3PEVA

S. cerevisiae dbp5 l327v c-terminal domain bound to gle1 and ip6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
180
structure length
178
Chain Sequence
AIKQLYMDCKNEADKFDVLTELYGVMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 60
structure length 178
sequence length 180
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pevA00
5KHOC 1CJKC 1Z8FA 3EIHA 4AYWA 1E2JA 2WPDD 3SFZA 2A30A 1JXOA 3VKWA 2IS2A 2ZJZA 5SZIA 1T5LA 2WM9B 3L0SA 3K70B 2EFCB 1RPZA 1XEXA 4GMDA 3RLFA 4M1MA 4RZ2A 1GL7A 2DPXA 2GJ9A 2AD1A 2W2XA 2W6JA 4FCWA 2RGNA 3AKDA 3L0IB 4JBYA 4UNPA 3RRMA 2F3TA 3CPEA 2ZANA 2G1JA 4LJ8A 2XSZA 3IIKA 1SVIA 1CR4A 4LWZA 3AM1A 3J81k 3HU2A 2ANBA 2ZVPX 1NN3A 2AWOA 1HYQA 2GEVA 3A4MA 3B6EA 1G7SA 4B2LA 4UXJA 3RS7A 3TLXA 1ZM2A 3FFAA 1E0KA 1V43A 2QSZA 4BUJA 4PTLA 1KSHA 2QI9C 1NMXA 2FPKA 1Q3TA 2FX3A 1JJ7A 2IC5A 421PA 1XNJA 3AVYA 5JEEA 1NI3A 3KUCA 4XTRA 4YDSA 1HT2E 5KSOA 2NGRA 1S1CA 4W5JA 2ASEA 2H16A 5AK0A 5EXSA 1NVXQ 5JHHB 3RVBA 3ZJYA 1G6OA 5DN6D 3U7HB 5DYGA 3ZQ6A 2IYQA 1N2CE 3E1SA 4GZMA 1OSNA 4GRAA 1U8AA 4AG5A 2OLJA 1MO3A 2XZLA 3PUYA 3R20A 3GLIE 3I3SR 2W0SA 1NBMA 4KBFA 3HR8A 1M2OB 4LC1A 1P62B 4HYYA 2NZJA 2O8DB 3DPUA 1G7TA 1N0WA 1RRGA 3A37A 1IY2A 4MYHA 2XB2A 1GRRA 2WMOB 2IS1A 3ETLA 4M0LA 4HATA 4PPNA 2QBYA 2AK3A 2YWGA 1E9EA 3QQ5A 1VECA 4TN1A 4Q66C 5H70A 1S3GA 1KTVA 4ESVA 3THWB 2J7PA 2LKDA 1UBGA 1F48A 2SHKA 3C41J 4OHWA 3ADDA 1Z3IX 2GJKA 4DJTA 1BO6A 2HT6A 4GBMA 3PVSA 1QVRA 3NKVA 2IYTA 1NSTA 1QF9A 2QNRA 1U98A 1GL9B 1MKYA 1I4TD 2WSSD 2A9KA 2ZU6A 4WZAE 4AKEA 4HB4A 2PJRA 4AKIA 1P72A 4R7ZA 2CMKA 1UJ2A 3ZGXA 4NL4H 3ADCA 3LLUA 2HCBA 4CGZA 1G16A 4UJ5A 1P6XA 2ZI7A 4C2UA 5CJ2A 1F5NA 2JLQA 5DE3A 5FUVA 3BH7A 4C2TA 2J0QA 1UBCA 2WTUA 3QPUA 3V4FA 3KB1A 3NDPA 1DARA 4TQ9A 5CDFA 4Z54A 1S96A 4JJZA 3VFDA 1G291 4URVR 1ZNXA 1JR6A 2RGAA 3CRMA 3IPYA 3KKNA 2C04A 2CE7A 4AURA 2EFGA 3EPKA 1BMFA 3EIQA 3SOPA 4LUCA 1K8RA 3OIUA 2HF8A 4RKEA 5LDDC 2ZRNA 3OE7A 4NMMA 3A1TA 3BH6A 2VP6A 5AJZA 2IF2A 1II9A 3WHKA 4PQYA 4Q47A 1ZM3A 4MRVA 4IVPA 4I1UA 2QGZA 4A9AA 2PX3A 3VTKA 4C4PA 5HZKA 3QOFA 4NPHA 2GJSA 4QGFA 1AM4D 1NG1A 1E2NA 3O8DA 1RVDA 3ZH9B 4DXAA 1TQ4A 1G18A 1O87A 1JALA 1P61B 1NNEA 1E79D 1L4UA 1M34E 2OCAA 3BB3A 1SXJD 2ECKA 1W4AA 1XDBA 2RGCA 3CW2A 3PCRB 3GFOA 4LPKA 2AL7A 5F2EA 3C5HA 1WMSA 2ZUBA 5GJBA 1D8TA 2FMXA 5AWFC 2JCSA 2ZRHA 4G5SA 1CBUA 2JIZD 4JSYA 1N5IA 2WSSA 2OAQ1 3VHXA 4IDHA 1XEXB 1NN0A 2PEYA 3I8SA 5H8WA 5JWHA 4PSKA 3RRNA 1WA5A 4Q03A 4TMVA 4Q9KA 4Q4LA 5G53C 2R65A 4RD2A 1E2PA 2NO9A 4K81B 3GLGA 1Q20A 3CKLA 4KODA 2G77B 5J4YA 3NVAA 3ADBA 1KI8A 1JR3D 2I1QA 4LBYA 1P4SA 4ON9A 4XWKA 2QTFA 4IEEA 4FMBB 4H9GA 1JJVA 2DFNA 2VHTA 1SGWA 4A8JA 2CVHA 3IKJA 4ZIRA 3H84A 3BJIC 3EWAA 2IUSA 3ONWA 3EZ6A 4A8JB 2ORIA 1N6KA 2AFHE 2PMDA 3IQXA 4B33A 3MSXA 2DR3A 4A8JC 2HF9A 1U0LA 1EX6A 2BKEA 2C9CA 3CBQA 4JVNA 4Z1MA 3T1QA 2QT1A 1VKJA 5EZ6B 4LSGA 3QXXA 2MMGA 2NO1A 3WYFA 3K0AA 1WB9A 3JZMA 5AUOB 4RCYA 2O8FB 3A1WA 4M1OA 4P4SA 2O52A 4Q48A 3KL4A 1OXTA 1CTQA 2O8CB 5M04A 2CHVA 1EFTA 1IN4A 3RRZA 1DPFA 2IUTA 3AGPA 4QL3A 1E2QA 1D5CA 4PC6A 4JSTA 3NBXX 2PZGA 3SJAA 2JJ2D 3FMIA 1HY3A 2P5TB 4ZDKA 3SYLA 1AK2A 4L4UA 5AJXA 3VR3A 4L9SA 5JEDA 1DAEA 3KQKA 1ZC3A 4XSGA 1AA9A 3L0PA 4EJSA 5CB6A 821PA 4A2QA 1Z08A 3X1WA 1XB2A 2RGXA 3AF1A 2IYRA 2F1HA 2WOJA 1QHIA 2PCLA 5BXQC 2OXCA 4B44A 2FZ4A 4YMWA 3RS3A 3A6PC 4Q9IA 2ZS7A 3R9XA 2ZRPA 4HAUA 4JT2A 2IWRA 1Z2CA 2CLSA 2X1VA 3I5YA 2D4HA 3ZYCA 3P1JA 3AVUA 4ZI3A 2F3RA 5JRZA 4ZIRB 3NH6A 5AJYA 5C4MA 1P5ZB 4ZCMA 3SBEA 1MABA 3FHOA 1A5TA 4ZDJA 3K0CC 5LB2A 4B3CA 2WWGA 4IFBA 3W5IA 2Z0MA 1D2EA 5J4LA 1W4CA 4A0FA 1II0A 1WF3A 3CIOA 3NG1A 2VIIA 4FCVA 2WWFA 4GNKA 1JBKA 2IHYA 5BYKA 2BIFA 2RMKA 3EW9A 1SXJB 2YHSA 4AWXA 1VG8A 3B2EA 1EFUA 3AKYA 1CJTC 4DCNA 3K09A 3BFKA 4G5QA 4F4CA 4U5XA 2O8DA 3B78A 3OAAD 2V55B 4M1YA 3ZVLA 4RD3A 2HCJB 4JL5A 1W44A 2IEYA 2OCPA 3ZDQA 2OCBA 1UF9A 1IBRA 3A36A 4Q1BA 5HE8A 4C0LA 5DIFA 4MKGA 4PHTA 3VR5A 4PSAA 3SJZA 3VR4A 4HAXA 3RS5A 3HR7A 4GP6A 1F2TA 4PHGA 1C9KA 4HUQA 4PO9A 4CW7A 1DAIA 2OBNA 2WJJA 4ASUD 3OIYA 2ZJBA 2GDJA 2OFOA 5BWMA 1ZP6A 3CX8A 4QHYA 1FTNA 1AIPA 4M1KA 3KFVA 1VCMA 4NZYA 3DZ8A 3TVDA 4DEXA 4P4TA 3LNCA 2R44A 4TTPA 3GMTA 1GKIA 3T1TA 4Q7JB 4ILEA 1GRNA 2VHQA 2WJGA 4U7DA 4ARZA 1P3JA 1X8JA 1GKYA 1ZINA 2JLSA 4FINA 2ZUCA 3SYKA 1C1YA 3A1UA 3CZPA 3RHFA 4GPTA 4GDFA 4F7WA 3HP1A 1OT3A 1E2GA 5C46F 2QMHA 2X77A 5L3QB 1I4DD 4M9XA 2QY9A 3ZZUA 2B6HA 2Z83A 5FPKA 1Z6YA 4A36A 3RDPA 5TMPA 1KZ7B 2YWHA 1HH4A 4AKGA 2DWPA 2G88A 2P0EA 3QG1A 4XH9B 3S1AB 3WBKA 3GLFA 3TKLA 2CL6X 5KDLA 5LBIA 1YR8A 4Q1FA 4JYBA 3CLVA 4GT1A 4BE7B 3NBYC 2IYLD 2ZJ5A 2VP0A 2P6NA 1RFLA 2EVWX 1GAJA 2VP5A 3RS4A 2CNWD 2LCFA 4RJLA 2GZDA 1Z0AA 5JWRA 2G6BA 2XX3A 1NMZA 3D6TB 4Q4JB 3U61B 3OE7D 2EW1A 4PC2A 2JEOA 3C16C 1RC8A 2IBMA 4PPFA 3VR6A 3TRFA 1LV7A 3DMNA 3OFND 3N5CA 2XEXA 4DUGD 1E2EA 2JIZA 5EP2A 4ZDWA 5JMTA 4Q1EA 2A5GA 1VYTA 1VYUA 4C0AC 1T3LA 2ZI9A 3IEUA 4YLGA 1DAHA 1NP6A 3AF3A 2ZE5A 4BFTA 3TR0A 6Q21A 2OCYC 3G0HA 3RRYA 4C30A 2XITA 1MR3F 2HXYA 2ZE8A 2AKYA 5LB4A 2EQBA 3UWOA 1W0JD 3ZVNA 2F6RA 2OT3B 2A3RA 1E0JA 5JSZA 4JBWA 2O0KA 1K5GA 1EFHA 2YZ2A 3P4XA 1W36C 3AP1A 2WKQA 4LJAA 1EGAA 1RJ9B 1XD2B 2FFAA 4DCUA 2V4ZA 3A4NA 2O8EA 3FB4A 1VPLA 4ACAA 3S1AA 4MUAA 3EIEA 4FMDB 4LJ5A 3PG5A 4LJ4A 1MV5A 3LX5A 2QP3A 1DO2A 1NKTA 4P0TA 5FUWA 4D0NA 4OHVA 1E0AA 2C78A 4B3XA 4BLTA 2O5VA 3VNVA 5KSYA 2X19A 2ZU0C 1XJCA 4Q1DA 4ZCLA 3HWSA 1J7KA 4CVNA 3C4JA 4NYJQ 2FSIA 3MG9A 1VCNA 4JLNA 1CJUC 3KXKA 1Z06A 2XTMA 4MYUA 3ZZTA 2PMKA 3NHBA 5D3MB 2PT5A 3UKDA 3KJHA 2W83A 1WE2A 1BKDR 2TMKA 2X2FA 1XCPA 5G3YA 2DCUA 2DFLA 5JI2E 1XMVA 2P6UA 3B1YA 2AFIE 1XJQA 4MGKR 1FUUA 1KI1A 2JA1A 4XVQA 3DKVA 4XOIA 2GNOA 2YOFA 3RNLA 5GJCA 5CM8B 5IDVA 4II7A 5GVRA 4OHYA 2D2FA 1RRFA 2FPMA 4M1TA 1E0SA 1CEEA 1J8YF 1P73A 3Q7PA 2HLDD 2WAXA 4LHYA 2WJIA 2YC2C 3U3MA 2QPAA 5H68A 4RZXA 1G8FA 1NKSA 4NBSA 3TVTA 3U44A 1XFAA 4Q4AA 4NE2A 2N46A 1II8B 5TDHA 4KVAA 2BEJA 2F7SA 3CNOA 2IEZA 4XJXA 3GLGE 2RHDA 5DH9A 1NY5A 2O8EB 4AKHA 3CF6R 1DAGA 2ZRBA 3CH5A 2CE2X 1Z6AA 2IHBA 2OBLA 4P31A 5TXGA 1ZUHA 3IHLA 4IVRA 3M6AA 2O8BB 1OXXK 5CLQA 3DEFA 2WMNB 4CEHA 4PAOA 4LJYA 4URZR 3F0TA 3AQ4A 1XJ0A 3REFA 4ZV4A 1NIPA 1VG1A 1CR1A 3PEUA 1PZNA 3THXA 3AVQA 1KK2A 1XWIA 4W9MC 1RW4A 1TTTA 1N6OA 5B64A 1W5SA 4LGMA 4V0LA 2FPLA 3CF0A 3OIWA 2AR7A 2GJAA 3AUXA 5DLQC 2IYSA 4WVFA 1YR9A 2FSGA 2KE5A 4IOMA 3AVPA 3QKRB 3DOEA 1VCOA 4QOSA 5FPYA 1XPRA 4AY2A 3PEYA 3FKSD 1GILA 4B3FX 3TUZC 3THWA 1Z6TA 1YZLA 4MRPA 1OXVA 2OFXA 4E07A 2NPIA 2F55A 4RD1A 4HLUC 2NQ2C 5EE3A 1NL3A 3LO5A 2X8AA 3KB2A 1U8YA 5KDDA 1HQCA 3WMGA 3H2YA 2GEUA 4BFXA 1W46A 2Q9BA 1S2MA 1ZD9A 4CEJA 2VF8A 1KJYA 1ZNZA 2PCJA 3TNFA 1X6VA 5FI1B 1T3HA 1RRPA 2XNDA 4US1R 5BN5A 1VG9B 4I99A 5DI3A 5FI0B 2CLCX 1SZPA 3QNUA 4C0QC 2CVFA 3QVVA 2PJZA 1L8QA 3GJ7A 1F60A 4QC2A 4DSNA 2ZSAA 4LI0A 1G19A 1J90A 1YHNA 1XF9A 4UNNA 2NPFA 1PVOA 1KMQA 1GTVA 3R9WA 2XSZD 3QKTA 3K1JA 2Q21A 4CT5A 2F1RA 1TUIA 2JGNA 3L8YA 4U00A 1LS1A 1EG7A 4QFMA 1U2RA 2WWIA 1Q44A 2V3CC 3A4LA 4EFLA 1XD2A 4Q02A 2DWOA 1Y3AA 1KK1A 5FL7D 4DWJA 2EFHB 2QENA 1Z0IA 3B1WA 4HDOB 4IDQA 2WZQA 4BEBA 1E9AA 2GK6A 3T1VA 1IN7A 2PLRA 1IOZA 4LYHA 3RSLA 1S4QA 1E9SA 2XJ4A 3SEAA 5JCZA 3W6PA 1S9HA 4AC9A 2RGBA 1MO6A 1XD9A 4HAWA 3ICQB 1KI4A 1MRNA 4KLZA 2BWJA 1UKZA 2FH5B 3IBYA 3U5ZB 2FF7A 4WAUA 1P75A 4YONB 1SVOA 4TZ6A 4Q4JA 1R5OA 3SC3A 2NOAA 1R0WA 3D7MA 4G3XA 4IDOA 2QP4A 1A7JA 1KGDA 1JEEA 2ZRFA 4AYXA 5JRJA 2CEAA 2EFDB 4TT3A 3FFBA 4CDGA 4NCHA 1MOZA 2FFBA 3EPLA 5D3QA 1UADA 1DTSA 2BEKA 1OXUA 2JLZA 1Q3HA 4DLXA 4HLDA 4G5RA 4HUQB 2C9OA 1DE0A 4TMWA 3RSOA 3QKSB 2ANCA 4PC7A 4OK5A 5CYOA 3N2EA 4E03A 1NG9A 1WDTA 4QM7A 5L3VA 4KLNA 4YDHB 3BERA 3QPWA 4PC1A 4FCTA 5SZJA 3KKPA 4URYR 1OIXA 1XTSA 5EP3A 2CDNA 1HA3A 4LV5B 1M1YE 4X8OA 4DCSA 1EFCA 2OESA 1CP2A 1DS6A 2KJQA 4ITRC 4QBIA 3I1FA 3W90A 2VSXA 3LA6A 4UNQA 3G82C 5KUTA 2BMDA 4NYJR 1VHTA 2GCPA 2UVQA 3TUJC 2RKOA 4RZ3A 3MLEA 3EA5A 1R0ZA 5CIWA 3Q5EA 1RJ9A 1G17A 1C4OA 3KXIA 4TYNA 3BXZA 2IXEA 3NIBA 3QEOA 2RGNC 3QI2A 3CF2A 4ZO4A 1L4YA 1QHXA 2R62A 3PENA 5CM9C 1G8YA 4I4LA 3ASYA 3LVRE 3MD0A 4Q01A 3CZQA 3DOFA 5FBQB 2FN4A 2ZS9A 1NJGA 5L8VA 2C9YA 2ZRDA 1OLOA 1E2LA 4PAMA 1I2MA 1LY1A 2QAGB 2KI5A 1U0JA 3I92A 2J45A 5KPJA 1RRCA 3OIVA 1N6IA 5AUPB 4HLQB 2CLDX 4DLUA 4JVMA 2AWNA 2CBZA 1SKQA 3SHWA 4E09A 3CWQA 3GEHA 4LHVA 3FOZA 1G9XA 4KHZA 4E22A 4WIAA 1UDXA 1IY0A 4JT4A 3BWDD 4JLPA 2JJ1A 5AR1A 3TUIC 2IYVA 2YWEA 4KFTA 2ZQ5A 2ZXUA 1YE8A 3NC1C 2ATVA 1IHUA 1T6NA 2PBRA 2XB4A 3V00A 4ZI2A 2VSOA 2P3SA 2NO6A 2HV8A 2ZSDA 1N6RA 2IXGA 4UJ3A 3Q9LA 2XXAA 4A82A 4FIDA 1Z28A 1KDPA 3AVWA 3T1OA 1HTWA 2WKPA 1IY1A 4WOPA 4XD7A 5H1YA 4GOXA 3T34A 1OJLA 2G0NA 2ZJ8A 3F3YA 4OI2A 1KY2A 5GADl 2F1IA 2CK3D 4NU0A 5HTKA 1N6LA 1P60A 1XTKA 3SQXA 5L3RA 3RYTC 2C03A 4BFWA 3DDCA 3BOSA 1NVVR 3LW7A 1GIAA 1OFHA 3T06B 3LBNA 2V9PA 5L3QA 3CX6A 2HUPA 2ZR9A 2PH1A 3Q3JB 3MFYA 2ZROA 1R8SA 1XTQA 3K53A 4FMCF 3U3RA 1G5TA 2DYKA 1AZSC 1FQJA 4XVUA 4PHHA 3LDAA 2CCKA 4NTZA 4OL0A 4BRWA 2VO1A 3LFUA 5JHGB 1IQPA 3THXB 1K5DA 2JLWA 1LS6A 1MO5A 1E94E 3TJZA 4PQFA 1A2BA 3KTAB 1W4RA 5LD2B 4BASA 3CX7A 4V0KA 1WBDA 1KI7A 1Z83A 5AUQA 4PANA 4CYMA 2KB0A 4W5HA 1PLLA 1T0JB 1FX0A 3QKRA 1JR3E 1KZGB 5G40A 1WQ1R 4RSGA 5HE9A 1FX0B 4DT1A 4Q7LA 2W6ID 4MYCA 3U3OA 2R8RA 4FD2A 1TMKA 2QA5A 2UZ3A 4PZZA 1W49A 4IOJA 5A5GA 2F9MA 3OEHD 4ZKEA 1ZVQA 4A1FA 1IXZA 2QL6A 1M7BA 1Z63A 2D06A 4IEIA 1OH6A 1UBFA 2R6CA 2H5EA 1R10A 2R6DA 5G3ZA 3ZD6A 1NSFA 3WRYC 3EX7C 3WP1B 1BMFD 1IXRC 4N3NA 2XXAB 2NTYC 3VU9A 1WRBA 3GLGB 3BC1A 3FMFA 4S35A 3PFIA 2D2EA 4YMTA 1Z47A 4K46A 1E2FA 1G3IA 2HEIA 2GCNA 5CK5A 1HUQA 1PV4A 1G5RA 3QF4B 5KU1A 4A2PA 2YOGA 3KJGA 5AJVB 4I81A 2QM7A 2YV5A 2XZOA 1UAAA 2OBMA 4B2PA 1Z6GA 4EQ6B 1T4GA 1T8TA 3RABA 4TTRA 2IYWA 4QG7A 2JASA 1OYWA 2OG2A 4D6PA 1CF4A 3EC2A 4I1VA 3HDTA 4MKFA 3THYA 3TSZA 3CB4A 4C3ZA 2FWRA 2BV3A 2GCOB 2E1RA 4TMTA 3R8FA 4HB3A 1E6CA 2QTVB 1GNPA 3HU3A 1G3UA 1OKKA 2ERYA 4H1VA 3BORA 3QKUA 1OV4A 1AKYA 4A6PA 1LTQA 1QVAA 1M7GA 2WPDA 3CWZA 4IVQA 4J0QA 4LDJA 1I4LD 5EE0A 3TSOA 2QAGA 3WRXC 2ZRMA 2ZEJA 1R0YA 3ZIAD 5E3HA 4BGDA 2PZEA 5FPSA 1ZD1A 5JJIA 2CL7X 4LJ7A 1UFQA 1JR3A 4FXPA 1T9HA 2H92A 4X8HA 3UPUA 2GVDC 2BCGY 4MGYR 3FDIA 4D0LB 5BN3A 3EA0A 2BHRA 3R9IA 2DFKB 3SU8A 3TQFA 3OESA 1D9XA 2OUKA 3GQBA 1G20E 4QXAA 2HJVA 5K8LA 1SXJC 4JVSB 1IJFA 2W6JD 3A8TA 3DHWC 1XEFA 3JZAA 3W5JA 4Q7MB 3RS0A 1JQJC 3VHLB 2QT0A 2FG5A 3WNBA 4TLEA 4RD0A 2EWVA 5GJWC 3UWKA 1UBEA 1Z22A 5F9FA 2GVZC 2ZI5A 5FOUA 2IS4A 3GJ8A 5E95A 4TYQA 3QBTA 4WXPA 4DLSA 4QBGB 2GXAA 3K9LA 3HPQA 4B71A 2GCOA 4JJKA 4P4UA 4OYHA 3CM0A 5DISB 2VYFA 1AS0A 5FTKA 5FTLA 1KDTA 3BIFA 4A0RA 4LYAA 1Q1EA 1BYIA 2QPTA 1PLKA 2A5JA 3CONA 3V4RA 2WAYA 4D80A 3SR0A 2O8FA 1XP8A 1L7VC 5EZ5A 2RGEA 4L5BA 2YWFA 3PUVA 3LBIA 1GM5A 1VDZA 5HR5A 1T3SA 4Q7KA 3Q85A 4D2IA 3C14C 4H1UA 5E7IA 3VNUA 1TQ6A 1S0UA 2O8CA 2ZAMA 4GP7A 4QJ5A 5EUQB 1V5WA 2LKCA 4JLJA 1OIVA 2VLIA 4MKHA 5JJKA 3W9YA 4NONA 3NWJA 4HZUB 3FHTA 4FI3C 3WY9A 1I2DA 4Q1CA 2BCJQ 4QGHA 3K9NA 3CNNA 1T0HB 2P2LA 2BM1A 5AUNB 2FZLA 2OILA 4KFRA 3W8NA 1QDEA 2XOKA 2XTNA 2Q3FA 1JPNA 2R9VA 4I1SA 4EJSB 3K8YA 3C8UA 5KNDA 5FBVB 1H8EA 2WJVA 3SHFA 3EZ9A 3W6NA 3GP8A 4L8GA 4LV6A 1EESA 2P5SA 5TVKA 4DVGA 3I62A 2G0TA 1XZPA 3DZDA 4WW0A 4OHXA 4F4IA 2DFTA 4TYPA 1MRSA 2ODBA 1FZQA 1X86B 3ASZA 3TSWA 3X1XA 1T8UA 1UPTA 1FNMA 4HLCA 1Q1BA 1R2QA 2ZTSA 3EASA 4KSCA 5TARA 4US2R 5DHAA 1AGRA 2J46A 4KV9A 5BQ5A 2H7VA 4C0KA 1Z6XA 2ZAOA 1FMJA 1BOFA 3LWNA 1XTIA 4NYIQ 4P33A 3AVOA 3UMSA 4ERNA 3CPJB 3BH0A 1LF5A 2AXNA 3FVQA 5DSZA 3GLIA 1E4YA 5JS8A 3GLFB 3R7WA 4DEYA 3H1TA 2FA9A 1ZUIA 1JAIA 3THOA 4EKDA 2QRNA 2RH5A 1ESNA 3B7GA 1DEKA 5HKKD 3ZLJA 3CR7A 4MH0R 4PSVA 3GFTA 3RC8A 3Q72A 4B73A 2GRJA 4BWYA 1HT1E 1KSFX 4WZ6A 1S3SA 4XIGS 4CEIA 4LHZA 1EWRA 1QBKC 1QHHA 3BBPA 4QHSA 4AIIA 4DSOA 1OHHA 5F98A 1DO0A 3HPRA 1COWD 1XX6A 1UDWA 1KK0A 4TMZA 4BLPA 1VCIA 2RAPA 2MSDB 1CJVC 1M8PA 2J87A 4PPQA 4D4JA 5JCPA 2DB3A 721PA 1GFIA 2FEMA 4KVGA 2PEZA 4O3MA 2REBA 4G5GA 3AV0B 1RYFA 2A2ZA 3MCAA 4KO8A 1G1MA 5JS7A 4JLMA 2DHRA 4B43A 4LOAA 1E9CA 2VHJA 2GWHA 3JVVA 1M74A 3N2IA 4OI4A 4NDZA 1F2TB 1DG1G 4JLOA 4V0MA 2ERXA 4C9BA 4IW3B 4OK6A 2OFWA 4NCKA 4TYYA 5G41A 3LQRA 5FUYA 3SS8A 4NP6A 5TY0A 4C0HA 4ESHA 4RZUA 4G5OA 3KQNA 3CO5A 1ZC4A 2RHMA 5KYKA 3B1XA 4KCGA 2F43B 2JLRA 3QF4A 2OZEA 2J7PD 3OEHA 1OXSC 2CHGA 2YNMA 2FFQA 3TBKA 2ZRIA 3I73A 3ICEA 1COWA 3U7FB 4DLVA 3GLHA 2QM8A 3D3QA 4EFNA 3KZ1E 4X8MA 3B60A 3TMKA 1A1VA 1KNQA 1KO7A 1FNNA 2JLUA 1MABB 1FTSA 4F4JA 2IWHA 4PXAA 2C98A 1KDRA 4A92A 1UKYA 2B21A 3R7WB 1OKKD 2JJ1D 3VQTA 4AI6A 4M9ZA 4LY6A 4TL9A 4WBSA 1ESMA 4TLAA 1ZRHA 1R4AA 2QAJA 1VTKA 3A1SA 3AUYA 2QU8A 1DAKA 2EYQA 4IFEA 2CCGA 4OQNA 3OF5A 4R2IA 2I3BA 3KJEA 2JJ2A 2CHQA 5DO9A 1FOEB 2OSBA 3EZ7A 2WWXA 1XZQA 2H18A 4B6EA 4DT1B 4GOKA 3UXMA 4ABYA 4BQSA 1E2IA 1KNXA 1XU4A 2WIBA 3HJNA 4KYUA 1E9DA 4NYIR 1OFTA 2J3EA 2ONKA 4OJQA 4DHEA 1U8ZA 1D2NA 4RFSA 4HZIA 3I4LA 2ZSEA 3W6OA 8OHMA 3K0CA 2OV2A 1R5NA 1X8LA 2BDTA 1KIMA 3B8HA 4PO8A 4V0ME 3IHWA 2VQSA 5GVSA 2IX3A 3B9PA 4IOLA 1KO5A 1OW3B 5FL3A 1GL6A 1KAOA 1N5LA 1E9RA 2QMUA 4OKSA 2JAQA 2RCNA 4Q19A 1YR6A 4G01B 3TW4A 4F38A 3BB4A 1N0VC 4LV8B 1G4AE 4QKQA 1NVVQ 1NJFA 3WMEA 1XTRA 4Q21A 3U4QA 4KBGA 3H4MA 4JS0A 3U4QB 2HDNB 5F3WB 3GLIB 3F8TA 1KMHA 1FP7A 1ONBA 2FGKA 1P7CA 2BMFA 2JDIA 3HYTA 4IXNA 4EPRA 2D7DA 3X1ZA 4CT4B 5HCNA 3TGPA 5KPDA 3QE0A 5TV2A 4D4MA 3GLFE 2YKGA 1JNYA 4TL7A 2WJYA 1E96A 2H1LA 5EP1A 4RCZA 1ZM7A 3WNCA 4PAQA 4PR0A 2J9RA 2GXSA 3GJ6A 1E69A 3BRWD 1W4BA 2J0VA 2PT7A 4KITB 2HJGA 4YC7A 5E7MA 3NHAA 4KU4A 1TU3A 2ZREA 1W0JA 2ZJOA 1U90A 3SN6A 3U7GA 4UXHA 2FSHA 3CR8A 3SI7A 4AG6A 3QF7A 2WOOA 4JYCA 5DYIA 1CKEA 3P4YA 4NH0A 5EQTA 1XCGB 3BB1A 1EFRA 2VP2A 3KFXA 4B47A 2UKDA 1SVSA 1XBTA 1G64A 1PJRA 1ZW6A 5TB5A 3CRRA 2HT1A 2PL3A 4Z8YA 1XCMA 4TMKA 1YVDA 4L16A 1TAGA 2YYZA 4O0MA 1SULA 1E2MA 2CL0X 3QIAA 4O25A 4OQLA 1GRQA 3SJBA 3IEVA 1J2JA 1IM2A 1ELOA 5CDFE 3GJ3A 3LH5A 1U0HC 1H8ED 3AP2A 1N6NA 4GL2A 2XAUA 2ZYVX 5JLJA 1OPXA 4KJZA 5J40A 2G3YA 2WBLC 1FL9A 2QROA 4DDTA 1QHYA 4RFVA 1G6HA 4ACBA 3THYB 3U3KA 1AQYA 3MJRA 4JKIA 1IXSB 2LWIA 4DLTA 2ZM5A 5KTYA 1HE8B 1N6PA 2ZYTX 1ZUNB 1FUKA 4I1OA 4D82A 1KJWA 2W0MA 1U9IC 1M7HA 4Q00A 3SE0A 5KNBA 1GNQA 1P9RA 2BVNA 4M9QA 1KHTA 1NN1A 4EDHA 1QHHB 1OH5A 3MWKA 1UEJA 5HZHA 1R7RA 5FPHA 1XTJA 4A0HA 1TF5A 2ZI6A 3EG5A 2FV8A 4JBXA 4UQOA 5FTNA 3X1DA 2VPPA 1SXJE 4V03A 2QQ0A 3EWSA 1CU1A 2KSQA 3T12A 1WCV1 1W36D 2CNWA 1AJEA 1S8FA 1YQTA 4LJ9A 1T5IA 2IYYA 4BFUA 1TF2A 4M22A 1F6BA 4DBLC 3M0EA 3KXLA 4YMSA 1GDDA 2HYDA 1EK0A 5EUMA 5ELXA 3IPXA 3AGQA 4TLDA 1M6NA 3H86A 3U60B 3B5JA 3T61A 4LCBA 1W2GA 4LX0A 3UMRA 2NMVA 1Z0DA 3K09C 5JECA 2XNSA 1SVWA 4RD4A 4DLWA 3L82B 3TAHA 3LD9A 4KI0A 2RB4A 4OQXA 4D4KA 2ZE6A 3T5DA 1ZU5A 1UM8A 3GFPA 5L3SB 3E70C 1DAMA 3MMPA 4NYMQ 4P32A 1KO1A 2VTKA 4B3BA 4KFSA 4Q4HB 3FKSA 1Z07A 5CIQA 1PUJA 1ZYUA 1YKSA 2VHUA 3I32A 4RD6A 3AF2A 3LAWA 4LHXA 3SDZA 5JZVA 1RIFA 4A2WA 4M1SA 1VIYA 2ZI4A 2GESA 4TLBA 2ODNA 4QBFA 3P27A 4KAXA 3U3JA 2Z4RA 5CK4A 5F9HA 2AXPA 2JJ8A 2BJWA 4JKYA 3PXGA 3ZQJA 2QORA 4UXIA 1CR2A 3L2OB 3PUWA 2BC9A 1EXMA 4HUTA 1G5PA 3CUEF 2J59A 3EXAA 5KSZA 1CULC 2ZYWX 5J4KA 3RAPR 3FMOB 3BGWA 1O3YA 3MWLA 4XVRA 1F2UB 3EZ2A 1GWNA 2ZRKA 1GP2A 1QG4A 3Q8XB 4W5WA 1JPJA 4K8OA 1JI0A 4OK3A 4XTCS 4F91B 2UZIR 4QNRA 1KI6A 4N0DA 5J5CA 1HURA 3IO3A 4Q9HA 2WVJA 5IF9A 2N1BA 1KI6B 3D31A 5FTJA 4Z51A 1TX4B 1KSGA 4QNMA 1FQKA 2ZSBA 4B74A 2W6IA 2GF0A 4RFSB 1NBMD 1Q1ZA 3JVUA 5SZHB 2ATXA 3REGA 1NVWQ 4BLQA 3SBDA 3V9PA 4C7OB 1U81A 3AF4A 4ARZB 4MKIA 2CJWA 4IHQA 2D74A 1YZNA 1JAHA 1YZTA 1ZIOA 4M8NE 4YQFA 4URXR 4JLAA 3ND8A 3PITA 1HV8A 5BN4A 1QG2A 2ZJYA 3WP0A 1RKBA 4FMCB 2X2EA 5KDOA 4JMPA 3TR5A 5FOSA 1TU4A 1E4VA 1DBSA 2OXRA 5C2JB 1WBBA 3VAAA 2E87A 3B13B 121PA 621PA 4MA4A 3TAUA 1N25A 3K9GA 4ASUA 1NVUQ 1G3MA 3SJCA 2B8WA 3AF0A 4M2LA 1MO4A 3LW8A 4XD7D 3VR2A 2AKAB 3W3AA 1KSJA 4MRNA 2BBTA 4EPXA 5IK2D 1E3MA 1VHLA 1W2HA 2FJUA 2WIAA 1ZM4A 4MITA 1JXMA 4PPGA 1J99A 3MUFA 5CB8A 4XSHA 4YXWA 3CH4B 3VKHA 5FBLB 3RC3A 2JLXA 3U7EB 2ZE7A 3AH8A 1B23P 3FPAA 1Y63A 1US8A 4UKDA 2D3WA 3CRVA 2BMEA 3PQCA 2K5UA 3PV0A 2V6IA 1NIJA 1TQDA 4JLBA 4CF7A 2V6JA 3AKEA 4KFUA 1A4RA 1GUAA 3ADKA 4LHWA 2BBWA 4LYJA 1LB1B 3IQWA 3PIRA 2REOA 3I61A 1YRAA 5FH9A 4C7OA 1E2DA 1XMSA 3H0KA 3OZXA 4DDWA 1Z0FA 1FW6A 4M21A 1QZXA 1NLYA 2XNDD 3VX3A 2VHCA 1U9IA 3QY0A 3DO6A 1Q57A 5KO2A 1TPZA 3M4YA 5EXPA 5JSZB 1YRBA 1II8A 3NH9A 4PZLA 3IUYA 4B32A 4UNSA 1E1RD 2L0XA 3C15C 4JLKA 2FEOA 3KX2A 4N1AA 1AQUA 4QRHA 3GLHE 2Q9CA 1E2HA 2J0UB 4DLYA 2H57A 1B0UA 4B3GA 4EIWA 4BFZA 3GEEA 1KMHB 5B2ZA 3E2IA 5FOVA 3T15A 2V1UA 1QHSA 4QGGA 4B76A 2IL1A 3QPVA 2MSCB 2RGDA 2H8KA 1GZSA 1ZM9A 1W7AA 1YZKA 3MGCA 1XEWY 2VRWA 1EWQA 4ZPXA 1DOAA 3IDQA 4DC9A 1ZNYA 3BS4A 1OIWA 4DSTA 1SKYB 4DUGA 4M1WA 1H8HA 4TTQA 5IK2A 5JI3E 2J41A 4D25A 1N5JA 1ZJ6A 1LFDB 3K0AB 1W1WA 2GXUA 4NCIA 4DCVA 3ZVRA 1TEXA 4GOJA 2QBYB 2ONJA 3DM5A 4PFSA 2QZ4A 1GSIA 3VR1A 3FMPB 2W2TA 2AK2A 4XWOA 1AS2A 1U94A 4QHTA 1S9DA 3OEED 5FTMA 2GBLC 1HE1C 4M53A 3QUSA 5E7JA 1L2TA 3EC1A 3B82A 3BE4A 1E1RA 4M9SA 2CXXA 4V02A 4Z8XA 4TT3D 4B75A 2GK7A 1KI9A 5IHPA 3TQCA 5DI3B 3MWYW 3MWJA 4MQBA 3R8CA 1Q12A 1PLJA 2GILA 1KO8A 2OE2A 4DSUA 4EFMA 1OB5A 3O47A 1OYYA 2ZUDA 1P2TA 4V0NA 2ZSFA 1WP9A 5FFMA 2C2HA 4BZQA 4TSFA 1H8HD 4JIMA 3NTUA 2VH5R 3BK7A 3FHCB 3U2QA 1AS3A 4FMDF 1A2KC 3K0FA 1YU9A 3RANA 4R71A 1OE0A 2G9NA 3UG7A 3IGFA 4TWZA 2WV9A 3FTQA 2NZ8A 2C77A 5L3SA 1NN5A 4Y0VA 3TW8B 4RKFA 5FBRB 3RS2A 5DI9A 2VP4A 2O8BA 3U6BA 4NYMR 2XJ9A 4HSEA 3B9QA 4HB0A 4LBZA 2XGJA 5FPTA 3B1ZA 3D8BA 2WWHA 4YMUA 3K0SA 4CEHB 5CYPA 2XTZA 2A5YB 1RE0A 5FR1A 2YINC 2DBYA 2N42A 1FMLA 1E1QD 1R5BA 4M4SA 3MRSA 1Z5ZA 1XEWX 1R6BX 1R8QA 2W58A 1U99A 3GCGA 5JFGA 3EPHA 2GEDA 2Z4SA 1JB1A 2WKRA 2QTHA 3TH5A 1G4UR 4HAZA 3HYRA 1Q22A 1TF7A 4NKRA 3EZFA 2B7CA 4PX9A 1UKEA 2C5LA 2ZRAA 5K8UA 3CPHA 4NCNA 1IN6A 1X1RA 4HZUA 2QE7D 2QMEA 1G3RA 1VIAA 4URUR 3Q7QA 4OQFA 1NLZA 2GHIA 2H17A 3PEWA 1XXHA 4PHFA 4GFDA 3UANA 2Q9AA 3BFVA 4FWTA 2FSFA 2IYXA 2GAOA 2FOLA 2CK3A 3PJRA 3K9HA 4DDUA 3UATA 2C95A 4WZBE 3SYNA 3LX8A 4R9UC 2F43A 2VL7A 4BFYA 3QXHA 1ZMXA 4HB2A 2KBFA 1HQYE 1ZAKA 1ZU4A 1CJMA 2WJHA 2GZHA 3X1YA 4WXRA 4DB2A 2GETA 2ZITA 1N6HA 3PUZA 3QJYA 5DNYB 4TLCA 1J8MF 1KOFA 1XMJA 3GLHB 1TL7C 3WYAA 4B34A 3SNHA 4TL6A 1GITA 1XPUA 1AGPA 2ORWA 3UG6A 4Q1AA 2AD5A 2OLKA 4HEJA 4P3YA 3IIJA 1IN8A 3QXSA 2REXB 3KQHA 4EJSC 4MYTA 1N5KA 2IA5A 4JLDA 5J47A 1W0KA 5D3MA 2IS6A 2GF9A 3KDSE 4BLRA 1KJZA 1WXQA 2ZR0A 1RYHA 4B2IA 1H65A 1ZBDA 1JEDA 4B6FA 2ZRJA 3Q5DA 3RWMB 2J0SA 1E9BA 2V8OA 4OI0A 3WYGA 5DN6A 2VA8A 4A0GA 3AVXA 1DG3A 2YC4C 1KK3A 5JBQA 3AVTA 3VKGA 4R2HA 1NF3A 3L43A 4PZYA 4D4LA 4CEJB 3K70C 4FW9A 4YXWD 2IT1A 4G0NA 1JQLB 3QKSA 3F5FA 2QN6A 4AD8A 1OFUX 2FE4A 3T35A 4OBEA 2BMJA 3I8XA 3OAAA 3VMFA 3SQWA 1XPOA 4POAA 2B7BA 3ECCA 4BFVA 1TEVA 2R6FA 2BOVA 3NEYA 2FDCA 2ZRCA 3K0FB 1E98A 2QPOA 3ZVMA 1ODFA 1CRPA 4LK2A 2XZPA 1G21E 1Z0JA 2GJ8A 3W34A 1W36B 3E5HA 1ZCAA 2ODWA 3ZS8A 2V54A 3G5UA 5FOTA 5A4JA 1E9FA 1GG2A 2VP9A 1XMIA 5AJWA 3QBVA 1ZCBA 4A6XA 4LZZA 1XRJA 3WBJA 2G83A 3WXMA 1FPMA 2ZPTX 2QMOA 3FGNA 4BPBA 2IF0A 3LY5A 5FOWA 2P67A 5HCIA 2QP9X 5IT5A 1T91A 3C5CA 1NLFA 2MMCA 4MGZR 4D26A 1CS4C 3TE6A 4LC0A 4TQUS 2B92A 4Q9JA 1G7RA 1G8HA 2VBCA 2I1VB 4RVCA 1F2UA 5ANRB 5EP4A 3KQUA 4MDFA 2W2VA 3FKQA 3RWOA 4BRUA 5UKDA 1JECA 3UIEA 5CJPA 3PUXA 1AKEA 1N3BA 2ZIAA 5DGXA 3ZIAA 4EAQA 1US8B 3KQLA 4BZPA 1NRJB 1UKVY 2ZETA 4U02A 1A82A 2QG6A 2Q3MA 5EJEA 3IIMA 2VF7A 1F3OA 2P65A 2ZRGA 2D7CA 3CRW1 5J4VA 1XD8A 4TMXA 3TIFA 3OEEA 5KNCA 2J5XA 2WICA 4ZCIA 2GAAA 4B3DA 4MRRA 3K0EA 4DZZA 1OB2A 3B1VA 4DIEA 1E32A 1DADA 3NC0C 3NEJA 2ZJ2A 1KKLA 1XXHB 3NBZC 4X8LA 4DLZA 1LVGA 1CXZA 1G7CA 4DKXA 3QVUA 4MGIR 3PEVA 3SZRA 4QJ3A 2NIPA 2QEQA 2V7QA 1CIPA 3AB3A 3KUDA 4TYWA 5E4FA 2ORVA 2R2AA 2GZAA 3GEIA 5EE5B 5FL7A 1Z29A 4DIDA 4IDPA 2CCJA 2EWWA 3W3ZB 3CRQA 3IILA 5J4HA 2ZRLA 4NHOA 4PQRA 2NG1A 2JLYA 1ETUA 1SKYE 3DL0A 1CLUA 2OM2A 2PZFA 1VMAA 3LV8A 5IRCD 4GZLA 1D2MA 1R0XA 4G1UC 1ZIPA 1YJ5A 1ZD8A 2PLFA 3LBHA 4C0BA 5KOYA 1YZGA 3B85A 1NBME 4LPSA 2NO0A 3FE2A 3OFNA 3P26A 1G8PA 3MAAC 4AYTA 4DCTA 5GJVC 4DRZA 1DELA 5EE1A 2VEDA 4OHZA 2YJTD 4MRSA 3LVQE 1X3SA 5EXTA 4YMVA 3GPLA 2QUZA 2P6RA 3L0OA 4PO1A 1ANKA 4HAVA 4TQAA 1PUIA 1YZUA 1D6JA 1P9NA 3P20A 2C8VA 3NBFA 4CEIB 1SHKA 3AEZA 3AKCA 2AX4A 5C1BA 2IXFA 2J1LA 3HU1A 3MJHA 3W8RA 5B30A 3P32A 2EU8A 2BBOA 4DB4A 1G41A 1SQ5A 1KKMA 3DM9B 2NO7A 1ZNWA 4R98A 4A15A 1NY6A 2YOHA 4IKEA 3LXXA 5SZKB 1GKUB 4EUNA 2WWYA 4B35A 4JVLA 2V7QD 2QE7A 1UEIA 2RGGA 2ZVQX 3L8ZA 4FN5A 2IUUA 5BW8A 3AVVA 4LBVA 3WHLA 4C0JA 1MH1A 4Q18A 5B58C 1BIFA 2A5DA 2XOKD 1GVNB 1P2UA 4JL8A 2D62A 2YVUA 3DKPA 2BKUA 2QRZA 3QSYA 1Q1QA 5C4GB 2MSEB 1OH7A 1IN5A 2Q0HA 2Y8EA 1QHGA 1X1SA 1NMYA 2OO7A 1HEIA 1AN0A 3LLMA 3KKQA 1W5TA 5FUXA 4QGAA 3WNDA 1N0UA 2GBLA 2EFEB 1G3QA 221PA 1KO4A 5A0FA 2BJVA 2F1JA 2Z5FA 4QJ4A 4BEJA 3CNLA 521PA 5B57C 4KXFB 2O0HA 2WSMA 2ZS8A 1GNRA 2C96A 5BYJA 2R6GA 1D9ZA 3DMDA 1EFRD 3EARA 1YZQA 3LQQA 2ODEA 1CRQA 1AZTA 3OHMA 2A78A 1Q21A 2FU5C 4ZDIA 2HLDA 3KJIA 4W7SA 5EE9A 4CRWB 5HKKA 2JATA 4BLSA 1BS1A 2KWIA 4OQMA 4LRWA 4XWAA 1IJEA 1QHNA 2E9SA 4MDEA 3O8BA 1GOTA 4MUBA 1RZ3A 1J70A 4Q9LA 1OH8A 3LRPA 4P4SB 2IK8A 2ZYUX 3AP3A 3IBGA 4EPTA 4TSFD 3ZZ0A 1OFIA 1KAGA 4D0GA 1BH2A 1VG0B 4KYIB 5K8TA 2GA8A 2AHOA 3SFVA 5KSPA 5CITA 4HLUA 4HAYA 4LYFA 2G1KA 4DLRA 3UK6A 2ZR7A 1QRAA 3QG5A 1W48A 5FOXA 5C18A 4B48A 2A7QA 2QSYA 1TQ2A 3A58B 1IAQA 4UNRA 4KSBA 2FNAA 4TL8A 3UMFA 1BYUA 1E2KA 1XXHE 2AN9A 4O2LA 2BM0A 4Q4AB 2DWQA 2IYUA 4FWIB 4GI7A 1KYIA 2J0UA 3QENA 4JZKA 3QXJA 1P2SA 1DAFA 1LNZA 1W47A 2Q3HA 3ZD7A 2W00A 4Q4HA 2R6AA 1Z2AA 3K70D 3KKOA 1FFHA 1E79A 2WWWA 3T5GA 2O0JA 4PC3A 4DDVA 4F93B 4OI1A 2EYUA 3BFXA 2BBSA 1K6MA 4LBWA 3QEJA 4US0R 4URWR 3NDBB 5CLLA 2DY1A 1Q0UA 2F9LA 1E99A 4JL6A 2GKSA 2HYIC 2Q6TA 4BFSA 3PR1A 3X2SA 1MT0A 4BZXA 3QXCA 3TK1A 4BLOA 1SXJA 2J7KA 5LD2C 2QAGC 4HI0E 1S1MA 2IW3A 2ZJAA 3GJ4A 4IRUB 4A4DA 4C0SA 1KY3A 3A1VA 2PX0A 3ND9A 4HDCA 3EPJA 1EX7A 4EPYA 3IO5A 3I72A 4HDQB 4GSYA 4N0EA 4EPWA 1SVKA 1KI3A 5EXXA 3C7KA 2OAP1 4EPVA 1CR0A 1G8GA 1YR7A 3DVLA 1SHZA 1KI2A 2IYZA 3FWYA 5JWOA 1LF0A 2QGNA 2VSFA 4Y0AA 4JLVA 1P9WA 2Z43A 2ZI3A 4E5UA 1OHHD 3VU9B 1DVRA 1Z0KA 2QQEA 4WA7A 3NXSA 5P21A 4Z1MD 4AK9A 1X8KA 3U44B 1LW7A 5JJLA 3LXRA 2C99A 3M1IA 4RY2A 2GTPA 4OJKA 3U6KA 2FGJA 1W0KD 2A5FA 2Z6VA 1TUEA 1E1QA 3KKMA 2JLVA 4IXMA 5HPYB 5K8IA 2I4IA 4TZ0A 2CJWB 3WMFA 5FR2A 2FFHA 1SVLA 4EQ6A 3BD9A 2B8TA 4NCJA 4CIDA 3EAQA 2HXSA 4GMXA 3N70A 4QM6A 3GD7A 5DHFA 2OEPA 4L15A 2KBEA 2WHXA 1TNDA 4IDNA 3VX4A 5FBWB 1FP6A 1KDOA 3FYHA 5LPNA 1TADA 3BAFA 1P2VA 4O2RA 4V0OA 2V1XA 1OF1A 3I5XA 4ZKDA 1VYVA 4Q5IA 4IOKA 4D81A 2JDID 3ZS9A 4LJ6A 4IJMA 3O8RA 3GJXC 4F92B 3KTAA 2GXQA 2OHFA 4L9WA 4QBHA 4CZ2A 4BECA 1IONA 3GJ0A 4S2EA 3O8CA 1SVMA 3GJ5A
chains in the Genus database with same CATH superfamily
3H3FA 4OMFG 3KOOA 1NX6A 4UMFA 4UNIA 5EPOA 1PK7A 2O57A 3A28A 4AYWA 4G0PA 2F9FA 2OXFA 5DX8A 3SFZA 4I1RA 2E3JA 4RQUA 2GRUA 1MQAA 2JIMA 2X9GA 3NBUA 2AMYA 4ZXFA 1T5LA 2B8EA 4PG7A 3N8KA 2WM9B 3L0SA 1FP4A 1GPYA 1G1AA 2EFCB 4GMDA 3DJFA 3UH1A 2BELA 4M1MA 4RZ2A 1QR6A 2C5BA 2DPXA 2GJ9A 2R4TA 2W6JA 3AUJB 4JBYA 1G66A 4UNPA 3L0IB 4MRMA 5DM4A 1IE3A 4KNYA 3FAZA 1V7QA 2G1JA 3BEOA 3HEMA 4MRMB 4UMVA 2BGJA 4PG5A 1Y89A 3IXMA 4LWZA 2SKEA 2FSVC 3AM1A 1Y8RB 2PSHA 4EFKA 1ZOPA 2GI4A 2GEVA 2I03A 3OEWA 4UXJA 2A57A 1BWQA 3FFAA 3HK2A 3JW8A 4R69A 4BUJA 3JR7A 1C3EA 4PEVA 3QMVA 4ZRDA 2B4QA 4UEKA 3V33A 3KPJA 3WRWA 2WTMA 5JEEA 3KUCA 3WO1A 3E7DA 5JQWA 4KR7A 2H16A 1NU8A 5AK0A 1NVXQ 1RXEA 1QONA 3Q3HA 1KYZA 3PNMA 4YAKA 5DYGA 3B53X 3E9DA 3TI7A 3ZQ6A 1H9AA 4X6XA 3VBEA 2QN7A 1N2CE 2XD4A 2OZLB 3E1SA 3H2HA 1ATZA 4GBGA 3CVYA 3MYRA 1XA0A 4ID3A 2XVZA 1MO3A 2QRMA 3PUYA 2SCUA 3R20A 3I3SR 3SZ3A 1GU0A 3GFQA 3P2EA 1GN9A 1Q15A 3M5WA 4NU8X 3FCEA 2AUMA 2ASVA 2PJRA 5TNXA 3FPKA 1XRRA 3ZHXA 3NRBA 2D5AA 4MUGA 1N0WA 1RRGA 1JAZA 1NATA 1SNYA 3OZAA 2WMOB 5C81A 2IS1A 4RK0A 2QBYA 2AK3A 3CSSA 3VV2A 3WWPA 5LFAA 4ZRMA 1QZTA 1FDIA 3IDAA 2GPWA 1Y9EA 1UBGA 2SHKA 2GD1O 3C41J 3KQTA 4MWOA 1QR2A 4N0MA 4OHWA 5AO9A 4MTCA 3VUFA 4GI2A 3HZOA 2QG4A 4HDMA 5KQLA 5E1BA 3AJ9A 3PX2A 4D5EA 2AFIA 3DTVD 3RTDA 4BO4A 2HT6A 4B6SA 4O4HB 3R6TA 1VHWA 1I3OA 3ENKA 4BB5A 5CTJA 1DC7A 2XDQB 1ZW1A 1MJGM 4NQRA 4DJAA 3HGMA 5HYVA 3FM9A 5KJCA 1H42A 1XAIA 3VBCA 3Q3GE 4B7ZA 2A9KA 4WZAE 1JTFA 4MRAA 4GM1A 4HB4A 4N5HX 3RREA 3ZJ5A 5EYPB 1P72A 2B4AA 3MQFA 4R7ZA 2CMKA 1UJ2A 3VPBA 3ADCA 1ZI6A 5HIAA 4EUEA 3BIJA 1RSZA 4IAOA 4IFIA 3FNBA 4UJ5A 1I5RA 2ZI7A 4EMSA 2OD2A 5CJ2A 4BMDA 5HJEA 1R66A 1F5NA 2JLQA 5DE3A 2QN8A 5GIPE 1UH5A 3VA7A 3QSGA 3ZCVA 2AZXA 5JDIC 5ALTA 1UBCA 1RS0A 2K2WA 5CP8A 4MV0A 2J0QA 3QPUA 4O6VA 1UK6A 5D6NA 3KB1A 4FHGA 3E4DA 3ZXUB 3NDPA 1Q6YA 3S5JA 1ULZA 4Z54A 4TXLA 2VYND 1S96A 4J16A 1F8XA 1BKSB 4PIMA 3BWVA 3IPYA 1ULSA 2BAGA 2C04A 5C1IA 4AURA 2ZUWA 4AXXA 2WV7A 4MWBA 1K8RA 2J30A 5DCWA 3A1TA 3WHKA 1GGKA 5CDUA 2IF2A 3UF0A 4PQYA 1Z4PX 3EDQA 3KD3A 3PXUA 4MRVA 4IVPA 4I1UA 4QEZA 4X71A 2PX3A 3W9BA 4C4PA 3QOFA 4P93A 3P0IA 4NPHA 2RBGA 4Z1OA 1N8KA 1R15A 4WJKB 4BP8A 2VLBA 3ZV5A 3O8DA 4R7TA 1Z5WA 1CHNA 1NQUA 1PTJC 1X7DA 3LP5A 8LDHA 4KTTE 3ZH9B 5HIMA 4DXAA 1KEZA 5KYYA 1O87A 1JALA 3AB8A 2B99A 1NNEA 3DPIA 3LT0A 1P0IA 5ALPA 1X1EA 5SY6A 2ECKA 4C29A 2A7XA 2RGCA 3R5JA 1HDZA 3A1DA 1NXOA 2QVCA 1WMSA 2ZUBA 3C5HA 1ZHHA 1D8TA 2FMXA 4KJXA 4WN9A 1GYQA 3E3OA 4TSKA 4Y7DA 3I5MA 5AWFC 2ZR8A 3A4TA 4J0KA 4G5SA 1CBUA 1O95D 4JSYA 3WQBA 5FRDA 5ICMA 3RV3A 3O73A 4JX9A 4XQ0A 1UMCA 2WSSA 4D42A 2FX5A 3VHXA 1XEXB 3KYBA 4UE3S 5EHQA 2AFIB 2VYNA 4V0QA 1I30A 2D5IA 3ZEIA 2R8OA 2W98A 4FFVA 3U4DA 4TMVA 4Q9KA 4ZWNA 5AK3A 3WOHA 3PNVA 4AW9A 5MDHA 2VPZA 3QLUA 4G9EA 1A7UA 3G7SA 5G53C 2OGTA 4OSEA 5KWSA 2DTDA 1VL5A 2WHEA 1E2PA 2B4RO 4E51A 1YS9A 4CM5A 1D0IA 3T3OA 2XYPA 1IVYA 2I6UA 1Q20A 2V0NA 3H19A 4KODA 3C5WP 1F2DA 5EHXA 5IVKA 1Q0QA 3L1HA 1MVLA 3TLJA 3SZLA 1I3CA 1KI8A 3E5RA 1JR3D 5EMNA 3G5AA 3KP1A 2QVLA 4ON9A 1FLVA 3EVEA 4IEEA 1WZ2A 2PKRA 1AZLA 1JIUA 1USGA 4PS1A 3QYJA 1DT3A 1C8KA 4EW6A 5JD5A 4MKZA 3NO4A 2CVHA 2VDMB 3DCNA 2WEKA 2V7PA 3ENZA 3NW9A 4RWEA 5IM5A 2IUSA 4KP7A 3EZ6A 4A8JB 3PXCX 1Y98A 2AFHE 2PMDA 2PX5A 4B33A 3MSXA 1LX7A 3CEAA 1QP8A 3FFTA 2VATA 2FRVA 2BKEA 1S2OA 2D2XA 1L7RA 4JVNA 4Z1MA 1ADYA 1VKJA 1H6DA 1M3SA 2F90A 2FW9A 2QVXX 4IF6A 3KYCA 2QTZA 3GLTA 1I4OA 2CFRA 3K0AA 1QGED 4GOOD 4ZVVA 1YUMA 4NAVA 3U31A 5AUOB 4IIYA 3G9UA 2G4VA 4ETWA 4CLRA 2P35A 5IUNC 4P86A 3TIXB 1XMOB 2FZGA 2O52A 3P9SA 4JWKA 2VAMA 4CFZA 5FI3A 1OXTA 3R5TA 3NUZA 4IIJA 3VOAA 4TPKA 4P0QB 1EFTA 1IN4A 4Z0NA 2V3VA 3HGTA 1NHWA 1W35A 4PYLA 2Q2WA 2IUFA 4QL3A 4HRVA 4CQLB 1J21A 4XI9A 3H1GA 5DP1A 3NBXX 4MUHA 5E0OA 5AKZA 3FMIA 2HGSA 4O0LA 2P5TB 5HXAA 2Q2OA 3FPGA 4L4UA 4MVJI 2JVJA 3NIWA 4R1LA 1ZCFA 3SYLA 2Y93A 4ZOBA 3WA6A 4EJFA 5ENZA 1EDBA 4WLUA 1ZONA 1CD5A 1ESZA 4ZQCB 3W6ZA 4YUVA 3IAAA 3RNOA 3PCTA 1EWVA 3L8DA 4UOQA 1Z4LA 1BE1A 1T26A 5IDYA 5JUWA 1Z08A 2ZIEA 4KO1S 3CCBA 1M2VA 2I8LA 1MA3A 2QRQA 1D7OA 3G1WA 1QFJA 1C7IA 4DLBA 3GN1A 4U2EA 1PN3A 3D7SA 4E12A 2C2MA 1U80A 1YCHA 4N01A 5CB4A 5I5EA 2ZQZA 5BXQC 4EG5A 4B44A 3KVYA 4YMWA 4G0VA 2YBDA 1SCQA 1YV9A 1I10A 4Q9IA 4FFSA 2PKXA 5HKLA 4YRNA 3R9XA 3VV3A 4KE9A 2JIRA 2X1VA 1U9CA 3ZYCA 5B55A 1AK9A 3QVTA 2E4YA 5K9ZA 1OBFO 2IEAA 5FT9A 2R1UA 4XEUA 3RSSA 2R00A 1KC3A 3RUIA 3VC3A 3WTBA 5KYXB 4ARIA 1XU7A 3KEFA 1A9ZA 1Q1GA 2EZTA 3DP9A 5J9FA 5DEOA 4AJ2A 2XCLA 1P31A 2UUPA 4HL6A 1W87A 3WGQA 3UFXA 1MABA 3FHOA 1A5TA 3R0VA 4CETA 2XMPA 4YRQA 4ZU1X 2D1QA 2HC9A 4MPDA 5J4LA 3K20A 4ZEVA 3KAKA 4A0FA 4PPYA 2PAAA 1II0A 3NG1A 3GPDG 1W94A 1RWBA 2YHIA 1JBKA 4L28A 4KGDA 2FW7A 2IHYA 2NADA 3EW9A 3M4JA 4AWXA 5BRNA 3AKYA 3UYLA 4HNRA 4K9QA 4U5XA 1JWLA 1RWPA 3OAAD 4LVNA 4Q4DA 1OV6A 1TVKB 3BE8A 3T41A 5AW3A 2IHNA 5EVJA 4GLLA 1W44A 1PYDA 2IEYA 4B4OA 3ZDQA 1SHTX 5DJ5A 3K6SB 1A4UA 1XALA 2JGDA 3CVJA 3JQ7A 3ZU3A 3LWBA 3PKIA 5ENVA 3PXDA 4TXNA 3ZBQA 4CDNA 4Q1BA 5HRCA 4BE4A 3MJEA 4HBZA 4GUAA 2XNJA 1YZ3A 4PHTA 5REQA 3SJZA 3ROGA 3VR5A 4D9HA 1SU8A 3E27A 1IC6A 3JWGA 4J0JA 4X20B 1T10A 3HR7A 1F2TA 4CW7A 1LQUA 3ZOKA 1DAIA 1ZZGA 3WVNA 2D0PB 1C3JA 4G6ZA 3ZI0A 4GWLA 1U3CA 1ZP6A 3KD2A 3KQYA 5EMKA 2EGGA 5T4FA 2FRDC 2Q5OA 4HS9A 2M9MA 3KFVA 2IKSA 1JXAA 2WA2A 3E1GA 1Y8QA 4W8HA 1QIMA 4HN2A 4FXOA 3GMTA 3KQOA 3G9QA 2HF7A 1DKLA 5EWMA 3W7BA 4CG1A 2JNWA 3HN6A 3P0HA 1RFGE 4U7DA 3TSYA 5JMOA 3MJVA 3KWLA 4L22A 4HQOA 2FPGB 4RVHA 3NS7A 2M6KA 4MS3B 5HNKA 3RHFA 1DQZA 4GPTA 4PBSA 4LQ4A 3HP1A 4BP9A 5K51A 4DVJA 4F04A 4F7WA 1Q17A 5C46F 3P2MA 4M9XA 1QMGA 4QPZA 1AQ6A 3ACBA 4IIXA 2C83A 1CY7A 3A0RB 1XVAA 3V9AA 2W42A 3HVJA 1N4AA 1PG0A 4BQRA 4G1EB 3ZD9A 2IPAB 3NVDA 5BWNA 4EF5A 4YX9A 1CIVA 4Q1FA 2NXEA 4JC5A 4UULA 2VF4X 2F4VB 1EEXB 4BE7B 3TLKA 3SX2A 3R44A 2IYLD 4EI8A 2VP0A 3JYOA 4CLXA 2ZFUA 2P6NA 4MZDA 6LDHA 1T9GS 5BUSA 1GAJA 4CMIA 3HXTA 2DFPA 3DNFA 3KG2A 4XM1A 3EMKA 1VJGA 3OUZA 4ZC1A 4LF5B 5LNK6 3A9TA 3GDWA 5CU7A 2VPIA 3H5NA 2Y0CA 3UJHA 4HGQA 5TQ2A 1KOLA 3OE7D 4AJ1A 4Z4FA 4IXWA 2AG0A 2VZLA 2OO5A 1QIKA 2ID8A 2JEOA 3C3BA 4Y2JA 1V39A 4F6LA 2IBMA 5KIAA 4HGPA 3O3OB 3FTEA 2ET6A 4MV6A 3TRFA 3URMA 4GRDA 1UR5A 1RM0A 2XEXA 1YB4A 3N5CA 1E2EA 2JIZA 3ZHRA 1Z75A 2M2IA 4Y6GB 5JMTA 2A0WA 3I8OA 3FNGA 3HNOA 1PKEA 4Q1EA 1V8FA 3SZUA 4C0AC 3OT1A 1T3LA 4FSDA 3DZIA 4OHMA 4YECA 3ASUA 1N92A 1SCAA 4HGNA 4TMFA 1WQ4A 4O4JB 2OQVA 3TLYA 3TR0A 3RRYA 2XITA 2BF4A 2YIJA 1TCAA 1WO8A 3QUQA 5FJIA 1MGPA 1X0VA 3IPCA 3QELA 4ZMRA 3FZNA 3UAZA 4B46A 5I7SA 5JYDA 3WHPA 1URPA 3GA5A 3FUWA 1H1TA 1W36C 2JHFA 4Y0NA 1DFIA 1XD2B 2WYIA 3FDFA 3CN7A 2QDKA 2WD7A 3A4NA 3H8JA 2O8EA 3RQIA 3MRVA 4RETA 1P3DA 3OKFA 3LHSA 3KKLA 3F6CA 1HF3A 5AKGA 2H2IA 3LX5A 1JGTA 4MVYA 2C7QA 3N0TA 3VISA 3RCBA 3L7JA 4EGSA 1L1RA 1BMTA 1WHSA 2XCUA 5GMOA 2IJGX 3NR2A 4B3XA 1K6JA 5AOCA 3B3GA 1TJ5A 1YBHA 1XDDA 2UDPA 5IS2A 3HWSA 1J7KA 1RYBA 4W7HA 2FSIA 3MG9A 1VCNA 4G8BA 1CJUC 2PQMA 3HYLA 3L7OA 4UZSA 3H5IA 3O4RA 4Q7QA 5AW6A 1H93A 5FNZA 4MYUA 3WSVA 4L02A 3ZZTA 2PMKA 5D3MB 2HBZA 4ZAZA 5GP1A 3IERA 3UKDA 3L9XA 2NUTA 3WL3A 4RQTA 4CL0A 3KJHA 2W83A 4D9MA 4TRRA 3PVCA 4PYJA 4ESEA 1UJ5A 3NBQA 5G3YA 3NC4A 5CDTA 1JR2A 2P4EA 4OHCA 4DN6A 4MGKR 4WLVA 1FUUA 1TKRA 3HYSA 1KI1A 1USKA 1V8OA 4GYYA 4AO7A 4E31A 3OLWA 2EV9A 3ZE9A 5GJCA 3ZV4A 1A2OA 1U7PA 5EPEA 2OK8A 4OHYA 5HG0A 1RRFA 2IEIA 4HDSA 3LC7O 1EE2A 2H7XA 4M1TA 4NEHB 4KRFA 1CEEA 1J8YF 1P73A 3Q7PA 1WB6A 2Q3EA 1VJ1A 1X7ZB 2HA3A 4P0PB 1E63A 5H68A 4R4JA 3P45A 4YBRA 1GFZA 4LZNA 1L0BA 2FMUA 4RS4A 2HWKA 3TVTA 4ZJZA 2QX8A 4S05A 1KH2A 1MH9A 4NE2A 2AOVA 3F90A 1W34A 1KBOA 5TDHA 3IPLA 3FGZA 2IEZA 3A14A 4QTYA 3DULA 2X5XA 5DH9A 4BBAA 4CG2A 2VNSA 5F7ZA 1N36B 2CXHA 2R47A 1DAGA 1HG1A 1M76A 1UZUA 3DXFA 1OA1A 2CE2X 5B1EA 1FDRA 4HOYA 2O2IA 2PNJA 5TXGA 4D0RA 1JG3A 3LPDA 3EGWA 4F5ZA 2GPJA 4O2BB 2BGIA 3UJBA 2BR5A 5LQAA 4ZOLF 1VC2A 4B8ZA 2O8BB 5HIIA 1MC1A 1JHPA 2MYPA 3GLVA 4H4DA 4UC0A 1EKXA 3O95A 1UBRS 2Z2XA 2LIVA 3W3AD 1CY6A 1X2EA 3B12A 3M5DA 4LWPA 4XDZA 4RTQA 3FRIA 1YQGA 4EB3A 1CR1A 4F60A 2CEKA 1PZNA 1DIRA 3GJZA 3I01M 5DVZA 1NW6A 1Y82A 4JGBA 2INGX 4CFYA 4WLFA 3RJTA 2J9FA 4L7QA 3RPEA 2H06A 3K31A 4X90A 1FRNA 2XUDA 1W5SA 2NZVG 4V0LA 3WGUA 1PFKA 2AR7A 5AOBA 5E1OA 2PJDA 2KE5A 3H2SA 3ZXIA 2YZKA 4B8WA 1UEXC 4AY2A 2G82A 3EEQA 4AKSA 1GILA 4XZ3A 3P9NA 4C06A 2R8YA 1OXVA 4DF3A 4YQZA 2W2LA 1XHLA 2NPIA 3DBOB 4MR7B 4A03A 2IKQA 4IUBS 2NU9B 1E6EA 4B84A 1W96A 3R3SA 3GUVA 2OFFA 3K9BA 1TJPB 2PIDA 2RI1A 3KB2A 4I1PA 1HQCA 1OTYA 4BFXA 3VDQA 2I76A 5EIAA 1V2HE 3P19A 1KARA 4WBNF 1ZNZA 4TTVA 3TNFA 1X6VA 4AY4A 1RRPA 2XNDA 4L27A 4MW9A 2OKGA 2XD9A 1ZVMA 5IXSA 4N8DA 4QC2A 3T3NA 1F60A 1W85A 4UEOA 2YRXA 2OV8A 3CG4A 2C92A 3O8QA 1MX5A 2Y67A 1XF9A 3DVRX 2TYSB 2BSAA 2VK2A 3QKTA 2K6GA 2Q21A 1R64A 3E8SA 3IP3A 4LRTB 4WNCA 1ZOIA 4HN4B 3VVBA 4P38A 3KETA 1HNWB 3AEKB 5T57A 5LLDA 4XVCA 1U2RA 2WWIA 3P97A 3HTXA 1XNHA 1JEJA 2V6BA 2YY7A 3DB1A 4H35A 1J20A 1XD2A 5KNCH 3GDGA 1T0BA 1Y3AA 3D6FA 4RMJA 1N2ZA 2IZ5A 3OMLA 1QV7A 2EFHB 1OZAA 2V74B 3WLJA 4BEBA 4IDQA 3H04A 4P53A 4UBLA 4BC1A 4WBNB 3T1VA 1IN7A 1XLUA 2JAXA 1A76A 3OOYA 3PJGA 3QW4B 1EIZA 2DHEA 4BO8A 1UOOA 5E8JA 1PBTA 1WUIS 1C50A 4G67A 4ICIA 2XJ4A 5L45A 4CHTA 1LWNA 3HCPA 4HAWA 1HC7A 3KV1A 4L76A 1QGZA 1KI4A 1TYZA 4KWHA 4NBVA 1AZWA 4HFNA 2O1WA 3DOUA 4QDJA 4X60A 4YI5A 2Q8NA 2RE8A 2FF7A 3BDVA 3U5ZB 2W2PA 4YONB 2ILVA 3U16A 4J94A 3OLXA 1U3UA 5FWDA 4BMPB 1EJBA 1X7GA 1WEKA 5J5VA 1KGDA 4PZDA 1JEEA 5C34B 2NNWB 4AYXA 5JRJA 2CEAA 2L18A 3LX4A 1PJ3A 1ESCA 3FFBA 1E4EB 3SM3A 3ZWMA 3MXTA 3KSRA 2BR3A 1Q1NA 1JX6A 1UADA 4PAGA 1TYDE 4WLNA 4YP7A 5TC4A 4WOJA 1Q3HA 2GZ3A 4KPEC 3URKA 1ZNQO 1JQ3A 2FYTA 1FF9A 1QCZA 4HUQB 2R5WA 3KOMA 4TMWA 3LS2A 5HRAA 3DZBA 3JASB 3CW9A 4N9WA 1YJXA 3H2IA 3HVIA 2AZMA 4J03A 4Z7NB 5DDIP 1LBHA 1VFPA 3MRXA 4X7BA 1YNOA 2PQ0A 3N2EA 3ONFA 3R3VA 5EHNA 3U1TA 2CJFA 2JGLA 1I24A 2EKLA 4QM7A 1O94A 1W19A 3EGEA 5LZ9A 4WESA 3C97A 1DQSA 3ES9A 1OC2A 3BERA 3QPWA 4G5YA 5HJ5A 4RH3A 1Q7CA 2CKDA 2Q6IA 1XTSA 3B52X 4URYR 5DTMA 5EP3A 4MUKA 3SQLA 5DBIA 1U5AA 1V0JA 1HA3A 3B6MA 1M1YE 1A95A 1RAGA 1XTVA 1DS6A 1FDTA 1RCFA 1N2HA 2J33A 2JCVA 2VSXA 2ZB2A 3ENQA 3LA6A 4MP6A 4MV8A 2W6ZA 2BMDA 3ZD8A 2YXEA 4BJ6A 1I7SB 5AW1A 3LYHA 4AJLA 5FB3A 2VT6A 1YIAA 1Q74A 4KH0A 1R0BA 4AJIA 2H4FA 1ZH6A 2PUTA 3KHSA 1DIHA 1R0ZA 2XH8A 3I2FA 2BZGA 3Q5EA 5CIWA 3CNQS 3EYAA 3KXIA 1G59A 2RKWA 2RGNC 1E3JA 3KLNA 1UM9A 2LRHA 2XDWA 1L4YA 4OU4A 2ZB3A 3PENA 2VUSA 4LDRA 1FLAA 2G67A 5ESRA 1D07A 2DKNA 3FOBA 4I4LA 2QG9A 1MXHA 3N0XA 1OAAA 1PO7A 3HFRA 4MW0A 4WUTA 2J3QA 4QAQA 3LP6A 2R751 2CNOA 2C9YA 1OLOA 5EUBA 3NASA 4JLUA 3OFKA 3UTCA 1B6RA 4MVJD 2P40A 2YMPA 1RRCA 4F56A 3QU2A 4IWYA 3P8ZA 2AWNA 3FXAA 2PRKA 1O97C 4RDHA 3B9BA 3M5CA 4GPD1 4HX9A 3VVCA 3E81A 3GEHA 4LHVA 4OAPA 3C7DB 2AEMA 4G2NA 5ILGA 3K6SA 1RBZA 3Q7EA 1PT6A 3FLAA 4QOJA 3DBHA 3UM9A 1N0HA 1KZ4A 3SF8A 4J43A 4I3GA 4IX1A 3L02A 2B4TO 2SECE 1GHTA 2NWQA 2H48A 1K2VN 3LQ1A 4KFTA 1JSRA 4DLKA 3FYUA 2FP3A 3L8EA 3O31A 2QLTA 4ZI7B 3OCWA 3TQQA 2FPWA 1IHUA 4GLFA 2XB4A 3IUQA 1VIVA 3IIEA 4I1YA 5DBFA 2VSOA 2HV8A 2XXAA 1N6RA 2IXGA 4BVAA 2LNDA 5AM2A 1XQYA 1BQ4A 3W1EA 5GONB 1OD6A 1MHTA 4RENA 1HTWA 4UHCA 3ESZA 1L5RA 2VFAA 1OJLA 2G0NA 2ZJ8A 4K6HA 4DAOA 1KY2A 1JG6A 5GADl 3FPFA 1QO7A 2P75A 3OX2A 1Z0SA 1CIJA 3MILA 4RDCA 4BFWA 5KOJA 1QC5B 3U39A 5GZ6A 2NVUB 4C22A 3T06B 3LBNA 2V9PA 2YW9A 4WBNA 5L3QA 6ABPA 1AX9A 2PH1A 2POQX 3GUHA 2CZCA 3MFYA 3Q3JB 2ZROA 3MRTA 4PU0A 4ZYUA 5AJTA 4OXYA 1B1CA 3IT3A 5IBRA 1SUDA 2DYKA 1AZSC 5LA6A 3GGCA 3QEKA 3C6KA 2VT2A 3GNLA 1ENZA 3EGIA 5GONF 3U40A 2I22A 1IHDA 2JLWA 5AI4A 3FYCA 1A2BA 3VO9A 1JI3A 1C1XA 4BDSA 1RQNA 2B94A 4XX0A 2JVKA 2HNAA 4M8LA 3BBLA 4MS4B 4V0KA 3CMCO 4O4LF 4WNYA 5B37A 5I48A 1XLTA 4PANA 3W9SA 3PFCA 4KNWA 3TLMA 4WEQA 1CVLA 2KB0A 5TVGA 4DQVA 4NOMA 4H77A 4HMQA 3G2OA 1LH0A 1IBSA 4NOKA 1T2FA 4RNCA 4X3PA 1RHMA 3FWNA 1FS5A 2ACWA 5BSWA 4OJYA 4RSGA 1KYXA 3UJ9A 1WVMA 4NXNB 5TX7A 1XWFA 4I19A 5EWJA 1M67A 1YCFA 2WT8A 2R8RA 1LX6A 1ABEA 3QUBA 2UZ3A 5KINB 4JJ4A 2QZJA 2A9RA 4FS8A 3HFSA 2A9FA 2F9MA 4MUXA 4ZKEA 3K1ZA 4J2OA 3UWMA 3MJ4A 4A1FA 3EE6A 1LZLA 4O1HA 4U1RA 4NZMA 3PEEA 4AF8A 4IEIA 3L7MA 1R10A 2XYRA 3WRYC 2Q50A 3PRKE 5CCBA 1JQDA 1QFYA 1IXRC 4MUJA 4OA8A 4O29A 3TMYA 3VU9A 4JV5B 4F8YA 1B1AA 1JDTA 1EVYA 1AG9A 2BGNA 3IT1A 3TEMA 4ARBA 2P2YA 1USIA 4S35A 2CN1A 2YWRA 3PFIA 4FNAA 3WGOA 2HEIA 2R7MA 1KFCB 1GGEA 5AD1A 5LOVA 2HSWA 3QF4B 5KU1A 5ALWA 4BQEA 3MJCA 1VBFA 3D3WB 1CCWA 3JYPA 3WA7A 3QX3A 4KR2A 4Y9DA 1UAAA 2E4UA 1Z6GA 1T8TA 1U04A 3CXUA 4OYYA 2VF2A 2PO5A 2OHHA 3W2FA 4HWRA 1HFJA 5HIKA 4Z2AA 1OYWA 2FMFA 3EODA 2OSVA 4I1VA 1X1TA 3HDTA 2ETXA 2I99A 5AM0A 3TSZA 3VRHA 2C29D 3W2TA 1WEHA 2FWRA 1KORA 3EVCA 1IHXA 3R8FA 1CB0A 1T0UA 2R0QC 1YWGO 3I1IA 2AS0A 2XE7A 3HU3A 5THQA 3RRJA 4DR4B 4K9SA 1FXSA 1U1GA 4QLOA 2FUG1 3W5VA 1Z13A 3QKUA 2E4XA 1DL5A 1E60A 2XECA 1WCXA 3OWXA 3IKLA 4AJPA 4HGZA 4XB2A 2QRKA 1UBHS 3RVLA 1VHJA 5HZGA 2I4RA 3KDAA 1XZCA 2HWXA 1M7GA 2PD3A 2VXYA 2WPDA 4BMVA 4DPMA 5A4FS 5EE0A 1QRTA 2MR6A 2QAGA 3A6KA 3F7OA 1ILEA 1H1DA 4BXOB 4NMLA 1JDJA 1M6EX 1RE1A 1R0YA 1C0EA 4D9FA 1O6ZA 2V0CA 5FPSA 5IVPA 4KYVA 2RD2A 1C30B 1GCUA 3MSCA 2CL7X 4LXXA 3EVTA 1KEWA 1UFQA 1JR3A 1Z45A 4FXPA 3PB3A 4QXMA 4X8HA 4I1IA 1VMEA 2HMUA 5BN3A 5D1HA 1E1KA 2AN1A 3EA0A 2HHJA 2XUHA 3OZRA 2DMRA 3E5MA 2E4WA 3EXEB 4RH1A 3NRCA 2LDXA 1T1EA 4RM2A 3SU8A 5EYPA 3OESA 3RIXA 3CHYA 2H6EA 3GX1A 1M72A 3CR3C 3ESRA 1SQFA 4B9EA 4GGOA 1UDAA 4CLOA 5PGMA 4MB2A 4JVSB 1NKVA 3RRBA 2VNHA 3DHWC 1XEFA 3KZCA 3KPVA 1GZ3A 4RABA 2PWPA 4FGJA 4K9KA 3RS0A 1JQJC 4D0SA 1GSHA 3A2LA 4BLWA 4UVIA 2QW1A 4V24A 4U6QA 1KEKA 2JHCA 4RD0A 2QLFA 1U1CA 3TKYA 1XK7A 2GVZC 3A7DA 3WIEA 2IS4A 1SO8A 2XPCA 4DLSA 2C4WA 3EG9A 3K9LA 3UHFA 3CVWA 2QAIA 1VE7A 4FZVA 3UCXA 4GKBA 1U31A 3GCWA 5DISB 5F1PA 5K0LA 1M83A 5FTLA 1Q0SA 1HZZA 2XUIA 2HPAA 3HEAA 4J0FA 3GELA 1IXYA 1G2PA 5JCOA 4EYEA 3G7UA 4OOEA 1Q1EA 5CFRA 2ACEA 5AJUA 2ZUFA 1M8KA 2Q45A 2E6UX 3JVIA 4J0HA 3OE4A 1MX9A 2QRVA 5WRFA 4CT0A 1PLKA 1H1LA 3E9QA 1C8VB 2QN1A 3GRKA 3M33A 3V3KA 3V4RA 3H5LA 3DSRA 4D4GA 3LM8A 3SR0A 5F7XA 1GSAA 3Q8LA 2A4KA 1L7VC 3SHVA 3UOAB 2RGEA 4F84A 2VF5X 5IXYA 3PUVA 4EI7A 5HR5A 1T3SA 5ALHA 4C43A 1RRMA 3C14C 3KLPX 4H1UA 3CLUD 3ZY6A 4D2IA 2RK3A 1E4EA 5JNUA 1DCFA 2QY6A 2FCAA 4H6XA 5B4UA 2O8CA 4M0CA 4JLJA 2BMWA 5DM70 1WZCA 4GZ5A 3ZWQA 1BDJA 1OIVA 1P2DA 1I01A 3DOIA 4ZT2A 5JJKA 1LRKA 4W82A 1L8OA 1P77A 2DQ4A 3NWJA 2NU8B 2O14A 2QRHA 3ED1A 3WY9A 4A73A 4LOLA 4Q1CA 1U4SA 4JN6B 3KCQA 3DGFC 2II6A 2QYHA 3CNNA 3L0ZA 2C84A 4GR4A 3JQQA 4PWYA 2FZLA 4KFRA 1MENA 2B30A 1K6EA 5JFTA 4BGIA 4BU1A 3F3MA 2WTBA 5F4ZA 4MUMA 2Q3FA 3PUHA 3MCZA 4FYPA 1ORVA 3AJRA 4EJSB 1KVUA 1T9ZA 2C5GA 4JC8A 3OEYA 3HP4A 4YCBA 3ZZNA 5FBVB 5H7XA 2I3DA 3SHFA 2VJDA 3V8EA 3QNWA 4CMGA 2H5IA 1I1QB 3N87A 5TVKA 3DZDA 3C6MA 1BXRB 4WW0A 1RBQA 3ITNA 4TYPA 1F7UA 2WP8J 1FZQA 4G86A 3ASZA 4ISCA 2AIRA 3P52A 2QB5A 5DWDA 3NT4A 2ZTSA 2X1LA 3WWYA 1ZSNA 1JP7A 3I2YX 4NNPA 2D0IA 3B8EA 4KSCA 4C89A 5BNWA 1Y81A 1AGRA 4H6PA 1VRWA 3TIGA 4KV9A 1SA0A 4FGWA 3B70A 3OE1A 4C0KA 1GT6A 4P33A 1KZHA 4WINA 2AXNA 2IYOA 3PNKA 1U8FO 2F3QA 3H1TA 4E0BA 4KE6A 4DLAA 4WK2B 1JAIA 2R87A 3BSSA 3K5HA 2QRNA 1FNDA 5HMMA 5HKKD 3ZLJA 3CR7A 1VLZA 4WXYB 3GFTA 2R8XA 3C6QA 1KSFX 1S3SA 3BBPA 4QHSA 4DSOA 3HBAA 4FX2A 1OHHA 4KLAA 5F98A 2H11A 2RBEA 3M9WA 4UBOA 1XMXA 4D46A 5AI0A 3QJGA 1COWD 4EKIA 1Z7EA 3KS9A 4UDNA 1N77A 2RAPA 3F98A 3BJMA 2MSDB 3MXOA 2WNSA 4ZO8A 4CE6A 1G8JA 1UQRA 3DDHA 1VGRA 1N2EA 4L0QA 1RQPA 3CWCA 1K5HA 5IZCA 1Y7IA 5REQB 3DWEX 2IPOA 1RYFA 2WF6A 3H3JA 4Z4QA 2Q46A 2IY9A 2GNAA 3HLKA 4KO8A 4LTNA 1P91A 3RUEA 2CLIB 3E5NA 4YT8A 2Q5EA 1RWOA 5CPFA 1OZFA 3H5AA 3LYUA 1IEWA 4ZN6A 4OLBA 1MO2A 2PRYA 3ON5A 4KK4A 4OI4A 4Y6PA 4G63A 4YA6A 4QFDA 2OD7A 1VE3A 4NNOA 4R5MA 1IUPA 3E6AA 3VR6H 2ERXA 2I2CA 4XYGA 3FVRA 4JJFA 4C9BA 3R8XA 4NCKA 2WP0A 2JCBA 5FUYA 1HRKA 4IV8A 4R1SA 3UN1A 2P5YA 2Q4TA 5JNTA 1GYRA 1C9NA 4TS9A 3V4OA 3KQNA 2GPBA 3B1XA 3QVSA 1ISHA 3BA1A 5BMOA 3GYBA 1IFXA 2L2QA 2DZDA 2E1PA 3PPWA 3D4IA 2SNIE 5IBCA 4F3RA 2EKQA 3DLTA 2ZJ3A 2YNMA 5I9SA 2XMSA 3W2GA 3TBKA 3KUUA 5IC4A 5AVRA 1D1QA 3U7FB 4DLVA 1CW2B 3HH8A 4QG3A 3LCVB 5D2CA 3B51X 5AM4A 2FCRA 1ZUD1 2QJRA 1A1VA 1MNAA 5DKFA 4S1OA 3VR5D 5L7WA 1RXCA 2FW1A 4C5CA 2IWHA 4CM4A 2RGRA 4NJMA 4PXAA 3K6JA 1J8VA 4ZVKA 2VJAA 3F49S 2HR1A 1J49A 1GCOA 1RLJA 2XCIA 3F3KA 4HH1A 1WCIB 4A92A 1GDHA 3BGDA 1UKYA 1KJIA 1H69A 1OKKD 4N7RA 1YNSA 3VQTA 4M9ZA 2PBZA 3BT7A 3F3SA 5AM1A 2F3PA 1QIIA 1PJSA 3ZH2A 1V4VA 1R4AA 3K2QA 3KYIB 1VSUA 2B78A 5B1IA 1FDUA 1CUIA 4ODIA 5HOQA 2M6LA 3N2LA 4GZ6A 2V7VA 2EYQA 1PGPA 4IFEA 4N5DA 2ZB4A 2YN0A 2JARA 3IAUA 4HQ6A 2OP0A 2A84A 4GMHA 4MWSA 3FWKA 4D41A 3QRWA 2OC9A 3PUKA 4MVJM 4NEQA 1N2IA 4KPFC 2WWXA 4I2VA 4B6EA 2DY0A 5EOVA 4QE3A 3UXMA 3VH4A 2C3UA 1E2IA 5ALSA 4BWGA 1E9DA 2FN3A 2QQFA 4MYDA 4DMLA 1C7RA 3IV6A 4HD8A 2P0AA 4OJQA 4U2CA 3VHRA 1V25A 4DHEA 2CXSA 2XYVA 4U2KA 1P1JA 3PQ8A 4Y1EA 4DMUB 2HSGA 1IWPB 5HUQA 4RJKA 1R5NA 3G0CA 3L49A 1L4EA 4RGQA 2A92A 1APBA 4YAFA 4QLAA 2G28A 5DNEA 2X4DA 5JD4A 3MBOA 1KTIA 4V0ME 2VQSA 1PD0A 4OHPA 1E58A 3B9PA 4QFBA 2ZIUB 4IOLA 1OW3B 3DT9A 3KB8A 4WY2A 4LA4A 4YIKA 5EIBC 4J2TA 5FL3A 1HM5A 1XFDA 5A5FA 1FC0A 2BKAA 2IV2X 3V8NA 1R8XA 5ICGA 1YRLA 3COJA 2O20A 1TOAA 2RCNA 3AI2A 2YYYA 2HQRA 4G01B 3L41A 2VRCA 2HMVA 3JD4A 3TFWA 5CFZA 3AR3A 1G4AE 4QKQA 1NVVQ 3V2UA 5LSAA 1UPCA 3H83A 4BLVA 4E88A 4QLBA 5CLJA 4JS0A 3MINA 1AKVA 2YJ5A 4RVDA 3RTAA 4KDRA 2HDNB 4WY5A 3GLIB 3F8TA 2W22A 4ZOLB 3LFTA 3MBKA 3WJ1A 4EPRA 3BL8A 1NPDA 5MF6A 2NZUG 1GDTA 2BFAA 5H4GA 2D7DA 3QA3E 1FXWA 1X39A 5CBPA 1ADFA 4TXJA 1P5RA 3QE0A 2YWXA 5KPDA 4D4MA 4OBWA 4TL7A 2WJYA 5DTEA 1E96A 4OQZA 1K63A 1ZM7A 2OCDA 4PR0A 2Q27A 1ZGGA 2JJYA 4QRIA 3WXBA 1UMDA 1W4BA 2EW2A 4X24A 4X1YA 2J0VA 2Y71A 2R8EA 2QMQA 4AUNA 3N2KA 2OKCA 2ZREA 1U90A 4U7WA 3U7GA 4ETIA 2O2SA 2X2OA 4P5EA 4CQLA 4LZOA 3LZ6A 3MGKA 3PICA 5DYIA 4JYCA 4J7CA 4PZ0A 1CKEA 4NH0A 4YCDA 5TSDA 3WGNA 3K0BA 4KXVA 1XCGB