3PEVB

S. cerevisiae dbp5 l327v c-terminal domain bound to gle1 and ip6
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
TNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 108
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07817 GLE1 GLE1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.510 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pevB00
3PEVB 3PEUB 3RRNB 3RRMB
chains in the Genus database with same CATH superfamily
3E32A 4FLHA 3ULEG 4V3IA 2LSVA 2M63A 3WG7E 4WNGA 2BF0X 3PREA 4C48B 1UG3A 5EKQD 1HS6A 4URKA 4XZ4A 2XZTG 2V4HC 4WWOA 3CSTA 2EQXA 3CHOA 3SNXA 4I6JA 5JJTA 3D9LA 3U4TA 2WXNA 2P9SG 5KNHD 1TNOA 1FT1A 3EHQA 5H7PA 1N94A 4ACKA 5FWQA 4F6RD 4TUUA 3B7SA 4HQDA 1HG2A 1SZ9A 1MYOA 2KZTA 2V5FA 4CDRA 4AM9A 3UXGA 3MEKA 1U2VG 4Q96A 1IYGA 3VTYA 4N3CA 1HFAA 2YHCA 4ILHB 5J08A 2L0TB 5EYPF 1LF8A 1H19A 2J9QA 5ANRA 5FJYA 3T8KA 3QWWA 4ATGA 4EQFA 4WNFA 4EZJA 4HOUA 4M7CA 3DXKG 4DX2A 2FEZA 4WWNA 5ENQD 3D9NA 3UKUG 3D9HA 4G24A 4O60A 1N54A 3CVQA 3SFYA 4N39A 1K8KG 5JJ6A 5JMND 2B6CA 3TL5A 2XPZA 3GW4A 3T8MA 4UWLA 5C1DA 2IOLA 4TUMA 5CMYA 3LY9A 3ZW3A 4IYPA 3ASDA 4JA9A 1N0QA 2LXMA 1SA4A 3PH0C 4RG9A 5B3SE 2DVWA 4GTVA 3R9MA 5FTPA 3RRNB 4NIKA 3D3MA 1G3NB 3UT7A 2F8XK 1X81A 1NFIE 3TJPA 3G2WA 3BG0B 5BW8C 2QZAA 2RKKA 3UUXA 4XX5A 3FUEA 3QWVA 4F7AA 3MGBA 4UI9K 3I5PA 5DBKA 2LXLA 1K3ZD 3NZUA 1NP7A 3VLDA 2WQ7A 3LEWA 2HE0A 5BUZA 1EPUA 3CK9A 3Q78A 4YVOA 3ML9A 2XENA 4N3BA 2DIWA 2FO7A 4U8HA 5FINA 1HE8A 2R59A 3ABKE 2MRIA 2AJAA 3EHNA 3CHSA 2OVBA 3ZU7B 4BESA 4HNAD 5EIDA 3PZ4A 1IHBA 2KC7A 1FT2A 5A6CA 2LO6A 3Q4AB 3FEXA 4H7YA 4E85A 1QNFA 4TXPA 5EIBE 4G2VA 1SW6A 1OWLA 3KD7A 4ANXA 3E30A 1TN6A 3FUHA 4LEUA 2XQ0A 2FI7A 1S64A 4Q69A 2GRQB 5JHBA 4GMLA 4CZ2D 4JA7A 4G26A 4BTAA 2IU1A 4FJZA 1HZ4A 4EPZA 4APOA 3RK6A 4LNBA 2IJGX 3CVXA 2J09A 2VSYA 4U95D 2L0IA 2CHZA 3D9JA 3TWVA 3FU6A 4OAVB 3IBEA 1E8WA 1JUQA 2GGFA 4N5QA 1IXVA 2YQ8A 4OAUC 3ZHEB 4JB8P 2F37A 3S2AA 1W3BA 1WG0A 4QFVA 5HS0A 2L9BA 1OCOE 1OWPA 3RSEG 2MOWA 2ZIRA 4GU5A 3MV3B 4GTTA 4G8LA 2PM7A 3Q79A 3HYMB 4A3TA 1LD8A 1TJCA 1N4SA 1HH8A 3JQ1A 4HOSA 4J6IA 3P1UA 2NSZA 4YDYA 3ASOE 2LAHA 3E34A 2HR2A 4HVBA 3SF4A 1TR4A 2VJ8A 5B1AE 5CMWA 4HFGA 4AV7A 2CG2A 3HXBA 4GB9A 5T3RA 1IHGA 2XS1A 1KT0A 3F6QA 2VGYA 1E8YA 1O1TA 1FPPA 4LERA 4JHRA 2WXPA 2PNNA 1OUVA 1N4QA 4MRUA 1AWCB 2C2LA 2WXFA 5CBOA 2GRPB 3QB2A 2IF4A 1NL4A 4AY6A 4ATZD 2DZNA 4B8CB 2E2EA 1NI1A 2XCCA 1DCEA 5CRUA 2F0YA 3MCXA 4DPRA 2GRRB 1MZCA 3G2VA 1YMPA 3Q9UC 3KEZA 3MKQA 4ILGA 3O4ZA 2XEHA 2JEKA 2LSUA 4U04A 2WXGA 5CEAA 2ZU6B 4RQIA 3FUKA 5AYWD 3DPDA 1IQUA 1RW2A 3D9OA 3TWUA 5G2NA 1KZOA 2KATA 4ZFHA 1TYQG 2WMNA 5LX8A 3QARA 4I6EA 4A63B 3RU0A 4LG6A 5E76A 5CRVA 2XGMA 3RO2A 4K0RA 2BKGA 4I43A 2A4ZA 4O6FA 3CHPA 4NURA 1QQEA 1MX2A 1WDYA 3HHMA 1N52A 2KXPC 3CK8A 3SQVA 3ZIMA 5G04C 3DWLG 4KXKB 1N11A 3GZ1A 4U7EB 2LUHA 3CHRA 4WAFA 4H7XA 2IO2C 3EHRA 3TXMA 2YHEA 2KBXA 5AARA 3LJ3A 4JD2G 3HDXA 3OXLA 4PH4B 4HLLA 3JUEA 3MA5A 2DCPA 2ETBA 2P9IG 4EBAG 4XKCA 3S7DA 4UQZA 3AS4A 2C0LA 4QQIA 4UI9C 1SA5A 2L6BA 3HXDA 5EX0A 4UQYA 3JXJA 3OXGA 4DUIA 5IY5E 4I2WA 4GZDA 1KPSB 4FP7A 4DLOA 4N5CA 1S0PA 2RG8A 5CCLA 3RJVA 4CEMA 1MQSA 4U8YD 1TNZA 3L13A 3U66A 4LUNU 4GTPA 4JZYA 1OT8A 1VDYA 4L2YA 3URZA 5G04J 2GRNB 3RAUA 2X3MA 4I2ZA 3ZKJA 1KLXA 1FVHA 4B8AA 1OWMA 2WXKA 1SZAA 3G2SA 1H2VC 3FH5A 2V5QC 2WMOA 1YA0A 2GW1A 2AXVA 5KJKA 3FUMA 1DVPA 3ESKA 5E75A 1WAO1 2C0MA 2VSNA 4GYOA 1UJJA 2VSXE 4HI9A 3FU3A 3I4RB 3PE3A 4AOFA 5BXOA 4NRHB 2R2LA 2H6HA 5LCWC 2HM8A 2ZISA 1JCQA 1UJKA 4DX1A 3NQPA 1DNPA 4PS8A 2BEDA 4GPKA 3UI2A 4BSXA 1MJ0A 2B0OE 4MKTA 5AQ7A 4DI3A 1PY1A 2I6HA 3TWSA 4I17A 2J07A 5G05J 4J0UA 4C0EA 3Q9NC 4XKBA 4L1BA 3R9AB 5JA4D 5AJDA 2V0PA 3AJIA 2YNQA 4JHJA 1Z3YA 5KBAA 1XNFA 3U9WA 3JYSA 2ETCA 1H6PA 3ZGQA 2VYIA 2Y0BG 4A1GA 4I1OB 4IN3B 3TWWA 2IY0C 2ZGGA 1HF8A 3SI5A 3S7JA 3VTXA 2EIKE 1S63A 4B0ZA 3L17A 4PUCA 4BT8A 4LNGA 3DSXA 3FUDA 4CGWA 5BNWA 4AVXA 2VTBB 3E33A 4J8YA 2FULA 2X38A 3FFLA 4HRMB 3PVLA 4EHMA 2PQRA 3UM1A 3R7QA 2V4LA 3EDTB 3PZDA 1H6KA 2MYOA 4GTRA 3UM3A 2AXUA 4G11A 3C3RA 5KNGA 3Q47B 2F8YA 1BLXB 2WXLA 3J5QB 3ASHA 3FTZA 4L7TA 3J5PA 3BQOA 4A3VA 5KJNA 4GTMA 1N4RA 4X8QA 2X6IA 4YDEA 4TXQA 5C2YA 3FUFA 2L6JA 3DSWA 3UIOC 3IV0A 5FZRA 1SVXA 5EILA 2GRLA 3D9KA 3IKOB 2I1KA 4UUCA 2DWZA 5AJLA 5BT1A 2Q7FA 1O1SA 4AXHA 4GYYA 4GZ5A 4WWPA 1N95A 4I6GA 4HOTA 1OXJA 4DRXE 4C9BB 4DLQA 2AW6A 3ZVVA 3SFXA 4MS6A 5KJMA 1YCSB 3ASNE 5AENA 4G23A 1TNBA 1NZNA 4CGVA 1TEZA 3ZPJA 3ASGA 4CDMA 4E6HA 3LY7A 1YYHA 4RSYA 3FTSA 2PZIA 3CHQA 2PL2A 1DC2A 3FY4A 2ZXWE 3LXUX 4HXIA 2NXPA 3PUJA 3SY2A 1QZ2A 2P9PG 3L9TA 3FU5A 2UY1B 5M72A 1D8EA 2WQ6A 4JXTA 4CYMD 3LYAA 3ZYQA 3FULA 2KM4A 3DEOA 4UWKA 3QNKA 2LNIA 2Y4UA 5CCMA 1FCHA 2XZDG 4O1OA 4TXRA 2PM6A 2WVIA 3OXFA 4EZLA 5LFAA 3DEPA 3FU0A 3ZYLA 5HQ8A 2UWJG 4GZ3A 2XGOA 3R7RA 4B94A 2I1JA 4XI0A 2Y3AA 2XCBA 3JCKC 3CR3A 3Q5MA 3DRAA 2EINE 2J4BA 4CT4A 2VGXB 5EN5D 2AVPA 5LP0A 3ULYA 2R03A 5ENPD 4G1TA 5D66A 5CBNA 4U8VD 4FC8A 2GROB 4FHKA 5ENSD 1U3CA 3VLFA 3PRZA 3ASFA 1K1AA 2WXIA 3LKUA 2OOEA 4K03A 4BERA 4JVSA 4CCAA 3AG3E 5ARGA 4J8FA 1H2UA 2IFUA 1NA0A 2XRZA 3FEYA 2X6KA 5FQ6A 3W9FA 3NZSA 4OVUA 1RZ4A 4I9EA 3Q73A 2R05A 3CKCA 2P9KG 4XI9A 5ENNA 1TNUA 3LDZA 3TAXA 3ZNGA 3ZHEA 3AG2E 4HI8A 2JABA 1EYHA 4Z68A 3EHMA 1SQMA 3IXEA 3ZUVB 2HYZA 4IULA 1X5BA 1D9SA 1BI8B 1WM5A 3MX3A 2X6HA 4KVMA 4AP2A 5AN8A 4A1SA 5FIOA 2GRMA 4PDXA 3PS6A 5T4YA 3U64A 3CV0A 3UM2A 2DYRE 4BSZB 2WB2A 2I9CA 3AAAC 4TV3A 3TWQA 3L22A 1HXIA 1JWGA 4NQ0A 4KBQA 3U3WA 3MZLB 4GA1A 3AS5A 4OVVA 2WM9A 3CGHA 5FQ7A 3S7BA 3Q49B 3ZYKA 3FP3A 3NOGD 3HVEB 3W9GA 3L16A 3B13A 4GZ6A 1PC2A 2DBAA 3FUJA 3ZFWA 3PE4A 3SGHA 3EJNA 3FTUA 4UQXA 3BU8A 2KCLA 4FA6A 1BPOA 4LRZA 3UT4A 3OTNA 3B7TA 4GMJA 5LOZA 3E4BA 1P5QA 2QFCA 5A23A 4NACA 1N4PA 4YDOA 3CEQA 1AP7A 2EILE 3K9IA 3Q7AA 4O1PA 4APFA 1ELRA 4B89A 3E37A 4BX9A 4LCTA 3S7FA 1MX6A 3L6AA 1EDUA 3QJZA 2VQ2A 2H6GA 4U0SA 3V2XA 3FDHA 3LCAA 3P2BA 5EYLA 2X6JA 3CSFA 3SBTB 3KS2A 2WXQA 2QC9A 4JPSA 2CHWA 1K1BA 2KZTB 3NB2A 2JLBA 4Q94A 4F1PA 3AU5A 4DX5D 1H2TC 2RFAA 3DBSA 5CECB 4DX6D 5D0QD 2DYSE 3B95A 4KZCA 2CG3A 4FLBA 2FF4A 3TGOA 1NA3A 3Q75A 4JL0A 1ELWA 3LPZA 4CDNA 4J8EA 3HXFA 3APDA 4FU3A 3T5VA 2IONA 4L2LA 3LS8A 5AQBA 4Y6CA 3EUVA 2IO3C 4ILIA 3G2UA 3LVRE 4GYWA 2J49A 4UI9J 3JXIA 3I3NA 4HOQA 3RIBA 3B7BA 1BI7B 2IQCA 3GZSA 3LJNA 3ZEFA 2H6IA 3BUAA 4JEHA 4GA2A 3CVYA 2HO1A 4AY5A 2J08A 4GZCA 4AIFA 4DI4A 2FO1E 3QWPA 2X6FA 4DK5A 4FADA 3TWTA 1TN7A 3ZYMA 3QK0A 4JEUA 3QC1A 1E8XA 2CFZA 3GYZA 3HXCA 2EIJE 4WNEA 3QKYA 1S70B 4ANUA 3TWXA 3JUIA 4IRUA 2P58C 3IEGA 4BEPA 1V54E 3HRAA 3BEEA 2OEWA 3I4GA 3ONLA 3PZ1A 3TWRA 5BXUA 1U3DA 1UN8A 3ZXSA 4HRNA 1TJFA 3RKVA 1OY3D 2RD0A 1INZA 1JCRA 1TNYA 2Y69E 4AEZC 3SZ7A 4RG6A 5LCWJ 4GTSA 3FH8A 3ESLA 5KCMA 5AAOA 2AWIA 1LD7A 1OCZE 3CQGB 3V31A 5JHAA 1HG5A 2BKKB 1E7VA 5HI7A 3V2OA 3PEUB 4BT9A 3NOCD 3CVUA 4A55A 3NBNB 4U0ZA 3L54A 5ANLA 4M3OA 4ANWA 3DPYA 4GPMA 2WXRA 4U0UA 5FZSA 2OVFA 3SD5A 3C3QA 5CERB 1XGWA 3G2TA 3PUKA 3MYVA 4CRWA 4KVOA 3UX4A 4R7LA 3ULQA 2WXOA 4GA0A 4EECA 1OCRE 3VLEA 2WQHA 5AQAA 1Q2ZA 3C5RA 4CT0A 2Y1LE 3MV2B 4G25A 2P9LG 3JQ0A 4L9PA 3Q7FA 4HBDA 3EU9A 4N3AA 5D2MC 3FUNA 3QDNA 1E7UA 3UTMA 1BU9A 4K5AB 4F3VA 5EDSA 2R17C 3TXNA 2H6FA 2XPYA 4XEIG 3RO3A 2ZGDA 3SO8A 1BD8A 4BX8A 2OV8A 5HRYA 2XGSA 4B93B 2CHXA 2VTBA 4WUYA 3IHVA 2P9UG 3AG1E 3KSLA 1HU3A 4KZ0A 1H0AA 1IQRA 5AQ9A 1WY6A 2P9NG 1JCSA 3D9IA 5ENOD 3SFZA 3SBSA 4KT6B 4XIFA 3LY8A 5EX3A 4HLEA 3UQ3A 5FQ8A 4ZHBA 3DSVA 3UIPC 2XPIA 5KJLA 2Y4TA 2QY7A 5FZQA 3UPVA 2V8SE 2P2CP 1EF1C 2RFMA 3ISMC 2A5UA 3FTVA 3ZXPA 3MKQB 2DZOA 3ONKA 4HS2A 3L08A 4UWFA 3NAWA 3KAEA 4BFRA 3T5XA 4PS7A 1DCQA 4BETA 3RRMB 3X2QE 4KMOA 2FBNA 3CHMA 4DX7D 1ZB1A 3AS8A 5ARFA 1IKND 1V55E 3KSQA 1LTXA 3PNTB 2ETAA 4ACLA 4N2SA 4UWHA 4K5BA 4YVQC 3PNLB 5B1BE 1Z6TA 4HB5A 4G8KA 1E8ZA 4LNUD 5BPPA 1UN9A 2WXJA 2VGEA 3CVNA 4GMRA 2WXMA 4BY6A 2KCKA 3QOUA 4U96D 1ZU2A 3CLJA 3ZN3A 4L23A 3B7RL 3DSSA 3C72A 3EU5A 1O5MA 1O1RA 5KWDA 3ZRHA 3DSUA 4OYSA 2BTDA 3WXXA 4WNDA 4W9RA 4PS3A 3APCA 3L82A 2NC9A 3AG4E 2XS8A 3FH7A 4FULA 2UY1A 4RVBA 3UT8A 4U07A 1OWNA 3V79K 3IHYA 3D9MA 3RRUA 1QYMA 5G55A 3LVQE 4D10C 3NF1A 5FT9A 4BTBA 1KT1A 3CK7A 4K5CA 1TN8A 4ABNA 4FJYA 1FVFA 2XHEA 1Y6IA 3PEVB 5D0OD 4J8SA 3FUIA 5HKPA 4F1SA 5AIJA 5BV1A 4EZKA 3ABME 5ENRD 4GTOA 2R5SA 2CFUA 4JC8A 2WPVA 3OAWA 1UW4B 3KEAA 3N71A 1E96B 1B89A 1Z3XA 3MKRA 2VGXA 4ANVA 2QYUA 3CVLA 4GCNA 4I1MA 1ZBPA 4JW1A 5T8IA 5DIZA 1OCCE 4MLPA 1ELKA 1KZPA 3T9KA 3HIZA 3BG1B 4MBGA 4JHKA 4HRLA 4ME2A 3CKBA 1L5JA 3PDNA 1UOHA 2KCVA 1D8DA 4TRQA 2A5EA 4KYOB 3MJWA 4RLYA 3HG0D 4UWGA 3AU4A 3TG4A 2XEVA 3SHFA 4Y6WA 3Q15A 3C3OA 1A5EA 4FHJA 5A7DB 3DSTA 2VSOE 1QBQA 1Y8MA 3HXEA 2J8SD 2BUGA 3ML8A 5CHEE 4P29A 2XRYA 5JJ7A 5CEDB 1N0RA 5J90A 3DXMG 1HX8A 2ILRA 3UMVA 3PZ2A 1N9AA 3CIAA 3UM0A 1MX4A 5BV0A 2E0IA 1PAQA 4C0MA 3CQCB 2AXZA 3FTXA 4AJWA 3FWVA 2ONDA 2QYJA 3V30A 3EIQC 2J4DA 3FTYA 3ABLE 3C98A 1JWFA 3UINC 1OWOA 2LAIA 4I9CA 5G05C 2IOSA 1E90A 2OCCE 1Z5SC 2XEEA 4EBAA 2NYJA 3CVWA 4GAAA 4HORA 5ITZF 2R02A 4YNDA 4BWRA 1JPLA 2YINA 1MHQA 4I1AA 3HVEA 4N2QA 3D9PA 3UKRG 3FHEA 4XE0A 2I2OA 2PQNA 3QAQA 5ENTD 1HO8A 3O48A 3CVVA 4GCOA 3FTWA 2WXHA 4U63A 4YDWA 2EIME 3CVPA 3TG5A 3APFA 1A17A 4LSZE 1H6OA 4DJAA 3B7UX 3GZ2A 3PZ3A 4GTQA 4F53A 2MHKA 4J7WA 2OEVA 2IEJA 5FQ4A 1GW6A 4J8DA 3ENEA 3EIJA
chains in the Genus database with same CATH topology
2J4BA 4CT4A 2VGXB 4R7LA 4FLHA 2WXOA 4GA0A 4KXKB 3ULQA 4EECA 4V3IA 2AVPA 5LP0A 2LSVA 2M63A 3GZ1A 4WNGA 2BF0X 3PREA 3VLEA 2WQHA 1UG3A 4G1TA 5EKQD 1HS6A 4CT0A 4URKA 3CHRA 4XZ4A 3MV2B 4G25A 3JQ0A 4FC8A 4WAFA 4H7XA 4WWOA 3CSTA 4N3AA 2EQXA 4FHKA 3CHOA 3SNXA 1U3CA 3VLFA 3PRZA 3FUNA 4I6JA 5JJTA 3ASFA 3QDNA 1E7UA 3D9LA 3U4TA 2WXNA 2WXIA 3TXMA 3LKUA 4F3VA 2OOEA 2YHEA 4K03A 5EDSA 2R17C 3TXNA 3LJ3A 4JVSA 4CCAA 5ARGA 4J8FA 4ACKA 1H2UA 5FWQA 3HDXA 2XPYA 2IFUA 3OXLA 1NA0A 4PH4B 3RO3A 2XRZA 3FEYA 2X6KA 5FQ6A 4TUUA 3B7SA 4BX8A 1HG2A 2OV8A 3MA5A 2XGSA 2DCPA 3NZSA 1SZ9A 4OVUA 2KZTA 4I9EA 2CHXA 4EBAG 4XKCA 3CKCA 3S7DA 2V5FA 4UQZA 4CDRA 2VTBA 4AM9A 3AS4A 2C0LA 4XI9A 5ENNA 3MEKA 4WUYA 4Q96A 3IHVA 1IYGA 4UI9C 3VTYA 4N3CA 1HFAA 2YHCA 3LDZA 1HU3A 4ILHB 4KZ0A 5J08A 3TAXA 1H0AA 5EX0A 4UQYA 2L0TB 3OXGA 1LF8A 3ZHEA 1H19A 4I2WA 4GZDA 4FP7A 1IQRA 4DLOA 4N5CA 1WY6A 1S0PA 1EYHA 2J9QA 5ANRA 2RG8A 3D9IA 5FJYA 3QWWA 4ATGA 4EQFA 4WNFA 3EHMA 4EZJA 5CCLA 3SFZA 3SBSA 1SQMA 3RJVA 4HOUA 4CEMA 1MQSA 2HYZA 4KT6B 3L13A 4XIFA 3U66A 4LUNU 2FEZA 4JZYA 3LY8A 4IULA 4WWNA 1X5BA 3D9NA 5EX3A 1WM5A 4HLEA 1VDYA 3UQ3A 3MX3A 4L2YA 4G24A 3URZA 2X6HA 5FQ8A 5G04J 4KVMA 2XPIA 1N54A 4AP2A 5KJLA 2X3MA 3CVQA 4I2ZA 4A1SA 1KLXA 2GRMA 4PDXA 1FVHA 2Y4TA 3PS6A 4N39A 2QY7A 5FZQA 5T4YA 2V8SE 1OWMA 3U64A 3CV0A 2WXKA 1SZAA 3UPVA 5JJ6A 3G2SA 1EF1C 2WB2A 1H2VC 3TL5A 2I9CA 3FH5A 2XPZA 2WMOA 1YA0A 2GW1A 4TV3A 3GW4A 3T8MA 2A5UA 4UWLA 2AXVA 5KJKA 3FTVA 3L22A 5C1DA 2IOLA 1HXIA 3MKQB 1JWGA 3FUMA 1DVPA 3ESKA 5CMYA 3LY9A 4NQ0A 5E75A 1WAO1 5G04C 3ZW3A 2C0MA 2VSNA 3ONKA 4HS2A 3MZLB 4GA1A 3ASDA 3L08A 4IYPA 4JA9A 4KBQA 3U3WA 4UWFA 3AS5A 4OVVA 2WM9A 3CGHA 4GYOA 3PH0C 3KAEA 1UJJA 5FQ7A 2VSXE 3Q49B 4RG9A 3S7BA 4BFRA 3FU3A 3I4RB 3T5XA 4PS7A 3ZYKA 3PE3A 3FP3A 4AOFA 3RRMB 3HVEB 3L16A 4KMOA 2FBNA 3CHMA 4NRHB 3B13A 5FTPA 3RRNB 3D3MA 3AS8A 5LCWC 2HM8A 5ARFA 3UT7A 1UJKA 3NQPA 1DNPA 3PUKA 4GZ6A 3TJPA 3G2WA 1PC2A 4PS8A 3BG0B 5BW8C 4GPKA 2DBAA 3PNTB 3FUJA 3ZFWA 3PE4A 3SGHA 3EJNA 4BSXA 3UUXA 4XX5A 3FUEA 3QWVA 4F7AA 3FTUA 3MGBA 4MKTA 4UQXA 4UI9K 4ACLA 3I5PA 4DI3A 4N2SA 2KCLA 1PY1A 5DBKA 3NZUA 2I6HA 4UWHA 4FA6A 1BPOA 1NP7A 4LRZA 3UT4A 4I17A 4YVQC 3OTNA 3VLDA 2WQ7A 2J07A 3PNLB 3B7TA 3LEWA 5BUZA 5G05J 1EPUA 4J0UA 3CK9A 4GMJA 1Z6TA 4YVOA 4C0EA 5LOZA 3E4BA 1P5QA 3ML9A 4XKBA 4N3BA 2QFCA 1E8ZA 2DIWA 2FO7A 4U8HA 4L1BA 5BPPA 3R9AB 1UN9A 2WXJA 5A23A 1HE8A 2R59A 4NACA 2MRIA 5AJDA 3CVNA 2V0PA 3EHNA 3CHSA 2WXMA 4BY6A 2YNQA 3CEQA 2OVBA 2KCKA 4JHJA 1Z3YA 3K9IA 4APFA 3QOUA 2KC7A 1ELRA 1XNFA 5A6CA 4B89A 2LO6A 3U9WA 1ZU2A 3CLJA 3Q4AB 3FEXA 3JYSA 4H7YA 4L23A 3ZN3A 4BX9A 4E85A 3B7RL 1QNFA 4LCTA 3S7FA 3ZGQA 2VYIA 4G2VA 3ZRHA 3L6AA 4OYSA 1OWLA 1EDUA 2BTDA 3KD7A 3QJZA 2VQ2A 4A1GA 3WXXA 4ANXA 4I1OB 3FUHA 4LEUA 4WNDA 4U0SA 4IN3B 2XQ0A 4W9RA 4PS3A 3APCA 2FI7A 2NC9A 3FDHA 3LCAA 3FH7A 4FULA 3P2BA 1HF8A 3SI5A 4Q69A 5JHBA 2UY1A 3S7JA 4GMLA 4JA7A 4RVBA 4G26A 2X6JA 4U07A 1OWNA 3UT8A 3VTXA 4BTAA 2IU1A 3IHYA 4FJZA 3D9MA 3RRUA 3CSFA 3SBTB 1HZ4A 3KS2A 5G55A 4EPZA 3LVQE 4B0ZA 4D10C 4APOA 3L17A 3NF1A 5FT9A 3RK6A 2WXQA 4BTBA 2IJGX 4PUCA 4BT8A 3CVXA 4JPSA 3FUDA 2CHWA 1KT1A 2J09A 4CGWA 2KZTB 2VSYA 3CK7A 5BNWA 2L0IA 4ABNA 4FJYA 1FVFA 4AVXA 2XHEA 1Y6IA 2VTBB 2CHZA 2FULA 2X38A 3FFLA 2JLBA 3D9JA 3PEVB 5D0OD 4J8SA 3FUIA 3FU6A 3PVLA 4Q94A 4B8AA 4F1SA 3IBEA 5AIJA 2PQRA 5BV1A 3R7QA 1E8WA 4EZKA 2V4LA 1JUQA 2GGFA 3EDTB 3PZDA 3AU5A 2YQ8A 1H2TC 1H6KA 2CFUA 2R5SA 4JC8A 3ZHEB 2WPVA 3DBSA 3OAWA 2AXUA 4G11A 1UW4B 5D0QD 4CRWA 3Q47B 3N71A 4KZCA 3S2AA 1W3BA 1E96B 2CG3A 2WXLA 1B89A 4FLBA 4QFVA 1Z3XA 2FF4A 3ASHA 3MKRA 2L9BA 2VGXA 1OWPA 3FTZA 4ANVA 3TGOA 1NA3A 3CVLA 4L7TA 2MOWA 4GCNA 4GU5A 4JL0A 4I1MA 1ELWA 3LPZA 3MV3B 1ZBPA 4CDNA 4A3VA 2PM7A 4JW1A 5T8IA 3HYMB 5DIZA 4A3TA 5KJNA 4J8EA 3APDA 4MLPA 1ELKA 1TJCA 4FU3A 2X6IA 3T5VA 1HH8A 2IONA 4L2LA 3JQ1A 3HIZA 3BG1B 3LS8A 4HOSA 4J6IA 4Y6CA 4JHKA 3P1UA 2NSZA 4ME2A 4ILIA 3CKBA 3G2UA 2LAHA 1L5JA 2HR2A 3LVRE 4HVBA 3PDNA 2KCVA 4GYWA 2J49A 4UI9J 3SF4A 4TRQA 5C2YA 4KYOB 3I3NA 3MJWA 3FUFA 4HOQA 4UWGA 3AU4A 3TG4A 2XEVA 2VJ8A 3RIBA 2L6JA 3SHFA 4HFGA 5CMWA 3IV0A 5FZRA 4AV7A 2CG2A 4Y6WA 2GRLA 3Q15A 3D9KA 3IKOB 4FHJA 2IQCA 3GZSA 4GB9A 5T3RA 3ZEFA 1IHGA 5A7DB 2VSOE 2I1KA 4JEHA 1KT0A 4GA2A 3UX4A 5AJLA 5BT1A 3CVYA 2HO1A 4AY5A 2VGYA 1Y8MA 2Q7FA 2J08A 4GZCA 1E8YA 4AXHA 4AIFA 4DI4A 4GYYA 4GZ5A 2BUGA 4LERA 3QWPA 4WWPA 2X6FA 4JHRA 3ML8A 4DK5A 2WXPA 4FADA 4I6GA 1OUVA 4HOTA 5CHEE 4P29A 2XRYA 3ZYMA 5JJ7A 3QK0A 4MRUA 4JEUA 2C2LA 3QC1A 5J90A 1E8XA 4C9BB 2WXFA 4DLQA 1HX8A 2CFZA 2ILRA 3GYZA 3QB2A 3UMVA 4WNEA 3QKYA 2IF4A 4ANUA 2AW6A 4AY6A 3CIAA 3JUIA 4IRUA 2P58C 5BV0A 2E0IA 3IEGA 1PAQA 3ZVVA 4C0MA 4B8CB 2E2EA 4MS6A 3CQCB 5KJMA 2AXZA 3FTXA 4AJWA 3BEEA 3FWVA 2ONDA 2XCCA 3I4GA 5AENA 3ONLA 4G23A 3EIQC 2J4DA 3MCXA 3FTYA 4DPRA 1U3DA 1UN8A 3ZXSA 1NZNA 4CGVA 1TEZA 3C98A 3G2VA 1TJFA 3ZPJA 3ASGA 3KEZA 1JWFA 4CDMA 4E6HA 3LY7A 3RKVA 2RD0A 3MKQA 4ILGA 4RSYA 1OWOA 4I9CA 2LAIA 3O4ZA 5G05C 1INZA 2IOSA 3FTSA 1E90A 2PZIA 3CHQA 2JEKA 2PL2A 4AEZC 3SZ7A 3FY4A 4RG6A 5LCWJ 2LSUA 3FH8A 3ESLA 5KCMA 3LXUX 4EBAA 2AWIA 4HXIA 4U04A 3CVWA 2WXGA 4GAAA 4HORA 4YNDA 4BWRA 2NXPA 1JPLA 2ZU6B 3FUKA 2YINA 1MHQA 3CQGB 4I1AA 5AYWD 3DPDA 5JHAA 3HVEA 4N2QA 3D9PA 1IQUA 3PUJA 1HG5A 3D9OA 1QZ2A 3FHEA 3FU5A 4XE0A 2UY1B 5M72A 5G2NA 2I2OA 2KATA 2PQNA 2WQ6A 3QAQA 4JXTA 1HO8A 3LYAA 1E7VA 3ZYQA 3O48A 2WMNA 5HI7A 3FULA 3CVVA 5LX8A 2KM4A 3PEUB 4GCOA 4BT9A 3FTWA 4UWKA 3QNKA 3QARA 4I6EA 3CVUA 2WXHA 4A55A 4U63A 2LNIA 2Y4UA 5E76A 3RU0A 2XGMA 4U0ZA 5CCMA 1FCHA 3CVPA 3RO2A 4K0RA 3L54A 4I43A 3TG5A 5ANLA 2A4ZA 4M3OA 4ANWA 2PM6A 1A17A 2WVIA 3APFA 3OXFA 4O6FA 3CHPA 4NURA 4DJAA 4EZLA 3B7UX 5LFAA 3FU0A 1QQEA 3ZYLA 5HQ8A 2UWJG 3GZ2A 2WXRA 3HHMA 2XGOA 4GZ3A 3R7RA 4B94A 2MHKA 4U0UA 2I1JA 4XI0A 4F53A 5FZSA 1N52A 2OVFA 3SD5A 3CK8A 2Y3AA 5FQ4A 2XCBA 3JCKC 3CR3A 1GW6A 1XGWA 4J8DA 3G2TA 3ZIMA 3ENEA 3MYVA 4KVOA 3Q5MA 3EIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEV B;  3PEU B;  3RRN B;  3RRM B; 
#chains in the Genus database with same CATH topology
 3E32 A;  4FLH A;  3ULE G;  4V3I A;  2LSV A;  2M63 A;  3WG7 E;  4WNG A;  2BF0 X;  3PRE A;  4C48 B;  1UG3 A;  5EKQ D;  1HS6 A;  4URK A;  4XZ4 A;  2XZT G;  2V4H C;  4WWO A;  3CST A;  2EQX A;  3CHO A;  3SNX A;  4I6J A;  5JJT A;  3D9L A;  3U4T A;  2WXN A;  2P9S G;  5KNH D;  1TNO A;  1FT1 A;  3EHQ A;  5H7P A;  1N94 A;  4ACK A;  5FWQ A;  4F6R D;  4TUU A;  3B7S A;  4HQD A;  1HG2 A;  1SZ9 A;  1MYO A;  2KZT A;  2V5F A;  4CDR A;  4AM9 A;  3UXG A;  3MEK A;  1U2V G;  4Q96 A;  1IYG A;  3VTY A;  4N3C A;  1HFA A;  2YHC A;  4ILH B;  5J08 A;  2L0T B;  5EYP F;  1LF8 A;  1H19 A;  2J9Q A;  5ANR A;  5FJY A;  3T8K A;  3QWW A;  4ATG A;  4EQF A;  4WNF A;  4EZJ A;  4HOU A;  4M7C A;  3DXK G;  4DX2 A;  2FEZ A;  4WWN A;  5ENQ D;  3D9N A;  3UKU G;  3D9H A;  4G24 A;  4O60 A;  1N54 A;  3CVQ A;  3SFY A;  4N39 A;  1K8K G;  5JJ6 A;  5JMN D;  2B6C A;  3TL5 A;  2XPZ A;  3GW4 A;  3T8M A;  4UWL A;  5C1D A;  2IOL A;  4TUM A;  5CMY A;  3LY9 A;  3ZW3 A;  4IYP A;  3ASD A;  4JA9 A;  1N0Q A;  2LXM A;  1SA4 A;  3PH0 C;  4RG9 A;  5B3S E;  2DVW A;  4GTV A;  3R9M A;  5FTP A;  3RRN B;  4NIK A;  3D3M A;  1G3N B;  3UT7 A;  2F8X K;  1X81 A;  1NFI E;  3TJP A;  3G2W A;  3BG0 B;  5BW8 C;  2QZA A;  2RKK A;  3UUX A;  4XX5 A;  3FUE A;  3QWV A;  4F7A A;  3MGB A;  4UI9 K;  3I5P A;  5DBK A;  2LXL A;  1K3Z D;  3NZU A;  1NP7 A;  3VLD A;  2WQ7 A;  3LEW A;  2HE0 A;  5BUZ A;  1EPU A;  3CK9 A;  3Q78 A;  4YVO A;  3ML9 A;  2XEN A;  4N3B A;  2DIW A;  2FO7 A;  4U8H A;  5FIN A;  1HE8 A;  2R59 A;  3ABK E;  2MRI A;  2AJA A;  3EHN A;  3CHS A;  2OVB A;  3ZU7 B;  4BES A;  4HNA D;  5EID A;  3PZ4 A;  1IHB A;  2KC7 A;  1FT2 A;  5A6C A;  2LO6 A;  3Q4A B;  3FEX A;  4H7Y A;  4E85 A;  1QNF A;  4TXP A;  5EIB E;  4G2V A;  1SW6 A;  1OWL A;  3KD7 A;  4ANX A;  3E30 A;  1TN6 A;  3FUH A;  4LEU A;  2XQ0 A;  2FI7 A;  1S64 A;  4Q69 A;  2GRQ B;  5JHB A;  4GML A;  4CZ2 D;  4JA7 A;  4G26 A;  4BTA A;  2IU1 A;  4FJZ A;  1HZ4 A;  4EPZ A;  4APO A;  3RK6 A;  4LNB A;  2IJG X;  3CVX A;  2J09 A;  2VSY A;  4U95 D;  2L0I A;  2CHZ A;  3D9J A;  3TWV A;  3FU6 A;  4OAV B;  3IBE A;  1E8W A;  1JUQ A;  2GGF A;  4N5Q A;  1IXV A;  2YQ8 A;  4OAU C;  3ZHE B;  4JB8 P;  2F37 A;  3S2A A;  1W3B A;  1WG0 A;  4QFV A;  5HS0 A;  2L9B A;  1OCO E;  1OWP A;  3RSE G;  2MOW A;  2ZIR A;  4GU5 A;  3MV3 B;  4GTT A;  4G8L A;  2PM7 A;  3Q79 A;  3HYM B;  4A3T A;  1LD8 A;  1TJC A;  1N4S A;  1HH8 A;  3JQ1 A;  4HOS A;  4J6I A;  3P1U A;  2NSZ A;  4YDY A;  3ASO E;  2LAH A;  3E34 A;  2HR2 A;  4HVB A;  3SF4 A;  1TR4 A;  2VJ8 A;  5B1A E;  5CMW A;  4HFG A;  4AV7 A;  2CG2 A;  3HXB A;  4GB9 A;  5T3R A;  1IHG A;  2XS1 A;  1KT0 A;  3F6Q A;  2VGY A;  1E8Y A;  1O1T A;  1FPP A;  4LER A;  4JHR A;  2WXP A;  2PNN A;  1OUV A;  1N4Q A;  4MRU A;  1AWC B;  2C2L A;  2WXF A;  5CBO A;  2GRP B;  3QB2 A;  2IF4 A;  1NL4 A;  4AY6 A;  4ATZ D;  2DZN A;  4B8C B;  2E2E A;  1NI1 A;  2XCC A;  1DCE A;  5CRU A;  2F0Y A;  3MCX A;  4DPR A;  2GRR B;  1MZC A;  3G2V A;  1YMP A;  3Q9U C;  3KEZ A;  3MKQ A;  4ILG A;  3O4Z A;  2XEH A;  2JEK A;  2LSU A;  4U04 A;  2WXG A;  5CEA A;  2ZU6 B;  4RQI A;  3FUK A;  5AYW D;  3DPD A;  1IQU A;  1RW2 A;  3D9O A;  3TWU A;  5G2N A;  1KZO A;  2KAT A;  4ZFH A;  1TYQ G;  2WMN A;  5LX8 A;  3QAR A;  4I6E A;  4A63 B;  3RU0 A;  4LG6 A;  5E76 A;  5CRV A;  2XGM A;  3RO2 A;  4K0R A;  2BKG A;  4I43 A;  2A4Z A;  4O6F A;  3CHP A;  4NUR A;  1QQE A;  1MX2 A;  1WDY A;  3HHM A;  1N52 A;  2KXP C;  3CK8 A;  3SQV A;  3ZIM A;  5G04 C;  3DWL G;  4KXK B;  1N11 A;  3GZ1 A;  4U7E B;  2LUH A;  3CHR A;  4WAF A;  4H7X A;  2IO2 C;  3EHR A;  3TXM A;  2YHE A;  2KBX A;  5AAR A;  3LJ3 A;  4JD2 G;  3HDX A;  3OXL A;  4PH4 B;  4HLL A;  3JUE A;  3MA5 A;  2DCP A;  2ETB A;  2P9I G;  4EBA G;  4XKC A;  3S7D A;  4UQZ A;  3AS4 A;  2C0L A;  4QQI A;  4UI9 C;  1SA5 A;  2L6B A;  3HXD A;  5EX0 A;  4UQY A;  3JXJ A;  3OXG A;  4DUI A;  5IY5 E;  4I2W A;  4GZD A;  1KPS B;  4FP7 A;  4DLO A;  4N5C A;  1S0P A;  2RG8 A;  5CCL A;  3RJV A;  4CEM A;  1MQS A;  4U8Y D;  1TNZ A;  3L13 A;  3U66 A;  4LUN U;  4GTP A;  4JZY A;  1OT8 A;  1VDY A;  4L2Y A;  3URZ A;  5G04 J;  2GRN B;  3RAU A;  2X3M A;  4I2Z A;  3ZKJ A;  1KLX A;  1FVH A;  4B8A A;  1OWM A;  2WXK A;  1SZA A;  3G2S A;  1H2V C;  3FH5 A;  2V5Q C;  2WMO A;  1YA0 A;  2GW1 A;  2AXV A;  5KJK A;  3FUM A;  1DVP A;  3ESK A;  5E75 A;  1WAO 1;  2C0M A;  2VSN A;  4GYO A;  1UJJ A;  2VSX E;  4HI9 A;  3FU3 A;  3I4R B;  3PE3 A;  4AOF A;  5BXO A;  4NRH B;  2R2L A;  2H6H A;  5LCW C;  2HM8 A;  2ZIS A;  1JCQ A;  1UJK A;  4DX1 A;  3NQP A;  1DNP A;  4PS8 A;  2BED A;  4GPK A;  3UI2 A;  4BSX A;  1MJ0 A;  2B0O E;  4MKT A;  5AQ7 A;  4DI3 A;  1PY1 A;  2I6H A;  3TWS A;  4I17 A;  2J07 A;  5G05 J;  4J0U A;  4C0E A;  3Q9N C;  4XKB A;  4L1B A;  3R9A B;  5JA4 D;  5AJD A;  2V0P A;  3AJI A;  2YNQ A;  4JHJ A;  1Z3Y A;  5KBA A;  1XNF A;  3U9W A;  3JYS A;  2ETC A;  1H6P A;  3ZGQ A;  2VYI A;  2Y0B G;  4A1G A;  4I1O B;  4IN3 B;  3TWW A;  2IY0 C;  2ZGG A;  1HF8 A;  3SI5 A;  3S7J A;  3VTX A;  2EIK E;  1S63 A;  4B0Z A;  3L17 A;  4PUC A;  4BT8 A;  4LNG A;  3DSX A;  3FUD A;  4CGW A;  5BNW A;  4AVX A;  2VTB B;  3E33 A;  4J8Y A;  2FUL A;  2X38 A;  3FFL A;  4HRM B;  3PVL A;  4EHM A;  2PQR A;  3UM1 A;  3R7Q A;  2V4L A;  3EDT B;  3PZD A;  1H6K A;  2MYO A;  4GTR A;  3UM3 A;  2AXU A;  4G11 A;  3C3R A;  5KNG A;  3Q47 B;  2F8Y A;  1BLX B;  2WXL A;  3J5Q B;  3ASH A;  3FTZ A;  4L7T A;  3J5P A;  3BQO A;  4A3V A;  5KJN A;  4GTM A;  1N4R A;  4X8Q A;  2X6I A;  4YDE A;  4TXQ A;  5C2Y A;  3FUF A;  2L6J A;  3DSW A;  3UIO C;  3IV0 A;  5FZR A;  1SVX A;  5EIL A;  2GRL A;  3D9K A;  3IKO B;  2I1K A;  4UUC A;  2DWZ A;  5AJL A;  5BT1 A;  2Q7F A;  1O1S A;  4AXH A;  4GYY A;  4GZ5 A;  4WWP A;  1N95 A;  4I6G A;  4HOT A;  1OXJ A;  4DRX E;  4C9B B;  4DLQ A;  2AW6 A;  3ZVV A;  3SFX A;  4MS6 A;  5KJM A;  1YCS B;  3ASN E;  5AEN A;  4G23 A;  1TNB A;  1NZN A;  4CGV A;  1TEZ A;  3ZPJ A;  3ASG A;  4CDM A;  4E6H A;  3LY7 A;  1YYH A;  4RSY A;  3FTS A;  2PZI A;  3CHQ A;  2PL2 A;  1DC2 A;  3FY4 A;  2ZXW E;  3LXU X;  4HXI A;  2NXP A;  3PUJ A;  3SY2 A;  1QZ2 A;  2P9P G;  3L9T A;  3FU5 A;  2UY1 B;  5M72 A;  1D8E A;  2WQ6 A;  4JXT A;  4CYM D;  3LYA A;  3ZYQ A;  3FUL A;  2KM4 A;  3DEO A;  4UWK A;  3QNK A;  2LNI A;  2Y4U A;  5CCM A;  1FCH A;  2XZD G;  4O1O A;  4TXR A;  2PM6 A;  2WVI A;  3OXF A;  4EZL A;  5LFA A;  3DEP A;  3FU0 A;  3ZYL A;  5HQ8 A;  2UWJ G;  4GZ3 A;  2XGO A;  3R7R A;  4B94 A;  2I1J A;  4XI0 A;  2Y3A A;  2XCB A;  3JCK C;  3CR3 A;  3Q5M A;  3DRA A;  2EIN E;  2J4B A;  4CT4 A;  2VGX B;  5EN5 D;  2AVP A;  5LP0 A;  3ULY A;  2R03 A;  5ENP D;  4G1T A;  5D66 A;  5CBN A;  4U8V D;  4FC8 A;  2GRO B;  4FHK A;  5ENS D;  1U3C A;  3VLF A;  3PRZ A;  3ASF A;  1K1A A;  2WXI A;  3LKU A;  2OOE A;  4K03 A;  4BER A;  4JVS A;  4CCA A;  3AG3 E;  5ARG A;  4J8F A;  1H2U A;  2IFU A;  1NA0 A;  2XRZ A;  3FEY A;  2X6K A;  5FQ6 A;  3W9F A;  3NZS A;  4OVU A;  1RZ4 A;  4I9E A;  3Q73 A;  2R05 A;  3CKC A;  2P9K G;  4XI9 A;  5ENN A;  1TNU A;  3LDZ A;  3TAX A;  3ZNG A;  3ZHE A;  3AG2 E;  4HI8 A;  2JAB A;  1EYH A;  4Z68 A;  3EHM A;  1SQM A;  3IXE A;  3ZUV B;  2HYZ A;  4IUL A;  1X5B A;  1D9S A;  1BI8 B;  1WM5 A;  3MX3 A;  2X6H A;  4KVM A;  4AP2 A;  5AN8 A;  4A1S A;  5FIO A;  2GRM A;  4PDX A;  3PS6 A;  5T4Y A;  3U64 A;  3CV0 A;  3UM2 A;  2DYR E;  4BSZ B;  2WB2 A;  2I9C A;  3AAA C;  4TV3 A;  3TWQ A;  3L22 A;  1HXI A;  1JWG A;  4NQ0 A;  4KBQ A;  3U3W A;  3MZL B;  4GA1 A;  3AS5 A;  4OVV A;  2WM9 A;  3CGH A;  5FQ7 A;  3S7B A;  3Q49 B;  3ZYK A;  3FP3 A;  3NOG D;  3HVE B;  3W9G A;  3L16 A;  3B13 A;  4GZ6 A;  1PC2 A;  2DBA A;  3FUJ A;  3ZFW A;  3PE4 A;  3SGH A;  3EJN A;  3FTU A;  4UQX A;  3BU8 A;  2KCL A;  4FA6 A;  1BPO A;  4LRZ A;  3UT4 A;  3OTN A;  3B7T A;  4GMJ A;  5LOZ A;  3E4B A;  1P5Q A;  2QFC A;  5A23 A;  4NAC A;  1N4P A;  4YDO A;  3CEQ A;  1AP7 A;  2EIL E;  3K9I A;  3Q7A A;  4O1P A;  4APF A;  1ELR A;  4B89 A;  3E37 A;  4BX9 A;  4LCT A;  3S7F A;  1MX6 A;  3L6A A;  1EDU A;  3QJZ A;  2VQ2 A;  2H6G A;  4U0S A;  3V2X A;  3FDH A;  3LCA A;  3P2B A;  5EYL A;  2X6J A;  3CSF A;  3SBT B;  3KS2 A;  2WXQ A;  2QC9 A;  4JPS A;  2CHW A;  1K1B A;  2KZT B;  3NB2 A;  2JLB A;  4Q94 A;  4F1P A;  3AU5 A;  4DX5 D;  1H2T C;  2RFA A;  3DBS A;  5CEC B;  4DX6 D;  5D0Q D;  2DYS E;  3B95 A;  4KZC A;  2CG3 A;  4FLB A;  2FF4 A;  3TGO A;  1NA3 A;  3Q75 A;  4JL0 A;  1ELW A;  3LPZ A;  4CDN A;  4J8E A;  3HXF A;  3APD A;  4FU3 A;  3T5V A;  2ION A;  4L2L A;  3LS8 A;  5AQB A;  4Y6C A;  3EUV A;  2IO3 C;  4ILI A;  3G2U A;  3LVR E;  4GYW A;  2J49 A;  4UI9 J;  3JXI A;  3I3N A;  4HOQ A;  3RIB A;  3B7B A;  1BI7 B;  2IQC A;  3GZS A;  3LJN A;  3ZEF A;  2H6I A;  3BUA A;  4JEH A;  4GA2 A;  3CVY A;  2HO1 A;  4AY5 A;  2J08 A;  4GZC A;  4AIF A;  4DI4 A;  2FO1 E;  3QWP A;  2X6F A;  4DK5 A;  4FAD A;  3TWT A;  1TN7 A;  3ZYM A;  3QK0 A;  4JEU A;  3QC1 A;  1E8X A;  2CFZ A;  3GYZ A;  3HXC A;  2EIJ E;  4WNE A;  3QKY A;  1S70 B;  4ANU A;  3TWX A;  3JUI A;  4IRU A;  2P58 C;  3IEG A;  4BEP A;  1V54 E;  3HRA A;  3BEE A;  2OEW A;  3I4G A;  3ONL A;  3PZ1 A;  3TWR A;  5BXU A;  1U3D A;  1UN8 A;  3ZXS A;  4HRN A;  1TJF A;  3RKV A;  1OY3 D;  2RD0 A;  1INZ A;  1JCR A;  1TNY A;  2Y69 E;  4AEZ C;  3SZ7 A;  4RG6 A;  5LCW J;  4GTS A;  3FH8 A;  3ESL A;  5KCM A;  5AAO A;  2AWI A;  1LD7 A;  1OCZ E;  3CQG B;  3V31 A;  5JHA A;  1HG5 A;  2BKK B;  1E7V A;  5HI7 A;  3V2O A;  3PEU B;  4BT9 A;  3NOC D;  3CVU A;  4A55 A;  3NBN B;  4U0Z A;  3L54 A;  5ANL A;  4M3O A;  4ANW A;  3DPY A;  4GPM A;  2WXR A;  4U0U A;  5FZS A;  2OVF A;  3SD5 A;  3C3Q A;  5CER B;  1XGW A;  3G2T A;  3PUK A;  3MYV A;  4CRW A;  4KVO A;  3UX4 A;  4R7L A;  3ULQ A;  2WXO A;  4GA0 A;  4EEC A;  1OCR E;  3VLE A;  2WQH A;  5AQA A;  1Q2Z A;  3C5R A;  4CT0 A;  2Y1L E;  3MV2 B;  4G25 A;  2P9L G;  3JQ0 A;  4L9P A;  3Q7F A;  4HBD A;  3EU9 A;  4N3A A;  5D2M C;  3FUN A;  3QDN A;  1E7U A;  3UTM A;  1BU9 A;  4K5A B;  4F3V A;  5EDS A;  2R17 C;  3TXN A;  2H6F A;  2XPY A;  4XEI G;  3RO3 A;  2ZGD A;  3SO8 A;  1BD8 A;  4BX8 A;  2OV8 A;  5HRY A;  2XGS A;  4B93 B;  2CHX A;  2VTB A;  4WUY A;  3IHV A;  2P9U G;  3AG1 E;  3KSL A;  1HU3 A;  4KZ0 A;  1H0A A;  1IQR A;  5AQ9 A;  1WY6 A;  2P9N G;  1JCS A;  3D9I A;  5ENO D;  3SFZ A;  3SBS A;  4KT6 B;  4XIF A;  3LY8 A;  5EX3 A;  4HLE A;  3UQ3 A;  5FQ8 A;  4ZHB A;  3DSV A;  3UIP C;  2XPI A;  5KJL A;  2Y4T A;  2QY7 A;  5FZQ A;  3UPV A;  2V8S E;  2P2C P;  1EF1 C;  2RFM A;  3ISM C;  2A5U A;  3FTV A;  3ZXP A;  3MKQ B;  2DZO A;  3ONK A;  4HS2 A;  3L08 A;  4UWF A;  3NAW A;  3KAE A;  4BFR A;  3T5X A;  4PS7 A;  1DCQ A;  4BET A;  3RRM B;  3X2Q E;  4KMO A;  2FBN A;  3CHM A;  4DX7 D;  1ZB1 A;  3AS8 A;  5ARF A;  1IKN D;  1V55 E;  3KSQ A;  1LTX A;  3PNT B;  2ETA A;  4ACL A;  4N2S A;  4UWH A;  4K5B A;  4YVQ C;  3PNL B;  5B1B E;  1Z6T A;  4HB5 A;  4G8K A;  1E8Z A;  4LNU D;  5BPP A;  1UN9 A;  2WXJ A;  2VGE A;  3CVN A;  4GMR A;  2WXM A;  4BY6 A;  2KCK A;  3QOU A;  4U96 D;  1ZU2 A;  3CLJ A;  3ZN3 A;  4L23 A;  3B7R L;  3DSS A;  3C72 A;  3EU5 A;  1O5M A;  1O1R A;  5KWD A;  3ZRH A;  3DSU A;  4OYS A;  2BTD A;  3WXX A;  4WND A;  4W9R A;  4PS3 A;  3APC A;  3L82 A;  2NC9 A;  3AG4 E;  2XS8 A;  3FH7 A;  4FUL A;  2UY1 A;  4RVB A;  3UT8 A;  4U07 A;  1OWN A;  3V79 K;  3IHY A;  3D9M A;  3RRU A;  1QYM A;  5G55 A;  3LVQ E;  4D10 C;  3NF1 A;  5FT9 A;  4BTB A;  1KT1 A;  3CK7 A;  4K5C A;  1TN8 A;  4ABN A;  4FJY A;  1FVF A;  2XHE A;  1Y6I A;  3PEV B;  5D0O D;  4J8S A;  3FUI A;  5HKP A;  4F1S A;  5AIJ A;  5BV1 A;  4EZK A;  3ABM E;  5ENR D;  4GTO A;  2R5S A;  2CFU A;  4JC8 A;  2WPV A;  3OAW A;  1UW4 B;  3KEA A;  3N71 A;  1E96 B;  1B89 A;  1Z3X A;  3MKR A;  2VGX A;  4ANV A;  2QYU A;  3CVL A;  4GCN A;  4I1M A;  1ZBP A;  4JW1 A;  5T8I A;  5DIZ A;  1OCC E;  4MLP A;  1ELK A;  1KZP A;  3T9K A;  3HIZ A;  3BG1 B;  4MBG A;  4JHK A;  4HRL A;  4ME2 A;  3CKB A;  1L5J A;  3PDN A;  1UOH A;  2KCV A;  1D8D A;  4TRQ A;  2A5E A;  4KYO B;  3MJW A;  4RLY A;  3HG0 D;  4UWG A;  3AU4 A;  3TG4 A;  2XEV A;  3SHF A;  4Y6W A;  3Q15 A;  3C3O A;  1A5E A;  4FHJ A;  5A7D B;  3DST A;  2VSO E;  1QBQ A;  1Y8M A;  3HXE A;  2J8S D;  2BUG A;  3ML8 A;  5CHE E;  4P29 A;  2XRY A;  5JJ7 A;  5CED B;  1N0R A;  5J90 A;  3DXM G;  1HX8 A;  2ILR A;  3UMV A;  3PZ2 A;  1N9A A;  3CIA A;  3UM0 A;  1MX4 A;  5BV0 A;  2E0I A;  1PAQ A;  4C0M A;  3CQC B;  2AXZ A;  3FTX A;  4AJW A;  3FWV A;  2OND A;  2QYJ A;  3V30 A;  3EIQ C;  2J4D A;  3FTY A;  3ABL E;  3C98 A;  1JWF A;  3UIN C;  1OWO A;  2LAI A;  4I9C A;  5G05 C;  2IOS A;  1E90 A;  2OCC E;  1Z5S C;  2XEE A;  4EBA A;  2NYJ A;  3CVW A;  4GAA A;  4HOR A;  5ITZ F;  2R02 A;  4YND A;  4BWR A;  1JPL A;  2YIN A;  1MHQ A;  4I1A A;  3HVE A;  4N2Q A;  3D9P A;  3UKR G;  3FHE A;  4XE0 A;  2I2O A;  2PQN A;  3QAQ A;  5ENT D;  1HO8 A;  3O48 A;  3CVV A;  4GCO A;  3FTW A;  2WXH A;  4U63 A;  4YDW A;  2EIM E;  3CVP A;  3TG5 A;  3APF A;  1A17 A;  4LSZ E;  1H6O A;  4DJA A;  3B7U X;  3GZ2 A;  3PZ3 A;  4GTQ A;  4F53 A;  2MHK A;  4J7W A;  2OEV A;  2IEJ A;  5FQ4 A;  1GW6 A;  4J8D A;  3ENE A;  3EIJ A; 
#chains in the Genus database with same CATH homology
 2J4B A;  4CT4 A;  2VGX B;  4R7L A;  4FLH A;  2WXO A;  4GA0 A;  4KXK B;  3ULQ A;  4EEC A;  4V3I A;  2AVP A;  5LP0 A;  2LSV A;  2M63 A;  3GZ1 A;  4WNG A;  2BF0 X;  3PRE A;  3VLE A;  2WQH A;  1UG3 A;  4G1T A;  5EKQ D;  1HS6 A;  4CT0 A;  4URK A;  3CHR A;  4XZ4 A;  3MV2 B;  4G25 A;  3JQ0 A;  4FC8 A;  4WAF A;  4H7X A;  4WWO A;  3CST A;  4N3A A;  2EQX A;  4FHK A;  3CHO A;  3SNX A;  1U3C A;  3VLF A;  3PRZ A;  3FUN A;  4I6J A;  5JJT A;  3ASF A;  3QDN A;  1E7U A;  3D9L A;  3U4T A;  2WXN A;  2WXI A;  3TXM A;  3LKU A;  4F3V A;  2OOE A;  2YHE A;  4K03 A;  5EDS A;  2R17 C;  3TXN A;  3LJ3 A;  4JVS A;  4CCA A;  5ARG A;  4J8F A;  4ACK A;  1H2U A;  5FWQ A;  3HDX A;  2XPY A;  2IFU A;  3OXL A;  1NA0 A;  4PH4 B;  3RO3 A;  2XRZ A;  3FEY A;  2X6K A;  5FQ6 A;  4TUU A;  3B7S A;  4BX8 A;  1HG2 A;  2OV8 A;  3MA5 A;  2XGS A;  2DCP A;  3NZS A;  1SZ9 A;  4OVU A;  2KZT A;  4I9E A;  2CHX A;  4EBA G;  4XKC A;  3CKC A;  3S7D A;  2V5F A;  4UQZ A;  4CDR A;  2VTB A;  4AM9 A;  3AS4 A;  2C0L A;  4XI9 A;  5ENN A;  3MEK A;  4WUY A;  4Q96 A;  3IHV A;  1IYG A;  4UI9 C;  3VTY A;  4N3C A;  1HFA A;  2YHC A;  3LDZ A;  1HU3 A;  4ILH B;  4KZ0 A;  5J08 A;  3TAX A;  1H0A A;  5EX0 A;  4UQY A;  2L0T B;  3OXG A;  1LF8 A;  3ZHE A;  1H19 A;  4I2W A;  4GZD A;  4FP7 A;  1IQR A;  4DLO A;  4N5C A;  1WY6 A;  1S0P A;  1EYH A;  2J9Q A;  5ANR A;  2RG8 A;  3D9I A;  5FJY A;  3QWW A;  4ATG A;  4EQF A;  4WNF A;  3EHM A;  4EZJ A;  5CCL A;  3SFZ A;  3SBS A;  1SQM A;  3RJV A;  4HOU A;  4CEM A;  1MQS A;  2HYZ A;  4KT6 B;  3L13 A;  4XIF A;  3U66 A;  4LUN U;  2FEZ A;  4JZY A;  3LY8 A;  4IUL A;  4WWN A;  1X5B A;  3D9N A;  5EX3 A;  1WM5 A;  4HLE A;  1VDY A;  3UQ3 A;  3MX3 A;  4L2Y A;  4G24 A;  3URZ A;  2X6H A;  5FQ8 A;  5G04 J;  4KVM A;  2XPI A;  1N54 A;  4AP2 A;  5KJL A;  2X3M A;  3CVQ A;  4I2Z A;  4A1S A;  1KLX A;  2GRM A;  4PDX A;  1FVH A;  2Y4T A;  3PS6 A;  4N39 A;  2QY7 A;  5FZQ A;  5T4Y A;  2V8S E;  1OWM A;  3U64 A;  3CV0 A;  2WXK A;  1SZA A;  3UPV A;  5JJ6 A;  3G2S A;  1EF1 C;  2WB2 A;  1H2V C;  3TL5 A;  2I9C A;  3FH5 A;  2XPZ A;  2WMO A;  1YA0 A;  2GW1 A;  4TV3 A;  3GW4 A;  3T8M A;  2A5U A;  4UWL A;  2AXV A;  5KJK A;  3FTV A;  3L22 A;  5C1D A;  2IOL A;  1HXI A;  3MKQ B;  1JWG A;  3FUM A;  1DVP A;  3ESK A;  5CMY A;  3LY9 A;  4NQ0 A;  5E75 A;  1WAO 1;  5G04 C;  3ZW3 A;  2C0M A;  2VSN A;  3ONK A;  4HS2 A;  3MZL B;  4GA1 A;  3ASD A;  3L08 A;  4IYP A;  4JA9 A;  4KBQ A;  3U3W A;  4UWF A;  3AS5 A;  4OVV A;  2WM9 A;  3CGH A;  4GYO A;  3PH0 C;  3KAE A;  1UJJ A;  5FQ7 A;  2VSX E;  3Q49 B;  4RG9 A;  3S7B A;  4BFR A;  3FU3 A;  3I4R B;  3T5X A;  4PS7 A;  3ZYK A;  3PE3 A;  3FP3 A;  4AOF A;  3RRM B;  3HVE B;  3L16 A;  4KMO A;  2FBN A;  3CHM A;  4NRH B;  3B13 A;  5FTP A;  3RRN B;  3D3M A;  3AS8 A;  5LCW C;  2HM8 A;  5ARF A;  3UT7 A;  1UJK A;  3NQP A;  1DNP A;  3PUK A;  4GZ6 A;  3TJP A;  3G2W A;  1PC2 A;  4PS8 A;  3BG0 B;  5BW8 C;  4GPK A;  2DBA A;  3PNT B;  3FUJ A;  3ZFW A;  3PE4 A;  3SGH A;  3EJN A;  4BSX A;  3UUX A;  4XX5 A;  3FUE A;  3QWV A;  4F7A A;  3FTU A;  3MGB A;  4MKT A;  4UQX A;  4UI9 K;  4ACL A;  3I5P A;  4DI3 A;  4N2S A;  2KCL A;  1PY1 A;  5DBK A;  3NZU A;  2I6H A;  4UWH A;  4FA6 A;  1BPO A;  1NP7 A;  4LRZ A;  3UT4 A;  4I17 A;  4YVQ C;  3OTN A;  3VLD A;  2WQ7 A;  2J07 A;  3PNL B;  3B7T A;  3LEW A;  5BUZ A;  5G05 J;  1EPU A;  4J0U A;  3CK9 A;  4GMJ A;  1Z6T A;  4YVO A;  4C0E A;  5LOZ A;  3E4B A;  1P5Q A;  3ML9 A;  4XKB A;  4N3B A;  2QFC A;  1E8Z A;  2DIW A;  2FO7 A;  4U8H A;  4L1B A;  5BPP A;  3R9A B;  1UN9 A;  2WXJ A;  5A23 A;  1HE8 A;  2R59 A;  4NAC A;  2MRI A;  5AJD A;  3CVN A;  2V0P A;  3EHN A;  3CHS A;  2WXM A;  4BY6 A;  2YNQ A;  3CEQ A;  2OVB A;  2KCK A;  4JHJ A;  1Z3Y A;  3K9I A;  4APF A;  3QOU A;  2KC7 A;  1ELR A;  1XNF A;  5A6C A;  4B89 A;  2LO6 A;  3U9W A;  1ZU2 A;  3CLJ A;  3Q4A B;  3FEX A;  3JYS A;  4H7Y A;  4L23 A;  3ZN3 A;  4BX9 A;  4E85 A;  3B7R L;  1QNF A;  4LCT A;  3S7F A;  3ZGQ A;  2VYI A;  4G2V A;  3ZRH A;  3L6A A;  4OYS A;  1OWL A;  1EDU A;  2BTD A;  3KD7 A;  3QJZ A;  2VQ2 A;  4A1G A;  3WXX A;  4ANX A;  4I1O B;  3FUH A;  4LEU A;  4WND A;  4U0S A;  4IN3 B;  2XQ0 A;  4W9R A;  4PS3 A;  3APC A;  2FI7 A;  2NC9 A;  3FDH A;  3LCA A;  3FH7 A;  4FUL A;  3P2B A;  1HF8 A;  3SI5 A;  4Q69 A;  5JHB A;  2UY1 A;  3S7J A;  4GML A;  4JA7 A;  4RVB A;  4G26 A;  2X6J A;  4U07 A;  1OWN A;  3UT8 A;  3VTX A;  4BTA A;  2IU1 A;  3IHY A;  4FJZ A;  3D9M A;  3RRU A;  3CSF A;  3SBT B;  1HZ4 A;  3KS2 A;  5G55 A;  4EPZ A;  3LVQ E;  4B0Z A;  4D10 C;  4APO A;  3L17 A;  3NF1 A;  5FT9 A;  3RK6 A;  2WXQ A;  4BTB A;  2IJG X;  4PUC A;  4BT8 A;  3CVX A;  4JPS A;  3FUD A;  2CHW A;  1KT1 A;  2J09 A;  4CGW A;  2KZT B;  2VSY A;  3CK7 A;  5BNW A;  2L0I A;  4ABN A;  4FJY A;  1FVF A;  4AVX A;  2XHE A;  1Y6I A;  2VTB B;  2CHZ A;  2FUL A;  2X38 A;  3FFL A;  2JLB A;  3D9J A;  3PEV B;  5D0O D;  4J8S A;  3FUI A;  3FU6 A;  3PVL A;  4Q94 A;  4B8A A;  4F1S A;  3IBE A;  5AIJ A;  2PQR A;  5BV1 A;  3R7Q A;  1E8W A;  4EZK A;  2V4L A;  1JUQ A;  2GGF A;  3EDT B;  3PZD A;  3AU5 A;  2YQ8 A;  1H2T C;  1H6K A;  2CFU A;  2R5S A;  4JC8 A;  3ZHE B;  2WPV A;  3DBS A;  3OAW A;  2AXU A;  4G11 A;  1UW4 B;  5D0Q D;  4CRW A;  3Q47 B;  3N71 A;  4KZC A;  3S2A A;  1W3B A;  1E96 B;  2CG3 A;  2WXL A;  1B89 A;  4FLB A;  4QFV A;  1Z3X A;  2FF4 A;  3ASH A;  3MKR A;  2L9B A;  2VGX A;  1OWP A;  3FTZ A;  4ANV A;  3TGO A;  1NA3 A;  3CVL A;  4L7T A;  2MOW A;  4GCN A;  4GU5 A;  4JL0 A;  4I1M A;  1ELW A;  3LPZ A;  3MV3 B;  1ZBP A;  4CDN A;  4A3V A;  2PM7 A;  4JW1 A;  5T8I A;  3HYM B;  5DIZ A;  4A3T A;  5KJN A;  4J8E A;  3APD A;  4MLP A;  1ELK A;  1TJC A;  4FU3 A;  2X6I A;  3T5V A;  1HH8 A;  2ION A;  4L2L A;  3JQ1 A;  3HIZ A;  3BG1 B;  3LS8 A;  4HOS A;  4J6I A;  4Y6C A;  4JHK A;  3P1U A;  2NSZ A;  4ME2 A;  4ILI A;  3CKB A;  3G2U A;  2LAH A;  1L5J A;  2HR2 A;  3LVR E;  4HVB A;  3PDN A;  2KCV A;  4GYW A;  2J49 A;  4UI9 J;  3SF4 A;  4TRQ A;  5C2Y A;  4KYO B;  3I3N A;  3MJW A;  3FUF A;  4HOQ A;  4UWG A;  3AU4 A;  3TG4 A;  2XEV A;  2VJ8 A;  3RIB A;  2L6J A;  3SHF A;  4HFG A;  5CMW A;  3IV0 A;  5FZR A;  4AV7 A;  2CG2 A;  4Y6W A;  2GRL A;  3Q15 A;  3D9K A;  3IKO B;  4FHJ A;  2IQC A;  3GZS A;  4GB9 A;  5T3R A;  3ZEF A;  1IHG A;  5A7D B;  2VSO E;  2I1K A;  4JEH A;  1KT0 A;  4GA2 A;  3UX4 A;  5AJL A;  5BT1 A;  3CVY A;  2HO1 A;  4AY5 A;  2VGY A;  1Y8M A;  2Q7F A;  2J08 A;  4GZC A;  1E8Y A;  4AXH A;  4AIF A;  4DI4 A;  4GYY A;  4GZ5 A;  2BUG A;  4LER A;  3QWP A;  4WWP A;  2X6F A;  4JHR A;  3ML8 A;  4DK5 A;  2WXP A;  4FAD A;  4I6G A;  1OUV A;  4HOT A;  5CHE E;  4P29 A;  2XRY A;  3ZYM A;  5JJ7 A;  3QK0 A;  4MRU A;  4JEU A;  2C2L A;  3QC1 A;  5J90 A;  1E8X A;  4C9B B;  2WXF A;  4DLQ A;  1HX8 A;  2CFZ A;  2ILR A;  3GYZ A;  3QB2 A;  3UMV A;  4WNE A;  3QKY A;  2IF4 A;  4ANU A;  2AW6 A;  4AY6 A;  3CIA A;  3JUI A;  4IRU A;  2P58 C;  5BV0 A;  2E0I A;  3IEG A;  1PAQ A;  3ZVV A;  4C0M A;  4B8C B;  2E2E A;  4MS6 A;  3CQC B;  5KJM A;  2AXZ A;  3FTX A;  4AJW A;  3BEE A;  3FWV A;  2OND A;  2XCC A;  3I4G A;  5AEN A;  3ONL A;  4G23 A;  3EIQ C;  2J4D A;  3MCX A;  3FTY A;  4DPR A;  1U3D A;  1UN8 A;  3ZXS A;  1NZN A;  4CGV A;  1TEZ A;  3C98 A;  3G2V A;  1TJF A;  3ZPJ A;  3ASG A;  3KEZ A;  1JWF A;  4CDM A;  4E6H A;  3LY7 A;  3RKV A;  2RD0 A;  3MKQ A;  4ILG A;  4RSY A;  1OWO A;  4I9C A;  2LAI A;  3O4Z A;  5G05 C;  1INZ A;  2IOS A;  3FTS A;  1E90 A;  2PZI A;  3CHQ A;  2JEK A;  2PL2 A;  4AEZ C;  3SZ7 A;  3FY4 A;  4RG6 A;  5LCW J;  2LSU A;  3FH8 A;  3ESL A;  5KCM A;  3LXU X;  4EBA A;  2AWI A;  4HXI A;  4U04 A;  3CVW A;  2WXG A;  4GAA A;  4HOR A;  4YND A;  4BWR A;  2NXP A;  1JPL A;  2ZU6 B;  3FUK A;  2YIN A;  1MHQ A;  3CQG B;  4I1A A;  5AYW D;  3DPD A;  5JHA A;  3HVE A;  4N2Q A;  3D9P A;  1IQU A;  3PUJ A;  1HG5 A;  3D9O A;  1QZ2 A;  3FHE A;  3FU5 A;  4XE0 A;  2UY1 B;  5M72 A;  5G2N A;  2I2O A;  2KAT A;  2PQN A;  2WQ6 A;  3QAQ A;  4JXT A;  1HO8 A;  3LYA A;  1E7V A;  3ZYQ A;  3O48 A;  2WMN A;  5HI7 A;  3FUL A;  3CVV A;  5LX8 A;  2KM4 A;  3PEU B;  4GCO A;  4BT9 A;  3FTW A;  4UWK A;  3QNK A;  3QAR A;  4I6E A;  3CVU A;  2WXH A;  4A55 A;  4U63 A;  2LNI A;  2Y4U A;  5E76 A;  3RU0 A;  2XGM A;  4U0Z A;  5CCM A;  1FCH A;  3CVP A;  3RO2 A;  4K0R A;  3L54 A;  4I43 A;  3TG5 A;  5ANL A;  2A4Z A;  4M3O A;  4ANW A;  2PM6 A;  1A17 A;  2WVI A;  3APF A;  3OXF A;  4O6F A;  3CHP A;  4NUR A;  4DJA A;  4EZL A;  3B7U X;  5LFA A;  3FU0 A;  1QQE A;  3ZYL A;  5HQ8 A;  2UWJ G;  3GZ2 A;  2WXR A;  3HHM A;  2XGO A;  4GZ3 A;  3R7R A;  4B94 A;  2MHK A;  4U0U A;  2I1J A;  4XI0 A;  4F53 A;  5FZS A;  1N52 A;  2OVF A;  3SD5 A;  3CK8 A;  2Y3A A;  5FQ4 A;  2XCB A;  3JCK C;  3CR3 A;  1GW6 A;  1XGW A;  4J8D A;  3G2T A;  3ZIM A;  3ENE A;  3MYV A;  4KVO A;  3Q5M A;  3EIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...