3PEVB

S. cerevisiae dbp5 l327v c-terminal domain bound to gle1 and ip6
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
TNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 108
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pevB00
3RRNB 3PEUB 3RRMB 3PEVB
chains in the Genus database with same CATH superfamily
3TG5A 4UWGA 1UJKA 3DSXA 4BTAA 2R03A 5J08A 4U07A 5J90A 3KD7A 5CECB 3G2VA 2MHKA 4FADA 3N71A 3MV2B 4B94A 5EIBE 4IN3B 3CSTA 1LD7A 3IBEA 5BXUA 4J8SA 1LTXA 3FUJA 2AVPA 5FJYA 1VDYA 3JYSA 3S7BA 5FZSA 3PNLB 1LF8A 1IHBA 3B7BA 4RG6A 4GYYA 2AW6A 4JB8P 5G04C 1MX6A 2BTDA 3MX3A 4HNAD 2VGEA 4N2QA 4I17A 4AY5A 1E96B 5AQ9A 5CMYA 4CCAA 3FUNA 2WQ6A 3O48A 3ZUVB 3B7RL 4B8CB 2UWJG 1TJFA 1H2VC 1S63A 5EILA 2RKKA 2R2LA 2CHWA 4U0ZA 2XRZA 4IRUA 2EINE 3ZHEB 1TNYA 2LXMA 4DJAA 4LNBA 3FUHA 3PEUB 2WXGA 2HO1A 3E34A 1D8EA 3IKOB 4ACLA 4CT4A 2VSYA 1E7UA 1YYHA 4E6HA 4HQDA 3UPVA 4I9EA 4IYPA 3QDNA 2KATA 2LAHA 3IHYA 5LP0A 5FQ4A 4AY6A 2FEZA 4GTQA 2X3MA 2J08A 4ANUA 2XPYA 3LKUA 3I5PA 4GZ3A 4FU3A 3TXNA 3CVXA 1NL4A 3QOUA 5A6CA 4BT9A 4UI9K 4U04A 4PS8A 3OXFA 3UT4A 2P9PG 5JHBA 3V31A 2BF0X 5AENA 4JL0A 3ESLA 3UI2A 3TGOA 3ABKE 3SF4A 1KZOA 3EU5A 2VGXB 1UOHA 1TNOA 4X8QA 4DLQA 2XCCA 2VYIA 3QAQA 4K5CA 4TXPA 3ISMC 4ZFHA 3Q75A 3ZW3A 3T9KA 5ARGA 3D9HA 2J4DA 3TL5A 3DWLG 4R7LA 2XGMA 3LCAA 1JCRA 3FEYA 4FA6A 5EDSA 4GB9A 4J7WA 3LVRE 4QQIA 3HVEB 3CHPA 3RRMB 3O4ZA 4MS6A 4P29A 1KT1A 4G8KA 3QJZA 3S7JA 4BX8A 4FHJA 2X6KA 2KBXA 4F7AA 4HBDA 4G25A 3RSEG 3GZ2A 3I4RB 2Y0BG 4BESA 4DI3A 2WXPA 3FTXA 1OWNA 4FLBA 4GZCA 3ZNGA 1W3BA 1NZNA 1HXIA 3GYZA 3J5QB 2GGFA 3D9OA 4GMRA 4GYOA 4ILHB 4HOUA 2C0MA 2AWIA 3E32A 4BWRA 1L5JA 1N4SA 2FF4A 3B13A 3MA5A 4BEPA 3HIZA 4OYSA 1MX4A 3VTYA 3R7QA 4BTBA 4N3BA 4AOFA 2XS1A 4Y6WA 3MYVA 4YVOA 3KEAA 3MGBA 3QWWA 3DPDA 3LY9A 3LYAA 1WY6A 5ENRD 4HOSA 4U63A 1HH8A 3AG3E 2V4HC 5ITZF 1H2UA 5D0OD 2VSNA 1TNUA 4KXKB 2F0YA 3SFXA 1RZ4A 4PH4B 2YHCA 2NC9A 3BQOA 4HB5A 1N52A 1OWPA 3NF1A 5A7DB 4AXHA 2GRRB 5KCMA 5EKQD 2WXFA 1SZ9A 4LCTA 5T8IA 2R17C 5CCLA 3ML9A 4KMOA 1V54E 4NACA 3PZDA 1KT0A 3PH0C 1Y6IA 1EPUA 4CZ2D 2WVIA 2WXRA 2WB2A 4J8YA 5FWQA 4JA9A 1A17A 3MKQB 3CVVA 4L23A 3RRNB 1OCRE 2A5EA 1N9AA 3HXEA 3E4BA 2X6FA 2KZTB 4G11A 3CKCA 5BNWA 3RKVA 2YQ8A 2GRLA 5EN5D 3RIBA 3D3MA 3BG0B 4AEZC 2QYJA 4FJZA 3SHFA 3ASDA 4ATGA 3K9IA 2WXOA 2LNIA 4MRUA 2FBNA 2X6HA 4L1BA 1MZCA 1Y8MA 5BW8C 2I6HA 1JWGA 1BI7B 5CRUA 4UUCA 3FTZA 3LS8A 2IOLA 3SBTB 4DX5D 4IULA 3DXKG 4GTOA 2WXKA 3G2WA 4F53A 5FQ7A 4L7TA 3LY7A 1TN7A 4U95D 3V79K 5ENSD 5BV1A 4BT8A 4QFVA 4DX7D 2L0TB 5EYPF 3PZ4A 4F1SA 3ABLE 4AP2A 3UKUG 2KC7A 5D0QD 3RO3A 5BXOA 3FP3A 5BPPA 3C3RA 1UN9A 1WDYA 4XKCA 2H6FA 4EHMA 4PUCA 2F8XK 1X5BA 3DBSA 2WXNA 3CQCB 2AXVA 2C0LA 1D8DA 5AQ7A 5JJ6A 3AS4A 3AS8A 1KPSB 3Q73A 1Z5SC 3DXMG 3ASFA 1PY1A 3MJWA 3VLFA 1HX8A 5AAOA 2IY0C 2DCPA 4ME2A 4U8VD 4XE0A 3UMVA 5EYLA 4YVQC 3Q9NC 1IXVA 2XEVA 2DIWA 1WM5A 2A5UA 4B8AA 4Q94A 2OEVA 5B3SE 3QB2A 4NQ0A 3ZKJA 2ZGDA 3OXGA 3ZYKA 3GZSA 3CHMA 2WQ7A 4GPKA 4HLLA 3I3NA 1UW4B 3ZHEA 3VTXA 1TYQG 2CFUA 4UQZA 2BUGA 2IJGX 4GZ6A 3CIAA 3FUFA 2P9IG 3LY8A 5G05J 3C5RA 2E2EA 4JXTA 5ANLA 5HI7A 4YNDA 1KLXA 1BLXB 2CG3A 2XEHA 5CHEE 4TRQA 5EX0A 3ZYLA 2WXJA 2DWZA 5ENNA 4ABNA 5KJNA 2XZDG 1K1BA 5AYWD 1BI8B 2PQRA 2XCBA 4G26A 3CKBA 1HG5A 5B1AE 3E30A 1OY3D 3ZFWA 1K1AA 4ACKA 5T4YA 3Q79A 1N4RA 2F37A 2OV8A 4GAAA 4L2YA 4RG9A 4M7CA 4DPRA 3UM0A 3MKQA 3G2TA 3CK7A 1OUVA 1MYOA 2XGSA 4GCNA 3W9FA 2XGOA 4APOA 3JUIA 4H7YA 3D9PA 4FJYA 1S70B 3LXUX 3NZUA 1BD8A 3PE4A 2KCLA 2Y69E 3TWTA 2L6JA 3C72A 4Q96A 2LO6A 3MKRA 2JABA 1Q2ZA 3EU9A 4JW1A 4AVXA 1OWLA 5LCWC 1HE8A 4OAVB 4HORA 1RW2A 3UUXA 1HZ4A 4GPMA 2WXLA 1YA0A 3FTYA 1JCQA 5FINA 1SA4A 4C48B 4G23A 3TWXA 2NXPA 3CLJA 2OVFA 4UI9C 3Q47B 3ZRHA 4EECA 3FU5A 4WUYA 3ZXSA 3QWPA 4CT0A 3EDTB 3URZA 2WXMA 2VQ2A 5AJDA 1HFAA 1UJJA 2F8YA 4O60A 4OVUA 2AJAA 3SFZA 3U66A 2A4ZA 5D2MC 3CVPA 1MX2A 3HXDA 4U0SA 1D9SA 3JQ1A 4L2LA 4G24A 3Q7AA 1ELKA 2ZISA 2HR2A 4C9BB 1QQEA 4Q69A 3HDXA 3BUAA 4U96D 2WPVA 4C0MA 3DPYA 3LPZA 4GTPA 1U3DA 3WXXA 1E90A 4RVBA 3EHQA 3EIJA 2UY1B 3SGHA 4G1TA 4D10C 4CDNA 1IKND 1S64A 3EHMA 3L16A 1SQMA 3QK0A 5AQAA 4CDRA 3DEPA 3LVQE 4HVBA 2VGXA 4FULA 3SQVA 3AU5A 5JMND 5KWDA 3T5XA 1BPOA 4CRWA 3DSWA 3L08A 3TWUA 4LNUD 3ASHA 3UXGA 5KJLA 4JC8A 2WXHA 4HXIA 3T5VA 4WNFA 5AJLA 1WAO1 4NIKA 3CHSA 2PZIA 4PDXA 1MQSA 4F6RD 1E8YA 2WQHA 1IYGA 3AG2E 4WAFA 1H2TC 3TWVA 1KZPA 1E8ZA 4DX1A 4HOQA 3UIOC 4U8YD 4UQYA 2FO1E 1XNFA 2XHEA 3TWRA 1QBQA 4HFGA 3ULEG 2X38A 4GA0A 1U3CA 1AP7A 3U64A 1OCOE 1N95A 3T8KA 2Y1LE 2DYRE 3PUJA 4HOTA 4BERA 2J9QA 1EYHA 2P9LG 4J8EA 3UM2A 3T8MA 3ONKA 1HS6A 4O6FA 4L9PA 1QZ2A 3UIPC 5G05C 1TR4A 5KNHD 4GMJA 3DSSA 4BX9A 2EILE 1X81A 3FH8A 5G04J 2H6HA 4APFA 4A55A 3ASNE 4I2WA 4UQXA 5M72A 3L54A 3QNKA 2JLBA 1HO8A 3CEQA 3AG4E 3ZXPA 2ETCA 3E33A 2V5FA 3Q7FA 4GTRA 4CGWA 5CBNA 3B95A 3I4GA 3FU6A 4FP7A 5HS0A 4BSXA 1JCSA 3FULA 5AARA 3RU0A 3NQPA 2V5QC 4GTSA 4LSZE 3UINC 3QC1A 3VLDA 4EZLA 3L22A 4HRNA 3HHMA 3FUDA 2ETBA 2ZXWE 2DVWA 5FQ8A 3ZGQA 3AS5A 2IO2C 2PM6A 2WXIA 1UN8A 3FUKA 3OXLA 4DLOA 2EIJE 4EBAG 3NAWA 3QARA 2XEEA 4XEIG 1BU9A 3FH5A 3RO2A 4LRZA 3LJ3A 4WNGA 3CVWA 4F1PA 3JXIA 4URKA 5FTPA 2WMOA 4O1PA 3IV0A 4XIFA 3U4TA 3HXFA 4KT6B 1SW6A 3D9JA 3NOCD 3JXJA 4I2ZA 3CVYA 3UQ3A 3GW4A 2I1KA 1OCCE 2ILRA 3CK8A 4N3AA 2PNNA 3QWVA 4RSYA 1DNPA 4EBAA 4YDWA 3NB2A 3FH7A 3SO8A 3UTMA 4NURA 3QKYA 2DZNA 2VSXE 4J8FA 2XRYA 4U0UA 4M3OA 3CVNA 2XZTG 2B0OE 2NYJA 4MBGA 4TUUA 1OXJA 3U3WA 1MHQA 2OEWA 4K0RA 2DYSE 1H6OA 2XPIA 4JA7A 3SD5A 4N5QA 4I1MA 3KSQA 5LOZA 3PZ1A 4B0ZA 2R02A 1OWMA 3SZ7A 4ZHBA 3ZVVA 2H6GA 2QC9A 5ANRA 4G8LA 2R59A 2H6IA 2KZTA 3DEOA 4PS7A 1H6PA 1S0PA 4GMLA 3ZYQA 4Z68A 2X6JA 3PE3A 4A1GA 4PS3A 4J8DA 1OWOA 3KEZA 3J5PA 3PDNA 4UWLA 4UI9J 3HYMB 1DC2A 4TXRA 3NBNB 2QZAA 3D9MA 2GROB 3C3QA 1ZU2A 3FU3A 2OOEA 1E8XA 2R05A 3Q15A 3EJNA 3L6AA 2Y3AA 1IHGA 1U2VG 2BEDA 2V8SE 2GRQB 2PM7A 1NA0A 1V55E 3V2OA 5CERB 5E75A 3PNTB 5KJKA 4HRLA 3MV3B 5LX8A 3U9WA 5C1DA 2JEKA 1SA5A 4I9CA 3C98A 1K3ZD 5H7PA 4A1SA 1DVPA 2RD0A 1IQUA 4JEUA 3KAEA 4GYWA 3S7DA 3UKRG 3SBSA 5KJMA 3ZYMA 3F6QA 2WM9A 4F3VA 4O1OA 4EZKA 3Q4AB 4DK5A 4N3CA 4LERA 5FT9A 3S7FA 1N11A 2P9SG 4XI9A 3DSTA 2IU1A 3ZIMA 5CEDB 2LUHA 3B7SA 3X2QE 5CMWA 2VTBA 1ZB1A 3RAUA 2KXPC 3RJVA 4WWOA 4TV3A 3VLEA 1HU3A 4XI0A 4GCOA 5B1BE 4GZDA 1TNZA 3TXMA 2VTBB 2P9UG 2GRNB 3HXBA 3APFA 1K8KG 3NOGD 3FWVA 1O1SA 1EDUA 2XENA 3LDZA 2BKKB 4U8HA 4DX2A 2ZIRA 3AJIA 5BUZA 3CSFA 3V30A 4GA2A 4Y6CA 2AXZA 4JHJA 4HS2A 3R9MA 3TAXA 3ZU7B 2J09A 4EPZA 1UG3A 4KYOB 4K5BA 2EQXA 5D66A 3L13A 3FTUA 3KSLA 3CK9A 3SNXA 3L17A 2R5SA 4NRHB 5C2YA 5JJTA 1INZA 1OCZE 3C3OA 5A23A 3ASGA 5AIJA 4CDMA 1N4QA 4OAUC 4LG6A 3CVLA 2IOSA 1JWFA 4UWFA 3R7RA 2LAIA 2FULA 3BEEA 4DUIA 4HRMB 4G2VA 2LXLA 3CVUA 5CCMA 1TN6A 2DZOA 3G2SA 2RFMA 4BFRA 3HRAA 3TWWA 3PZ2A 2L9BA 2ZGGA 4JHKA 2OVBA 1PC2A 3W9GA 2MYOA 2MOWA 4A63B 2ONDA 2Y4TA 5BV0A 5FZRA 3BG1B 3CVQA 2P9NG 4YDEA 1E7VA 5AN8A 3D9LA 4JD2G 1HG2A 3PZ3A 3ONLA 4J0UA 1TNBA 2J49A 1YCSB 1Z6TA 2PQNA 4HLEA 4XX5A 1B89A 3B7UX 4JVSA 2P2CP 5T3RA 5ENTD 5IY5E 2QFCA 3UT7A 1ZBPA 1ELWA 4XZ4A 3PVLA 2V0PA 1NFIE 2WXQA 2P58C 3PS6A 4JZYA 2J8SD 4A3TA 2PL2A 3FTWA 1HF8A 4U7EB 2QYUA 4B93B 4KZCA 1N94A 4N5CA 3NZSA 3CR3A 4ATZD 3V2XA 5JJ7A 1JUQA 3D9IA 2YNQA 3CQGB 5HRYA 3OTNA 3FUMA 1QNFA 3D9KA 3ML8A 5G55A 5KNGA 4N2SA 2IF4A 5ENQD 1FVHA 2KCVA 2CFZA 4V3IA 4J6IA 4C0EA 3MEKA 2IONA 1N0RA 2GRMA 2I1JA 3BU8A 5CBOA 5FQ6A 2YHEA 3LEWA 3EHNA 1Z3XA 3HXCA 3DRAA 3CHQA 4I6JA 3JCKC 1P5QA 1TN8A 2IQCA 3CGHA 2RG8A 5EX3A 1AWCB 1FT2A 3RK6A 1YMPA 3APCA 5HKPA 3TWSA 2FI7A 4ANVA 2IO3C 2J4BA 5ENOD 5KBAA 4A3VA 4ILIA 4AJWA 3UM3A 3E37A 1MJ0A 3AG1E 1XGWA 3SFYA 2ZU6B 3HVEA 2LSUA 3EUVA 4KVMA 4JHRA 5LFAA 5JA4D 3PREA 4TUMA 3FY4A 2NSZA 4EQFA 4AV7A 3ZN3A 1H0AA 4TXQA 1G3NB 5BT1A 2CG2A 4UWKA 5ENPD 1TEZA 4KZ0A 1A5EA 2HYZA 1N0QA 2Y4UA 2KM4A 4WWNA 3FU0A 2HM8A 4UWHA 2VSOE 4OVVA 3CHOA 4LNGA 3SI5A 4ILGA 2FO7A 3B7TA 3R9AB 4KVOA 5DBKA 3EIQC 3FUEA 4CYMD 4K5AB 2IFUA 4RQIA 1EF1C 3Q5MA 3ESKA 3MZLB 2EIME 2E0IA 2Q7FA 3Q49B 4LUNU 5CRVA 2C2LA 2EIKE 2OCCE 4AM9A 2QY7A 5AQBA 3ULQA 4EZJA 3HG0D 3Q9UC 3IHVA 4FHKA 2V4LA 2RFAA 4CGVA 1LD8A 1TJCA 4N39A 3S2AA 5EIDA 3ZPJA 2IEJA 1DCQA 3TWQA 2MRIA 2M63A 1WG0A 2ETAA 3EHRA 3FEXA 4XKBA 2YINA 4WWPA 3UM1A 1N54A 1O1TA 4ANWA 2XS8A 5FIOA 3APDA 4KBQA 4W9RA 3TJPA 1NP7A 5E76A 1FVFA 3PUKA 3CV0A 3PEVB 1OT8A 2X6IA 3FHEA 2HE0A 2CHZA 1IQRA 3FFLA 3JQ0A 1GW6A 3RRUA 1H19A 1SVXA 2XPZA 4BETA 4I6EA 1SZAA 2I9CA 3CHRA 1PAQA 4E85A 1NA3A 3UT8A 5G2NA 3LJNA 4DX6D 4AIFA 2J07A 1H6KA 4I1AA 4WNEA 2LSVA 2L6BA 2P9KG 3FDHA 3IEGA 3OAWA 4I1OB 4WNDA 3WG7E 1DCEA 4JEHA 4I43A 3P2BA 5CEAA 3DSUA 3IXEA 3GZ1A 3ENEA 2KCKA 1N4PA 5ARFA 5LCWJ 3JUEA 4GTVA 4JPSA 3AU4A 4FLHA 3FTVA 3G2UA 3ABME 4CEMA 2B6CA 2BKGA 4HI9A 3Q78A 4YDOA 1E8WA 1FPPA 3PRZA 1O5MA 2I2OA 2UY1A 1O1RA 3TG4A 1ELRA 3UX4A 3FTSA 4GTMA 3FUIA 1FCHA 4BY6A 5FZQA 4FC8A 5JHAA 1QYMA 3ASOE 4RLYA 4YDYA 2WMNA 5HQ8A 2VGYA 3SY2A 1FT1A 2CHXA 1Z3YA 3P1UA 2L0IA 4H7XA 4K03A 3L82A 4DI4A 4BSZB 3KS2A 4DRXE 2GW1A 3ZEFA 4LEUA 1JPLA 4I6GA 4GZ5A 2GRPB 4ANXA 3MCXA 2XQ0A 4MKTA 3D9NA 2DBAA 4HI8A 1NI1A 3DSVA 4GA1A 4GU5A 4GTTA 3ULYA 4B89A 5DIZA 2VJ8A 3L9TA 3AAAC 2AXUA 4MLPA
chains in the Genus database with same CATH topology
3DBSA 2V5FA 3TG5A 2WXNA 4UWGA 3CQCB 2AXVA 2C0LA 3ONLA 1UJKA 4J0UA 4BTAA 2J49A 5JJ6A 1Z6TA 4CGWA 2PQNA 3AS4A 5J08A 3I4GA 3FU6A 4FP7A 3AS8A 4U07A 4XX5A 4HLEA 1B89A 3B7UX 3KD7A 4JVSA 3G2VA 5J90A 4BSXA 5T3RA 3FULA 3RU0A 2QFCA 3UT7A 2MHKA 4FADA 3ASFA 1PY1A 3MJWA 3NQPA 1ZBPA 1ELWA 3N71A 3VLFA 4XZ4A 3PVLA 3MV2B 2V0PA 2WXQA 4B94A 2P58C 1HX8A 3PS6A 4JZYA 4A3TA 2DCPA 2PL2A 4ME2A 3FTWA 1HF8A 4XE0A 3QC1A 3UMVA 3VLDA 4IN3B 3L22A 4KZCA 4EZLA 4YVQC 4N5CA 3NZSA 3CSTA 3HHMA 3IBEA 4J8SA 3FUDA 3FUJA 3CR3A 2XEVA 2DIWA 1WM5A 5JJ7A 1JUQA 2AVPA 3D9IA 5FJYA 2YNQA 1VDYA 3JYSA 3CQGB 3OTNA 3S7BA 2A5UA 3FUMA 5FQ8A 5FZSA 1QNFA 3ZGQA 4B8AA 4Q94A 3AS5A 3D9KA 3PNLB 3QB2A 4NQ0A 3ML8A 1LF8A 3ZYKA 3OXGA 3GZSA 5G55A 2PM6A 3CHMA 4N2SA 2WXIA 4RG6A 2IF4A 1UN8A 2WQ7A 4GPKA 3FUKA 4GYYA 2AW6A 3OXLA 5G04C 2BTDA 3I3NA 3MX3A 1UW4B 4DLOA 1FVHA 3ZHEA 3VTXA 4EBAG 2KCVA 2CFZA 3QARA 2CFUA 4UQZA 4I17A 4V3IA 4N2QA 4AY5A 4J6IA 1E96B 4C0EA 2BUGA 2IJGX 4GZ6A 3FH5A 3RO2A 3CIAA 3FUFA 2IONA 3MEKA 4LRZA 2GRMA 5CMYA 3LY8A 3LJ3A 4WNGA 3CVWA 2I1JA 5G05J 4CCAA 2E2EA 3FUNA 4JXTA 2WQ6A 3O48A 5ANLA 5HI7A 4URKA 5FTPA 3B7RL 4B8CB 2UWJG 1TJFA 2WMOA 5FQ6A 2YHEA 4YNDA 3LEWA 1KLXA 1H2VC 3EHNA 2CG3A 1Z3XA 2CHWA 4U0ZA 3IV0A 4IRUA 2XRZA 4XIFA 5CHEE 4TRQA 3U4TA 3CHQA 4I6JA 4KT6B 3ZHEB 3D9JA 3JCKC 1P5QA 4DJAA 4I2ZA 3FUHA 3PEUB 3CVYA 2WXGA 5EX0A 3UQ3A 2IQCA 3GW4A 2HO1A 2I1KA 3ZYLA 3IKOB 2WXJA 2ILRA 2VSYA 4ACLA 1E7UA 3CGHA 2RG8A 4CT4A 5EX3A 3CK8A 4E6HA 4N3AA 5ENNA 4ABNA 5KJNA 3RK6A 3UPVA 4I9EA 5AYWD 3APCA 3QWVA 4IYPA 3QDNA 4PUCA 4RSYA 1DNPA 2KATA 2FI7A 4ANVA 4EBAA 2LAHA 2PQRA 3IHYA 2XCBA 2J4BA 3FH7A 4G26A 3CKBA 4ILIA 1HG5A 4A3VA 4AJWA 5LP0A 4NURA 5FQ4A 3QKYA 4AY6A 2VSXE 4J8FA 2FEZA 2XRYA 4U0UA 2X3MA 4M3OA 2J08A 3CVNA 4ANUA 2XPYA 3ZFWA 1XGWA 3LKUA 4ACKA 5T4YA 3I5PA 2ZU6B 4TUUA 3U3WA 4GZ3A 1MHQA 3HVEA 2LSUA 4FU3A 3TXNA 2OV8A 4GAAA 3CVXA 5A6CA 3QOUA 4JHRA 4KVMA 5LFAA 4L2YA 3PREA 4K0RA 4RG9A 4BT9A 4UI9K 4U04A 3FY4A 2XPIA 2NSZA 4DPRA 4PS8A 4EQFA 4JA7A 3OXFA 3SD5A 4AV7A 3ZN3A 4I1MA 3UT4A 1H0AA 5BT1A 5JHBA 2CG2A 4UWKA 3MKQA 5LOZA 1TEZA 4KZ0A 2HYZA 4B0ZA 3G2TA 2Y4UA 1OWMA 3CK7A 3SZ7A 1OUVA 2BF0X 2KM4A 4WWNA 3FU0A 2XGSA 4GCNA 5AENA 4JL0A 3ESLA 2HM8A 3TGOA 4UWHA 2VSOE 4OVVA 3ZVVA 3CHOA 3SF4A 2XGOA 5ANRA 3SI5A 4ILGA 2FO7A 2R59A 2KZTA 4APOA 3JUIA 2VGXB 3B7TA 4PS7A 3R9AB 4H7YA 2XCCA 3D9PA 4KVOA 4DLQA 4FJYA 2VYIA 3QAQA 3EIQC 5DBKA 3FUEA 3LXUX 1S0PA 2IFUA 3NZUA 1EF1C 4GMLA 3ZYQA 3PE4A 2KCLA 2X6JA 2L6JA 3ZW3A 5ARGA 3PE3A 4Q96A 2LO6A 4A1GA 3MKRA 3Q5MA 4PS3A 3ESKA 2J4DA 4J8DA 3TL5A 1OWOA 4R7LA 3KEZA 2XGMA 3MZLB 3LCAA 3PDNA 4UWLA 4UI9J 3HYMB 3FEYA 4JW1A 4AVXA 1OWLA 3D9MA 4FA6A 5EDSA 5LCWC 1HE8A 2E0IA 1ZU2A 2Q7FA 3FU3A 2OOEA 4GB9A 4HORA 1E8XA 3Q15A 3EJNA 3L6AA 2Y3AA 3Q49B 4LUNU 3UUXA 1HZ4A 3LVRE 3HVEB 1IHGA 2C2LA 2WXLA 3CHPA 1YA0A 4AM9A 2QY7A 3FTYA 2V8SE 3ULQA 2PM7A 4EZJA 3RRMB 1NA0A 3O4ZA 4MS6A 4P29A 3IHVA 4G23A 2NXPA 1KT1A 4FHKA 2V4LA 3CLJA 3QJZA 3S7JA 2OVFA 4FHJA 4BX8A 4CGVA 4UI9C 3Q47B 5E75A 2X6KA 3ZRHA 4EECA 4F7AA 3PNTB 3FU5A 4WUYA 3ZXSA 3QWPA 5KJKA 4CT0A 3EDTB 5LX8A 3MV3B 4G25A 3URZA 1TJCA 3U9WA 3GZ2A 5C1DA 2WXMA 2JEKA 2VQ2A 4N39A 5AJDA 3S2AA 1HFAA 1UJJA 3ZPJA 3I4RB 4I9CA 3C98A 4OVUA 3SFZA 4DI3A 3U66A 2WXPA 2A4ZA 3FTXA 1OWNA 4FLBA 4A1SA 3CVPA 2MRIA 4GZCA 2M63A 1DVPA 2RD0A 1IQUA 4JEUA 1W3BA 4U0SA 3KAEA 4GYWA 3JQ1A 4L2LA 4G24A 3S7DA 1NZNA 3FEXA 3SBSA 1HXIA 1ELKA 3GYZA 3ZYMA 2GGFA 2HR2A 3D9OA 4GYOA 4ILHB 4XKBA 4C9BB 4HOUA 1QQEA 2C0MA 2AWIA 4BWRA 2YINA 4WWPA 4Q69A 1L5JA 2FF4A 2WM9A 3B13A 3MA5A 4F3VA 1N54A 3HIZA 4OYSA 4EZKA 3HDXA 3VTYA 3Q4AB 3R7QA 4BTBA 4DK5A 4N3CA 4LERA 4N3BA 5FT9A 3S7FA 4AOFA 4ANWA 2WPVA 4C0MA 4Y6WA 3APDA 3LPZA 3MYVA 4KBQA 4YVOA 1U3DA 3MGBA 3QWWA 3DPDA 4XI9A 2IU1A 4W9RA 3ZIMA 3TJPA 1NP7A 5E76A 3WXXA 1FVFA 3LY9A 3LYAA 1WY6A 4HOSA 3PUKA 4U63A 1HH8A 3CV0A 3PEVB 1H2UA 2X6IA 5D0OD 1E90A 3B7SA 3FHEA 4RVBA 2VSNA 5CMWA 3EIJA 2VTBA 2CHZA 2UY1B 1IQRA 4KXKB 3SGHA 3RJVA 4G1TA 4D10C 3FFLA 4PH4B 4WWOA 4CDNA 3JQ0A 4TV3A 3VLEA 1GW6A 2YHCA 2NC9A 1HU3A 1H19A 4XI0A 3RRUA 1N52A 3EHMA 4GCOA 1OWPA 3L16A 2XPZA 1SQMA 3NF1A 4GZDA 5A7DB 3QK0A 4I6EA 4AXHA 5KCMA 1SZAA 5EKQD 3TXMA 2I9CA 4CDRA 3CHRA 1PAQA 2WXFA 3LVQE 2VTBB 1SZ9A 4LCTA 3APFA 2R17C 5T8IA 2VGXA 4E85A 4HVBA 1NA3A 5CCLA 3UT8A 3ML9A 4FULA 4KMOA 4NACA 3FWVA 1KT0A 3PZDA 3AU5A 5G2NA 3T5XA 3PH0C 1BPOA 1Y6IA 1EPUA 1EDUA 4CRWA 2WVIA 2WXRA 3L08A 2WB2A 3LDZA 4AIFA 2J07A 4U8HA 1H6KA 4I1AA 5FWQA 4JA9A 4WNEA 2LSVA 1A17A 5BUZA 3ASHA 3FDHA 3IEGA 3OAWA 4I1OB 4WNDA 3CSFA 3MKQB 5KJLA 3CVVA 4L23A 4JEHA 3RRNB 4I43A 3P2BA 4GA2A 4JC8A 2WXHA 4Y6CA 2AXZA 4HXIA 3GZ1A 3T5VA 3ENEA 4WNFA 4JHJA 4HS2A 5AJLA 2KCKA 3TAXA 5ARFA 1WAO1 5KJMA 3CHSA 2J09A 2PZIA 1UG3A 4KYOB 4PDXA 1MQSA 3E4BA 4EPZA 5LCWJ 2X6FA 1E8YA 2EQXA 4JPSA 2KZTB 2WQHA 3L13A 3FTUA 4G11A 1IYGA 3AU4A 4FLHA 3CKCA 3FTVA 3G2UA 5BNWA 3CK9A 4WAFA 3RKVA 2YQ8A 3SNXA 1H2TC 2GRLA 3L17A 3RIBA 2R5SA 3D3MA 4NRHB 3BG0B 4CEMA 5C2YA 5JJTA 1E8ZA 1INZA 4AEZC 4FJZA 3SHFA 4HOQA 3ASDA 4ATGA 3K9IA 2WXOA 2LNIA 1E8WA 4UQYA 3PRZA 5A23A 1XNFA 2XHEA 4MRUA 2I2OA 2FBNA 2UY1A 2X6HA 3ASGA 5AIJA 4L1BA 4CDMA 3TG4A 4HFGA 1ELRA 3UX4A 3CVLA 3FTSA 2IOSA 1Y8MA 1JWFA 2X38A 5BW8C 2I6HA 4GA0A 1U3CA 1JWGA 4UWFA 3R7RA 3U64A 3FUIA 1FCHA 2LAIA 3FTZA 2FULA 3LS8A 4FC8A 3BEEA 5FZQA 4BY6A 5JHAA 3PUJA 2IOLA 2WMNA 4G2VA 3SBTB 5HQ8A 2VGYA 4HOTA 2CHXA 3CVUA 1Z3YA 4IULA 5CCMA 3P1UA 2J9QA 2L0IA 1EYHA 3G2SA 4H7XA 4J8EA 4K03A 3T8MA 2WXKA 4BFRA 4DI4A 3G2WA 3ONKA 1HS6A 3KS2A 2GW1A 4O6FA 3ZEFA 4F53A 2L9BA 4LEUA 1JPLA 4I6GA 4JHKA 2OVBA 4GZ5A 1PC2A 1QZ2A 5FQ7A 5G05C 4L7TA 3LY7A 2XQ0A 3MCXA 4ANXA 4GMJA 4MKTA 3D9NA 2DBAA 2MOWA 5BV1A 4BT8A 4BX9A 4GA1A 4QFVA 2ONDA 4GU5A 2Y4TA 2L0TB 3FH8A 5FZRA 4F1SA 5BV0A 3BG1B 5G04J 3CVQA 4AP2A 1E7VA 2KC7A 5D0QD 5DIZA 3RO3A 4B89A 4APFA 4A55A 3D9LA 3FP3A 4I2WA 5BPPA 1UN9A 4UQXA 4XKCA 1HG2A 2VJ8A 3L54A 5M72A 3QNKA 2JLBA 1HO8A 2AXUA 3CEQA 1X5BA 4MLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRN B;  3PEU B;  3RRM B;  3PEV B; 
#chains in the Genus database with same CATH topology
 3TG5 A;  4UWG A;  1UJK A;  3DSX A;  4BTA A;  2R03 A;  5J08 A;  4U07 A;  5J90 A;  3KD7 A;  5CEC B;  3G2V A;  2MHK A;  4FAD A;  3N71 A;  3MV2 B;  4B94 A;  5EIB E;  4IN3 B;  3CST A;  1LD7 A;  3IBE A;  5BXU A;  4J8S A;  1LTX A;  3FUJ A;  2AVP A;  5FJY A;  1VDY A;  3JYS A;  3S7B A;  5FZS A;  3PNL B;  1LF8 A;  1IHB A;  3B7B A;  4RG6 A;  4GYY A;  2AW6 A;  4JB8 P;  5G04 C;  1MX6 A;  2BTD A;  3MX3 A;  4HNA D;  2VGE A;  4N2Q A;  4I17 A;  4AY5 A;  1E96 B;  5AQ9 A;  5CMY A;  4CCA A;  3FUN A;  2WQ6 A;  3O48 A;  3ZUV B;  3B7R L;  4B8C B;  2UWJ G;  1TJF A;  1H2V C;  1S63 A;  5EIL A;  2RKK A;  2R2L A;  2CHW A;  4U0Z A;  2XRZ A;  4IRU A;  2EIN E;  3ZHE B;  1TNY A;  2LXM A;  4DJA A;  4LNB A;  3FUH A;  3PEU B;  2WXG A;  2HO1 A;  3E34 A;  1D8E A;  3IKO B;  4ACL A;  4CT4 A;  2VSY A;  1E7U A;  1YYH A;  4E6H A;  4HQD A;  3UPV A;  4I9E A;  4IYP A;  3QDN A;  2KAT A;  2LAH A;  3IHY A;  5LP0 A;  5FQ4 A;  4AY6 A;  2FEZ A;  4GTQ A;  2X3M A;  2J08 A;  4ANU A;  2XPY A;  3LKU A;  3I5P A;  4GZ3 A;  4FU3 A;  3TXN A;  3CVX A;  1NL4 A;  3QOU A;  5A6C A;  4BT9 A;  4UI9 K;  4U04 A;  4PS8 A;  3OXF A;  3UT4 A;  2P9P G;  5JHB A;  3V31 A;  2BF0 X;  5AEN A;  4JL0 A;  3ESL A;  3UI2 A;  3TGO A;  3ABK E;  3SF4 A;  1KZO A;  3EU5 A;  2VGX B;  1UOH A;  1TNO A;  4X8Q A;  4DLQ A;  2XCC A;  2VYI A;  3QAQ A;  4K5C A;  4TXP A;  3ISM C;  4ZFH A;  3Q75 A;  3ZW3 A;  3T9K A;  5ARG A;  3D9H A;  2J4D A;  3TL5 A;  3DWL G;  4R7L A;  2XGM A;  3LCA A;  1JCR A;  3FEY A;  4FA6 A;  5EDS A;  4GB9 A;  4J7W A;  3LVR E;  4QQI A;  3HVE B;  3CHP A;  3RRM B;  3O4Z A;  4MS6 A;  4P29 A;  1KT1 A;  4G8K A;  3QJZ A;  3S7J A;  4BX8 A;  4FHJ A;  2X6K A;  2KBX A;  4F7A A;  4HBD A;  4G25 A;  3RSE G;  3GZ2 A;  3I4R B;  2Y0B G;  4BES A;  4DI3 A;  2WXP A;  3FTX A;  1OWN A;  4FLB A;  4GZC A;  3ZNG A;  1W3B A;  1NZN A;  1HXI A;  3GYZ A;  3J5Q B;  2GGF A;  3D9O A;  4GMR A;  4GYO A;  4ILH B;  4HOU A;  2C0M A;  2AWI A;  3E32 A;  4BWR A;  1L5J A;  1N4S A;  2FF4 A;  3B13 A;  3MA5 A;  4BEP A;  3HIZ A;  4OYS A;  1MX4 A;  3VTY A;  3R7Q A;  4BTB A;  4N3B A;  4AOF A;  2XS1 A;  4Y6W A;  3MYV A;  4YVO A;  3KEA A;  3MGB A;  3QWW A;  3DPD A;  3LY9 A;  3LYA A;  1WY6 A;  5ENR D;  4HOS A;  4U63 A;  1HH8 A;  3AG3 E;  2V4H C;  5ITZ F;  1H2U A;  5D0O D;  2VSN A;  1TNU A;  4KXK B;  2F0Y A;  3SFX A;  1RZ4 A;  4PH4 B;  2YHC A;  2NC9 A;  3BQO A;  4HB5 A;  1N52 A;  1OWP A;  3NF1 A;  5A7D B;  4AXH A;  2GRR B;  5KCM A;  5EKQ D;  2WXF A;  1SZ9 A;  4LCT A;  5T8I A;  2R17 C;  5CCL A;  3ML9 A;  4KMO A;  1V54 E;  4NAC A;  3PZD A;  1KT0 A;  3PH0 C;  1Y6I A;  1EPU A;  4CZ2 D;  2WVI A;  2WXR A;  2WB2 A;  4J8Y A;  5FWQ A;  4JA9 A;  1A17 A;  3MKQ B;  3CVV A;  4L23 A;  3RRN B;  1OCR E;  2A5E A;  1N9A A;  3HXE A;  3E4B A;  2X6F A;  2KZT B;  4G11 A;  3CKC A;  5BNW A;  3RKV A;  2YQ8 A;  2GRL A;  5EN5 D;  3RIB A;  3D3M A;  3BG0 B;  4AEZ C;  2QYJ A;  4FJZ A;  3SHF A;  3ASD A;  4ATG A;  3K9I A;  2WXO A;  2LNI A;  4MRU A;  2FBN A;  2X6H A;  4L1B A;  1MZC A;  1Y8M A;  5BW8 C;  2I6H A;  1JWG A;  1BI7 B;  5CRU A;  4UUC A;  3FTZ A;  3LS8 A;  2IOL A;  3SBT B;  4DX5 D;  4IUL A;  3DXK G;  4GTO A;  2WXK A;  3G2W A;  4F53 A;  5FQ7 A;  4L7T A;  3LY7 A;  1TN7 A;  4U95 D;  3V79 K;  5ENS D;  5BV1 A;  4BT8 A;  4QFV A;  4DX7 D;  2L0T B;  5EYP F;  3PZ4 A;  4F1S A;  3ABL E;  4AP2 A;  3UKU G;  2KC7 A;  5D0Q D;  3RO3 A;  5BXO A;  3FP3 A;  5BPP A;  3C3R A;  1UN9 A;  1WDY A;  4XKC A;  2H6F A;  4EHM A;  4PUC A;  2F8X K;  1X5B A;  3DBS A;  2WXN A;  3CQC B;  2AXV A;  2C0L A;  1D8D A;  5AQ7 A;  5JJ6 A;  3AS4 A;  3AS8 A;  1KPS B;  3Q73 A;  1Z5S C;  3DXM G;  3ASF A;  1PY1 A;  3MJW A;  3VLF A;  1HX8 A;  5AAO A;  2IY0 C;  2DCP A;  4ME2 A;  4U8V D;  4XE0 A;  3UMV A;  5EYL A;  4YVQ C;  3Q9N C;  1IXV A;  2XEV A;  2DIW A;  1WM5 A;  2A5U A;  4B8A A;  4Q94 A;  2OEV A;  5B3S E;  3QB2 A;  4NQ0 A;  3ZKJ A;  2ZGD A;  3OXG A;  3ZYK A;  3GZS A;  3CHM A;  2WQ7 A;  4GPK A;  4HLL A;  3I3N A;  1UW4 B;  3ZHE A;  3VTX A;  1TYQ G;  2CFU A;  4UQZ A;  2BUG A;  2IJG X;  4GZ6 A;  3CIA A;  3FUF A;  2P9I G;  3LY8 A;  5G05 J;  3C5R A;  2E2E A;  4JXT A;  5ANL A;  5HI7 A;  4YND A;  1KLX A;  1BLX B;  2CG3 A;  2XEH A;  5CHE E;  4TRQ A;  5EX0 A;  3ZYL A;  2WXJ A;  2DWZ A;  5ENN A;  4ABN A;  5KJN A;  2XZD G;  1K1B A;  5AYW D;  1BI8 B;  2PQR A;  2XCB A;  4G26 A;  3CKB A;  1HG5 A;  5B1A E;  3E30 A;  1OY3 D;  3ZFW A;  1K1A A;  4ACK A;  5T4Y A;  3Q79 A;  1N4R A;  2F37 A;  2OV8 A;  4GAA A;  4L2Y A;  4RG9 A;  4M7C A;  4DPR A;  3UM0 A;  3MKQ A;  3G2T A;  3CK7 A;  1OUV A;  1MYO A;  2XGS A;  4GCN A;  3W9F A;  2XGO A;  4APO A;  3JUI A;  4H7Y A;  3D9P A;  4FJY A;  1S70 B;  3LXU X;  3NZU A;  1BD8 A;  3PE4 A;  2KCL A;  2Y69 E;  3TWT A;  2L6J A;  3C72 A;  4Q96 A;  2LO6 A;  3MKR A;  2JAB A;  1Q2Z A;  3EU9 A;  4JW1 A;  4AVX A;  1OWL A;  5LCW C;  1HE8 A;  4OAV B;  4HOR A;  1RW2 A;  3UUX A;  1HZ4 A;  4GPM A;  2WXL A;  1YA0 A;  3FTY A;  1JCQ A;  5FIN A;  1SA4 A;  4C48 B;  4G23 A;  3TWX A;  2NXP A;  3CLJ A;  2OVF A;  4UI9 C;  3Q47 B;  3ZRH A;  4EEC A;  3FU5 A;  4WUY A;  3ZXS A;  3QWP A;  4CT0 A;  3EDT B;  3URZ A;  2WXM A;  2VQ2 A;  5AJD A;  1HFA A;  1UJJ A;  2F8Y A;  4O60 A;  4OVU A;  2AJA A;  3SFZ A;  3U66 A;  2A4Z A;  5D2M C;  3CVP A;  1MX2 A;  3HXD A;  4U0S A;  1D9S A;  3JQ1 A;  4L2L A;  4G24 A;  3Q7A A;  1ELK A;  2ZIS A;  2HR2 A;  4C9B B;  1QQE A;  4Q69 A;  3HDX A;  3BUA A;  4U96 D;  2WPV A;  4C0M A;  3DPY A;  3LPZ A;  4GTP A;  1U3D A;  3WXX A;  1E90 A;  4RVB A;  3EHQ A;  3EIJ A;  2UY1 B;  3SGH A;  4G1T A;  4D10 C;  4CDN A;  1IKN D;  1S64 A;  3EHM A;  3L16 A;  1SQM A;  3QK0 A;  5AQA A;  4CDR A;  3DEP A;  3LVQ E;  4HVB A;  2VGX A;  4FUL A;  3SQV A;  3AU5 A;  5JMN D;  5KWD A;  3T5X A;  1BPO A;  4CRW A;  3DSW A;  3L08 A;  3TWU A;  4LNU D;  3ASH A;  3UXG A;  5KJL A;  4JC8 A;  2WXH A;  4HXI A;  3T5V A;  4WNF A;  5AJL A;  1WAO 1;  4NIK A;  3CHS A;  2PZI A;  4PDX A;  1MQS A;  4F6R D;  1E8Y A;  2WQH A;  1IYG A;  3AG2 E;  4WAF A;  1H2T C;  3TWV A;  1KZP A;  1E8Z A;  4DX1 A;  4HOQ A;  3UIO C;  4U8Y D;  4UQY A;  2FO1 E;  1XNF A;  2XHE A;  3TWR A;  1QBQ A;  4HFG A;  3ULE G;  2X38 A;  4GA0 A;  1U3C A;  1AP7 A;  3U64 A;  1OCO E;  1N95 A;  3T8K A;  2Y1L E;  2DYR E;  3PUJ A;  4HOT A;  4BER A;  2J9Q A;  1EYH A;  2P9L G;  4J8E A;  3UM2 A;  3T8M A;  3ONK A;  1HS6 A;  4O6F A;  4L9P A;  1QZ2 A;  3UIP C;  5G05 C;  1TR4 A;  5KNH D;  4GMJ A;  3DSS A;  4BX9 A;  2EIL E;  1X81 A;  3FH8 A;  5G04 J;  2H6H A;  4APF A;  4A55 A;  3ASN E;  4I2W A;  4UQX A;  5M72 A;  3L54 A;  3QNK A;  2JLB A;  1HO8 A;  3CEQ A;  3AG4 E;  3ZXP A;  2ETC A;  3E33 A;  2V5F A;  3Q7F A;  4GTR A;  4CGW A;  5CBN A;  3B95 A;  3I4G A;  3FU6 A;  4FP7 A;  5HS0 A;  4BSX A;  1JCS A;  3FUL A;  5AAR A;  3RU0 A;  3NQP A;  2V5Q C;  4GTS A;  4LSZ E;  3UIN C;  3QC1 A;  3VLD A;  4EZL A;  3L22 A;  4HRN A;  3HHM A;  3FUD A;  2ETB A;  2ZXW E;  2DVW A;  5FQ8 A;  3ZGQ A;  3AS5 A;  2IO2 C;  2PM6 A;  2WXI A;  1UN8 A;  3FUK A;  3OXL A;  4DLO A;  2EIJ E;  4EBA G;  3NAW A;  3QAR A;  2XEE A;  4XEI G;  1BU9 A;  3FH5 A;  3RO2 A;  4LRZ A;  3LJ3 A;  4WNG A;  3CVW A;  4F1P A;  3JXI A;  4URK A;  5FTP A;  2WMO A;  4O1P A;  3IV0 A;  4XIF A;  3U4T A;  3HXF A;  4KT6 B;  1SW6 A;  3D9J A;  3NOC D;  3JXJ A;  4I2Z A;  3CVY A;  3UQ3 A;  3GW4 A;  2I1K A;  1OCC E;  2ILR A;  3CK8 A;  4N3A A;  2PNN A;  3QWV A;  4RSY A;  1DNP A;  4EBA A;  4YDW A;  3NB2 A;  3FH7 A;  3SO8 A;  3UTM A;  4NUR A;  3QKY A;  2DZN A;  2VSX E;  4J8F A;  2XRY A;  4U0U A;  4M3O A;  3CVN A;  2XZT G;  2B0O E;  2NYJ A;  4MBG A;  4TUU A;  1OXJ A;  3U3W A;  1MHQ A;  2OEW A;  4K0R A;  2DYS E;  1H6O A;  2XPI A;  4JA7 A;  3SD5 A;  4N5Q A;  4I1M A;  3KSQ A;  5LOZ A;  3PZ1 A;  4B0Z A;  2R02 A;  1OWM A;  3SZ7 A;  4ZHB A;  3ZVV A;  2H6G A;  2QC9 A;  5ANR A;  4G8L A;  2R59 A;  2H6I A;  2KZT A;  3DEO A;  4PS7 A;  1H6P A;  1S0P A;  4GML A;  3ZYQ A;  4Z68 A;  2X6J A;  3PE3 A;  4A1G A;  4PS3 A;  4J8D A;  1OWO A;  3KEZ A;  3J5P A;  3PDN A;  4UWL A;  4UI9 J;  3HYM B;  1DC2 A;  4TXR A;  3NBN B;  2QZA A;  3D9M A;  2GRO B;  3C3Q A;  1ZU2 A;  3FU3 A;  2OOE A;  1E8X A;  2R05 A;  3Q15 A;  3EJN A;  3L6A A;  2Y3A A;  1IHG A;  1U2V G;  2BED A;  2V8S E;  2GRQ B;  2PM7 A;  1NA0 A;  1V55 E;  3V2O A;  5CER B;  5E75 A;  3PNT B;  5KJK A;  4HRL A;  3MV3 B;  5LX8 A;  3U9W A;  5C1D A;  2JEK A;  1SA5 A;  4I9C A;  3C98 A;  1K3Z D;  5H7P A;  4A1S A;  1DVP A;  2RD0 A;  1IQU A;  4JEU A;  3KAE A;  4GYW A;  3S7D A;  3UKR G;  3SBS A;  5KJM A;  3ZYM A;  3F6Q A;  2WM9 A;  4F3V A;  4O1O A;  4EZK A;  3Q4A B;  4DK5 A;  4N3C A;  4LER A;  5FT9 A;  3S7F A;  1N11 A;  2P9S G;  4XI9 A;  3DST A;  2IU1 A;  3ZIM A;  5CED B;  2LUH A;  3B7S A;  3X2Q E;  5CMW A;  2VTB A;  1ZB1 A;  3RAU A;  2KXP C;  3RJV A;  4WWO A;  4TV3 A;  3VLE A;  1HU3 A;  4XI0 A;  4GCO A;  5B1B E;  4GZD A;  1TNZ A;  3TXM A;  2VTB B;  2P9U G;  2GRN B;  3HXB A;  3APF A;  1K8K G;  3NOG D;  3FWV A;  1O1S A;  1EDU A;  2XEN A;  3LDZ A;  2BKK B;  4U8H A;  4DX2 A;  2ZIR A;  3AJI A;  5BUZ A;  3CSF A;  3V30 A;  4GA2 A;  4Y6C A;  2AXZ A;  4JHJ A;  4HS2 A;  3R9M A;  3TAX A;  3ZU7 B;  2J09 A;  4EPZ A;  1UG3 A;  4KYO B;  4K5B A;  2EQX A;  5D66 A;  3L13 A;  3FTU A;  3KSL A;  3CK9 A;  3SNX A;  3L17 A;  2R5S A;  4NRH B;  5C2Y A;  5JJT A;  1INZ A;  1OCZ E;  3C3O A;  5A23 A;  3ASG A;  5AIJ A;  4CDM A;  1N4Q A;  4OAU C;  4LG6 A;  3CVL A;  2IOS A;  1JWF A;  4UWF A;  3R7R A;  2LAI A;  2FUL A;  3BEE A;  4DUI A;  4HRM B;  4G2V A;  2LXL A;  3CVU A;  5CCM A;  1TN6 A;  2DZO A;  3G2S A;  2RFM A;  4BFR A;  3HRA A;  3TWW A;  3PZ2 A;  2L9B A;  2ZGG A;  4JHK A;  2OVB A;  1PC2 A;  3W9G A;  2MYO A;  2MOW A;  4A63 B;  2OND A;  2Y4T A;  5BV0 A;  5FZR A;  3BG1 B;  3CVQ A;  2P9N G;  4YDE A;  1E7V A;  5AN8 A;  3D9L A;  4JD2 G;  1HG2 A;  3PZ3 A;  3ONL A;  4J0U A;  1TNB A;  2J49 A;  1YCS B;  1Z6T A;  2PQN A;  4HLE A;  4XX5 A;  1B89 A;  3B7U X;  4JVS A;  2P2C P;  5T3R A;  5ENT D;  5IY5 E;  2QFC A;  3UT7 A;  1ZBP A;  1ELW A;  4XZ4 A;  3PVL A;  2V0P A;  1NFI E;  2WXQ A;  2P58 C;  3PS6 A;  4JZY A;  2J8S D;  4A3T A;  2PL2 A;  3FTW A;  1HF8 A;  4U7E B;  2QYU A;  4B93 B;  4KZC A;  1N94 A;  4N5C A;  3NZS A;  3CR3 A;  4ATZ D;  3V2X A;  5JJ7 A;  1JUQ A;  3D9I A;  2YNQ A;  3CQG B;  5HRY A;  3OTN A;  3FUM A;  1QNF A;  3D9K A;  3ML8 A;  5G55 A;  5KNG A;  4N2S A;  2IF4 A;  5ENQ D;  1FVH A;  2KCV A;  2CFZ A;  4V3I A;  4J6I A;  4C0E A;  3MEK A;  2ION A;  1N0R A;  2GRM A;  2I1J A;  3BU8 A;  5CBO A;  5FQ6 A;  2YHE A;  3LEW A;  3EHN A;  1Z3X A;  3HXC A;  3DRA A;  3CHQ A;  4I6J A;  3JCK C;  1P5Q A;  1TN8 A;  2IQC A;  3CGH A;  2RG8 A;  5EX3 A;  1AWC B;  1FT2 A;  3RK6 A;  1YMP A;  3APC A;  5HKP A;  3TWS A;  2FI7 A;  4ANV A;  2IO3 C;  2J4B A;  5ENO D;  5KBA A;  4A3V A;  4ILI A;  4AJW A;  3UM3 A;  3E37 A;  1MJ0 A;  3AG1 E;  1XGW A;  3SFY A;  2ZU6 B;  3HVE A;  2LSU A;  3EUV A;  4KVM A;  4JHR A;  5LFA A;  5JA4 D;  3PRE A;  4TUM A;  3FY4 A;  2NSZ A;  4EQF A;  4AV7 A;  3ZN3 A;  1H0A A;  4TXQ A;  1G3N B;  5BT1 A;  2CG2 A;  4UWK A;  5ENP D;  1TEZ A;  4KZ0 A;  1A5E A;  2HYZ A;  1N0Q A;  2Y4U A;  2KM4 A;  4WWN A;  3FU0 A;  2HM8 A;  4UWH A;  2VSO E;  4OVV A;  3CHO A;  4LNG A;  3SI5 A;  4ILG A;  2FO7 A;  3B7T A;  3R9A B;  4KVO A;  5DBK A;  3EIQ C;  3FUE A;  4CYM D;  4K5A B;  2IFU A;  4RQI A;  1EF1 C;  3Q5M A;  3ESK A;  3MZL B;  2EIM E;  2E0I A;  2Q7F A;  3Q49 B;  4LUN U;  5CRV A;  2C2L A;  2EIK E;  2OCC E;  4AM9 A;  2QY7 A;  5AQB A;  3ULQ A;  4EZJ A;  3HG0 D;  3Q9U C;  3IHV A;  4FHK A;  2V4L A;  2RFA A;  4CGV A;  1LD8 A;  1TJC A;  4N39 A;  3S2A A;  5EID A;  3ZPJ A;  2IEJ A;  1DCQ A;  3TWQ A;  2MRI A;  2M63 A;  1WG0 A;  2ETA A;  3EHR A;  3FEX A;  4XKB A;  2YIN A;  4WWP A;  3UM1 A;  1N54 A;  1O1T A;  4ANW A;  2XS8 A;  5FIO A;  3APD A;  4KBQ A;  4W9R A;  3TJP A;  1NP7 A;  5E76 A;  1FVF A;  3PUK A;  3CV0 A;  3PEV B;  1OT8 A;  2X6I A;  3FHE A;  2HE0 A;  2CHZ A;  1IQR A;  3FFL A;  3JQ0 A;  1GW6 A;  3RRU A;  1H19 A;  1SVX A;  2XPZ A;  4BET A;  4I6E A;  1SZA A;  2I9C A;  3CHR A;  1PAQ A;  4E85 A;  1NA3 A;  3UT8 A;  5G2N A;  3LJN A;  4DX6 D;  4AIF A;  2J07 A;  1H6K A;  4I1A A;  4WNE A;  2LSV A;  2L6B A;  2P9K G;  3FDH A;  3IEG A;  3OAW A;  4I1O B;  4WND A;  3WG7 E;  1DCE A;  4JEH A;  4I43 A;  3P2B A;  5CEA A;  3DSU A;  3IXE A;  3GZ1 A;  3ENE A;  2KCK A;  1N4P A;  5ARF A;  5LCW J;  3JUE A;  4GTV A;  4JPS A;  3AU4 A;  4FLH A;  3FTV A;  3G2U A;  3ABM E;  4CEM A;  2B6C A;  2BKG A;  4HI9 A;  3Q78 A;  4YDO A;  1E8W A;  1FPP A;  3PRZ A;  1O5M A;  2I2O A;  2UY1 A;  1O1R A;  3TG4 A;  1ELR A;  3UX4 A;  3FTS A;  4GTM A;  3FUI A;  1FCH A;  4BY6 A;  5FZQ A;  4FC8 A;  5JHA A;  1QYM A;  3ASO E;  4RLY A;  4YDY A;  2WMN A;  5HQ8 A;  2VGY A;  3SY2 A;  1FT1 A;  2CHX A;  1Z3Y A;  3P1U A;  2L0I A;  4H7X A;  4K03 A;  3L82 A;  4DI4 A;  4BSZ B;  3KS2 A;  4DRX E;  2GW1 A;  3ZEF A;  4LEU A;  1JPL A;  4I6G A;  4GZ5 A;  2GRP B;  4ANX A;  3MCX A;  2XQ0 A;  4MKT A;  3D9N A;  2DBA A;  4HI8 A;  1NI1 A;  3DSV A;  4GA1 A;  4GU5 A;  4GTT A;  3ULY A;  4B89 A;  5DIZ A;  2VJ8 A;  3L9T A;  3AAA C;  2AXU A;  4MLP A; 
#chains in the Genus database with same CATH homology
 3DBS A;  2V5F A;  3TG5 A;  2WXN A;  4UWG A;  3CQC B;  2AXV A;  2C0L A;  3ONL A;  1UJK A;  4J0U A;  4BTA A;  2J49 A;  5JJ6 A;  1Z6T A;  4CGW A;  2PQN A;  3AS4 A;  5J08 A;  3I4G A;  3FU6 A;  4FP7 A;  3AS8 A;  4U07 A;  4XX5 A;  4HLE A;  1B89 A;  3B7U X;  3KD7 A;  4JVS A;  3G2V A;  5J90 A;  4BSX A;  5T3R A;  3FUL A;  3RU0 A;  2QFC A;  3UT7 A;  2MHK A;  4FAD A;  3ASF A;  1PY1 A;  3MJW A;  3NQP A;  1ZBP A;  1ELW A;  3N71 A;  3VLF A;  4XZ4 A;  3PVL A;  3MV2 B;  2V0P A;  2WXQ A;  4B94 A;  2P58 C;  1HX8 A;  3PS6 A;  4JZY A;  4A3T A;  2DCP A;  2PL2 A;  4ME2 A;  3FTW A;  1HF8 A;  4XE0 A;  3QC1 A;  3UMV A;  3VLD A;  4IN3 B;  3L22 A;  4KZC A;  4EZL A;  4YVQ C;  4N5C A;  3NZS A;  3CST A;  3HHM A;  3IBE A;  4J8S A;  3FUD A;  3FUJ A;  3CR3 A;  2XEV A;  2DIW A;  1WM5 A;  5JJ7 A;  1JUQ A;  2AVP A;  3D9I A;  5FJY A;  2YNQ A;  1VDY A;  3JYS A;  3CQG B;  3OTN A;  3S7B A;  2A5U A;  3FUM A;  5FQ8 A;  5FZS A;  1QNF A;  3ZGQ A;  4B8A A;  4Q94 A;  3AS5 A;  3D9K A;  3PNL B;  3QB2 A;  4NQ0 A;  3ML8 A;  1LF8 A;  3ZYK A;  3OXG A;  3GZS A;  5G55 A;  2PM6 A;  3CHM A;  4N2S A;  2WXI A;  4RG6 A;  2IF4 A;  1UN8 A;  2WQ7 A;  4GPK A;  3FUK A;  4GYY A;  2AW6 A;  3OXL A;  5G04 C;  2BTD A;  3I3N A;  3MX3 A;  1UW4 B;  4DLO A;  1FVH A;  3ZHE A;  3VTX A;  4EBA G;  2KCV A;  2CFZ A;  3QAR A;  2CFU A;  4UQZ A;  4I17 A;  4V3I A;  4N2Q A;  4AY5 A;  4J6I A;  1E96 B;  4C0E A;  2BUG A;  2IJG X;  4GZ6 A;  3FH5 A;  3RO2 A;  3CIA A;  3FUF A;  2ION A;  3MEK A;  4LRZ A;  2GRM A;  5CMY A;  3LY8 A;  3LJ3 A;  4WNG A;  3CVW A;  2I1J A;  5G05 J;  4CCA A;  2E2E A;  3FUN A;  4JXT A;  2WQ6 A;  3O48 A;  5ANL A;  5HI7 A;  4URK A;  5FTP A;  3B7R L;  4B8C B;  2UWJ G;  1TJF A;  2WMO A;  5FQ6 A;  2YHE A;  4YND A;  3LEW A;  1KLX A;  1H2V C;  3EHN A;  2CG3 A;  1Z3X A;  2CHW A;  4U0Z A;  3IV0 A;  4IRU A;  2XRZ A;  4XIF A;  5CHE E;  4TRQ A;  3U4T A;  3CHQ A;  4I6J A;  4KT6 B;  3ZHE B;  3D9J A;  3JCK C;  1P5Q A;  4DJA A;  4I2Z A;  3FUH A;  3PEU B;  3CVY A;  2WXG A;  5EX0 A;  3UQ3 A;  2IQC A;  3GW4 A;  2HO1 A;  2I1K A;  3ZYL A;  3IKO B;  2WXJ A;  2ILR A;  2VSY A;  4ACL A;  1E7U A;  3CGH A;  2RG8 A;  4CT4 A;  5EX3 A;  3CK8 A;  4E6H A;  4N3A A;  5ENN A;  4ABN A;  5KJN A;  3RK6 A;  3UPV A;  4I9E A;  5AYW D;  3APC A;  3QWV A;  4IYP A;  3QDN A;  4PUC A;  4RSY A;  1DNP A;  2KAT A;  2FI7 A;  4ANV A;  4EBA A;  2LAH A;  2PQR A;  3IHY A;  2XCB A;  2J4B A;  3FH7 A;  4G26 A;  3CKB A;  4ILI A;  1HG5 A;  4A3V A;  4AJW A;  5LP0 A;  4NUR A;  5FQ4 A;  3QKY A;  4AY6 A;  2VSX E;  4J8F A;  2FEZ A;  2XRY A;  4U0U A;  2X3M A;  4M3O A;  2J08 A;  3CVN A;  4ANU A;  2XPY A;  3ZFW A;  1XGW A;  3LKU A;  4ACK A;  5T4Y A;  3I5P A;  2ZU6 B;  4TUU A;  3U3W A;  4GZ3 A;  1MHQ A;  3HVE A;  2LSU A;  4FU3 A;  3TXN A;  2OV8 A;  4GAA A;  3CVX A;  5A6C A;  3QOU A;  4JHR A;  4KVM A;  5LFA A;  4L2Y A;  3PRE A;  4K0R A;  4RG9 A;  4BT9 A;  4UI9 K;  4U04 A;  3FY4 A;  2XPI A;  2NSZ A;  4DPR A;  4PS8 A;  4EQF A;  4JA7 A;  3OXF A;  3SD5 A;  4AV7 A;  3ZN3 A;  4I1M A;  3UT4 A;  1H0A A;  5BT1 A;  5JHB A;  2CG2 A;  4UWK A;  3MKQ A;  5LOZ A;  1TEZ A;  4KZ0 A;  2HYZ A;  4B0Z A;  3G2T A;  2Y4U A;  1OWM A;  3CK7 A;  3SZ7 A;  1OUV A;  2BF0 X;  2KM4 A;  4WWN A;  3FU0 A;  2XGS A;  4GCN A;  5AEN A;  4JL0 A;  3ESL A;  2HM8 A;  3TGO A;  4UWH A;  2VSO E;  4OVV A;  3ZVV A;  3CHO A;  3SF4 A;  2XGO A;  5ANR A;  3SI5 A;  4ILG A;  2FO7 A;  2R59 A;  2KZT A;  4APO A;  3JUI A;  2VGX B;  3B7T A;  4PS7 A;  3R9A B;  4H7Y A;  2XCC A;  3D9P A;  4KVO A;  4DLQ A;  4FJY A;  2VYI A;  3QAQ A;  3EIQ C;  5DBK A;  3FUE A;  3LXU X;  1S0P A;  2IFU A;  3NZU A;  1EF1 C;  4GML A;  3ZYQ A;  3PE4 A;  2KCL A;  2X6J A;  2L6J A;  3ZW3 A;  5ARG A;  3PE3 A;  4Q96 A;  2LO6 A;  4A1G A;  3MKR A;  3Q5M A;  4PS3 A;  3ESK A;  2J4D A;  4J8D A;  3TL5 A;  1OWO A;  4R7L A;  3KEZ A;  2XGM A;  3MZL B;  3LCA A;  3PDN A;  4UWL A;  4UI9 J;  3HYM B;  3FEY A;  4JW1 A;  4AVX A;  1OWL A;  3D9M A;  4FA6 A;  5EDS A;  5LCW C;  1HE8 A;  2E0I A;  1ZU2 A;  2Q7F A;  3FU3 A;  2OOE A;  4GB9 A;  4HOR A;  1E8X A;  3Q15 A;  3EJN A;  3L6A A;  2Y3A A;  3Q49 B;  4LUN U;  3UUX A;  1HZ4 A;  3LVR E;  3HVE B;  1IHG A;  2C2L A;  2WXL A;  3CHP A;  1YA0 A;  4AM9 A;  2QY7 A;  3FTY A;  2V8S E;  3ULQ A;  2PM7 A;  4EZJ A;  3RRM B;  1NA0 A;  3O4Z A;  4MS6 A;  4P29 A;  3IHV A;  4G23 A;  2NXP A;  1KT1 A;  4FHK A;  2V4L A;  3CLJ A;  3QJZ A;  3S7J A;  2OVF A;  4FHJ A;  4BX8 A;  4CGV A;  4UI9 C;  3Q47 B;  5E75 A;  2X6K A;  3ZRH A;  4EEC A;  4F7A A;  3PNT B;  3FU5 A;  4WUY A;  3ZXS A;  3QWP A;  5KJK A;  4CT0 A;  3EDT B;  5LX8 A;  3MV3 B;  4G25 A;  3URZ A;  1TJC A;  3U9W A;  3GZ2 A;  5C1D A;  2WXM A;  2JEK A;  2VQ2 A;  4N39 A;  5AJD A;  3S2A A;  1HFA A;  1UJJ A;  3ZPJ A;  3I4R B;  4I9C A;  3C98 A;  4OVU A;  3SFZ A;  4DI3 A;  3U66 A;  2WXP A;  2A4Z A;  3FTX A;  1OWN A;  4FLB A;  4A1S A;  3CVP A;  2MRI A;  4GZC A;  2M63 A;  1DVP A;  2RD0 A;  1IQU A;  4JEU A;  1W3B A;  4U0S A;  3KAE A;  4GYW A;  3JQ1 A;  4L2L A;  4G24 A;  3S7D A;  1NZN A;  3FEX A;  3SBS A;  1HXI A;  1ELK A;  3GYZ A;  3ZYM A;  2GGF A;  2HR2 A;  3D9O A;  4GYO A;  4ILH B;  4XKB A;  4C9B B;  4HOU A;  1QQE A;  2C0M A;  2AWI A;  4BWR A;  2YIN A;  4WWP A;  4Q69 A;  1L5J A;  2FF4 A;  2WM9 A;  3B13 A;  3MA5 A;  4F3V A;  1N54 A;  3HIZ A;  4OYS A;  4EZK A;  3HDX A;  3VTY A;  3Q4A B;  3R7Q A;  4BTB A;  4DK5 A;  4N3C A;  4LER A;  4N3B A;  5FT9 A;  3S7F A;  4AOF A;  4ANW A;  2WPV A;  4C0M A;  4Y6W A;  3APD A;  3LPZ A;  3MYV A;  4KBQ A;  4YVO A;  1U3D A;  3MGB A;  3QWW A;  3DPD A;  4XI9 A;  2IU1 A;  4W9R A;  3ZIM A;  3TJP A;  1NP7 A;  5E76 A;  3WXX A;  1FVF A;  3LY9 A;  3LYA A;  1WY6 A;  4HOS A;  3PUK A;  4U63 A;  1HH8 A;  3CV0 A;  3PEV B;  1H2U A;  2X6I A;  5D0O D;  1E90 A;  3B7S A;  3FHE A;  4RVB A;  2VSN A;  5CMW A;  3EIJ A;  2VTB A;  2CHZ A;  2UY1 B;  1IQR A;  4KXK B;  3SGH A;  3RJV A;  4G1T A;  4D10 C;  3FFL A;  4PH4 B;  4WWO A;  4CDN A;  3JQ0 A;  4TV3 A;  3VLE A;  1GW6 A;  2YHC A;  2NC9 A;  1HU3 A;  1H19 A;  4XI0 A;  3RRU A;  1N52 A;  3EHM A;  4GCO A;  1OWP A;  3L16 A;  2XPZ A;  1SQM A;  3NF1 A;  4GZD A;  5A7D B;  3QK0 A;  4I6E A;  4AXH A;  5KCM A;  1SZA A;  5EKQ D;  3TXM A;  2I9C A;  4CDR A;  3CHR A;  1PAQ A;  2WXF A;  3LVQ E;  2VTB B;  1SZ9 A;  4LCT A;  3APF A;  2R17 C;  5T8I A;  2VGX A;  4E85 A;  4HVB A;  1NA3 A;  5CCL A;  3UT8 A;  3ML9 A;  4FUL A;  4KMO A;  4NAC A;  3FWV A;  1KT0 A;  3PZD A;  3AU5 A;  5G2N A;  3T5X A;  3PH0 C;  1BPO A;  1Y6I A;  1EPU A;  1EDU A;  4CRW A;  2WVI A;  2WXR A;  3L08 A;  2WB2 A;  3LDZ A;  4AIF A;  2J07 A;  4U8H A;  1H6K A;  4I1A A;  5FWQ A;  4JA9 A;  4WNE A;  2LSV A;  1A17 A;  5BUZ A;  3ASH A;  3FDH A;  3IEG A;  3OAW A;  4I1O B;  4WND A;  3CSF A;  3MKQ B;  5KJL A;  3CVV A;  4L23 A;  4JEH A;  3RRN B;  4I43 A;  3P2B A;  4GA2 A;  4JC8 A;  2WXH A;  4Y6C A;  2AXZ A;  4HXI A;  3GZ1 A;  3T5V A;  3ENE A;  4WNF A;  4JHJ A;  4HS2 A;  5AJL A;  2KCK A;  3TAX A;  5ARF A;  1WAO 1;  5KJM A;  3CHS A;  2J09 A;  2PZI A;  1UG3 A;  4KYO B;  4PDX A;  1MQS A;  3E4B A;  4EPZ A;  5LCW J;  2X6F A;  1E8Y A;  2EQX A;  4JPS A;  2KZT B;  2WQH A;  3L13 A;  3FTU A;  4G11 A;  1IYG A;  3AU4 A;  4FLH A;  3CKC A;  3FTV A;  3G2U A;  5BNW A;  3CK9 A;  4WAF A;  3RKV A;  2YQ8 A;  3SNX A;  1H2T C;  2GRL A;  3L17 A;  3RIB A;  2R5S A;  3D3M A;  4NRH B;  3BG0 B;  4CEM A;  5C2Y A;  5JJT A;  1E8Z A;  1INZ A;  4AEZ C;  4FJZ A;  3SHF A;  4HOQ A;  3ASD A;  4ATG A;  3K9I A;  2WXO A;  2LNI A;  1E8W A;  4UQY A;  3PRZ A;  5A23 A;  1XNF A;  2XHE A;  4MRU A;  2I2O A;  2FBN A;  2UY1 A;  2X6H A;  3ASG A;  5AIJ A;  4L1B A;  4CDM A;  3TG4 A;  4HFG A;  1ELR A;  3UX4 A;  3CVL A;  3FTS A;  2IOS A;  1Y8M A;  1JWF A;  2X38 A;  5BW8 C;  2I6H A;  4GA0 A;  1U3C A;  1JWG A;  4UWF A;  3R7R A;  3U64 A;  3FUI A;  1FCH A;  2LAI A;  3FTZ A;  2FUL A;  3LS8 A;  4FC8 A;  3BEE A;  5FZQ A;  4BY6 A;  5JHA A;  3PUJ A;  2IOL A;  2WMN A;  4G2V A;  3SBT B;  5HQ8 A;  2VGY A;  4HOT A;  2CHX A;  3CVU A;  1Z3Y A;  4IUL A;  5CCM A;  3P1U A;  2J9Q A;  2L0I A;  1EYH A;  3G2S A;  4H7X A;  4J8E A;  4K03 A;  3T8M A;  2WXK A;  4BFR A;  4DI4 A;  3G2W A;  3ONK A;  1HS6 A;  3KS2 A;  2GW1 A;  4O6F A;  3ZEF A;  4F53 A;  2L9B A;  4LEU A;  1JPL A;  4I6G A;  4JHK A;  2OVB A;  4GZ5 A;  1PC2 A;  1QZ2 A;  5FQ7 A;  5G05 C;  4L7T A;  3LY7 A;  2XQ0 A;  3MCX A;  4ANX A;  4GMJ A;  4MKT A;  3D9N A;  2DBA A;  2MOW A;  5BV1 A;  4BT8 A;  4BX9 A;  4GA1 A;  4QFV A;  2OND A;  4GU5 A;  2Y4T A;  2L0T B;  3FH8 A;  5FZR A;  4F1S A;  5BV0 A;  3BG1 B;  5G04 J;  3CVQ A;  4AP2 A;  1E7V A;  2KC7 A;  5D0Q D;  5DIZ A;  3RO3 A;  4B89 A;  4APF A;  4A55 A;  3D9L A;  3FP3 A;  4I2W A;  5BPP A;  1UN9 A;  4UQX A;  4XKC A;  1HG2 A;  2VJ8 A;  3L54 A;  5M72 A;  3QNK A;  2JLB A;  1HO8 A;  2AXU A;  3CEQ A;  1X5B A;  4MLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...