3PEVB

S. cerevisiae dbp5 l327v c-terminal domain bound to gle1 and ip6
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
b'TNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
total genus 108
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pevB00
3RRMB 3PEVB 3RRNB 3PEUB
chains in the Genus database with same CATH superfamily
1FVHA 3FTZA 4GTSA 4CT0A 1SA5A 3D9IA 3B7TA 3ULQA 4CYMD 4UQYA 4BETA 1H19A 3KS2A 2WXLA 1TNBA 4KZCA 1GW6A 1UN8A 4WNDA 4IULA 5KJKA 3RU0A 4GMRA 3EDTB 4EHMA 3LPZA 4AOFA 4ACKA 3TWWA 4BFRA 4AVXA 4I17A 1JWGA 4YDOA 2QYJA 3F6QA 5CCMA 4DRXE 3RK6A 4NQ0A 5D0OD 1UOHA 3CLJA 1IYGA 3FH7A 3QDNA 2MRIA 3BG1B 1V54E 3BEEA 1E96B 4C48B 2BEDA 3SQVA 4HRNA 2KCKA 3UM2A 5FTPA 3B13A 2BF0X 4TRQA 3J5PA 3QAQA 5EDSA 2WXQA 2ILRA 3HYMB 3MEKA 4RG6A 4LNUD 1ELKA 4G11A 3T9KA 5IY5E 2OEWA 4U0UA 3Q73A 4GYWA 3ULEG 4U7EB 3MV3B 5EIBE 4Y6CA 3PVLA 1OCZE 3NOGD 1JUQA 3FP3A 1IHGA 2A5UA 4GZ6A 1N0RA 3B7RL 4JW1A 3RRNB 4GZ3A 3UM3A 3EU9A 1MZCA 3DSXA 3QKYA 3TWUA 2PQRA 4DPRA 3MKQA 3DWLG 3JYSA 1HO8A 2XZTG 5ANRA 5FQ7A 2KCVA 3S2AA 3WXXA 3FU6A 3G2SA 2WM9A 4ME2A 4WNFA 4A55A 3I4GA 4B8AA 4BESA 3D9KA 3CHPA 5LCWC 4BWRA 1EDUA 3E30A 3D9LA 4DI4A 2X6HA 3E33A 3CIAA 5HRYA 3C3OA 4QFVA 3QJZA 4G8LA 1OWNA 2ZGGA 3FUNA 3PE4A 2FO7A 5EILA 4FA6A 1QBQA 3SFXA 1OXJA 1TYQG 3UT8A 1OWMA 2IY0C 2WXRA 3DSVA 2I9CA 5BV0A 4HQDA 1YMPA 2VJ8A 3S7FA 5KCMA 2F37A 3C5RA 2OCCE 2NYJA 1Z6TA 3TWXA 3GZ1A 4EQFA 3ZYLA 2FF4A 3V2XA 4WAFA 4BX9A 3PZDA 3UINC 5CMYA 2L0IA 2OVBA 1O5MA 4FJYA 4IN3B 4O6FA 5A23A 4N3BA 1TN7A 3OXFA 2J9QA 2GGFA 2JEKA 4LNBA 1FVFA 4WUYA 3K9IA 4EPZA 4MLPA 4CRWA 1WY6A 4N5CA 1H2UA 1WDYA 3IHYA 1OCCE 3TXNA 2WQ6A 1FPPA 4URKA 4I2ZA 4GZCA 1ZB1A 4JPSA 5J90A 4RSYA 3HXFA 3FUEA 2DYRE 5ENTD 3EIJA 3AG1E 4KT6B 5JJTA 1LTXA 1HG2A 2XEHA 3U4TA 2R05A 1HG5A 4K5AB 3BU8A 4K0RA 3UIPC 3CSTA 4YDWA 2ZISA 3SHFA 2EQXA 1KLXA 2RG8A 4FHKA 4DJAA 1H0AA 4KVOA 2LSUA 1ELRA 1S63A 2J07A 3MGBA 2IQCA 4GB9A 4PS8A 1HX8A 4UQXA 4ANUA 3ZW3A 4XKCA 5EYPF 3QB2A 3ZUVB 4YNDA 4BY6A 4HI8A 2LNIA 3RO3A 4FULA 4A63B 3L22A 4G8KA 1H6KA 3JCKC 2OOEA 4HXIA 3FULA 2QFCA 2ONDA 4GA1A 2V8SE 3Q49B 4BTAA 4I9EA 4Q96A 3L16A 4A1SA 4CDNA 1JCSA 1N0QA 3DXMG 3CVYA 3ZKJA 4N39A 3NBNB 3O4ZA 4H7YA 2CHXA 2IO2C 3PREA 1OWLA 2RKKA 4JL0A 1U2VG 3V30A 1DCEA 4LCTA 4EECA 4L2LA 2EIKE 1DVPA 4UUCA 2LXLA 2MOWA 2AXVA 2J4DA 3N71A 3ASOE 4L23A 3ESKA 4AXHA 4PS7A 4Z68A 3KEAA 5FIOA 3B7SA 2KBXA 1RW2A 3TAXA 2KC7A 2X6FA 4CDMA 3ZNGA 3ZYMA 3AU5A 3SZ7A 3B7BA 4GTRA 2GW1A 3UKUG 2CFUA 2VTBB 3P1UA 3ZYKA 3CQCB 3UX4A 2F8XK 2C0LA 3ML9A 1EF1C 2Y3AA 2NSZA 4H7XA 4L1BA 2I1KA 1TR4A 1Z3YA 4YVQC 2Q7FA 1O1SA 2IF4A 2FULA 4LSZE 1MX2A 3HRAA 1KZPA 2FEZA 1NL4A 5T8IA 3Q75A 2XPYA 4ILGA 1E8WA 3AS8A 4HVBA 3JUIA 2WXKA 3TWRA 2CHWA 4HI9A 3L08A 4J8DA 1BU9A 4X8QA 1EPUA 1S0PA 3APCA 2IOLA 2DZOA 2EIJE 3ABME 4I2WA 4DX2A 2WXOA 3X2QE 3ASGA 5G04C 4HS2A 1WG0A 2H6HA 3D9JA 3D9MA 2KZTA 4DX6D 5FZRA 4DLOA 2X6JA 1E90A 4FJZA 4KBQA 5LFAA 2IFUA 2PL2A 3KD7A 3PZ3A 3FTVA 4JHKA 5CBNA 4TXPA 2AXZA 4RLYA 2E0IA 2A4ZA 1K1BA 3E34A 2R2LA 4IYPA 1IQRA 4I6EA 5E76A 2BKGA 1S64A 2CFZA 2UY1A 1SA4A 3IEGA 2EILE 4BERA 4R7LA 1O1RA 2GRQB 2KM4A 3ZIMA 2J08A 5BW8C 2WQ7A 5HQ8A 4APOA 2AWIA 4BT8A 5AARA 3TXMA 3DPYA 1N4PA 1Y8MA 1U3CA 1TNZA 5FT9A 4UWFA 3E37A 5DBKA 4I1MA 3NB2A 4YDEA 4LERA 3EHQA 3IHVA 2VGXB 1HFAA 4B0ZA 4HLLA 3LVRE 4LEUA 1HE8A 3VLFA 3TWVA 1IXVA 2WQHA 4FLBA 1MHQA 3ESLA 2A5EA 2R17C 2QYUA 2IOSA 4HOTA 1H2TC 4AV7A 3I5PA 3CVXA 3E32A 3CV0A 1SZAA 3GZSA 1AP7A 3C72A 4U8YD 1BLXB 1SZ9A 3UT7A 2M63A 3DSWA 3KSLA 5ANLA 3NZSA 4DX7D 1HZ4A 3FUFA 3D9OA 3CVLA 5AJDA 3FH5A 5B1BE 1E8ZA 2V5QC 3AAAC 1E8YA 3TWTA 5AENA 3Q9NC 3SGHA 3LY7A 3OTNA 1N94A 2P9LG 2P9UG 4N2SA 3MV2B 4F1SA 3FUKA 2BUGA 2ETBA 5ARFA 1TNOA 4HBDA 1QQEA 4XIFA 3WG7E 3SO8A 2ZIRA 2LSVA 4J8EA 4GTOA 3T5XA 3HXBA 3JQ0A 5EYLA 4Q94A 4HLEA 3PE3A 5LX8A 2XGSA 3LXUX 2VTBA 1QNFA 3PZ1A 5JHAA 1D8EA 4ABNA 2HO1A 4F6RD 1LD8A 3UT4A 4GYOA 5ENOD 1XGWA 5CBOA 5BUZA 2ETCA 1NZNA 3CGHA 2PM6A 1A5EA 4GMJA 4RG9A 3SY2A 1JPLA 2DYSE 1HF8A 3PEVB 1TNYA 2J4BA 3ULYA 3D3MA 1YYHA 2MHKA 1MJ0A 2B0OE 2DCPA 4BEPA 3W9FA 1BD8A 2MYOA 5C1DA 4ATZD 2DBAA 3CVUA 1N95A 3ZU7B 1OWOA 4E85A 3AJIA 3QNKA 3UQ3A 3IV0A 2AVPA 3BUAA 5JA4D 3MZLB 3UPVA 1OY3D 5B3SE 3SBSA 1P5QA 4GAAA 2C0MA 3UIOC 4FC8A 4AM9A 3R9MA 3DSTA 5EN5D 1RZ4A 3PZ2A 2Y1LE 4WNEA 4FHJA 3AG2E 2XEEA 3AU4A 3L13A 5ENSD 4ANWA 4DLQA 2R59A 1BPOA 1KPSB 3DSUA 2PNNA 4JHJA 1LF8A 2GRMA 2KATA 3TL5A 1K1AA 3CHQA 3L6AA 3UI2A 2WVIA 1U3DA 3FTSA 3FTWA 1TN6A 4M7CA 3FFLA 3PNLB 3G2WA 2F8YA 4OVUA 4Q69A 1KZOA 4BSZB 4DX5D 2J8SD 3ABLE 3B95A 1ELWA 2XHEA 3SBTB 3TJPA 2J09A 5AYWD 4CZ2D 2XCBA 4L7TA 1AWCB 3FDHA 2P9KG 3ZXPA 4XI9A 3ZFWA 4U07A 4DUIA 1LD7A 2R02A 2EIME 3CK9A 4QQIA 4WWNA 5AIJA 5A7DB 3EUVA 4MRUA 4GTVA 4ZFHA 2YHEA 3EHRA 4KZ0A 1QZ2A 2WXIA 2IEJA 3ASDA 3MA5A 3U64A 4TXRA 3APDA 4GU5A 4LUNU 3QARA 3LKUA 4RVBA 4DI3A 4EBAG 4KYOB 4J6IA 4U8HA 4J8SA 3ISMC 2XEVA 4UWGA 4OAUC 2H6IA 2WPVA 5BNWA 2YHCA 1DNPA 3QWVA 3Q9UC 4UWHA 4JXTA 3EIQC 3PDNA 4A3TA 4D10C 5M72A 4NACA 4O60A 3QC1A 3GZ2A 3G2UA 4RQIA 2BTDA 1FT2A 3DEPA 1VDYA 5FWQA 3TWSA 2IJGX 4GTQA 3LEWA 1S70B 5BT1A 3LY8A 3UXGA 4CGWA 5AAOA 4A1GA 4EZKA 4HRLA 3I4RB 5KWDA 5FQ6A 1Y6IA 5DIZA 2GRLA 5KBAA 1N4RA 5KNHD 3ZN3A 5EX0A 2E2EA 2XGMA 4N5QA 2LAIA 1E8XA 3FHEA 3QWWA 4ILIA 1MX6A 4OYSA 1TNUA 2H6FA 2VGEA 4G25A 1G3NB 1PAQA 3Q47B 3RAUA 4Y6WA 4TXQA 2HM8A 2LAHA 2GRPB 2L6BA 3ZEFA 5JJ6A 3PNTB 3PS6A 4U0SA 2Y0BG 5HI7A 4GTTA 2OVFA 4WNGA 4M3OA 4OVVA 4LNGA 3HIZA 3CKBA 2F0YA 3LJNA 1OT8A 3ZXSA 4J7WA 3SFZA 4B93B 4I1AA 1BI7B 4F53A 3UKRG 4ANVA 3ASHA 4XKBA 4HOSA 5EKQD 2DIWA 4JB8P 1OWPA 3JXJA 4JA9A 4CT4A 2L9BA 4LRZA 4GTPA 1H2VC 2P2CP 3CR3A 3CSFA 5AQBA 2P58C 5D2MC 3L9TA 3BG0B 2X38A 1NA3A 2I2OA 1UW4B 2VSOE 4I9CA 4PDXA 1N52A 5AJLA 3AS5A 3B7UX 2J49A 4UI9C 2XS8A 4XI0A 3EHNA 5FZQA 3UTMA 2UWJG 1KT0A 1H6OA 2FO1E 3MCXA 3PEUB 5B1AE 2X3MA 3NOCD 2VQ2A 1IQUA 4HRMB 3T8MA 4WWPA 5CERB 2UY1B 2XPZA 3Q7AA 3CVQA 4KMOA 4XEIG 2GRNB 2XRYA 3CVWA 1DCQA 4AP2A 4J8YA 3TGOA 2L0TB 4JD2G 1V55E 4U04A 1PC2A 1OUVA 3ZRHA 2C2LA 3JXIA 4AJWA 5ITZF 3V31A 4K5CA 3FU0A 3UM1A 5G05C 2VYIA 3PRZA 5KJMA 1K8KG 1SVXA 2P9NG 4G24A 3ZPJA 2DVWA 5HKPA 4GZDA 4IRUA 2YINA 4B94A 3CEQA 1E7UA 1UN9A 3CHSA 3C3RA 2GRRB 2XS1A 4O1PA 1MQSA 3MYVA 3MKQB 3RSEG 2Y4TA 3MX3A 4G23A 3CVNA 2HR2A 3LS8A 3ML8A 2JABA 5G05J 2CG2A 1TEZA 3L82A 4UWLA 5ENQD 1Z5SC 3FWVA 5A6CA 1MX4A 2WXGA 3SNXA 4XZ4A 4AEZC 3HHMA 3GW4A 4ANXA 1N54A 4EBAA 3ZYQA 3LDZA 4U96D 4CDRA 4OAVB 4JHRA 1N4SA 3CVVA 2VGYA 2CG3A 1JWFA 4DX1A 4GA2A 2WXNA 3PUKA 4W9RA 4C0EA 4E6HA 2AW6A 3CKCA 3ABKE 2QY7A 1TN8A 3CK8A 2ZXWE 3KSQA 4DK5A 2VSXE 1HXIA 3NQPA 3APFA 2X6KA 4MKTA 2AXUA 3PH0C 4P29A 3OAWA 3RRUA 3LVQE 3E4BA 4KVMA 1H6PA 2KCLA 4I6JA 1XNFA 5G2NA 3Q78A 2QC9A 4NIKA 1K3ZD 2HYZA 4WWOA 1FCHA 5LCWJ 4HOUA 2OV8A 1SQMA 3HXCA 3LY9A 4GTMA 1NA0A 4FP7A 4A3VA 3RIBA 4F3VA 3Q7FA 5CMWA 4FLHA 5G55A 4U0ZA 5JJ7A 4JVSA 2IONA 5C2YA 1FT1A 5BXOA 2P9SG 3FUHA 3FTYA 3T8KA 4EZLA 5LOZA 3LJ3A 3CHOA 4ILHB 2H6GA 4AY5A 1D9SA 2PM7A 1E7VA 4F1PA 3ONLA 3J5QB 5FQ4A 4L9PA 5KNGA 4CCAA 2WXMA 2LUHA 2ZU6B 2FBNA 2P9PG 4JZYA 4JEHA 3G2VA 1NP7A 3R7RA 3VTYA 3G2TA 3FUIA 1KT1A 4EZJA 5KJNA 2X6IA 4GYYA 2KXPC 2QZAA 3EU5A 2BKKB 1NI1A 1OCRE 3AG3E 3SD5A 3TWQA 4APFA 2RFAA 4GMLA 1WM5A 5AQ7A 3ONKA 2JLBA 5KJLA 3P2BA 4UI9J 5BV1A 4G26A 4NRHB 1IHBA 2RD0A 1B89A 5HS0A 2XQ0A 2ETAA 2WXHA 2XRZA 1YCSB 4J8FA 2XENA 4F7AA 1Z3XA 3DRAA 3NF1A 4PUCA 3ENEA 3UUXA 4GPMA 3FEYA 4B8CB 5D0QD 1UJKA 3CK7A 1N9AA 3FTXA 5JHBA 2RFMA 1X81A 3LCAA 2WXJA 3PUJA 4YDYA 2VSNA 4FADA 1D8DA 4N3AA 4TUUA 3SI5A 4BX8A 5CCLA 1JCQA 4N3CA 4LG6A 5ENRD 4C9BB 4XX5A 5T4YA 4YVOA 2VSYA 2WB2A 4MS6A 3PZ4A 1WAO1 3UMVA 1OCOE 3O48A 2V4LA 3DBSA 1HH8A 4U95D 4K5BA 3C3QA 3I3NA 1NFIE 1UJJA 4FU3A 4BTBA 1L5JA 3JUEA 5CEAA 1Q2ZA 3QK0A 4HORA 1N4QA 3MKRA 4ZHBA 3Q4AB 2V5FA 2HE0A 1HU3A 2LO6A 3RO2A 2XZDG 2CHZA 5BPPA 3KEZA 3DSSA 5J08A 5AN8A 2I1JA 2VGXA 2B6CA 4BT9A 1MYOA 4XE0A 3FU3A 5CHEE 2PZIA 5BXUA 1BI8B 4HFGA 5EX3A 3OXGA 4L2YA 1O1TA 2KZTB 4JA7A 5FQ8A 3OXLA 5H7PA 3IBEA 2AJAA 2I6HA 2PQNA 3NZUA 4I43A 4HB5A 5AQ9A 4O1OA 2XCCA 3HVEA 3D9NA 3GYZA 3R7QA 5ARGA 3Q15A 4BSXA 4V3IA 4HNAD 3U3WA 5CRVA 4ACLA 3V2OA 2YNQA 3ZHEA 4K03A 3VLDA 5T3RA 5E75A 4GA0A 3ASNE 3AG4E 5AQAA 3VTXA 1IKND 1JCRA 1UG3A 2OEVA 3S7JA 2NC9A 2DZNA 3FUMA 4JC8A 1X5BA 1PY1A 2WXFA 1DC2A 3FU5A 2V0PA 5FJYA 2FI7A 5CECB 4PH4B 2NXPA 3NAWA 3RJVA 1TJFA 4N2QA 3QWPA 1SW6A 2YQ8A 2LXMA 4GCOA 3URZA 3D9HA 3DXKG 3VLEA 3V79K 3QOUA 1A17A 4GCNA 3JQ1A 2Y4UA 1N11A 1YA0A 4J0UA 3MJWA 3W9GA 1ZU2A 3FH8A 3HG0D 3UM0A 4AY6A 4I1OB 3SF4A 2R5SA 3FTUA 3D9PA 4NURA 5CRUA 5ENNA 5JMND 4UWKA 3FUJA 3CHMA 2XPIA 5FZSA 3DEOA 3ZGQA 4C0MA 4TV3A 3HXEA 4PS3A 3LYAA 2P9IG 2WMNA 3FEXA 5ENPD 3T5VA 2GROB 4U8VD 3FY4A 2IU1A 3CHRA 3L17A 3S7BA 1HS6A 1W3BA 3AS4A 2Y69E 4ATGA 3HXDA 5FINA 4UQZA 4AIFA 4I6GA 3ZVVA 3S7DA 5EIDA 1INZA 5G04J 3Q79A 4B89A 3EJNA 2EINE 4UI9K 4CEMA 4CGVA 4GZ5A 4TUMA 1TJCA 2WXPA 3R9AB 3IKOB 2L6JA 4MBGA 3DPDA 3ASFA 1QYMA 3U9WA 3CQGB 3RKVA 3C98A 5CEDB 3FUDA 2XGOA 4G2VA 3Q5MA 3RRMB 3IXEA 4HOQA 5D66A 2IO3C 4G1TA 3TG4A 2ZGDA 4U63A 3L54A 2WMOA 1EYHA 1ZBPA 3ZHEB 4JEUA 3TG5A 4GPKA 3SFYA 5LP0A 2R03A 2V4HC 3U66A 3CVPA 3HDXA 2DWZA 3KAEA 3BQOA 4KXKB 3EHMA 3HVEB
chains in the Genus database with same CATH topology
2FULA 1FVHA 1VDYA 5FWQA 2FEZA 3FTZA 4CT0A 5T8IA 2IJGX 3LEWA 2XPYA 3D9IA 5BT1A 3LY8A 3B7TA 3ULQA 4ILGA 4CGWA 1E8WA 3AS8A 4HVBA 3JUIA 4A1GA 2WXKA 3SD5A 2CHWA 4UQYA 4EZKA 3L08A 4J8DA 4APFA 1H19A 3I4RB 3KS2A 4GMLA 1EPUA 5FQ6A 1Y6IA 3APCA 1S0PA 2WXLA 1WM5A 2IOLA 5DIZA 3ONKA 4I2WA 2JLBA 5KJLA 2WXOA 2GRLA 3P2BA 4UI9J 5BV1A 4G26A 4KZCA 3ASGA 5G04C 1GW6A 3ZN3A 4NRHB 4HS2A 5EX0A 2E2EA 1UN8A 3D9JA 2XGMA 4IULA 4WNDA 2RD0A 3D9MA 2KZTA 5FZRA 1B89A 5KJKA 4DLOA 3RU0A 2X6JA 1E90A 2LAIA 4FJZA 3EDTB 4KBQA 2XQ0A 1E8XA 2WXHA 2XRZA 5LFAA 3FHEA 2IFUA 3LPZA 3QWWA 4AOFA 4ACKA 4J8FA 4ILIA 2PL2A 3KD7A 4OYSA 4F7AA 1Z3XA 3FTVA 3NF1A 4G25A 4BFRA 4PUCA 4JHKA 4AVXA 3ENEA 3UUXA 4I17A 1PAQA 3FEYA 1JWGA 3Q47B 4Y6WA 5D0QD 4B8CB 2HM8A 2LAHA 2AXZA 1UJKA 5CCMA 3CK7A 3RK6A 3ZEFA 3FTXA 2E0IA 5JHBA 5JJ6A 2A4ZA 4NQ0A 5D0OD 3LCAA 3PNTB 2WXJA 3PS6A 3PUJA 3CLJA 1IYGA 4U0SA 5HI7A 4IYPA 1IQRA 2OVFA 4WNGA 3FH7A 4I6EA 5E76A 4M3OA 3QDNA 4OVVA 2MRIA 3BG1B 2VSNA 4FADA 4N3AA 3BEEA 4TUUA 1E96B 3HIZA 3SI5A 2CFZA 4BX8A 3CKBA 5CCLA 4N3CA 2KCKA 2UY1A 3IEGA 5FTPA 4R7LA 4C9BB 4XX5A 3ZXSA 3B13A 4YVOA 5T4YA 2VSYA 2BF0X 4MS6A 4TRQA 2WB2A 3QAQA 3SFZA 5EDSA 2WXQA 1WAO1 2ILRA 3HYMB 2KM4A 3MEKA 3UMVA 3O48A 2V4LA 4I1AA 4RG6A 4F53A 3DBSA 3ZIMA 4ANVA 3ASHA 4XKBA 2J08A 5BW8C 4HOSA 2WQ7A 1ELKA 4G11A 5EKQD 5HQ8A 4APOA 1HH8A 2AWIA 2DIWA 4BT8A 1OWPA 4JA9A 3I3NA 4CT4A 2L9BA 4LRZA 4U0UA 3TXMA 1UJJA 4FU3A 4GYWA 4BTBA 1L5JA 1Y8MA 1U3CA 1H2VC 3CR3A 5FT9A 4UWFA 3MV3B 5DBKA 3CSFA 4I1MA 2P58C 3BG0B 4LERA 4Y6CA 3PVLA 3IHVA 3QK0A 2VGXB 2X38A 1NA3A 1HFAA 1JUQA 2I2OA 3FP3A 4B0ZA 1UW4B 4HORA 3LVRE 2VSOE 1IHGA 2A5UA 3MKRA 4LEUA 4GZ6A 4I9CA 4PDXA 3B7RL 4JW1A 1N52A 1HE8A 3Q4AB 5AJLA 2WQHA 3RRNB 4GZ3A 3VLFA 2V5FA 1MHQA 3AS5A 3ESLA 4FLBA 1HU3A 2R17C 2LO6A 3B7UX 3RO2A 2IOSA 2CHZA 4HOTA 1H2TC 2J49A 4AV7A 3I5PA 3QKYA 4UI9C 3CVXA 5BPPA 2PQRA 3CV0A 1SZAA 3MKQA 4DPRA 3GZSA 3KEZA 4XI0A 3EHNA 3JYSA 5FZQA 1HO8A 5ANRA 5FQ7A 2KCVA 3S2AA 5J08A 3WXXA 2UWJG 1KT0A 1SZ9A 3FU6A 3UT7A 2I1JA 3G2SA 2VGXA 2M63A 2WM9A 3MCXA 3PEUB 4BT9A 5ANLA 4ME2A 4XE0A 2X3MA 3NZSA 4WNFA 4A55A 3FU3A 5CHEE 2VQ2A 2PZIA 3I4GA 4B8AA 1HZ4A 4HFGA 3D9KA 1IQUA 3CHPA 3D9OA 3FUFA 3CVLA 3OXGA 5AJDA 4L2YA 5EX3A 3FH5A 2KZTB 3T8MA 4WWPA 4JA7A 5LCWC 4BWRA 1EDUA 1E8ZA 3OXLA 5FQ8A 3D9LA 3IBEA 4DI4A 2UY1B 2X6HA 3CIAA 2I6HA 2PQNA 2XPZA 1E8YA 5AENA 4QFVA 3QJZA 3CVQA 3NZUA 4I43A 4KMOA 3SGHA 3LY7A 1OWNA 3FUNA 3PE4A 3OTNA 2FO7A 4N2SA 2XRYA 3MV2B 3CVWA 4FA6A 4AP2A 4F1SA 3FUKA 2XCCA 2BUGA 3TGOA 3HVEA 3D9NA 5ARFA 3UT8A 1OWMA 1QQEA 3GYZA 2L0TB 5ARGA 3R7QA 2WXRA 2I9CA 3Q15A 4XIFA 4BSXA 5BV0A 4V3IA 4U04A 1PC2A 2LSVA 1OUVA 3ZRHA 2C2LA 4J8EA 4AJWA 3U3WA 2VJ8A 3S7FA 4ACLA 3FU0A 5G05C 2VYIA 2YNQA 3PRZA 5KCMA 4K03A 3T5XA 3VLDA 3ZHEA 5KJMA 5T3RA 3JQ0A 5E75A 4Q94A 4GA0A 1Z6TA 4HLEA 3PE3A 3GZ1A 5LX8A 4G24A 4EQFA 3VTXA 2XGSA 3ZYLA 2FF4A 1UG3A 3LXUX 4WAFA 3ZPJA 2VTBA 4BX9A 3PZDA 1QNFA 4GZDA 5JHAA 4ABNA 4IRUA 3S7JA 2HO1A 2NC9A 2YINA 5CMYA 4B94A 2L0IA 3CEQA 3FUMA 3UT4A 2OVBA 4FJYA 4GYOA 4IN3B 4JC8A 4O6FA 1X5BA 1PY1A 2WXFA 1E7UA 3FU5A 1XGWA 1UN9A 2V0PA 3CHSA 5BUZA 5FJYA 5A23A 4N3BA 1NZNA 2FI7A 3OXFA 3CGHA 2PM6A 1MQSA 2GGFA 2J9QA 2JEKA 3MKQB 3MYVA 4GMJA 4RG9A 1JPLA 2Y4TA 3MX3A 4G23A 3CVNA 1HF8A 1FVFA 3PEVB 2HR2A 2J4BA 4WUYA 4PH4B 2NXPA 3LS8A 3K9IA 4EPZA 3RJVA 4MLPA 4CRWA 1WY6A 3D3MA 4N5CA 1TJFA 4N2QA 1H2UA 3QWPA 2YQ8A 3IHYA 2MHKA 3ML8A 2DCPA 5G05J 4GCOA 2CG2A 3TXNA 3URZA 1TEZA 2WQ6A 4I2ZA 4URKA 4UWLA 3VLEA 4GZCA 5C1DA 4JPSA 5J90A 4RSYA 2DBAA 3QOUA 3FUEA 3CVUA 3FWVA 5A6CA 1OWOA 4E85A 1A17A 2WXGA 3SNXA 4XZ4A 3QNKA 4GCNA 3UQ3A 3IV0A 2AVPA 4AEZC 3HHMA 3GW4A 3JQ1A 3MZLB 2Y4UA 3EIJA 4ANXA 3UPVA 4KT6B 5JJTA 1N54A 4EBAA 1HG2A 4J0UA 1YA0A 3U4TA 3MJWA 3ZYQA 1HG5A 3LDZA 1ZU2A 3FH8A 4K0RA 3SBSA 4CDRA 1P5QA 3CSTA 4GAAA 4JHRA 2C0MA 3CVVA 4FC8A 4AM9A 4AY6A 4I1OB 3SF4A 2R5SA 2VGYA 3SHFA 2EQXA 1KLXA 2CG3A 3FTUA 1JWFA 2RG8A 3D9PA 4FHKA 1H0AA 4KVOA 4GA2A 4DJAA 4NURA 2WXNA 5ENNA 3PUKA 4UWKA 4W9RA 4C0EA 2LSUA 4E6HA 3FUJA 3CHMA 2AW6A 2XPIA 3CKCA 4WNEA 4FHJA 5FZSA 1ELRA 3ZGQA 3AU4A 2J07A 3L13A 4ANWA 3MGBA 4C0MA 4TV3A 2IQCA 4PS3A 4GB9A 2QY7A 4PS8A 3LYAA 4DLQA 2R59A 3CK8A 2WMNA 1BPOA 1HX8A 4UQXA 4DK5A 4ANUA 3FEXA 3T5VA 3ZW3A 2VSXE 1HXIA 4XKCA 3NQPA 3APFA 2X6KA 3QB2A 4YNDA 4BY6A 4MKTA 3FY4A 2IU1A 4JHJA 2AXUA 3CHRA 3L17A 1LF8A 3S7BA 2GRMA 2KATA 3PH0C 3TL5A 1HS6A 1W3BA 3AS4A 2LNIA 4ATGA 3RO3A 4FULA 3CHQA 3L6AA 3L22A 1H6KA 4P29A 2WVIA 3JCKC 1U3DA 3OAWA 2OOEA 4UQZA 3FTSA 4HXIA 3FTWA 3FULA 2QFCA 3RRUA 4AIFA 2ONDA 4I6GA 4GA1A 2V8SE 3Q49B 3FFLA 3ZVVA 3LVQE 4BTAA 3E4BA 4I9EA 4KVMA 3S7DA 3PNLB 4Q96A 3G2WA 4OVUA 3L16A 4A1SA 4CDNA 4Q69A 2KCLA 4I6JA 1INZA 3CVYA 5G04J 1XNFA 5G2NA 4N39A 3EJNA 4B89A 4UI9K 3O4ZA 2HYZA 4CEMA 1ELWA 1FCHA 2XHEA 4H7YA 4WWOA 4HOUA 3SBTB 3TJPA 2OV8A 4CGVA 1SQMA 5LCWJ 2J09A 2CHXA 4GZ5A 3PREA 1OWLA 4JL0A 3LY9A 4LCTA 1NA0A 1TJCA 4FP7A 5AYWD 2XCBA 3RIBA 4A3VA 4L2LA 4L7TA 4EECA 2WXPA 4F3VA 1DVPA 5CMWA 3R9AB 3IKOB 4FLHA 2L6JA 5G55A 3FDHA 3DPDA 4U0ZA 2MOWA 3ASFA 5JJ7A 2AXVA 4JVSA 4XI9A 3ZFWA 2J4DA 4U07A 3U9WA 3N71A 2IONA 3CQGB 4L23A 3RKVA 5C2YA 3ESKA 3CK9A 3C98A 4WWNA 3FUDA 4AXHA 2XGOA 4G2VA 5A7DB 5AIJA 4MRUA 4PS7A 2YHEA 3FTYA 3FUHA 4EZLA 4KZ0A 1QZ2A 5LOZA 2WXIA 3Q5MA 3LJ3A 3RRMB 3CHOA 3B7SA 4ILHB 3ASDA 3MA5A 4HOQA 3U64A 4AY5A 2PM7A 3APDA 4GU5A 1E7VA 3TAXA 3ONLA 4LUNU 4G1TA 3TG4A 5FQ4A 2KC7A 2X6FA 4CDMA 3QARA 3LKUA 3ZYMA 3AU5A 4RVBA 3SZ7A 4U63A 3L54A 4DI3A 4EBAG 4CCAA 2WMOA 4KYOB 2WXMA 1EYHA 4J6IA 2GW1A 4U8HA 1ZBPA 4J8SA 2XEVA 3ZHEB 4UWGA 2ZU6B 2CFUA 4JEUA 2VTBB 2WPVA 3TG5A 5BNWA 2FBNA 3P1UA 4GPKA 3ZYKA 3CQCB 4JZYA 4JEHA 2YHCA 5LP0A 3G2VA 3UX4A 1DNPA 1NP7A 3QWVA 4UWHA 3R7RA 4JXTA 2C0LA 3EIQC 3G2TA 3FUIA 3VTYA 1KT1A 3CVPA 3U66A 3HDXA 3ML9A 4EZJA 1EF1C 2Y3AA 2NSZA 3KAEA 3PDNA 4A3TA 4D10C 5KJNA 4H7XA 4L1BA 2X6IA 2I1KA 4GYYA 5M72A 4KXKB 3EHMA 4NACA 3QC1A 3GZ2A 3G2UA 1Z3YA 3HVEB 4YVQC 2Q7FA 2BTDA 2IF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRM B;  3PEV B;  3RRN B;  3PEU B; 
#chains in the Genus database with same CATH topology
 1FVH A;  3FTZ A;  4GTS A;  4CT0 A;  1SA5 A;  3D9I A;  3B7T A;  3ULQ A;  4CYM D;  4UQY A;  4BET A;  1H19 A;  3KS2 A;  2WXL A;  1TNB A;  4KZC A;  1GW6 A;  1UN8 A;  4WND A;  4IUL A;  5KJK A;  3RU0 A;  4GMR A;  3EDT B;  4EHM A;  3LPZ A;  4AOF A;  4ACK A;  3TWW A;  4BFR A;  4AVX A;  4I17 A;  1JWG A;  4YDO A;  2QYJ A;  3F6Q A;  5CCM A;  4DRX E;  3RK6 A;  4NQ0 A;  5D0O D;  1UOH A;  3CLJ A;  1IYG A;  3FH7 A;  3QDN A;  2MRI A;  3BG1 B;  1V54 E;  3BEE A;  1E96 B;  4C48 B;  2BED A;  3SQV A;  4HRN A;  2KCK A;  3UM2 A;  5FTP A;  3B13 A;  2BF0 X;  4TRQ A;  3J5P A;  3QAQ A;  5EDS A;  2WXQ A;  2ILR A;  3HYM B;  3MEK A;  4RG6 A;  4LNU D;  1ELK A;  4G11 A;  3T9K A;  5IY5 E;  2OEW A;  4U0U A;  3Q73 A;  4GYW A;  3ULE G;  4U7E B;  3MV3 B;  5EIB E;  4Y6C A;  3PVL A;  1OCZ E;  3NOG D;  1JUQ A;  3FP3 A;  1IHG A;  2A5U A;  4GZ6 A;  1N0R A;  3B7R L;  4JW1 A;  3RRN B;  4GZ3 A;  3UM3 A;  3EU9 A;  1MZC A;  3DSX A;  3QKY A;  3TWU A;  2PQR A;  4DPR A;  3MKQ A;  3DWL G;  3JYS A;  1HO8 A;  2XZT G;  5ANR A;  5FQ7 A;  2KCV A;  3S2A A;  3WXX A;  3FU6 A;  3G2S A;  2WM9 A;  4ME2 A;  4WNF A;  4A55 A;  3I4G A;  4B8A A;  4BES A;  3D9K A;  3CHP A;  5LCW C;  4BWR A;  1EDU A;  3E30 A;  3D9L A;  4DI4 A;  2X6H A;  3E33 A;  3CIA A;  5HRY A;  3C3O A;  4QFV A;  3QJZ A;  4G8L A;  1OWN A;  2ZGG A;  3FUN A;  3PE4 A;  2FO7 A;  5EIL A;  4FA6 A;  1QBQ A;  3SFX A;  1OXJ A;  1TYQ G;  3UT8 A;  1OWM A;  2IY0 C;  2WXR A;  3DSV A;  2I9C A;  5BV0 A;  4HQD A;  1YMP A;  2VJ8 A;  3S7F A;  5KCM A;  2F37 A;  3C5R A;  2OCC E;  2NYJ A;  1Z6T A;  3TWX A;  3GZ1 A;  4EQF A;  3ZYL A;  2FF4 A;  3V2X A;  4WAF A;  4BX9 A;  3PZD A;  3UIN C;  5CMY A;  2L0I A;  2OVB A;  1O5M A;  4FJY A;  4IN3 B;  4O6F A;  5A23 A;  4N3B A;  1TN7 A;  3OXF A;  2J9Q A;  2GGF A;  2JEK A;  4LNB A;  1FVF A;  4WUY A;  3K9I A;  4EPZ A;  4MLP A;  4CRW A;  1WY6 A;  4N5C A;  1H2U A;  1WDY A;  3IHY A;  1OCC E;  3TXN A;  2WQ6 A;  1FPP A;  4URK A;  4I2Z A;  4GZC A;  1ZB1 A;  4JPS A;  5J90 A;  4RSY A;  3HXF A;  3FUE A;  2DYR E;  5ENT D;  3EIJ A;  3AG1 E;  4KT6 B;  5JJT A;  1LTX A;  1HG2 A;  2XEH A;  3U4T A;  2R05 A;  1HG5 A;  4K5A B;  3BU8 A;  4K0R A;  3UIP C;  3CST A;  4YDW A;  2ZIS A;  3SHF A;  2EQX A;  1KLX A;  2RG8 A;  4FHK A;  4DJA A;  1H0A A;  4KVO A;  2LSU A;  1ELR A;  1S63 A;  2J07 A;  3MGB A;  2IQC A;  4GB9 A;  4PS8 A;  1HX8 A;  4UQX A;  4ANU A;  3ZW3 A;  4XKC A;  5EYP F;  3QB2 A;  3ZUV B;  4YND A;  4BY6 A;  4HI8 A;  2LNI A;  3RO3 A;  4FUL A;  4A63 B;  3L22 A;  4G8K A;  1H6K A;  3JCK C;  2OOE A;  4HXI A;  3FUL A;  2QFC A;  2OND A;  4GA1 A;  2V8S E;  3Q49 B;  4BTA A;  4I9E A;  4Q96 A;  3L16 A;  4A1S A;  4CDN A;  1JCS A;  1N0Q A;  3DXM G;  3CVY A;  3ZKJ A;  4N39 A;  3NBN B;  3O4Z A;  4H7Y A;  2CHX A;  2IO2 C;  3PRE A;  1OWL A;  2RKK A;  4JL0 A;  1U2V G;  3V30 A;  1DCE A;  4LCT A;  4EEC A;  4L2L A;  2EIK E;  1DVP A;  4UUC A;  2LXL A;  2MOW A;  2AXV A;  2J4D A;  3N71 A;  3ASO E;  4L23 A;  3ESK A;  4AXH A;  4PS7 A;  4Z68 A;  3KEA A;  5FIO A;  3B7S A;  2KBX A;  1RW2 A;  3TAX A;  2KC7 A;  2X6F A;  4CDM A;  3ZNG A;  3ZYM A;  3AU5 A;  3SZ7 A;  3B7B A;  4GTR A;  2GW1 A;  3UKU G;  2CFU A;  2VTB B;  3P1U A;  3ZYK A;  3CQC B;  3UX4 A;  2F8X K;  2C0L A;  3ML9 A;  1EF1 C;  2Y3A A;  2NSZ A;  4H7X A;  4L1B A;  2I1K A;  1TR4 A;  1Z3Y A;  4YVQ C;  2Q7F A;  1O1S A;  2IF4 A;  2FUL A;  4LSZ E;  1MX2 A;  3HRA A;  1KZP A;  2FEZ A;  1NL4 A;  5T8I A;  3Q75 A;  2XPY A;  4ILG A;  1E8W A;  3AS8 A;  4HVB A;  3JUI A;  2WXK A;  3TWR A;  2CHW A;  4HI9 A;  3L08 A;  4J8D A;  1BU9 A;  4X8Q A;  1EPU A;  1S0P A;  3APC A;  2IOL A;  2DZO A;  2EIJ E;  3ABM E;  4I2W A;  4DX2 A;  2WXO A;  3X2Q E;  3ASG A;  5G04 C;  4HS2 A;  1WG0 A;  2H6H A;  3D9J A;  3D9M A;  2KZT A;  4DX6 D;  5FZR A;  4DLO A;  2X6J A;  1E90 A;  4FJZ A;  4KBQ A;  5LFA A;  2IFU A;  2PL2 A;  3KD7 A;  3PZ3 A;  3FTV A;  4JHK A;  5CBN A;  4TXP A;  2AXZ A;  4RLY A;  2E0I A;  2A4Z A;  1K1B A;  3E34 A;  2R2L A;  4IYP A;  1IQR A;  4I6E A;  5E76 A;  2BKG A;  1S64 A;  2CFZ A;  2UY1 A;  1SA4 A;  3IEG A;  2EIL E;  4BER A;  4R7L A;  1O1R A;  2GRQ B;  2KM4 A;  3ZIM A;  2J08 A;  5BW8 C;  2WQ7 A;  5HQ8 A;  4APO A;  2AWI A;  4BT8 A;  5AAR A;  3TXM A;  3DPY A;  1N4P A;  1Y8M A;  1U3C A;  1TNZ A;  5FT9 A;  4UWF A;  3E37 A;  5DBK A;  4I1M A;  3NB2 A;  4YDE A;  4LER A;  3EHQ A;  3IHV A;  2VGX B;  1HFA A;  4B0Z A;  4HLL A;  3LVR E;  4LEU A;  1HE8 A;  3VLF A;  3TWV A;  1IXV A;  2WQH A;  4FLB A;  1MHQ A;  3ESL A;  2A5E A;  2R17 C;  2QYU A;  2IOS A;  4HOT A;  1H2T C;  4AV7 A;  3I5P A;  3CVX A;  3E32 A;  3CV0 A;  1SZA A;  3GZS A;  1AP7 A;  3C72 A;  4U8Y D;  1BLX B;  1SZ9 A;  3UT7 A;  2M63 A;  3DSW A;  3KSL A;  5ANL A;  3NZS A;  4DX7 D;  1HZ4 A;  3FUF A;  3D9O A;  3CVL A;  5AJD A;  3FH5 A;  5B1B E;  1E8Z A;  2V5Q C;  3AAA C;  1E8Y A;  3TWT A;  5AEN A;  3Q9N C;  3SGH A;  3LY7 A;  3OTN A;  1N94 A;  2P9L G;  2P9U G;  4N2S A;  3MV2 B;  4F1S A;  3FUK A;  2BUG A;  2ETB A;  5ARF A;  1TNO A;  4HBD A;  1QQE A;  4XIF A;  3WG7 E;  3SO8 A;  2ZIR A;  2LSV A;  4J8E A;  4GTO A;  3T5X A;  3HXB A;  3JQ0 A;  5EYL A;  4Q94 A;  4HLE A;  3PE3 A;  5LX8 A;  2XGS A;  3LXU X;  2VTB A;  1QNF A;  3PZ1 A;  5JHA A;  1D8E A;  4ABN A;  2HO1 A;  4F6R D;  1LD8 A;  3UT4 A;  4GYO A;  5ENO D;  1XGW A;  5CBO A;  5BUZ A;  2ETC A;  1NZN A;  3CGH A;  2PM6 A;  1A5E A;  4GMJ A;  4RG9 A;  3SY2 A;  1JPL A;  2DYS E;  1HF8 A;  3PEV B;  1TNY A;  2J4B A;  3ULY A;  3D3M A;  1YYH A;  2MHK A;  1MJ0 A;  2B0O E;  2DCP A;  4BEP A;  3W9F A;  1BD8 A;  2MYO A;  5C1D A;  4ATZ D;  2DBA A;  3CVU A;  1N95 A;  3ZU7 B;  1OWO A;  4E85 A;  3AJI A;  3QNK A;  3UQ3 A;  3IV0 A;  2AVP A;  3BUA A;  5JA4 D;  3MZL B;  3UPV A;  1OY3 D;  5B3S E;  3SBS A;  1P5Q A;  4GAA A;  2C0M A;  3UIO C;  4FC8 A;  4AM9 A;  3R9M A;  3DST A;  5EN5 D;  1RZ4 A;  3PZ2 A;  2Y1L E;  4WNE A;  4FHJ A;  3AG2 E;  2XEE A;  3AU4 A;  3L13 A;  5ENS D;  4ANW A;  4DLQ A;  2R59 A;  1BPO A;  1KPS B;  3DSU A;  2PNN A;  4JHJ A;  1LF8 A;  2GRM A;  2KAT A;  3TL5 A;  1K1A A;  3CHQ A;  3L6A A;  3UI2 A;  2WVI A;  1U3D A;  3FTS A;  3FTW A;  1TN6 A;  4M7C A;  3FFL A;  3PNL B;  3G2W A;  2F8Y A;  4OVU A;  4Q69 A;  1KZO A;  4BSZ B;  4DX5 D;  2J8S D;  3ABL E;  3B95 A;  1ELW A;  2XHE A;  3SBT B;  3TJP A;  2J09 A;  5AYW D;  4CZ2 D;  2XCB A;  4L7T A;  1AWC B;  3FDH A;  2P9K G;  3ZXP A;  4XI9 A;  3ZFW A;  4U07 A;  4DUI A;  1LD7 A;  2R02 A;  2EIM E;  3CK9 A;  4QQI A;  4WWN A;  5AIJ A;  5A7D B;  3EUV A;  4MRU A;  4GTV A;  4ZFH A;  2YHE A;  3EHR A;  4KZ0 A;  1QZ2 A;  2WXI A;  2IEJ A;  3ASD A;  3MA5 A;  3U64 A;  4TXR A;  3APD A;  4GU5 A;  4LUN U;  3QAR A;  3LKU A;  4RVB A;  4DI3 A;  4EBA G;  4KYO B;  4J6I A;  4U8H A;  4J8S A;  3ISM C;  2XEV A;  4UWG A;  4OAU C;  2H6I A;  2WPV A;  5BNW A;  2YHC A;  1DNP A;  3QWV A;  3Q9U C;  4UWH A;  4JXT A;  3EIQ C;  3PDN A;  4A3T A;  4D10 C;  5M72 A;  4NAC A;  4O60 A;  3QC1 A;  3GZ2 A;  3G2U A;  4RQI A;  2BTD A;  1FT2 A;  3DEP A;  1VDY A;  5FWQ A;  3TWS A;  2IJG X;  4GTQ A;  3LEW A;  1S70 B;  5BT1 A;  3LY8 A;  3UXG A;  4CGW A;  5AAO A;  4A1G A;  4EZK A;  4HRL A;  3I4R B;  5KWD A;  5FQ6 A;  1Y6I A;  5DIZ A;  2GRL A;  5KBA A;  1N4R A;  5KNH D;  3ZN3 A;  5EX0 A;  2E2E A;  2XGM A;  4N5Q A;  2LAI A;  1E8X A;  3FHE A;  3QWW A;  4ILI A;  1MX6 A;  4OYS A;  1TNU A;  2H6F A;  2VGE A;  4G25 A;  1G3N B;  1PAQ A;  3Q47 B;  3RAU A;  4Y6W A;  4TXQ A;  2HM8 A;  2LAH A;  2GRP B;  2L6B A;  3ZEF A;  5JJ6 A;  3PNT B;  3PS6 A;  4U0S A;  2Y0B G;  5HI7 A;  4GTT A;  2OVF A;  4WNG A;  4M3O A;  4OVV A;  4LNG A;  3HIZ A;  3CKB A;  2F0Y A;  3LJN A;  1OT8 A;  3ZXS A;  4J7W A;  3SFZ A;  4B93 B;  4I1A A;  1BI7 B;  4F53 A;  3UKR G;  4ANV A;  3ASH A;  4XKB A;  4HOS A;  5EKQ D;  2DIW A;  4JB8 P;  1OWP A;  3JXJ A;  4JA9 A;  4CT4 A;  2L9B A;  4LRZ A;  4GTP A;  1H2V C;  2P2C P;  3CR3 A;  3CSF A;  5AQB A;  2P58 C;  5D2M C;  3L9T A;  3BG0 B;  2X38 A;  1NA3 A;  2I2O A;  1UW4 B;  2VSO E;  4I9C A;  4PDX A;  1N52 A;  5AJL A;  3AS5 A;  3B7U X;  2J49 A;  4UI9 C;  2XS8 A;  4XI0 A;  3EHN A;  5FZQ A;  3UTM A;  2UWJ G;  1KT0 A;  1H6O A;  2FO1 E;  3MCX A;  3PEU B;  5B1A E;  2X3M A;  3NOC D;  2VQ2 A;  1IQU A;  4HRM B;  3T8M A;  4WWP A;  5CER B;  2UY1 B;  2XPZ A;  3Q7A A;  3CVQ A;  4KMO A;  4XEI G;  2GRN B;  2XRY A;  3CVW A;  1DCQ A;  4AP2 A;  4J8Y A;  3TGO A;  2L0T B;  4JD2 G;  1V55 E;  4U04 A;  1PC2 A;  1OUV A;  3ZRH A;  2C2L A;  3JXI A;  4AJW A;  5ITZ F;  3V31 A;  4K5C A;  3FU0 A;  3UM1 A;  5G05 C;  2VYI A;  3PRZ A;  5KJM A;  1K8K G;  1SVX A;  2P9N G;  4G24 A;  3ZPJ A;  2DVW A;  5HKP A;  4GZD A;  4IRU A;  2YIN A;  4B94 A;  3CEQ A;  1E7U A;  1UN9 A;  3CHS A;  3C3R A;  2GRR B;  2XS1 A;  4O1P A;  1MQS A;  3MYV A;  3MKQ B;  3RSE G;  2Y4T A;  3MX3 A;  4G23 A;  3CVN A;  2HR2 A;  3LS8 A;  3ML8 A;  2JAB A;  5G05 J;  2CG2 A;  1TEZ A;  3L82 A;  4UWL A;  5ENQ D;  1Z5S C;  3FWV A;  5A6C A;  1MX4 A;  2WXG A;  3SNX A;  4XZ4 A;  4AEZ C;  3HHM A;  3GW4 A;  4ANX A;  1N54 A;  4EBA A;  3ZYQ A;  3LDZ A;  4U96 D;  4CDR A;  4OAV B;  4JHR A;  1N4S A;  3CVV A;  2VGY A;  2CG3 A;  1JWF A;  4DX1 A;  4GA2 A;  2WXN A;  3PUK A;  4W9R A;  4C0E A;  4E6H A;  2AW6 A;  3CKC A;  3ABK E;  2QY7 A;  1TN8 A;  3CK8 A;  2ZXW E;  3KSQ A;  4DK5 A;  2VSX E;  1HXI A;  3NQP A;  3APF A;  2X6K A;  4MKT A;  2AXU A;  3PH0 C;  4P29 A;  3OAW A;  3RRU A;  3LVQ E;  3E4B A;  4KVM A;  1H6P A;  2KCL A;  4I6J A;  1XNF A;  5G2N A;  3Q78 A;  2QC9 A;  4NIK A;  1K3Z D;  2HYZ A;  4WWO A;  1FCH A;  5LCW J;  4HOU A;  2OV8 A;  1SQM A;  3HXC A;  3LY9 A;  4GTM A;  1NA0 A;  4FP7 A;  4A3V A;  3RIB A;  4F3V A;  3Q7F A;  5CMW A;  4FLH A;  5G55 A;  4U0Z A;  5JJ7 A;  4JVS A;  2ION A;  5C2Y A;  1FT1 A;  5BXO A;  2P9S G;  3FUH A;  3FTY A;  3T8K A;  4EZL A;  5LOZ A;  3LJ3 A;  3CHO A;  4ILH B;  2H6G A;  4AY5 A;  1D9S A;  2PM7 A;  1E7V A;  4F1P A;  3ONL A;  3J5Q B;  5FQ4 A;  4L9P A;  5KNG A;  4CCA A;  2WXM A;  2LUH A;  2ZU6 B;  2FBN A;  2P9P G;  4JZY A;  4JEH A;  3G2V A;  1NP7 A;  3R7R A;  3VTY A;  3G2T A;  3FUI A;  1KT1 A;  4EZJ A;  5KJN A;  2X6I A;  4GYY A;  2KXP C;  2QZA A;  3EU5 A;  2BKK B;  1NI1 A;  1OCR E;  3AG3 E;  3SD5 A;  3TWQ A;  4APF A;  2RFA A;  4GML A;  1WM5 A;  5AQ7 A;  3ONK A;  2JLB A;  5KJL A;  3P2B A;  4UI9 J;  5BV1 A;  4G26 A;  4NRH B;  1IHB A;  2RD0 A;  1B89 A;  5HS0 A;  2XQ0 A;  2ETA A;  2WXH A;  2XRZ A;  1YCS B;  4J8F A;  2XEN A;  4F7A A;  1Z3X A;  3DRA A;  3NF1 A;  4PUC A;  3ENE A;  3UUX A;  4GPM A;  3FEY A;  4B8C B;  5D0Q D;  1UJK A;  3CK7 A;  1N9A A;  3FTX A;  5JHB A;  2RFM A;  1X81 A;  3LCA A;  2WXJ A;  3PUJ A;  4YDY A;  2VSN A;  4FAD A;  1D8D A;  4N3A A;  4TUU A;  3SI5 A;  4BX8 A;  5CCL A;  1JCQ A;  4N3C A;  4LG6 A;  5ENR D;  4C9B B;  4XX5 A;  5T4Y A;  4YVO A;  2VSY A;  2WB2 A;  4MS6 A;  3PZ4 A;  1WAO 1;  3UMV A;  1OCO E;  3O48 A;  2V4L A;  3DBS A;  1HH8 A;  4U95 D;  4K5B A;  3C3Q A;  3I3N A;  1NFI E;  1UJJ A;  4FU3 A;  4BTB A;  1L5J A;  3JUE A;  5CEA A;  1Q2Z A;  3QK0 A;  4HOR A;  1N4Q A;  3MKR A;  4ZHB A;  3Q4A B;  2V5F A;  2HE0 A;  1HU3 A;  2LO6 A;  3RO2 A;  2XZD G;  2CHZ A;  5BPP A;  3KEZ A;  3DSS A;  5J08 A;  5AN8 A;  2I1J A;  2VGX A;  2B6C A;  4BT9 A;  1MYO A;  4XE0 A;  3FU3 A;  5CHE E;  2PZI A;  5BXU A;  1BI8 B;  4HFG A;  5EX3 A;  3OXG A;  4L2Y A;  1O1T A;  2KZT B;  4JA7 A;  5FQ8 A;  3OXL A;  5H7P A;  3IBE A;  2AJA A;  2I6H A;  2PQN A;  3NZU A;  4I43 A;  4HB5 A;  5AQ9 A;  4O1O A;  2XCC A;  3HVE A;  3D9N A;  3GYZ A;  3R7Q A;  5ARG A;  3Q15 A;  4BSX A;  4V3I A;  4HNA D;  3U3W A;  5CRV A;  4ACL A;  3V2O A;  2YNQ A;  3ZHE A;  4K03 A;  3VLD A;  5T3R A;  5E75 A;  4GA0 A;  3ASN E;  3AG4 E;  5AQA A;  3VTX A;  1IKN D;  1JCR A;  1UG3 A;  2OEV A;  3S7J A;  2NC9 A;  2DZN A;  3FUM A;  4JC8 A;  1X5B A;  1PY1 A;  2WXF A;  1DC2 A;  3FU5 A;  2V0P A;  5FJY A;  2FI7 A;  5CEC B;  4PH4 B;  2NXP A;  3NAW A;  3RJV A;  1TJF A;  4N2Q A;  3QWP A;  1SW6 A;  2YQ8 A;  2LXM A;  4GCO A;  3URZ A;  3D9H A;  3DXK G;  3VLE A;  3V79 K;  3QOU A;  1A17 A;  4GCN A;  3JQ1 A;  2Y4U A;  1N11 A;  1YA0 A;  4J0U A;  3MJW A;  3W9G A;  1ZU2 A;  3FH8 A;  3HG0 D;  3UM0 A;  4AY6 A;  4I1O B;  3SF4 A;  2R5S A;  3FTU A;  3D9P A;  4NUR A;  5CRU A;  5ENN A;  5JMN D;  4UWK A;  3FUJ A;  3CHM A;  2XPI A;  5FZS A;  3DEO A;  3ZGQ A;  4C0M A;  4TV3 A;  3HXE A;  4PS3 A;  3LYA A;  2P9I G;  2WMN A;  3FEX A;  5ENP D;  3T5V A;  2GRO B;  4U8V D;  3FY4 A;  2IU1 A;  3CHR A;  3L17 A;  3S7B A;  1HS6 A;  1W3B A;  3AS4 A;  2Y69 E;  4ATG A;  3HXD A;  5FIN A;  4UQZ A;  4AIF A;  4I6G A;  3ZVV A;  3S7D A;  5EID A;  1INZ A;  5G04 J;  3Q79 A;  4B89 A;  3EJN A;  2EIN E;  4UI9 K;  4CEM A;  4CGV A;  4GZ5 A;  4TUM A;  1TJC A;  2WXP A;  3R9A B;  3IKO B;  2L6J A;  4MBG A;  3DPD A;  3ASF A;  1QYM A;  3U9W A;  3CQG B;  3RKV A;  3C98 A;  5CED B;  3FUD A;  2XGO A;  4G2V A;  3Q5M A;  3RRM B;  3IXE A;  4HOQ A;  5D66 A;  2IO3 C;  4G1T A;  3TG4 A;  2ZGD A;  4U63 A;  3L54 A;  2WMO A;  1EYH A;  1ZBP A;  3ZHE B;  4JEU A;  3TG5 A;  4GPK A;  3SFY A;  5LP0 A;  2R03 A;  2V4H C;  3U66 A;  3CVP A;  3HDX A;  2DWZ A;  3KAE A;  3BQO A;  4KXK B;  3EHM A;  3HVE B; 
#chains in the Genus database with same CATH homology
 2FUL A;  1FVH A;  1VDY A;  5FWQ A;  2FEZ A;  3FTZ A;  4CT0 A;  5T8I A;  2IJG X;  3LEW A;  2XPY A;  3D9I A;  5BT1 A;  3LY8 A;  3B7T A;  3ULQ A;  4ILG A;  4CGW A;  1E8W A;  3AS8 A;  4HVB A;  3JUI A;  4A1G A;  2WXK A;  3SD5 A;  2CHW A;  4UQY A;  4EZK A;  3L08 A;  4J8D A;  4APF A;  1H19 A;  3I4R B;  3KS2 A;  4GML A;  1EPU A;  5FQ6 A;  1Y6I A;  3APC A;  1S0P A;  2WXL A;  1WM5 A;  2IOL A;  5DIZ A;  3ONK A;  4I2W A;  2JLB A;  5KJL A;  2WXO A;  2GRL A;  3P2B A;  4UI9 J;  5BV1 A;  4G26 A;  4KZC A;  3ASG A;  5G04 C;  1GW6 A;  3ZN3 A;  4NRH B;  4HS2 A;  5EX0 A;  2E2E A;  1UN8 A;  3D9J A;  2XGM A;  4IUL A;  4WND A;  2RD0 A;  3D9M A;  2KZT A;  5FZR A;  1B89 A;  5KJK A;  4DLO A;  3RU0 A;  2X6J A;  1E90 A;  2LAI A;  4FJZ A;  3EDT B;  4KBQ A;  2XQ0 A;  1E8X A;  2WXH A;  2XRZ A;  5LFA A;  3FHE A;  2IFU A;  3LPZ A;  3QWW A;  4AOF A;  4ACK A;  4J8F A;  4ILI A;  2PL2 A;  3KD7 A;  4OYS A;  4F7A A;  1Z3X A;  3FTV A;  3NF1 A;  4G25 A;  4BFR A;  4PUC A;  4JHK A;  4AVX A;  3ENE A;  3UUX A;  4I17 A;  1PAQ A;  3FEY A;  1JWG A;  3Q47 B;  4Y6W A;  5D0Q D;  4B8C B;  2HM8 A;  2LAH A;  2AXZ A;  1UJK A;  5CCM A;  3CK7 A;  3RK6 A;  3ZEF A;  3FTX A;  2E0I A;  5JHB A;  5JJ6 A;  2A4Z A;  4NQ0 A;  5D0O D;  3LCA A;  3PNT B;  2WXJ A;  3PS6 A;  3PUJ A;  3CLJ A;  1IYG A;  4U0S A;  5HI7 A;  4IYP A;  1IQR A;  2OVF A;  4WNG A;  3FH7 A;  4I6E A;  5E76 A;  4M3O A;  3QDN A;  4OVV A;  2MRI A;  3BG1 B;  2VSN A;  4FAD A;  4N3A A;  3BEE A;  4TUU A;  1E96 B;  3HIZ A;  3SI5 A;  2CFZ A;  4BX8 A;  3CKB A;  5CCL A;  4N3C A;  2KCK A;  2UY1 A;  3IEG A;  5FTP A;  4R7L A;  4C9B B;  4XX5 A;  3ZXS A;  3B13 A;  4YVO A;  5T4Y A;  2VSY A;  2BF0 X;  4MS6 A;  4TRQ A;  2WB2 A;  3QAQ A;  3SFZ A;  5EDS A;  2WXQ A;  1WAO 1;  2ILR A;  3HYM B;  2KM4 A;  3MEK A;  3UMV A;  3O48 A;  2V4L A;  4I1A A;  4RG6 A;  4F53 A;  3DBS A;  3ZIM A;  4ANV A;  3ASH A;  4XKB A;  2J08 A;  5BW8 C;  4HOS A;  2WQ7 A;  1ELK A;  4G11 A;  5EKQ D;  5HQ8 A;  4APO A;  1HH8 A;  2AWI A;  2DIW A;  4BT8 A;  1OWP A;  4JA9 A;  3I3N A;  4CT4 A;  2L9B A;  4LRZ A;  4U0U A;  3TXM A;  1UJJ A;  4FU3 A;  4GYW A;  4BTB A;  1L5J A;  1Y8M A;  1U3C A;  1H2V C;  3CR3 A;  5FT9 A;  4UWF A;  3MV3 B;  5DBK A;  3CSF A;  4I1M A;  2P58 C;  3BG0 B;  4LER A;  4Y6C A;  3PVL A;  3IHV A;  3QK0 A;  2VGX B;  2X38 A;  1NA3 A;  1HFA A;  1JUQ A;  2I2O A;  3FP3 A;  4B0Z A;  1UW4 B;  4HOR A;  3LVR E;  2VSO E;  1IHG A;  2A5U A;  3MKR A;  4LEU A;  4GZ6 A;  4I9C A;  4PDX A;  3B7R L;  4JW1 A;  1N52 A;  1HE8 A;  3Q4A B;  5AJL A;  2WQH A;  3RRN B;  4GZ3 A;  3VLF A;  2V5F A;  1MHQ A;  3AS5 A;  3ESL A;  4FLB A;  1HU3 A;  2R17 C;  2LO6 A;  3B7U X;  3RO2 A;  2IOS A;  2CHZ A;  4HOT A;  1H2T C;  2J49 A;  4AV7 A;  3I5P A;  3QKY A;  4UI9 C;  3CVX A;  5BPP A;  2PQR A;  3CV0 A;  1SZA A;  3MKQ A;  4DPR A;  3GZS A;  3KEZ A;  4XI0 A;  3EHN A;  3JYS A;  5FZQ A;  1HO8 A;  5ANR A;  5FQ7 A;  2KCV A;  3S2A A;  5J08 A;  3WXX A;  2UWJ G;  1KT0 A;  1SZ9 A;  3FU6 A;  3UT7 A;  2I1J A;  3G2S A;  2VGX A;  2M63 A;  2WM9 A;  3MCX A;  3PEU B;  4BT9 A;  5ANL A;  4ME2 A;  4XE0 A;  2X3M A;  3NZS A;  4WNF A;  4A55 A;  3FU3 A;  5CHE E;  2VQ2 A;  2PZI A;  3I4G A;  4B8A A;  1HZ4 A;  4HFG A;  3D9K A;  1IQU A;  3CHP A;  3D9O A;  3FUF A;  3CVL A;  3OXG A;  5AJD A;  4L2Y A;  5EX3 A;  3FH5 A;  2KZT B;  3T8M A;  4WWP A;  4JA7 A;  5LCW C;  4BWR A;  1EDU A;  1E8Z A;  3OXL A;  5FQ8 A;  3D9L A;  3IBE A;  4DI4 A;  2UY1 B;  2X6H A;  3CIA A;  2I6H A;  2PQN A;  2XPZ A;  1E8Y A;  5AEN A;  4QFV A;  3QJZ A;  3CVQ A;  3NZU A;  4I43 A;  4KMO A;  3SGH A;  3LY7 A;  1OWN A;  3FUN A;  3PE4 A;  3OTN A;  2FO7 A;  4N2S A;  2XRY A;  3MV2 B;  3CVW A;  4FA6 A;  4AP2 A;  4F1S A;  3FUK A;  2XCC A;  2BUG A;  3TGO A;  3HVE A;  3D9N A;  5ARF A;  3UT8 A;  1OWM A;  1QQE A;  3GYZ A;  2L0T B;  5ARG A;  3R7Q A;  2WXR A;  2I9C A;  3Q15 A;  4XIF A;  4BSX A;  5BV0 A;  4V3I A;  4U04 A;  1PC2 A;  2LSV A;  1OUV A;  3ZRH A;  2C2L A;  4J8E A;  4AJW A;  3U3W A;  2VJ8 A;  3S7F A;  4ACL A;  3FU0 A;  5G05 C;  2VYI A;  2YNQ A;  3PRZ A;  5KCM A;  4K03 A;  3T5X A;  3VLD A;  3ZHE A;  5KJM A;  5T3R A;  3JQ0 A;  5E75 A;  4Q94 A;  4GA0 A;  1Z6T A;  4HLE A;  3PE3 A;  3GZ1 A;  5LX8 A;  4G24 A;  4EQF A;  3VTX A;  2XGS A;  3ZYL A;  2FF4 A;  1UG3 A;  3LXU X;  4WAF A;  3ZPJ A;  2VTB A;  4BX9 A;  3PZD A;  1QNF A;  4GZD A;  5JHA A;  4ABN A;  4IRU A;  3S7J A;  2HO1 A;  2NC9 A;  2YIN A;  5CMY A;  4B94 A;  2L0I A;  3CEQ A;  3FUM A;  3UT4 A;  2OVB A;  4FJY A;  4GYO A;  4IN3 B;  4JC8 A;  4O6F A;  1X5B A;  1PY1 A;  2WXF A;  1E7U A;  3FU5 A;  1XGW A;  1UN9 A;  2V0P A;  3CHS A;  5BUZ A;  5FJY A;  5A23 A;  4N3B A;  1NZN A;  2FI7 A;  3OXF A;  3CGH A;  2PM6 A;  1MQS A;  2GGF A;  2J9Q A;  2JEK A;  3MKQ B;  3MYV A;  4GMJ A;  4RG9 A;  1JPL A;  2Y4T A;  3MX3 A;  4G23 A;  3CVN A;  1HF8 A;  1FVF A;  3PEV B;  2HR2 A;  2J4B A;  4WUY A;  4PH4 B;  2NXP A;  3LS8 A;  3K9I A;  4EPZ A;  3RJV A;  4MLP A;  4CRW A;  1WY6 A;  3D3M A;  4N5C A;  1TJF A;  4N2Q A;  1H2U A;  3QWP A;  2YQ8 A;  3IHY A;  2MHK A;  3ML8 A;  2DCP A;  5G05 J;  4GCO A;  2CG2 A;  3TXN A;  3URZ A;  1TEZ A;  2WQ6 A;  4I2Z A;  4URK A;  4UWL A;  3VLE A;  4GZC A;  5C1D A;  4JPS A;  5J90 A;  4RSY A;  2DBA A;  3QOU A;  3FUE A;  3CVU A;  3FWV A;  5A6C A;  1OWO A;  4E85 A;  1A17 A;  2WXG A;  3SNX A;  4XZ4 A;  3QNK A;  4GCN A;  3UQ3 A;  3IV0 A;  2AVP A;  4AEZ C;  3HHM A;  3GW4 A;  3JQ1 A;  3MZL B;  2Y4U A;  3EIJ A;  4ANX A;  3UPV A;  4KT6 B;  5JJT A;  1N54 A;  4EBA A;  1HG2 A;  4J0U A;  1YA0 A;  3U4T A;  3MJW A;  3ZYQ A;  1HG5 A;  3LDZ A;  1ZU2 A;  3FH8 A;  4K0R A;  3SBS A;  4CDR A;  1P5Q A;  3CST A;  4GAA A;  4JHR A;  2C0M A;  3CVV A;  4FC8 A;  4AM9 A;  4AY6 A;  4I1O B;  3SF4 A;  2R5S A;  2VGY A;  3SHF A;  2EQX A;  1KLX A;  2CG3 A;  3FTU A;  1JWF A;  2RG8 A;  3D9P A;  4FHK A;  1H0A A;  4KVO A;  4GA2 A;  4DJA A;  4NUR A;  2WXN A;  5ENN A;  3PUK A;  4UWK A;  4W9R A;  4C0E A;  2LSU A;  4E6H A;  3FUJ A;  3CHM A;  2AW6 A;  2XPI A;  3CKC A;  4WNE A;  4FHJ A;  5FZS A;  1ELR A;  3ZGQ A;  3AU4 A;  2J07 A;  3L13 A;  4ANW A;  3MGB A;  4C0M A;  4TV3 A;  2IQC A;  4PS3 A;  4GB9 A;  2QY7 A;  4PS8 A;  3LYA A;  4DLQ A;  2R59 A;  3CK8 A;  2WMN A;  1BPO A;  1HX8 A;  4UQX A;  4DK5 A;  4ANU A;  3FEX A;  3T5V A;  3ZW3 A;  2VSX E;  1HXI A;  4XKC A;  3NQP A;  3APF A;  2X6K A;  3QB2 A;  4YND A;  4BY6 A;  4MKT A;  3FY4 A;  2IU1 A;  4JHJ A;  2AXU A;  3CHR A;  3L17 A;  1LF8 A;  3S7B A;  2GRM A;  2KAT A;  3PH0 C;  3TL5 A;  1HS6 A;  1W3B A;  3AS4 A;  2LNI A;  4ATG A;  3RO3 A;  4FUL A;  3CHQ A;  3L6A A;  3L22 A;  1H6K A;  4P29 A;  2WVI A;  3JCK C;  1U3D A;  3OAW A;  2OOE A;  4UQZ A;  3FTS A;  4HXI A;  3FTW A;  3FUL A;  2QFC A;  3RRU A;  4AIF A;  2OND A;  4I6G A;  4GA1 A;  2V8S E;  3Q49 B;  3FFL A;  3ZVV A;  3LVQ E;  4BTA A;  3E4B A;  4I9E A;  4KVM A;  3S7D A;  3PNL B;  4Q96 A;  3G2W A;  4OVU A;  3L16 A;  4A1S A;  4CDN A;  4Q69 A;  2KCL A;  4I6J A;  1INZ A;  3CVY A;  5G04 J;  1XNF A;  5G2N A;  4N39 A;  3EJN A;  4B89 A;  4UI9 K;  3O4Z A;  2HYZ A;  4CEM A;  1ELW A;  1FCH A;  2XHE A;  4H7Y A;  4WWO A;  4HOU A;  3SBT B;  3TJP A;  2OV8 A;  4CGV A;  1SQM A;  5LCW J;  2J09 A;  2CHX A;  4GZ5 A;  3PRE A;  1OWL A;  4JL0 A;  3LY9 A;  4LCT A;  1NA0 A;  1TJC A;  4FP7 A;  5AYW D;  2XCB A;  3RIB A;  4A3V A;  4L2L A;  4L7T A;  4EEC A;  2WXP A;  4F3V A;  1DVP A;  5CMW A;  3R9A B;  3IKO B;  4FLH A;  2L6J A;  5G55 A;  3FDH A;  3DPD A;  4U0Z A;  2MOW A;  3ASF A;  5JJ7 A;  2AXV A;  4JVS A;  4XI9 A;  3ZFW A;  2J4D A;  4U07 A;  3U9W A;  3N71 A;  2ION A;  3CQG B;  4L23 A;  3RKV A;  5C2Y A;  3ESK A;  3CK9 A;  3C98 A;  4WWN A;  3FUD A;  4AXH A;  2XGO A;  4G2V A;  5A7D B;  5AIJ A;  4MRU A;  4PS7 A;  2YHE A;  3FTY A;  3FUH A;  4EZL A;  4KZ0 A;  1QZ2 A;  5LOZ A;  2WXI A;  3Q5M A;  3LJ3 A;  3RRM B;  3CHO A;  3B7S A;  4ILH B;  3ASD A;  3MA5 A;  4HOQ A;  3U64 A;  4AY5 A;  2PM7 A;  3APD A;  4GU5 A;  1E7V A;  3TAX A;  3ONL A;  4LUN U;  4G1T A;  3TG4 A;  5FQ4 A;  2KC7 A;  2X6F A;  4CDM A;  3QAR A;  3LKU A;  3ZYM A;  3AU5 A;  4RVB A;  3SZ7 A;  4U63 A;  3L54 A;  4DI3 A;  4EBA G;  4CCA A;  2WMO A;  4KYO B;  2WXM A;  1EYH A;  4J6I A;  2GW1 A;  4U8H A;  1ZBP A;  4J8S A;  2XEV A;  3ZHE B;  4UWG A;  2ZU6 B;  2CFU A;  4JEU A;  2VTB B;  2WPV A;  3TG5 A;  5BNW A;  2FBN A;  3P1U A;  4GPK A;  3ZYK A;  3CQC B;  4JZY A;  4JEH A;  2YHC A;  5LP0 A;  3G2V A;  3UX4 A;  1DNP A;  1NP7 A;  3QWV A;  4UWH A;  3R7R A;  4JXT A;  2C0L A;  3EIQ C;  3G2T A;  3FUI A;  3VTY A;  1KT1 A;  3CVP A;  3U66 A;  3HDX A;  3ML9 A;  4EZJ A;  1EF1 C;  2Y3A A;  2NSZ A;  3KAE A;  3PDN A;  4A3T A;  4D10 C;  5KJN A;  4H7X A;  4L1B A;  2X6I A;  2I1K A;  4GYY A;  5M72 A;  4KXK B;  3EHM A;  4NAC A;  3QC1 A;  3GZ2 A;  3G2U A;  1Z3Y A;  3HVE B;  4YVQ C;  2Q7F A;  2BTD A;  2IF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...