 4Z1MA 3W6NA 2PT5A 4H9GA 1OIWA 1G7SA 2REXB 1W4RA 4B47A 1GRRA 1JPJA 2RGEA 4DLWA 4ZCMA 4JLJA 4LJYA 2VP0A 2IYSA 1X8LA 1JBKA 2GZHA 3BD9A 1C1YA 2DPXA 2CK3A 3B7GA 1XMJA 2GXAA 3HP1A 1AK2A 1XEXA 1W36C 3U3JA 3VU9A 4RY2A 5JSZA 3GFPA 4K8OA 3KXIA 2ZETA 3ZDQA 2HF9A 1Z2CA 4LPKA 4KBFA 1AZTA 1R5NA 1A2BA 1EX7A 3IPXA 3CPJB 3HPQA 4TWZA 4EQ6A 3B13B 2CJWA 3EARA 5J40A 2EWVA 2JLQA 3KL4A 1KAOA 3THYB 4TLEA 2VF7A 2EWWA 5FUWA 3FDIA 3LY5A 4JL5A 1NJFA 1ELOA 4JBWA 2J3EA 3REGA 4G5RA 4D0LB 4RD6A 4UKDA 2YOGA 4YC7A 4XTCS 3V4FA 4B3BA 1U8AA 2AFHE 5ELXA 2GJSA 3FMOB 1AZSC 1E2NA 4JT4A 3AV0B 3AVWA 1VCIA 2AWOA 2NIPA 1R5OA 3LW7A 4DEYA 4HLCA 2WIBA 4FN5A 1U8ZA 4FCVA 2UZ3A 4NYJR 2F3TA 5TVKA 4D81A 4QKQA 5J4LA 3TLXA 4DLXA 2GCOA 3PFIA 1OKKA 1W1WA 4P31A 2EFHB 3QG1A 4V03A 1W48A 2C9OA 6Q21A 4B2LA 1MO3A 2NO1A 3B1ZA 1UEIA 2ODNA 2VHQA 2F6RA 1Z0KA 2ZRJA 2VSOA 2R2AA 1E9RA 3RS4A 4Q48A 2P5SA 1LVGA 1LF0A 3CR7A 5JJKA 4Q1EA 5FL3A 3FKSD 1ZD9A 1CJVC 3RVBA 1TQ6A 1TX4B 4ESVA 3FYHA 1PZNA 1CRQA 2QA5A 4BECA 2QPTA 4XVRA 1HURA 1JR6A 2BMFA 2E9SA 3B6EA 3KX2A 1A5TA 5K8IA 4ILEA 1I4TD 1E2PA 1T5IA 2Z4SA 2ERYA 1ZD8A 1NBMD 2QT0A 1G291 4TTPA 2A5JA 4A4DA 3IILA 2PJRA 1AQYA 2OCAA 1U9IA 1DO2A 2J0UB 2ZSEA 2PLFA 2RH5A 3DKPA 3DOFA 3K0FB 4FINA 4Q4AA 2AD5A 4LY6A 5JMTA 4A92A 2NGRA 5FPSA 5KSZA 3FFBA 2ZJ5A 4CVNA 1EWQA 5EXTA 3EZ7A 3GLIE 1Z0JA 3QQ5A 2V4ZA 1XMVA 2OBNA 3OFND 3CONA 2CE7A 3K1JA 3WP1B 3SR0A 1PVOA 4CIDA 1Z5ZA 3A36A 5HE9A 1GOTA 5CLLA 3R9XA 3TBKA 5UKDA 1EFCA 2XTZA 5KDOA 5JEEA 2G1KA 1TU4A 3QEJA 1P5ZB 1KK0A 4P4TA 4NYIR 3I62A 1TQ2A 1II8B 5TY0A 3U61B 2CMKA 2F1IA 1UJ2A 4Q4JB 2V7QD 4PAOA 5FBRB 1DARA 2VP9A 2NO0A 3D8BA 1E2MA 2O52A 5L3RA 4DT1B 4B2IA 2BJVA 2B21A 5CJ2A 2XNDA 2J46A 2ZYWX 4G0NA 5JEDA 1Y63A 1WDTA 1SQ5A 2FSFA 2QI9C 3DZDA 4TYPA 2O8DB 3IBGA 4FMCF 3H84A 1KDTA 3LVQE 2O8EB 2BBWA 3EA5A 5L3VA 3H2YA 2QAGC 2KSQA 2IEZA 4DCVA 4TL7A 2W6JA 1JJVA 2UKDA 3CF6R 4EJSA 2YWFA 5CITA 1IY0A 4TTQA 3ZD6A 5TV2A 2PZGA 1LS1A 4RZUA 5EP2A 1F2TA 3RHFA 2KB0A 2OUKA 3QXSA 5D3MB 5GJCA 1XPOA 2PZFA 3QBTA 2Z83A 3RC8A 4KI0A 2QE7D 3I8SA 2PCJA 5F2EA 3L8ZA 5F3WB 1K6MA 3AKEA 3NBZC 4C2TA 5SZJA 1KK1A 2ZE5A 1RZ3A 1Z6GA 4L9WA 4RSGA 3GLGE 1ZP6A 1N0VC 1F3OA 3IIJA 4GNKA 3VR6A 1J99A 2KWIA 2WJYA 1LV7A 1XB2A 1OW3B 3FHCB 1D9XA 3FTQA 3PITA 5HE8A 5B2ZA 3MUFA 1VCMA 3CX6A 2PT7A 4D80A 3EC1A 4DLRA 2GJ8A 3RSOA 2PEYA 1D9ZA 2MMGA 1VHLA 5KYKA 3JVUA 4G5SA 1SXJC 1MABA 2OG2A 2JA1A 4HLUC 4V0ME 2DYKA 2P6NA 3SHWA 3X1DA 2JLSA 2XZOA 1OXUA 2VSXA 4BPBA 2D3WA 1E99A 3PG5A 4KVGA 3GLHA 1CS4C 3NH9A 3Q72A 2N46A 5K8TA 5BW8A 2C9CA 4EAQA 3KQHA 1KI4A 4KITB 3VX3A 3A1VA 2HLDA 5J4VA 4JMPA 4CEHA 3EIQA 1N6RA 3MLEA 4U00A 2IUUA 1NRJB 3TGPA 3K0AA 2BKEA 1S0UA 3AF4A 2EU8A 1DAMA 4FMDF 3D7MA 2Z4RA 3FKSA 3A4LA 4OHVA 4A8JB 5KPJA 3AVVA 4EDHA 1N5LA 3Q85A 4KYUA 2HF8A 3DM5A 1JECA 1WXQA 1QHHA 3I73A 1ZBDA 1GNQA 1XTJA 5HKKD 2H18A 1JR3D 5EP1A 3UWKA 1AS3A 3C15C 2WKQA 3HU1A 2AKYA 4LV6A 3SFZA 2AX4A 5JCPA 2XGJA 1NG1A 4C9BA 5SZHB 4E07A 5EQTA 4D0NA 1T91A 1IJFA 5JHHB 3KXKA 2IHYA 2JJ8A 1JI0A 4YQFA 3CRRA 1BIFA 4Q4HB 3SJCA 2NTYC 3VFDA 3AVYA 2ZITA 1KGDA 3AVUA 2F55A 4HB2A 1KDOA 4DCUA 4PFSA 1P6XA 3PVSA 2ZSFA 5IF9A 1OFHA 1VECA 2HYDA 2GBLC 2G88A 3BH7A 5BN4A 4V0KA 2JEOA 2V55B 1R2QA 2B6HA 2G77B 1DG1G 2P2LA 2CVHA 2IYQA 4PX9A 2QTHA 3PIRA 4BRWA 4GOKA 2W00A 4IDQA 4OI0A 1NLYA 1U0LA 3BFVA 5E4FA 1AS2A 5FOUA 1RIFA 1P60A 5TXGA 1T5LA 2QMUA 4A8JC 4Q9KA 3HWSA 3Q5EA 5FUXA 1N6NA 2WSSA 4Q9IA 5KNBA 3CWZA 3H1TA 1E32A 3TSOA 1YKSA 3FFAA 2ZUDA 3CF2A 5E3HA 4KO8A 4OKSA 5DH9A 4DUGA 2FPLA 2JIZD 2J0VA 4FIDA 2FGKA 1ZAKA 1JJ7A 1KMQA 1TQ4A 1M1YE 4WZAE 4AG5A 3O8RA 1KO1A 1EFTA 1GG2A 1QG2A 1NL3A 2WWIA 3BE4A 4PZLA 5P21A 1W4AA 3EPLA 2XXAA 4LUCA 5CB8A 4MH0R 2WHXA 1KSHA 4HLQB 4FD2A 4EUNA 1I2MA 2XSZD 2F43A 1ZM4A 4LYHA 2BEJA 1GILA 1JQJC 4PHTA 221PA 1CULC 2QGZA 1F2UA 3G5UA 4LBWA 4M9SA 3IKJA 4F7WA 1XJQA 4Q1FA 2Q9AA 1G9XA 3CNNA 4F93B 3PJRA 3MRSA 4TT3A 3SBDA 4NMMA 4TYWA 2C98A 3T15A 4QJ3A 1XTSA 4ZDJA 3H0KA 3LW8A 2H1LA 3NH6A 1BMFD 2VHTA 2VL7A 5CK4A 2BKUA 4QG7A 2YYZA 1II9A 5G53C 3EG5A 2IYTA 2CK3D 1Z22A 4MYUA 1XF9A 1DAIA 4ASUD 1H8EA 1R0YA 2WJGA 4G3XA 4LHYA 3RANA 5A4JA 1IM2A 1U94A 3ZH9B 1CR0A 4TT3D 4B32A 3BIFA 2DFKB 1T8UA 4O0MA 1Q1ZA 4OL0A 1YVDA 5LD2C 4JLBA 3AVQA 1MV5A 2A5YB 2C77A 4QHYA 1H8HD 1U99A 3OEEA 1E94E 4P4SA 4BE7B 1E9SA 3CX7A 4TMVA 3OE7A 4IXNA 3EXAA 2QENA 1G21E 3QOFA 1XD9A 2HJVA 4ASUA 3GCGA 4YONB 3WP0A 3K0EA 1E9BA 1DADA 3ASZA 2BMEA 2RGCA 2GJKA 2ZRIA 4CYMA 4JZKA 1Q0UA 2MSCB 1IBRA 3L8YA 1FMJA 3SJAA 4AKEA 2X2EA 4CDGA 3TUJC 3CNLA 4YDHB 5C18A 3IPYA 4P33A 1ZC4A 3G0HA 2B8TA 2WMOB 4AK9A 3EPKA 2ZRAA 3OESA 1QVRA 4EPYA 1JB1A 1QHSA 1AKEA 3B1XA 2XSZA 4BGDA 3V4RA 1OF1A 4W7SA 5DGXA 1KO7A 2ODWA 3WYGA 2EFGA 1GZSA 4WZ6A 2FX3A 4IRUB 2EFEB 4Y0VA 2HXYA 4A15A 1S96A 2FDCA 1DAKA 4ACAA 2IC5A 2PBRA 3B9PA 4QHSA 1L2TA 3E70C 3L0SA 5DI9A 1NVVR 4RFSB 1OSNA 1G64A 2EFCB 2ATXA 2HCBA 3VNUA 1XP8A 5CJPA 3T06B 2ZRHA 4A2QA 2WIAA 4DLZA 1E9EA 1R0ZA 2C03A 1RRPA 5KOYA 1E2DA 3CRVA 3MWLA 1YZKA 3IIMA 5KPDA 3VR4A 4PHFA 2WSMA 5AR1A 5B58C 1WE2A 2EW1A 4MDEA 3GLFA 1KO5A 3QKRA 3IIKA 3ZYCA 1HUQA 2ONKA 4CEJA 1RVDA 4IVPA 4XD7A 2CXXA 5EUQB 5BXQC 2ASEA 2GVDC 3GLGA 4PO8A 4LHVA 1YZLA 3U44B 5KNDA 1GWNA 4I99A 4IVQA 2JJ1D 1MO5A 1G41A 2R6CA 1G7RA 4EPTA 3OAAD 1NIJA 3RDPA 1PLLA 2FV8A 3LO5A 1RYFA 5FR1A 5H1YA 1BYUA 1SKYE 3FGNA 1SXJB 3GJ5A 1Q1QA 4PC2A 2D06A 1NY5A 1VG0B 3ND8A 4D4JA 4R9UC 3X1YA 1EFUA 4HB0A 2O8FB 1J8MF 4FXPA 3U3RA 3Q7QA 4YMTA 1OH7A 3QSYA 1R0WA 1FW6A 5DI3B 3OEED 5KSPA 4URVR 4MQBA 2ZI9A 3RS7A 5DSZA 4IOKA 721PA 4AI6A 2WTUA 2YC2C 3OIYA 3O8BA 1DAEA 2ODEA 3LXXA 4ACBA 4M1SA 5CB6A 4EFMA 3R9IA 2DWPA 1G3MA 4K81B 1TADA 4A0FA 4W5WA 3HPRA 3EWSA 2WOOA 1XTQA 1JALA 1GITA 2GHIA 1UDXA 4YLGA 1X6VA 1FP7A 4G1UC 2BCJQ 3HU2A 2VRWA 4PC1A 3W9YA 1NN0A 3R9WA 2YVUA 3M6AA 4PZZA 3EW9A 3VX4A 3MAAC 1ZNYA 2D62A 2H5EA 1CU1A 1NBMA 2CLCX 4NZYA 4B76A 2IW3A 1E98A 1OIVA 1P73A 3EPJA 1VKJA 1KI3A 2CNWD 5KUTA 3MWYW 3RS2A 5GJBA 1S2MA 4AIIA 4HAVA 3AP2A 4HDOB 2BWJA 1FP6A 4TZ0A 2DCUA 3FHOA 3RSLA 1F60A 3LFUA 2XNDD 2OFOA 2VQSA 5D3QA 1E1QD 3VNVA 3FKQA 3ONWA 4OK5A 2IXFA 2O8BA 2IXGA 2IWHA 2E1RA 3NIBA 4YXWD 3E5HA 1T3SA 3B60A 3SS8A 1IN4A 2AR7A 4D25A 4A1FA 4DKXA 4B6EA 5G40A 5JJLA 2DHRA 4PSVA 1VTKA 2JIZA 4LSGA 3IQWA 4JSTA 4PPNA 4TMKA 3QJYA 4CEIB 3U7EB 3SJZA 3KFXA 4AYWA 5CIQA 3OF5A 2B8WA 4HDQB 4OI2A 2C5LA 4QHTA 4NTZA 4CF7A 3UPUA 5G41A 4MKIA 4JIMA 1EESA 1NN5A 2QE7A 1IN7A 3R7WA 3NEYA 2J1LA 3D6TB 4R7ZA 1KTVA 4N3NA 2VEDA 4KCGA 4G5OA 1VIAA 1FQKA 4LJ5A 5DLQC 1N25A 4XH9B 2D2FA 5EXXA 4KODA 4LJ9A 1K5DA 4QM6A 2FGJA 4MKHA 3ADDA 4NHOA 4OYHA 3UWOA 1N5IA 1XFAA 2B7BA 2WM9B 3DVLA 1GM5A 3PEYA 1G19A 4B34A 3THOA 2GF0A 2VLIA 2FH5B 3KJHA 2REBA 2A3RA 1TNDA 3MMPA 4IOMA 2FE4A 2FU5C 4Z51A 2FEOA 3K53A 4HUQB 2BMDA 3RRNA 2XOKD 1M7BA 3JVVA 5EE0A 4BLSA 3LH5A 2HEIA 1B0UA 5AJWA 2J7KA 3A58B 3AH8A 3IHLA 3JZMA 2BDTA 5IT5A 1NMYA 5JWHA 1RJ9A 4A9AA 4M9XA 1M6NA 3UKDA 5J5CA 1DBSA 1T6NA 1XXHA 2IHBA 4U7DA 2A78A 2TMKA 2Z5FA 3A8TA 3FB4A 3KJIA 3TSZA 4PQFA 1WRBA 4FWIB 5EE5B 2FA9A 3DDCA 1TUEA 1VG9B 2YKGA 5JECA 2XJ9A 1E2HA 2AXPA 2ZQ5A 1EG7A 4WIAA 3N2EA 5KDLA 1BYIA 2BHRA 3A1SA 3BK7A 2ZUCA 4UNPA 3REFA 2IWRA 3AGPA 4AG6A 1KZGB 3KDSE 4DIDA 1XEXB 2BCGY 1ONBA 2P3SA 1I2DA 3K9NA 2R44A 4L15A 1GFIA 1SKYB 4D4KA 4MKGA 2H8KA 4QGAA 3X2SA 2RGXA 3DL0A 1GL6A 3D3QA 3MG9A 3MJRA 4EQ6B 1FPMA 3TQFA 1Z28A 4JBYA 4KFSA 4M1WA 3THYA 1E1QA 2EFDB 4NE2A 5FOXA 2LCFA 1TL7C 4FI3C 4DCSA 3C14C 3CRMA 4RD4A 4PAMA 4IFBA 1SULA 3GJ8A 4V0MA 1VYTA 1Z2AA 4DLTA 2NMVA 2OO7A 4D26A 2OBMA 3B5JA 4S35A 2O0HA 1L8QA 2YWHA 4PHGA 1ZINA 1XTRA 1M8PA 1COWA 4A82A 4BWYA 4BFYA 1G3QA 3SE0A 1R8QA 4JVLA 2WJHA 3BJIC 4M9ZA 3QVUA 3IHWA 1P7CA 2GBLA 1ZNWA 1EFRA 3BOSA 1XTIA 1E0SA 2GKSA 2ZEJA 2W83A 1IQPA 4ZV4A 4U02A 5CYPA 4LBZA 3WRXC 4XSGA 1ESMA 1EK0A 1ZNZA 4QGGA 1C4OA 5FTJA 3LX8A 1NVUQ 4QXAA 4EPRA 3UANA 4CGZA 4ZDKA 1KJYA 3RRMA 3KKMA 2FSIA 3VQTA 5KO2A 1RC8A 5B57C 4XJXA 5H68A 1GL7A 2R6DA 4V0NA 3NG1A 2FSHA 3QXHA 1KYIA 2IXEA 1OH8A 1W2HA 1XJ0A 2D74A 3I8XA 1CR2A 1Z0DA 2JLVA 3LDAA 3LXRA 3VTKA 5J4YA 1QZXA 2DWOA 3QPWA 2ZRNA 4NCKA 1OFUX 4TMWA 3ZZUA 1NG9A 1A1VA 2GZDA 2PZEA 4LYJA 4IW3B 1KI6A 2VPPA 3E2IA 4OHYA 3AB3A 4HZUA 4C0KA 2REOA 4Y0AA 3BFXA 2G1JA 2L0XA 1XD8A 4IVRA 4HAWA 1VYVA 1N5JA 4NKRA 1YZGA 4GRAA 4JJZA 2GJ9A 2QAJA 3NXSA 4PHHA 1OB2A 5E7JA 4L5BA 4KFUA 3W8RA 1S1CA 5DE3A 2OESA 3LBHA 2G6BA 3PXGA 2FOLA 4TMXA 3U3MA 4BFTA 1OB5A 1LS6A 2YOFA 5KSYA 1II8A 2JDIA 4KFRA 1G3IA 1R5BA 1R6BX 1UBFA 3GP8A 3J81k 1E0AA 4M1YA 3CM0A 1J7KA 2WKPA 3CH5A 4DHEA 1ZCBA 1LB1B 4UJ5A 2QBYB 1YZTA 2VF8A 2J41A 5DHAA 4XVUA 2GF9A 2JLWA 2ZVPX 3RLFA 3BC1A 2BOVA 5G3YA 3AUYA 1F48A 2OLKA 2O8DA 2JATA 3I61A 4DWJA 5HR5A 2FPKA 4M0LA 2NG1A 4GMDA 1IHUA 1OLOA 2O8CA 4EJSB 3CB4A 3QF7A 2CLDX 4EPWA 1HTWA 1Z47A 1CLUA 1LW7A 4JLVA 1PV4A 4NBSA 4JVSB 4KJZA 3PEVA 1AQUA 1RRFA 1F2TB 5D3MA 3L0IB 4Q01A 3IBYA 3BS4A 2V3CC 1NKTA 2NO6A 3K9HA 3U4QB 1F5NA 3EAQA 1RW4A 1YRBA 1YZUA 4BEBA 4I1SA 2LWIA 4NCIA 5JLJA 3A1TA 1Q20A 1S3GA 4RKFA 1E2EA 3P4XA 3A1WA 3AEZA 2DFLA 5AUQA 3ADCA 4B3DA 3X1ZA 3PEUA 1FNNA 5SZIA 3OEHD 4LGMA 2CCKA 3BH6A 2WAYA 3TE6A 4JKYA 5L3SA 4F4IA 3A37A 2C99A 4XIGS 4ZKDA 5EE3A 3QIAA 2ZRKA 4JKIA 3WNCA 5EJEA 2Q21A 4FMCB 4M8NE 4PSAA 1G8YA 1MABB 4HLDA 1MT0A 2OFWA 3THXA 4US0R 2ZS7A 1O87A 1GTVA 1U0HC 3SNHA 4CT5A 4FW9A 5EP4A 2ZI5A 3VAAA 3VR3A 2IYWA 5HZKA 5IK2A 1IONA 1A4RA 2AKAB 4EPXA 3AF1A 2UVQA 1IXZA 2VP5A 2ZPTX 4KFTA 5FH9A 5TMPA 4CEHB 2W6ID 2W6IA 2ZRMA 4QJ5A 3W8NA 2QP9X 2JJ1A 1PLKA 3K0AB 3L2OB 3LQRA 2WAXA 3RS0A 2NQ2C 2QTVB 1UEJA 2GCNA 2AN9A 2WZQA 3C5CA 3F0TA 2G83A 4G5GA 2ZE7A 1WMSA 2FG5A 4RD2A 4DRZA 4LBYA 2F9MA 2OBLA 2V1UA 1QHHB 1OXXK 3TR5A 4Q9HA 3QBVA 2WICA 4D4LA 3QI2A 1UAAA 1E9DA 1P62B 3AP3A 3L43A 3GMTA 3WMFA 1Z6YA 4OQNA 1S9HA 1VG1A 1G4AE 4HAYA 1KI1A 2OCPA 4L16A 4URUR 4POAA 1CR1A 1E2KA 1JR3A 1GRQA 4MYHA 4RFVA 4PPQA 4OQFA 2F1JA 1NVWQ 2LKDA 5H70A 4Q4HA 4B3GA 5E7MA 3PUVA 3N2IA 2MSDB 5B30A 1QDEA 3O47A 1FOEB 4ITRC 2J5XA 1X3SA 3KUCA 2QMEA 1WA5A 3AUXA 2BBSA 1Z07A 4I81A 2ODBA 5FFMA 3B85A 3B1VA 1US8A 5JWRA 5JI2E 4DSTA 1E79A 1R7RA 2QM8A 2PEZA 2R9VA 2HV8A 5M04A 1OE0A 5FBQB 4HDCA 3K9GA 4PO1A 3EZ9A 1W44A 4KBGA 1FUKA 2XTMA 2H92A 2Q9CA 1KOFA 3QG5A 4YMUA 4HYYA 2BMJA 5EZ5A 1UBGA 2QL6A 3WYFA 3V9PA 3HJNA 5ANRB 4Q5IA 2NOAA 5CLQA 1RFLA 1T0HB 3C16C 4YMVA 1CF4A 1P2SA 3BBPA 3MJHA 3T34A 3GFTA 2GESA 3W6PA 2CVFA 4Z54A 1VIYA 2NPIA 4PQYA 2VHCA 3NWJA 2F3RA 1P4SA 2NZ8A 4QBHA 3SQXA 3WMGA 2XJ4A 3MD0A 2WPDD 3B2EA 2NO9A 2PX0A 3M1IA 3SZRA 2D7DA 3EASA 4BFWA 1ZD1A 1D2MA 5GJVC 4I1UA 1W4BA 5KNCA 5GADl 1G7TA 2G0TA 1G20E 2YC4C 4BZXA 2QAGB 4DSNA 2ZRDA 4GMXA
chains in the Genus database with same CATH superfamily
5ALWA 2O8BB 2DWCA 1AKYA 1XJWA 3LDFA 4BFSA 4NLLA 2HT1A 1PZMA 2DE0X 2R87A 3BM5A 3VAZA 1DFHA 1MX3A 1HDEA 1P0FA 2ZAOA 3RQIA 4B48A 1J70A 4DDWA 1B23P 4FBGA 1PDVA 4MS3B 1Q7RA 2I2CA 2EATA 4AJ9A 3OFNA 3MMXA 4WERA 1RXUA 1EDEA 3QELA 4G5FA 5ALDA 4DFDA 2O1WA 1P9OA 4KQ6A 3O1IC 3JTEA 2WJVA 2E5FA 4M36A 3QU9A 1SBIA 1B41A 3FLEA 4RLQA 3MOGA 4WUTA 3UXYA 2W43A 5T4EA 2Q27A 4Z0PA 3VOBA 3CT4A 1C3XA 2PRSA 3FPBA 3A6KA 5FFNA 3X1KA 2FR8A 2HXGA 3AQ4A 2Z9DA 3DMNA 5F76A 4IFIA 1Q0SA 2QTMA 5ILQA 4KC0A 3TW0A 5IK2D 4XOUA 1E62A 13PKA 3AB8A 3P9NA 3OPVA 5DRTA 3JWIA 4C0HA 1W36B 1TF2A 1L5GB 1ZCAA 4C14A 3CKKA 3L1UA 1ZD2P 3FSGA 1Z35A 4DR5B 3LS2A 3C6KA 1AGNA 2WA1A 4QOIA 1C8LA 3DZ8A 1JLLB 1R9NA 1EEXB 4ME6A 4Q03A 1NNI1 4REMA 1AKRA 2VWQA 3L6OO 3TPCA 2ANCA 1ZNQO 4YVFA 5CGQB 1BX1A 1ABBA 3DQPA 3ZK8A 3ML1A 2QY6A 2CXPA 4QDUA 1YHZA 2WC1A 4JI6B 3QY0A 4TS4A 3KFVA 1DO0A 3H4MA 3W3AA 2ECFA 2XTNA 2ANBA 2BRUA 3MIIA 1KOGA 6YASA 1FMTA 4DDHA 2JPDA 4LCEA 2QR5A 1WSAA 3QEMA 3IAS1 4D4GA 3KKKA 3TECE 4UNNA 1DRKA 4ND5A 3F73A 4BASA 2PUHA 3PE4A 1JF8A 1AZWA 4RJJA 3D4PA 4FJ0A 4Q7QA 2WM3A 3CE6A 2PL3A 4GGMX 1N32B 2V0NA 1FP1D 2VPTA 4M6WA 3LF1A 1J09A 1G8KA 1CQPA 2NU9A 3PA6A 1H93A 4YMSA 1UMBA 4JI1B 3U81A 3UZUA 3A4NA 3W05A 3JQAA 4I6GA 2WEKA 5EC8A 1U0RA 2XTJA 3O95A 4GMKA 3KSUA 3LWZA 4P2GA 4TGLA 5HTKA 1SNYA 3E4CA 4MVJG 3MJVA 4HTFA 4MW2A 4Q9LA 3TQRA 1K98A 1KI7A 1N34B 3LG2A 1U3DA 1ONNA 2WWHA 4TWAA 1Y8CA 4ZOLB 1WW8A 2Q6VA 4CF3A 4AF6A 3H7IA 1PNTA 4YCDA 2V98A 4ZOCA 3ANSA 4Q1AA 4IHKA 1EWTA 1QGED 3E8XA 1JA0A 3AP1A 5DM2A 3ORHA 1W96A 1NWHA 3RFVA 3WLQA 2JIDA 2W2KA 3DM9B 3ZVLA 2FQWA 2HCJB 4UATA 2H1HA 2HLPA 4DNQA 1FMCA 3LDGA 1USUA 4F3NA 3O8QB 3QWFA 1Z83A 4H0FA 1YQWA 5AHOA 4GEKA 4YT5A 5EWLA 4V02A 2H4XA 4JI0B 1XK7A 3FNBA 3SD7A 4ZEMA 1H1TA 4ZIRB 3VRHA 2DEUA 4D9MA 4DCCA 4CDRA 3VZQA 1YO6A 2ZJ4A 3AR9A 3ZV7A 1NVTA 3GAZA 4WACA 4FHZA 1VE9A 3MGKA 3DLTA 4K9DA 3CEPB 3IV9A 4OM8A 2UZAA 3AYXB 1GLNA 5AHKA 4GNRA 1SUBA 2FI1A 3R0QA 2NTEA 3A1CA 1R4AA 1ZWLA 1EX9A 1M5RA 2J3IA 2PNFA 3MMNA 4M1TA 1IDOA 4YQZA 3TTTA 3S40A 5B5SA 4DG8A 4FZRA 4XWAA 1YC5A 1KA9H 4PS1A 4YMLA 2W11A 3ZTYA 4RVHA 1VPTA 3ZCPA 4AMBA 4ZI2A 4ZHQF 1YZNA 3GQVA 3CF4G 4P86A 2LGJA 2H8GA 5G2OA 1NU8A 1HG0A 1LPNA 2QQFA 2FF5A 4JYBA 4N7RA 4WH0A 3J80A 2CL7X 3MRVA 3X43A 2QD2A 1GY8A 1Z8HA 1VJCA 3QUQA 1MLDA 4Z8YA 4IYRA 3KPWA 2VBIA 4A8PA 3EH1A 4F3RA 1TDJA 2KX7A 1X14A 3NHKA 2CDNA 3OSUA 1XAGA 3W5UA 4U2KA 1I36A 3K0KA 1PFGA 4YAFA 3AJAA 5EZYF 2UXDB 5KZMB 3LV8A 1Z0UA 4V38A 1GDDA 4GXTA 4H7JA 1X13A 4FBMA 4MQEB 4W6ZA 1NXWA 4C6HA 4K9RA 1YZFA 2QLTA 1OXBB 3AHJA 2HYIC 4TVKA 4G4GA 1N6HA 2FTKE 2UYOA 4I0WB 2RCNA 4W7HA 4RM3A 4HI0E 4XWTA 3GLFE 3PUWA 4UD2A 1D04A 4D7AA 4D9BA 1Y6GA 3BXFA 4MO2A 4N3AA 4WKGA 4HNVA 2P91A 2CMGA 1DJLA 1G2IA 3V1TC 1I4LD 3DTVD 1J21A 1CVIA 1ZS9A 4F12A 1TEXA 3GJ0A 1WCIA 3LUKA 3EQZA 5ALJA 4C03A 3R6LA 4F85A 2I4IA 4N5IX 4AX4A 3ZHXA 1I4EB 1FUEA 2CHGA 2WSBA 3EPRA 3FOWA 3PNQA 2Z30A 3AOGA 3UCXA 4CHGA 4JLAA 1I8TA 1Z29A 4RJLA 4TTJA 2LW7A 2HBQA 4YRTA 5LCXA 5JD3A 4P4NA 2EFYA 3AEKA 3BF7A 3E7XA 3O31A 1GPJA 4UCWA 3MAGA 3DEFA 1T2DA 3AL3A 2WJWA 4X3PA 3ANMA 5CFNA 4G85A 1IJKA 1NXVA 3IAEA 4LQCA 1SUFA 4OHMA 3WKBA 3SZGA 4EENA 4DQUA 3HSYA 4HLUA 3ENQA 3L82B 1G4UR 4I4LA 1ZOSA 1KXZA 1PEKE 2AE1A 2BP7B 5THQA 4EYOA 4RVFA 4MUHA 4P93A 4PYNA 2W7TA 2JGLA 4DR1B 1OWNA 1RTTA 1FJGB 4RJTA 4ARBA 4PTYA 2E82A 5BNFA 4IDBA 1D4FA 2NZJA 3TD9A 4ZTUB 4QTTB 4LVUA 5LM3A 3R20A 3JALA 4B6SA 2FUG6 3A1EA 3H5WA 1MO2A 4Q9NA 4E5NA 2PIAA 3RUCA 1L1QA 4L5YA 1Z7WA 1PJSA 1R64A 2AYXA 4MB2A 5FLEX 4ZO9A 3VYRB 3NHWA 1Q84A 3IDAA 3UMSA 5BN5A 4QDKA 1NRXA 1VMIA 2F9LA 2HBYA 4CV2A 1KSFX 2JD0A 3FF1A 1DG3A 1N0UA 5CNMA 3I6IA 5DHFA 1FA9A 1R8XA 3KJEA 4TWRA 1AHPA 4WXYB 1DIHA 1PT6A 2BEKA 2HEGA 4S2UA 3KUKA 4PWZA 621PA 1EDBA 2QZ4A 3R7WB 4NNOA 4GSYA 4R8RA 3EN0A 3JATB 5FR2A 5IYZF 1JXAA 2ZU6A 4TSRA 3WLSA 3OQHA 2WJJA 3CC8A 3O4RA 1ZOOA 1CUUA 3GAMA 3B3JA 5E1OA 4UNRA 2FMFA 4WDRA 4DPLA 1YR7A 3P9KA 4QBIA 4NMXB 1CQZA 5A5FA 1GPDG 2V7GA 2GN0A 3R6WA 1HDCA 5CVTA 2PRJA 2RC6A 3PDJA 3NW9A 1DAPA 1UR5A 4NNJA 5AOAA 5G1OA 8ADHA 1AK9A 1NY6A 2XVAA 5JRJA 1U8YA 3QX7A 2HWXA 4QOGA 2XNJA 1IBCA 1JT2A 1UDCA 1HKHA 4GI2A 4HUQA 3SJUA 1R6DA 4YUWA 3SZUA 1BRTA 2APJA 1MT3A 2FG6C 3LPCA 2OCXA 1G9TA 4AX8A 4LRYA 3EF1A 1IVNA 2JKZA 3E5NA 4PX5A 4N1AA 1O97C 1HXHA 4AXXA 3UH0A 1GQYA 3ZLJA 2R8ZA 3HCFA 4EMUA 1LI7A 3MOSA 3OCUA 1F6BA 4ZI7B 3SLRA 2F90A 3MZ0A 3TNFA 1XUOA 1L7MA 1XXLA 3R3HA 4M1MA 4MUJA 5BP7A 3ZJTA 2JFOA 2RAPA 8ABPA 3DAHA 4I1YA 4MV4A 4BNWA 4DA7A 4WWHA 2NXJA 4LOHA 5LB2A 1IJEA 1UT6A 3TR0A 3IVCA 1Y6JA 2N0SA 2J9ZB 2NP6A 4ZRDA 4I9NA 1T0BA 5AKYA 3SMVA 1Q0RA 2Q5EA 5FYDA 2CNOA 3SEAA 2IS6A 4DANA 1M7HA 1YE8A 4K6OA 4UJ3A 1TQDA 4HEA1 5CUQA 3T3HA 4C22A 1ZJYA 2BH9A 4WCFB 5IVKA 1OGIA 2YZ2A 4PLVA 3SU8A 4G0WA 4XTRA 2P78A 1TAUA 1DBVO 3GW8A 3W34A 1H2YA 5CG1A 4OUKX 1ETUA 5C7LO 4XM1A 4ROSA 1VB5A 4F3CA 1C0EA 2VDOB 5JQGF 1Z5VA 2ERXA 3H0EA 3JQFC 5E0KB 3S44A 5BOSB 3WHKA 1Q50A 3K6JA 2BM0A 1CBUA 3ZD8A 3R1IA 1YR9A 1N0WA 3C41J 3FUCA 4KLZA 4TXLA 5DN9A 5JAMA 1C3VA 1KI8A 2Y93A 5AK6A 5KQSA 3THWA 1IB0A 1X7WB 2QTNA 1V45E 3CNQS 3M2PA 3AEUA 4TV8A 5GPBA 3B9RA 1IY8A 4AJOA 1PW5A 1UM8A 1CRWG 5LZ9A 1ABEA 2W4IA 3KOXA 2IF0A 4H0CA 2JFVA 4CG3A 1Z4IA 3AESB 1U3WA 1XU4A 3EZFA 3RVOA 4LWZA 4OHFA 2NU8A 1Z39A 2OB2A 3C3PA 3DT9A 3EIXA 5D85A 2GRJA 4MI9A 2BM1A 2Y1OA 3GLQA 3L92A 3NS7A 4L3WA 1UBOS 4X8HA 5CM8B 1WW2A 2X9QA 3ELWA 1W4ZA 1S6YA 2O2CA 3JPYA 7ADHA 4KDFA 3MPOA 3K0HA 3OFKA 1NF8A 5AI0A 4EHBA 2V8OA 3IB6A 4KQFA 1W34A 3NHZA 2PZJA 1KH2A 5JCOC 3H4VA 3BMCB 5C8YA 1YUNA 2GM9A 2VA9A 2FK8A 5HSGA 1T3HA 2VF4X 1I0IA 1GIAA 1GAQA 1ZRMA 1DC5A 3PC7A 1A27A 4RF3A 1MZPA 1KTIA 1IVYA 5KI6A 2A0WA 3HNPA 3F3KA 1I33A 3BB4A 2I0FA 5BXYA 1JQKA 1O96B 1T9KA 1Z4PX 2PBFA 4KO3S 4IV5A 3T4PA 3VPFA 1SMKA 2Z1MA 4FYVA 2O3QA 2XEXA 4LY9A 4ZMBA 5BQ3A 5MDHA 4HAXA 5GAJA 4MUEA 1GTRA 4UAGA 4HNAB 1NP7A 3G0DA 4HNGA 4O59O 2QGFA 2HU2A 4BP8A 1CE8B 1PJQA 3LBNA 2HCRA 3HFSA 3TIFA 1CUBA 1EP9A 2YZNA 4RANA 4ALLA 1RKUA 4EB6A 3JQCA 1YIAA 4UXHA 2IZ0A 3GGOA 5CDTA 4K9PA 3I1FA 4UUNA 3DWGA 1M1ZA 3RLIA 1QRRA 1K7XB 1YZVA 3IV6A 1HSZA 4Y2JA 5ALPA 4MAMA 4S24A 4QM7A 3STYA 1XZKA 3TUZC 2G07A 2O7VA 3TTUA 1FDWA 1R5JA 4NS4A 4U2BA 3BKXA 4WK0B 3K9WA 3SSOA 1HFWA 3EBPA 3UJNA 4NFLA 2XKJE 4Q00A 4A0GA 3AUKA 2H4JA 1E3LA 3NTLA 3UAWA 4LV8B 1V5IA 2DG2A 3GLRA 1NT2A 1RYHA 4MGHA 2AEEA 3HV2A 3ZQKA 4EKDA 2CXQA 4XB6B 2EKZA 1WJGA 4O02B 3D2AA 3IESA 4I3GA 4AWXA 2GPTA 3GLVA 3O3OB 2XUPA 1F8GA 1OXTA 4A7PA 2EKPA 3L7LA 1USVA 3OA0A 1LVHA 3EVEA 1TJ4A 2EXXA 2DCMA 1XTKA 4BMDA 3S2FA 2BGWA 3E0XA 1N1EA 4GECA 4RWEA 2LCQA 3INYA 5AW5A 5JQWA 2Q3HA 3IE2A 1DELA 3OU7A 4HX9A 2X0NA 3F46A 3GAFA 3FE2A 3I04M 3U7FB 1H69A 1Z26A 1FU8A 2AJCA 5BSMA 2G1AA 3IUNA 1UKYA 1YRHA 2X8JB 3OKAA 5JFOA 1GUAA 2CJWB 3F7OA 4Q7JB 3TZBA 4CTKA 4US1R 1IDN1 5DBOA 5F1YA 4N5DA 3ZIAA 4KQ1A 5AD1A 5SZKB 4EI2A 5FTWA 1RJGA 1N2IA 4NOLA 1MO6A 3G85A 3LVRE 5E6SA 1TEHA 1G20B 2F8TA 1U2DA 3QE3A 3V8BA 4KDRA 1ZJWA 2MR5A 3CT6A 1YQGA 4BKMA 2XBMA 2AN4A 3TFQA 1MA3A 2B99A 1JVNA 2A1TS 3BD6A 1J49A 3RRBA 2O5VA 3WRVA 1PL7A 3UG6A 1LPPA 2G67A 1R6UA 1HYHA 4KO1S 3I2KA 3W7AA 4ZVVA 3ZDRA 3OCWA 5FI5A 4GZ3A 5TARA 4N5LA 5B6JA 3TIXB 1NR1A 5DM60 4NZPA 4PBTA 4YFYA 5BNTA 3QPAA 1Y3AA 1C1XA 3S2YA 5BVHB 2G76A 4MULA 4HATA 3RS9A 4FSXA 5DTJA 2DERA 2XB2A 2HI0A 4TL8A 2F1OA 1J4AA 1K6XA 3SX0A 2AT1A 2V7QA 3C5HA 3GZ4A 4RK5A 3EPPA 3L7OA 3FIJA 1VPVA 2XHEA 1K08A 3HB0A 3ZGYA 2PQMA 3KQTA 4NMLA 4NJMA 1JHYA 1KJJA 2HRBA 2IYVA 2XHZA 3A9UA 3HB4X 3I04A 3LHKA 3M6XA 3VGPA 1SG0A 1YL6A 4RIFA 3FYCA 4ETIA 1ADCA 1X8XA 4QYWA 4CLRA 4TMZA 1U3TA 2DR3A 4YR9A 4FXOA 5L3SB 1PUJA 3MD9A 2BGKA 4B5KA 1FJ2A 3OUTA 3UOWA 5CYOA 2BY4A 2ZSKA 4AQYB 3AL0C 1NPTO 3S2SA 4AN1A 1DT3A 2P9ZA 3DAYA 4KQGA 2JW5A 4ZYYA 3DB1A 1T4CB 2MT9A 1PQUA 3U80A 3IP5A 4M0MA 4QUHA 4R9NA 1SUIA 4KIJA 3W8DA 3MGAA 4WESB 2CNNA 2YINC 3L9XA 1E1RD 5IYZA 4ZU6X 4NJEA 1X86B 2IS2A 1Z0IA 5JFGA 3IEUA 4PZUA 1UBHS 1RTKA 1P4RA 5LBIA 1SU7A 1G8HA 2ZVQX 3FZGA 3LKVA 3W1EA 2CMFA 4CIYA 5EJ7A 1E3EA 2ZJ8A 3LA8A 5ICMA 4LYAA 1CY7A 2GZAA 3COZA 3CXRA 1QRDA 1S3SA 2PVCA 3N8GA 4Q21A 5FJIA 1EXWA 2R3SA 5K09A 4AW9A 3U9TA 1GG9A 1A82A 1XCGB 4OKIA 3M4ZA 4RSMA 4JL6A 1JXMA 2WWVD 1ZCZA 3WIUA 1SH7A 1EFAA 5ULLA 2FLWA 3DPSA 4WI1A 2R8OA 5LLDA 3HKBA 4ENRA 4B3JA 4N8SA 2QX9A 4HXGA 2C2XA 1XPJA 4INPA 2OZVA 2I62A 3HBMA 3QGMA 4B1FA 2C4VA 1K8XB 3U09A 1RWWA 3PS9A 3SJBA 2R84A 4HDRA 5DP1A 2WJZB 3TQTA 3WFIA 5TC4A 2JCVA 2IUTA 3RVRA 1LWNA 3HXPA 1L4BA 1LFDB 1O58A 3Q8XB 3N07A 1K8RA 4A0SA 4N0QA 1DJPA 1UC5B 5A4AA 2RJNA 4RMGA 2Z2IA 4URYR 3SN6A 4N40A 1W6RA 4O2RA 2H2AA 2NXCA 2EJTA 2QEQA 3OQMA 2I03A 2WJAA 3ZE7A 2PH3A 4RDXA 1SA0B 1R6VA 1RD4A 2WVJA 2AJLI 3DV0A 3SXJA 2F8LA 3JVEA 1J8YF 3JVIA 3AR6A 4Q4JA 2W0MA 3TZQA 4BQIA 1J2TA 4NIMA 1L4NA 1CUWA 3K0CA 1FQJA 2WYIA 4DT1A 2W2XA 4AKHA 4GYYA 1HBJA 4XWKA 1RZUA 2E6KA 2CW5A 2QV7A 3GJZA 4HWSA 2A6PA 1JEOA 3K0BA 4ZAYA 3ZWOA 4C3VA 2FZVA 2HFKA 1GZUA 4E13A 1TTTA 2PVSA 2G06A 4EABA 3ZVRA 1J1IA 3EEOA 3FRJA 3P26A 1LPSA 1QCZA 2J3KA 2CLEB 3HADA 2O8EA 4G0XA 3W2TA 4J4TA 4HTAA 3UWPA 2PX2A 1RWBA 2MHCA 2QN8A 4JU8A 2ZCUA 1E3DA 5GONA 4DRXA 2FMXA 2GEKA 2QMZA 2TSYB 5COQA 4ZWNA 2F48A 5AKJA 1BJTA 1PK9A 2OHXA 3AUFA 3PQCA 3W5CA 1SURA 3R8FA 4N41A 1TM1E 3NBAA 3NTUA 2AXNA 2FN8A 2DLNA 3UT6A 4EK9A 4Q9JA 4UOQA 4IXDA 4XUDA 1M1NA 2ZR9A 4PZCA 4NK5A 4L0MA 3WLMA 3PNVA 4KXWA 4OHKA 1FDVA 4NYMQ 3ANTA 1XRLA 1UANA 4HH1A 1SWVA 1U98A 2I76A 3EIUA 2G5CA 1JNYA 2P9EA 5E2BA 1ADFA 4CQMD 5DU2A 2GK7A 4DMLA 1Z45A 3TQQA 2P30A 3K96A 2QM3A 4W99A 3ZLTA 1U7UA 3NNNA 1Q1EA 3HUTA 3QKWA 3V4VB 4LOKA 1IZYA 1FTWA 1YMUA 2AMLA 2ZWIA 3AIMA 3KKPA 3QMPA 2RONA 1UKZA 1Z7YA 2IHVA 4YJ3F 4EA8A 2H54A 5HJEA 4MP3A 4HMPA 1HA3A 3OG9A 2GOYA 2KW5A 4YJGB 5JFTA 2PLWA 3L7KA 5F9FA 4H1UA 4YJ2A 2MSLA 3K9FC 3AILA 3IODA 3W5IA 3NGLA 4O4JA 1AMNA 1M0TA 2XKKA 5F4ZA 1OFVA 3I9LA 2ZU0C 4W6QA 1HNZB 3NYWA 1JDNA 5ERYA 1TM7E 3EVNA 2H65A 3LVFO 1N1DA 2DQKA 2HGSA 2YWEA 3QF4A 2W2TA 4P7BA 3KLBA 2ABWA 4ESEA 5FADA 3SVTA 3KD2A 3M1YA 1S2NA 1JIJA 1AM4D 1XD2A 3P1JA 5TNXA 3U7GA 4LGVA 1M2OB 2ZYRA 3EQ7A 2D8MA 1Z16A 2O3JA 3D8TA 2H31A 3DW3X 1K7YA 1GRCA 3QPDA 4YMIA 3JQDA 3KJGA 3O73A 4D2IA 2H00A 2H1VA 4B7XA 6REQA 3ADOA 5REQB 3WOVA 5C4MA 1H0RA 2GBIA 3P0FA 2O2YA 1THTA 5L3QA 3R7SA 4IQ4A 3HO8A 4B84A 4DCNA 3QPVA 1SK9A 2ZIVB 1J0BA 3ON5A 4RF2A 4Z1MD 1BCRB 2ADOA 3P0HA 3W4JA 2NX2A 5H0IA 4L8WB 2YNMA 1DEKA 2R6JA 2HDWA 3ORFA 4IQ8A 5A4MS 1DGQA 5H3HA 2Q0HA 1AMUA 1VCNA 1XOIA 4HFMA 3EIFA 4CMJA 4RULA 1DKPA 3QEOA 3T9FA 4Z7JA 3WQHA 1YA8A 1JAHA 4ZOBA 1T25A 3U5TA 4IDOA 3H87A 2DBRA 4MPDA 2AN1A 1UDRA 1YB2A 1Q0LA 2A9JA 4E14A 1FX0A 3P2KA 4AQ7A 1XRJA 1P7WA 3O74A 3V1LA 3THSA 1D03A 1GGMA 1U0OC 2A5LA 3Q3JB 5FPQA 2ZBRA 3LZ6A 1ZVVA 3O94A 2GHTA 1JLSA 1OAKA 3OQIA 1QFSA 4G2NA 5EGSA 5LUAA 2WFMA 3IEVA 3NWOA 3UXEA 1XRRA 2CNLA 2VRCA 5D6OA 1VZ2A 1OX4A 3NT5A 4Q1BA 3RSCA 1U02A 1ZSYA 1T5DX 1Q12A 2GLXA 3C6ZA 3DD5A 1J24A 4R2IA 3RW9A 5IAGA 4GC5A 3IIEA 4PYOA 1GCGA 4HYQA 3A3OA 2OORA 4UQOA 2PO5A 3TVDA 1T4GA 2R6R1 1VQ1A 5FV7A 1Z34A 1XCJA 2QN2A 5M3BA 1B3BA 1YC2A 4B33A 1Z0AA 2JFFA 2VS1A 2WT9A 2IVZA 3D7RA 3DZKA 5H83A 2XGOA 3RASA 3VR6D 2GEDA 2OK7A 2X9LA 3BZUA 3HA7A 3U49A 2RC5A 4E5KA 2QZZA 2D2EA 3F6RA 3OIGA 3LQQA 1VSQA 2XQIA 1XFDA 2H7YA 3VPBA 1XWIA 3BWCA 3DL7A 3ED1A 3JD1A 2PD6A 1CKEA 4CM8A 1IMOA 3TL2A 2H1CA 2V74B 3ETCA 3SSMA 4BGEA 5KKCA 2OO5C 4BWGA 4X60A 4Y9SA 1TCUA 2IU0A 2Y66A 1WP9A 1WDWB 2O1EA 3FPSA 2PKEA 3HGQA 3OQ6A 4WBSA 3WL4A 3LLVA 2Y77A 2VC2B 1VIMA 2H17A 3DUWA 3KB6A 1B76A 4RD3A 2EVWX 3F5SA 4UPEA 3JQGA 4EFLA 4UD6A 5IH7A 4JITA 3EXIB 3PCRB 1VMDA 4UNSA 4XVQA 4LZJA 1F2UB 2GN6A 3KUDA 3RGWS 4RHUA 1JHPA 2QGNA 1XXHE 3WWCA 5KQPA 1EJ2A 2IIPA 3CCCA 1QIIA 2LDXA 5LQNA 1BQEA 4TQUS 3QLTA 2HRRA 3ESDA 3HWRA 4M76B 4QBGB 3R5KA 3NP7A 3T54A 1F1JA 1Q7GA 4ER7A 2YS7A 3KR2A 2QRGA 2OFFA 3U37A 4XEHA 4AC9A 3NV7A 2R4QA 1JH8A 2QUAA 3EXHA 4AU1A 2WIJA 5IVHA 2R1TB 1L1RA 3QMMA 1MFZA 1CP2A 2M1ZA 5T67A 5JR3A 2PGOA 5F51A 2EWMA 5T5QA 1NNEA 3CWQA 3AI1A 4EHKA 1DC4A 1HETA 3RFCA 1IHXA 5FOQA 4I55F 1I6WA 2KI5A 1UZLA 4MQEA 1Q7CA 5BR4A 3D1JA 1T2VA 3SHFA 2P6OA 3RSFA 2IYZA 5INTA 1WP4A 1DDGA 5A3VA 5J4HA 1O95A 4XB2A 5AJHA 3RTDA 4KRGA 1N0HA 4IKPA 3MJFA 5JZ9A 2I2WA 4LF6B 3KTDA 1XVAA 1W2GA 2VP4A 2A33A 1FBNA 4Q9AA 2WWYA 4IOLA 4UTNA 1T1SA 4JC5A 2TMGA 3OX4A 4YQYA 3IAUA 4Q7KA 4M54A 5JBQA 2AYYA 1IN5A 4ZZ1A 3DYIA 4H4EA 3W0LB 5JMOA 3TW8A 3E61A 5DCLA 4DB4A 3PJDA 1WXWA 4IBOA 4KACA 2X2FA 3IEIA 2W98A 3NWBA 1A88A 3SQOA 2H7VA 3KHTA 8MHTA 1XDBA 2VYFA 1R16A 5I7RA 2AN5A 3I34X 5LMCA 1BJKA 3DTYA 1IN8A 2Q50A 2Y1KA 5A4DA 4KFCA 1I2CA 1X8KA 3BMNA 3KEGA 4LJRA 3UK6A 3UT5A 1X94A 1ZN9A 3T5TA 3WNBA 5C52B 1RPZA 3ISTA 2BHNA 4ZQBA 1N2ZA 3CBGA 1OYWA 4GRDA 2IEBA 4F06A 5HIKA 3COVA 1PLJA 1I9GA 4BEWA 1LBSA 1ZJ6A 2NUTB 4C4PA 5LIPA 1TUBB 2I71A 3C4QA 3KTAA 4P3XA 3UEOA 4BMZA 4L22A 2L82A 2CCJA 3N28A 5EG5A 2H16A 2Q3MA 5HA5A 1E2FA 2JI6A 1LSSA 1TYEB 3LE8A 3PRJA 4OXNA 4BRUA 5AQ1A 2E21A 2ZJOA 2JLUA 4YNBA 5EWMA 2YWGA 1CUIA 5TDHA 4V24A 5J1SB 1SK8A 3L6DA 2EJCA 2J85A 2A5FA 1PYDA 1IHOA 4BVJA 3RRXA 3KZ1E 2FR1A 2ZRLA 1W30A 1CJTC 1UODA 3JASA 2KQUA 4QUAA 5JCOA 4TV8F 1XAHA 3BFKA 1AGXA 1EXNA 1RHQA 5LZ5A 3KE8A 3DFUA 5EZYA 3TO5A 4EB3A 1XTTA 2DUNA 2EYUA 2NV0A 3KOZA 4GPTA 2FFQA 1EINA 4HYEA 4PO3X 4QTZA 5CK5A 2QAIA 3JSAA 2GGSA 2QL7A 3G1UA 1NWCA 4Y1RB 3DDNA 1E0KA 1G0NA 1QH9A 2Q7OE 3STUA 3HFRA 1EWYA 5KSWB 1GPWB 4AKIA 2YJ4A 3R5XA 2O5CA 1EQ2A 3MUNA 3C85A 2DETA 1AO0A 3EOAI 2JANA 2YY6A 2W6CX 3NGMA 3GMSA 5JMWA 1NQAO 2HHLA 1AU9A 4J16C 4KAAA 4DMFA 5I6DA 4LJ4A 2I65A 2IS4A 3DKIA 3E1SA 1NQTA 2LBPA 2CE2X 1AQ6A 2J8ZA 5DISB 2YOHA 5F4BA 1AXEA 1DMSA 1P74A 3C39A 1TZ2A 5FBKA 3T5PA 3A9RA 4J76A 3O8OB 3ROZA 1Q7TA 1JS1X 3C3EA 3OTIA 1GGEA 1T8YA 1WSBA 4TRMA 5IX8A 1T8SA 2GYVA 1SY7A 3GJXC 1VHTA 4JB2A 2GA8A 2QZ9A 2V7TA 4HQLA 5FTNA 5JD5A 1SXJE 2AB0A 2GARA 2C82A 1GGVA 4D8VA 4EX6A 1WXEA 2WLSA 1Z08A 5IDVA 3EHDA 2XDQB 4IJWA 3EC7A 3I6ZA 3L79A 5TS3A 1GZ4A 3W2IA 2AFIA 1QH0A 5C5DA 4LX0A 4P1ZA 4UMFA 7YASA 5BPHA 2AUNA 4ZI7A 3WGUA 1IUKA 1A4UA 3EXEB 3OFJA 1BC5A 2HWYA 2FMUA 1FXWA 1HK7A 2W71A 5L3ZA 5IABA 3DGEC 4XYMA 1P3JA 1P5FA 2BFEB 3C7KA 2I3BA 2DSNA 3NTQA 1G5HA 3RYIB 1L7PA 2R8PA 1XCMA 2PWZA 2Y1LA 3K70B 4KGXA 1NKVA 1ZGGA 2ZWOA 3IUYA 3WNZA 5C53B 4BQQA 4D6YA 3KEMA 1QLHA 3IT1A 3NHSA 1CB7A 5C4GB 1D2CA 4QXPA 2FEPA 3NORA 4QRIA 4WW0A 1G6KA 2ZJYA 3TFOA 3VPHA 3FOZA 5HUHA 2D4HA 4G5XA 1Y5MA 2FCAA 4UUMA 4BKOA 1JR2A 2C95A 5C3MA 5K8UA 1IPFA 3C3XA 1AHNA 1IC6A 3G2PA 5ER9A 4JCCA 2OHJA 5IEJA 4DB2A 5L4NA 3BDIA 4P08A 4L1KA 3DDHA 4Q4DA 1NSFA 1V1JA 2GJ4A 2B8JA 3N2KB 2ZSUA 4BTEA 5TLSA 2H3HA 3BHMA 3D6AA 3UK1A 2ZRBA 2IV3A 4BB6A 4YRSA 1O94A 1ISSA 2HJSA 2VHZA 2ZB3A 2VSQA 4GC9A 2ZAIA 4W8HA 1P39A 3PF8A 3PJFA 3RI3A 2CL0X 4WKNA 2AFHB 5TGDA 1WB9A 3OM1A 4QNMA 1ZJ5A 3GHYA 1GPMA 4R2JA 2X5KO 5CX1B 1LQUA 1UXHA 2EQBA 4KN5A 3THWB 1UDWA 2HF2A 3P27A 1F2VA 2P6UA 3E7WA 2V45A 3KWJA 1P5RA 3MJCA 4M1KA 3WWEA 2JVKA 3OOEA 1UH5A 1UMCA 2O8NA 1FUYB 5TB5A 1WLYA 3BTOA 4V2IA 1F5SA 2GCPA 2RGAA 5LJLA 3CNOA 3PC3A 5J2TF 3OEHA 4KLNA 1AZLA 2NU8B 3VO8A 1P2GA 3RNLA 4KR6A 2AIRA 4GM0A 1DWUA 4D82A 3T95A 4RTMA 4EI7A 5EPUA 1U81A 1YK1A 3ZD7A 1YD7A 3LQ4A 4IIJB 2OG1A 4HSEA 3ZGNA 1ZMXA 1LD3A 4BFXA 3O3MB 4FYIA 5JYEA 4WZBA 5CT6A 4A3SA 1GZDA 3L05A 1FEZA 2FE1A 2NN3C 3OLCX 3HYTA 1SOMA 1YCDA 2IHJA 4Q02A 2WABA 1DRWA 3COPA 5GONF 3VMMA 3CRW1 1UUFA 4I46A 1J2JA 4AKSA 3EQ6A 2NUAB 4HH3C 4NVRA 3WLFA 1VHDA 3P94A 5JSQA 3EWNA 1E9CA 4MI3A 1QGZA 4YI5A 4JYZA 4H31A 3B8HA 1ULUA 1V35A 4BQFA 4HRVA 1Z6AA 1IZ8A 2GZ3A 3I3SR 2IA5A 2J4DA 4V0SA 3WX0A 5GZ3A 5HIMA 1WPQA 1D6NA 2PKYX 2ROQA 5LYJA 1LZLA 4J4BA 4U9IS 2FVYA 5CNJA 3LECA 1R12A 1SB9A 5NLLA 3PQ4A 4RHYA 4LN1A 4B2PA 3EEYA 1MXHA 3QKSB 4KIUA 1VRCA 3TQIA 1EM6A 1SZPA 2UYCA 1KDPA 1BVYF 4HDNA 4DNOA 1SG9A 2GN8A 3CG4A 3OD1A 4NZOA 4MWOA 3HGTA 5JYDA 1M2WA 1QHIA 1CF2O 1YJAA 1MVLA 3IGFA 1Q77A 2C88A 1H3EA 4EM6A 3WGKA 4MHTA 4IIVA 5KB3A 4Q93A 1GYRA 4ZJYA 1U2EA 2HJHA 4JBGA 1WMEA 1YVPA 1L5MA 4CTJA 3ZXYA 5KVCA 4QQFA 1YCHA 2Y1DA 3SHVA 5ICGA 3ROXA 2OM6A 1CZHA 3FGOA 3RUEA 1DCMA 4OQMA 4PFKA 3MYRA 4QYIB 1DE0A 3P9PA 2ZYUX 1J9EA 1CNEA 3BRSA 4RDHA 1QGOA 1TYBE 6GPBA 2HSZA 1QO0A 2ZPAA 2C78A 3TTVA 1Q19A 2P5TB 5FOTA 5KTYA 1IVSA 3K16A 2A9PA 2ZAYA 4L9SA 1FPQA 1BWRA 1KO4A 2CHQA 3DE7X 2PYIA 1NHWA 4KE6A 3W6NA 1BMTA 4IZIA 4D8XA 3L4BA 1GPNA 2IHUA 1OIWA 1IOVA 2PT5A 3PUHA 2O2XA 4H9GA 4I50A 1G7SA 4YWHA 1T15A 3FSEA 4ZQCB 3ZIUA 4UFPA 4MV3A 2ZWAA 4JLJA 1E92A 2GZHA 1JBKA 1M8KA 4QICA 5KJ1A 1PKXA 1VE1A 2Q0QA 2GXAA 1U3FA 1OILA 4ZTBA 4EJ6A 1RIIA 4DM3A 4H6VA 2HF7A 3GFPA 1VRWA 4YIKA 4YT2A 2HF9A 1EE1A 1UK8A 4FE3A 4KBFA 4ZJZA 4FNOA 3ZWQA 2A1UB 2Q6OA 4MKRA 1HDZA 3IPXA 2NSHA 3K8QA 4EARA 3CPJB 1VLVA 5LQCA 1CUYA 2JVJA 1SUPA 3J81A 4UE2A 1NDQA 2DUJA 5KJEA 1C9NA 1H23A 2QVLA 2VF7A 1UM9B 1V25A 1NUQA 3GVPA 4OA5A 4CM9A 1E77A 5E6SB 1T0IA 2XYGA 3M4JA 2VJYA 5FWYA 5B37A 16PKA 3Q6NA 1DLJA 2HRDA 4QU9A 1ZKMA 2P2NA 3E3OA 5JU6A 2YOGA 3TXAA 3V4FA 3AR7A 1A5BB 3SC2B 1T8RA 5JDCA 5KS2A 1CUZA 2AFHE 2I4LA 5ELXA 4FHGA 2GJSA 1K1EA 1M6VB 4LOLA 1BQ3A 1PL6A 4DA0A 3UUFA 4HD8A 3V8MA 2QYSA 1LNQA 4LMPA 4G67A 4MAAA 1E5XA 4C7VA 3EVAA 3L0ZA 1OT5A 2R6ZA 4DEYA 1WZCA 4C6TA 1FS5A 1L0BA 2CY0A 2WIBA 2MJLA 3UJ7A 2ZDGA 1FFXB 4D81A 5DXFA 3WO0A 5J4LA 2WPNA 1YFJA 3TLXA 2GCOA 2XF2A 3FM9A 4I5IA 3RIXA 1VBKA 2MINA 5IWAB 4JROA 3K9CA 3HWX1 6Q21A 1GSHA 4L6IA 2J6BA 1L4GA 3L8EA 4WK6A 1SU6A 1L7DA 2ODNA 2PFGA 3TLGB 2F6RA 1Z0KA 5BVGB 3N9IA 3IJEB 1E9RA 2PDAA 3NIFB 4NBRA 4ZI5A 3R75A 4MQMA 4P98A 4CLRB 1LVGA 2PSFA 3LRTA 3U1VA 3WHIA 2AUMA 2HB6A 5HM8A 3O6VA 3WGLA 4HWTA 9LDBA 1ZD9A 3DKKA 4MWEA 1X77A 3RVBA 2FW7A 3WWOA 3FYHA 1JDZA 1GT91 2PKWA 3G5AA 3W9BA 1Z37A 2V0CA 1XVIA 4ZT3A 4XVRA 5NULA 3GZNA 4BGUA 2WLTA 2Q8QA 2Z8YA 1FFDA 2E9SA 3B6EA 4NS1A 4UHEA 5F5XA 3UBMA 1RACA 3IOBA 5K8IA 2X0KA 5G0WA 1I4TD 1AUVA 4HDSB 1T5IA 2Z4SA 3C3YA 5JC8A 1T6BY 1C7EA 1XE3A 2JC3A 1G291 2O0LA 3QBEA 3IILA 4MSUA 2OCAA 1U9IA 4B7CA 1T0UA 2ZSEA 3L7MA 3S70A 4W9RA 4X64B 3K0FB 5JMTA 4MMYB 1VJRA 2PUJA 2NGRA 4H16A 2O0MA 3GGJA 4A92A